(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE51

CAGLA1_12.PE51       Location/Qualifiers
FT   CDS_pept        complement(141519..143315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436702"
FT                   /locus_tag="CAGL0M01254g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62375.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124146"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniParc:UPI00003B7011"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK45"
FT                   /transl_table=1
FT                   /translation="MSPFIKGRQRRTEEILKGDLKHHNDDGLVKSVIDDLEDAISAIED
FT                   LKFFLATAPLNWHENQVIRRYYLNNSQGFISCVFWNSLYYMTGTDIVKACMYRMEKFGR
FT                   KVIERKKFEEGLFSDLRNLKCGLDATLEQPKSKFLKFLFRNLCLKTQKKQKVFFWFSIP
FT                   HDKLFADALERDLKREFNGQNPTTIAIQEPALSFNYDQDSKLSLQEQLSRHISTKKCNT
FT                   ITKSGDKDISKNKITNAVVDNQNEEQKEANDISSLEEVSNSVNIGDPLSRSNHSSSYAY
FT                   SKFQSCNTSHAQSAISSPLSPTNNLPASMDTDYSSDLKELTSDSPNFDNDDNFMNIKIE
FT                   YPDENISNGFLATSLNPDQSFLYYDDRNMEIDKNSSIDTNKIVTAQFSPFLVSASLDPQ
FT                   YLLPHVQRTPFQDIKSAAKDGAFTTQKINPSVGNNLHFPYPEVTSPGLVDSITLSELLD
FT                   ENCNNASFELNNERVKISSQELSIWNMLPHNSTSHMTPVFHSLLSAGIKGTHLPAYSPF
FT                   LTTTPWGSLSSPFSSAKSNKSSQRRQSQFDTRTLGKRRKTKTCSKYSSPNGIARNTKPN
FT                   KVLKNSINKMIDTLRSNTKNVS"
     atgagcccat ttataaaggg tagacaaaga agaacagaag aaattttgaa aggtgatctg        60
     aagcaccata atgatgacgg gcttgtaaaa agtgttatag atgatttgga agatgccata       120
     tcagctattg aagacctaaa gtttttccta gcgacagcac cacttaattg gcatgaaaat       180
     caagtcataa gaagatatta tttgaacaat tcacaaggct ttatatcttg tgttttttgg       240
     aacagcttat attatatgac tggaactgac atagttaagg cgtgtatgta cagaatggaa       300
     aaatttggtc gtaaggtaat agaaaggaag aagttcgaag agggactttt ctctgatttg       360
     cggaacttga agtgtggact ggatgcaact ttagaacagc cgaaatcaaa gtttttaaag       420
     ttcttattcc gcaatctatg cctcaagacc caaaagaagc aaaaggtatt cttttggttt       480
     agcattccac acgataaact ctttgcagat gcccttgaga gggacctcaa aagagaattc       540
     aatggccaga atccaactac aatcgcaatt caagaaccag ccttgtcatt taattacgac       600
     caggattcca aactgtcact ccaagaacaa ctgagccgcc atatttcgac aaagaaatgc       660
     aacacaatta caaaatctgg agataaagac ataagtaaaa ataaaattac aaatgctgtt       720
     gtcgataacc aaaatgagga gcaaaaggag gcaaatgata tctcttcttt agaggaagta       780
     agcaattctg ttaatattgg tgatccattg tcgagatcaa accattcttc atcttatgca       840
     tactcaaaat ttcaaagctg taacacatct catgctcaaa gtgctatcag ctctcctcta       900
     agccctacaa acaatcttcc cgctagtatg gatactgact attcaagtga tttaaaggaa       960
     ctgacatcag attctccaaa ttttgataac gatgataatt ttatgaatat taaaattgaa      1020
     tatcctgacg agaatattag taatggattt ctggctacta gtttgaaccc agaccaaagc      1080
     tttttgtatt acgacgatcg gaatatggag attgataaaa attccagcat tgatacaaac      1140
     aaaattgtta cggcacaatt ttcaccgttc ttggtctcgg ctagtttgga tccacaatat      1200
     ttattgcccc atgtccaacg aacaccattt caggatatta aatcagccgc aaaagatggt      1260
     gcatttacaa ctcagaagat aaatccttct gtagggaata atttacactt cccttacccg      1320
     gaggttacta gccctggatt agtggatagc ataactttaa gtgaactgtt agacgagaat      1380
     tgcaataatg caagctttga actgaacaat gagcgagtca aaatctcttc tcaggaattg      1440
     tcaatatgga atatgttacc tcacaattca acttcgcata tgactcctgt ttttcattca      1500
     ttattgagtg ctggtattaa aggtacccac ctcccagcgt atagtccatt cttaacaaca      1560
     actccttggg gtagcttgtc atcaccattc tctagtgcta aaagtaacaa gtcatcacaa      1620
     agacgacagt cgcagtttga caccagaacc ttgggaaaaa ggagaaaaac aaaaacctgc      1680
     tctaaatatt catccccaaa tggtattgct agaaatacaa aacccaataa ggtattaaaa      1740
     aacagtataa acaaaatgat agatacctta cgttcaaata caaaaaatgt aagttag         1797
//

If you have problems or comments...

PBIL Back to PBIL home page