(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE53

CAGLA1_12.PE53       Location/Qualifiers
FT   CDS_pept        complement(147015..148187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436703"
FT                   /locus_tag="CAGL0M01298g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62377.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG351228"
FT                   /db_xref="HOGENOM:HBG561734"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniParc:UPI00003B7013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK43"
FT                   /transl_table=1
FT                   /translation="MRIVLPCLLWLVTLACGVVNAEHTNNWAVLVSTSRFWFNYRHMAN
FT                   VLSMYRTVRRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKDHAIDLYGESVEVDYRG
FT                   YEVTVENFIRLLTDRWTEDQPKSKRLQTDENSNIFIYLTGHGGDDFLKFQDAEEIASED
FT                   IADAFAQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHSDVEI
FT                   GVAVIDRFTYYSLEFLEQIDKTSNLTLKDLFDSYTFEKVHSHVGVRSDLFKRNVSDVLI
FT                   TDFFANVQNVIPDDNSGKTSGNNEDIIDLAIQKSQLASKKDKSSQTPKPKEPASSIYFR
FT                   TASSLNKNITDAKNNSNEGLMTVLLIILVMLGLYTTFKRTSKKETAKFSL"
     atgaggattg tgctaccgtg cctattatgg ctagtaaccc tggcctgcgg ggtggtaaat        60
     gctgaacaca ctaacaactg ggccgttctg gtatcgactt ccagattttg gtttaattat       120
     agacacatgg ctaatgtgct gagcatgtac aggacggtga ggagactggg gattccggac       180
     tcgcagatca ttcttatgtt gagtgacgat gttgcatgta actctaggaa cctgttccca       240
     ggaagtgtat tcaacaacaa agatcatgct attgatttgt atggtgaatc tgtagaggtt       300
     gattacagag gctatgaagt aacagtggag aattttataa gactgctgac tgacagatgg       360
     acagaagatc aaccgaagtc aaaaagatta caaacggatg aaaactcaaa tatattcatt       420
     tatttaaccg gtcatggtgg tgatgacttc ctaaaattcc aggacgccga agagatcgct       480
     tcagaagata ttgcagacgc tttcgctcaa atgtacgaaa agaaaagata caacgaaata       540
     ttcttcatga ttgacacttg tcaggccaac accatgtact caaagtttta ctctccaaat       600
     gtacttgctg taggttcaag tgaactggac gaaagctcat actcacatca ctctgatgtg       660
     gaaattggtg ttgcagttat cgacagattt acatactata gcttggaatt tctggaacaa       720
     atcgataaga catcaaatct cacattgaaa gatttgtttg attcttatac atttgaaaaa       780
     gtacattcac atgtaggtgt gagatctgat ttgttcaaaa gaaacgtgtc tgatgttcta       840
     ataacagatt tctttgctaa tgttcaaaat gttatacctg atgacaacag tggtaagaca       900
     agtggaaata acgaggatat tatagattta gcaatccaaa agagccaact tgcctctaag       960
     aaagataaat cttctcaaac acctaagcct aaagaacctg cttcgtcaat ttactttaga      1020
     accgcgagct cgttgaataa gaatataaca gatgctaaaa acaactcgaa tgagggattg      1080
     atgactgtat tgctcataat tcttgtaatg ctaggtctat acacaacatt taagagaacg      1140
     tcaaaaaaag aaacagcaaa gttcagcctt taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page