(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE55

CAGLA1_12.PE55       Location/Qualifiers
FT   CDS_pept        150584..152002
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436704"
FT                   /locus_tag="CAGL0M01342g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="integral to peroxisomal membrane "
FT                   /protein_id="CAG62379.1"
FT                   /db_xref="GO:0005779"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="HOGENOM:HBG203255"
FT                   /db_xref="HOGENOM:HBG540659"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniParc:UPI00003B7015"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK41"
FT                   /transl_table=1
FT                   /translation="MVQGRAPVSRRVQRYRGGLFIAAASVGTLVAVGSLAVYIVKQWLY
FT                   RQQLRIAEEHFVKEQIKRRFDQTQSDSLATLYELVQVSSMVYDQKDLNLDEIMLALRDK
FT                   KLQKQSQTGSAARAADTTSNSSVTGVTSALNDKVSEKASSIRSSKTDDIRNMTKGELWN
FT                   QLKIRSISKLVTVTYTTSCLLLMTRLQLNILTRKEYLETVVKTTMQKNNDAGNSSGFFS
FT                   WVASKIWGSPSNGEEKRKSAQDMYGELVQAEKAGKHMSKGKVEYINEQAFLSIFWWLIN
FT                   RGWSKIHEIVEREVRSEFGHLDPKDALTIDDFSERLTKVYYRVNKTLFLVNEEKEKPLL
FT                   DIMIPRTPQELKNVLEQAMDLESLQLLEQDDSILRQLCKEMEKYMKSEATSIVMEQAIN
FT                   ESFDYAITEIDASIKKRNQEETQMALFALSCKECCDKMLKTNMMTMDNDYLTVLDGIAV
FT                   LDDLSAMVYSNFGL"
     atggttcaag gacgtgcgcc ggtgagtcga agggtacaga ggtatagagg tgggttgttt        60
     atcgcagccg cgtcggtggg aacgctagtt gctgtggggt cgctggcggt atatatagtg       120
     aagcagtggc tctatcgcca gcagctgagg attgctgaag agcattttgt caaggagcag       180
     atcaagcgcc ggtttgatca gacgcagagt gactctttgg cgacgttgta tgagctagtg       240
     caagtgagtt ccatggtcta cgaccagaag gacttgaacc ttgatgaaat catgcttgct       300
     ctgagggaca agaaactaca gaagcagtct caaactggca gtgccgccag agcagcggac       360
     accacaagta atagcagtgt gacgggtgtt acatctgctt tgaatgacaa agtcagtgag       420
     aaagccagta gtataagaag ttcaaagacc gatgatataa gaaacatgac caaaggagag       480
     ttatggaacc agttgaagat caggagcatt tctaagttgg tgaccgtaac gtacacaaca       540
     tcttgtctgc tactaatgac taggttacaa ctgaacattt tgacaagaaa ggaatatctt       600
     gagacagtgg tgaaaactac aatgcagaag aataatgatg ccggcaattc atcgggattc       660
     ttttcttggg tggcctcgaa aatatggggt agcccctcaa atggagagga gaagagaaag       720
     tctgctcagg atatgtatgg cgagttagtt caggctgaga aagcagggaa gcatatgtca       780
     aagggcaaag tcgagtatat caatgagcaa gcatttctat ccattttctg gtggctgatc       840
     aaccgtgggt ggtcgaagat acatgagatt gtagagcgcg aagtgcggtc agaatttgga       900
     catcttgacc ccaaggatgc gttgaccatt gatgatttta gtgagcggtt gacgaaggtc       960
     tattacagag ttaacaagac tttgttcctg gtcaatgagg agaaagagaa gccgcttctt      1020
     gatattatga tcccacggac ccctcaagag ttgaaaaatg tccttgagca agcaatggac      1080
     ctcgaatctt tgcaattact tgagcaagat gacagtatac tgcgccaatt gtgtaaagag      1140
     atggagaagt atatgaagag cgaggccaca tctatagtca tggagcaagc gataaacgag      1200
     tccttcgatt atgcgatcac tgagatagat gccagtatca agaagaggaa ccaggaagag      1260
     acacagatgg cattgtttgc gttgagctgc aaagaatgtt gtgacaagat gcttaagaca      1320
     aacatgatga ccatggacaa tgattactta actgttctcg acggcattgc agtattggac      1380
     gatctaagtg ctatggtata tagtaatttt ggcctctaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page