(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE56

CAGLA1_12.PE56       Location/Qualifiers
FT   CDS_pept        153430..153969
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500873"
FT                   /gene_name="CBF3d"
FT                   /locus_tag="CAGL0M01364g"
FT                   /product="Centromere binding factor 3d "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG62380.1"
FT                   /db_xref="EMBL:AAD56717.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG360223"
FT                   /db_xref="HOGENOM:HBG622018"
FT                   /db_xref="HSSP:1NEX"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="UniParc:UPI000006A355"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UVW8"
FT                   /transl_table=1
FT                   /translation="MDKKGKYVVLVSGEGEKFTVEKKIAQRSLLLKNYLNDMHESSLDD
FT                   EDEEQDEDEDEDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDAW
FT                   DREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTP
FT                   EEEAAIRRENEWAEDR"
     atggacaaga agggcaagta cgttgtattg gtgagtggtg aaggcgagaa gttcactgtt        60
     gagaagaaga ttgctcagag gtccttgctg ttgaagaatt acttgaatga catgcatgaa       120
     agcagtttag atgatgagga cgaggagcag gacgaggacg aggacgagga cgatgagatt       180
     gtgatgccgg ttcccaatgt caggtcgtct gtgttgcaga aagtgattga gtgggcagaa       240
     caccataggg actctaactt cccagacgag gacgatgacg actcgcgtaa gtctgctcca       300
     gtggatgcct gggaccgtga gttcttgaaa gtggaccagg agatgcttta cgaaatcata       360
     ttagcagcca actacttgaa tatcaagcca ttgctggacg ctggttgcaa agttgtcgcg       420
     gagatgataa gagggaggtc cccagaagag atcaggagga ctttcaatat agtaaacgat       480
     ttcacgcctg aggaagaagc agctatcaga cgtgaaaatg aatgggcgga ggaccgctaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page