(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE60

CAGLA1_12.PE60       Location/Qualifiers
FT   CDS_pept        167313..168917
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436708"
FT                   /locus_tag="CAGL0M01452g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62384.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060085"
FT                   /db_xref="HOGENOM:HBG203254"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR021565"
FT                   /db_xref="UniParc:UPI00003B7019"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK36"
FT                   /transl_table=1
FT                   /translation="MQSSDVRPNDTQQEYSKLIQEENTKSSCPICFKECANLNELNKHL
FT                   DKDHNFGNENSNGDHVKKHQNKKKSSGIRTSHHEVYNEGMSKCAYCRKKLTKSNGVSNC
FT                   YHCGKLYCRSHLLWQMKLDKRARYDPQHGKFYPCCFKCTSSRPGYNDYGLTVSKTSEFS
FT                   RLRSSKMEDKQLRSLQLETRLLKLIDGYISISRKYGNNLFSTVVRNSELSKYERSIVHW
FT                   KDDSNVHTCNICTSEFGLVRLSRKHHCRLCGNIVCDTDGYEEEVINTRRRKTTMKKCSY
FT                   QIKLRNLKSSTDDLHYNSQLRPDEEYIAELQVRLCSTCIDNLLLKRKFKRDLTKPMPPL
FT                   LSRYETLHNIADVIRTILPPFQDALQKIDNERTKKVSDEKELADLSKLRVKLLRSFANY
FT                   NSVNKQLCSIKPSNFSEERVKNSLLVESSYFINENILPLRSLPAVLSGEDYVMSKSEPE
FT                   VKKLSELMSSDLSIKEIKQGREELMVLEEQIFQIESLVETAKRQRKFDEVATLATNLNE
FT                   LNQRATELREKLGQEGF"
     atgcaatcta gtgatgtgcg gcctaatgac acgcaacaag agtattcgaa gttaatacag        60
     gaggagaata cgaaaagtag ttgtcccata tgcttcaaag aatgtgccaa tctaaatgaa       120
     ctcaataagc atttggataa agaccataat tttggaaacg aaaatagcaa tggtgatcat       180
     gtaaagaagc atcagaacaa gaaaaagagt agtggtatta gaactagcca ccatgaggtg       240
     tataatgagg gtatgagtaa atgtgcttat tgtagaaaga aactcactaa atcaaatggt       300
     gtctcaaatt gttatcactg tggtaaatta tactgccgat cgcatctgtt gtggcagatg       360
     aaactggata agagagcaag gtatgaccct cagcatggga agttctaccc ttgttgcttc       420
     aaatgcacgt cttcgagacc tggatataac gactatgggc ttacagtttc caagacatct       480
     gaattcagta gattaagatc ttcaaaaatg gaagacaaac agttaagatc attacagttg       540
     gagaccagac ttttgaaatt aatcgatggg tatatctcaa tatcgcggaa atatgggaat       600
     aatcttttct ccacagtggt acgaaacagt gaactttcca aatatgaacg atcaatagtg       660
     cattggaagg acgacagtaa tgtacacaca tgcaatatat gtacttcaga atttggactg       720
     gtgcgactta gtaggaagca tcattgccga ctttgtggaa acattgtgtg tgatacagac       780
     ggctatgagg aagaagtgat aaatacaaga cgtcggaaga cgacaatgaa gaaatgctcc       840
     tatcaaataa agctgcgaaa cctaaaatcc tccaccgatg atctgcatta taattctcag       900
     ctacgacccg atgaagagta tatagccgaa ttacaggtac gactatgctc gacttgcatt       960
     gataatttac tattgaagag gaaattcaag agggacctta caaaaccgat gccaccgtta      1020
     ttgtcccgct acgagacctt acacaatatc gccgatgtca tcagaaccat cctgccacca      1080
     tttcaagacg ctttacagaa aatagacaat gaacgtacca agaaagtaag tgatgaaaaa      1140
     gagctcgctg atctaagcaa actcagagtg aaactattac gctcttttgc taattacaat      1200
     agtgtgaaca aacagctttg tagcatcaaa ccgagcaact tcagtgaaga gcgagtcaag      1260
     aattcgttgt tggttgagtc ctcgtatttc atcaatgaga acatcctgcc actgagatcg      1320
     ttacctgctg tgctcagtgg tgaggactac gtgatgagca agagtgagcc ggaggtcaag      1380
     aagctctctg agcttatgtc cagtgacttg tctatcaagg agatcaagca aggccgtgag      1440
     gagttgatgg tactcgagga gcaaattttc cagatcgagt ccctggtcga gaccgccaag      1500
     cgccagagga agttcgacga agtggccaca ctagccacaa acctcaatga actgaaccaa      1560
     agagccactg agttaagaga gaagctcggg caagaagggt tttga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page