(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE61

CAGLA1_12.PE61       Location/Qualifiers
FT   CDS_pept        170175..170609
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044345"
FT                   /locus_tag="CAGL0M01474g"
FT                   /product="Similar to uniprot|Q92317 Saccharomyces
FT                   cerevisiae YDR397c YNC2beta"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62385.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B701A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK35"
FT                   /transl_table=1
FT                   /translation="MIGDGDDVTLPKATVQKIISEVLDSDLMFNRDAREIIIKSGIEFI
FT                   MILSSMASEMAESDAKKTIAPEHVIKALKELEYNEFIPLLEQILIEFKGTQKIKEKKNS
FT                   KFKKSGLTEEELLQQQEELFRKSRSRLHQNSVSGSATDST"
     atgataggag acggtgacga cgttacgctt cctaaggcga ctgtgcagaa gattatttca        60
     gaggtgctgg actcagacct gatgttcaac agggatgcgc gcgagattat catcaagagt       120
     ggtatcgagt tcattatgat cctgtccagc atggccagtg agatggcaga gtcggacgct       180
     aaaaagacta ttgcccccga gcatgtgatt aaggcgctca aggagctgga atacaatgag       240
     ttcataccct tgctggaaca gatactgatt gaattcaagg gcacacagaa aatcaaggag       300
     aaaaagaact ccaagtttaa gaagtcgggg ctaacagaag aagaactttt acaacagcaa       360
     gaagaactgt tcagaaaatc gagatcgagg ttacaccaaa atagtgtgtc aggctcagct       420
     actgattcta catga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page