(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE62

CAGLA1_12.PE62       Location/Qualifiers
FT   CDS_pept        complement(171045..173900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500874"
FT                   /locus_tag="CAGL0M01496g"
FT                   /product="Similar to uniprot|Q04175 Saccharomyces
FT                   cerevisiae YDR395w SXM1"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62386.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG059555"
FT                   /db_xref="HOGENOM:HBG396152"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B701B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK34"
FT                   /transl_table=1
FT                   /translation="MLDERAILTCIGHTLISDAKVIKQAEDQLYEYQKQPGFTSFLLNV
FT                   VTDNSIAMNVRLSAAIYMKNKIQRSWNTTKYTEGLTKEEQASVKEQLVQTLIKFSESSH
FT                   LRPHLTESIRGILNADNSWDLTATVKELLTSGKQEYLYPGLLLVFEVAIVHRWDMSDNR
FT                   EVIDNFIIEIFPIVENITSQLVNQTDYRSNELLYLVLKSFKYSCLNNLPKYFADLDKLN
FT                   AWIQLHLFICQKPLPAEVLELDPSDRSLDKRVKVNKWGFGNLTRFLYRYSRSTKVITPE
FT                   FVNYVFTKIVPEIIQEYFKFIESWSNKSLWLGEASLYYMVQFLEKCMITNELFPLLEPH
FT                   LNVVLQHLIFPCLCATEESVELLYEDPEEYTRRYFDLNKDGSMADFASSDFVYMLGTVR
FT                   PDKLNEVLVFINEVFTNFSQHKGDKEWSFKQEGAMRMISTLFSLFQNPQDLEGMFSNYI
FT                   VNFLADDSHHFLVARALETVASYPYDINDMGTLSKLFEQTYGHFLNSDCLPIQVEAADA
FT                   LKSLVVLNPNIHGHISSQVPGIMEKLLKLSKEFEIDILSEVMESFVENFADELTPFAKD
FT                   LAVNLAEQFLNLGRSIVESTNGAYSTGDQDQETQACALLATMTTMVMSMNKVSLVEQFA
FT                   PVVKFVIVHAQISFITEIVDLMDSLALSSKALFNQFTPEIWEMFHDVMDSFQTYALDYF
FT                   ESYLVFFETIVLQGFPQDQTFVEPFLSLLSVKLESEIDYDVEGVMNLLTCFALSMKETP
FT                   FLEKALSRAMDEEFGLDDKQVIKMVLAYLFVKPIETLQVMESSGVTLNILKRWFDLKFK
FT                   SVFAIKLQILAIMSILKLPELPSCVSGYLKEFSNKLVTLVEQLPVAIRNREALNKGEEL
FT                   SGGADGTDLLDPQEEDEYLEEYDDDLKESILDQVNAFQEVSVFLTSLQSENPQRYQDII
FT                   SGMSDDKKESLQVILEFVSNN"
     atgttggatg aacgtgctat tcttacatgc attgggcata cgctaatatc tgatgccaaa        60
     gttatcaagc aggctgagga ccagctatat gagtaccaga aacagcccgg ttttacgtct       120
     tttctgctaa atgttgtgac tgacaacagt attgccatga acgtgagact ctctgctgct       180
     atttacatga agaacaaaat acagaggtct tggaatacta ctaaatatac agagggctta       240
     actaaagaag aacaggcaag tgttaaggaa caattagtgc aaacattgat taagtttagc       300
     gagagttctc atttgaggcc acatttgact gagtctatta gaggtatact gaatgctgac       360
     aactcatggg atttgactgc tacagtaaaa gaattattga ctagtggcaa acaagaatac       420
     ttataccctg gtctattgtt agttttcgaa gtagcaattg ttcatagatg ggatatgtca       480
     gataacagag aagtaattga caacttcatt attgaaattt tccctattgt tgagaatatc       540
     acctcacaac tagtgaacca aactgattat agatctaacg aactcctcta cctggtattg       600
     aagtcattca aatactcatg tctgaacaac ttaccaaaat actttgccga cttagacaag       660
     cttaatgcgt ggattcaact acatctattc atctgccaaa aaccactacc agctgaagtt       720
     ctggaattgg atccaagtga tagatctctt gataagagag ttaaagtgaa caaatggggc       780
     tttggtaact tgactcgttt cctatacaga tatagcagat ctacaaaggt catcacacca       840
     gagtttgtta actatgtatt caccaagatt gttcctgaga ttattcaaga atatttcaag       900
     ttcattgagt cctggagcaa caaatcttta tggttgggtg aagcttcctt atattatatg       960
     gtccaattcc ttgaaaaatg tatgataaca aacgagttat tcccacttct agaacctcat      1020
     ctaaatgttg ttctccagca cttaatattc ccatgcctat gtgctacaga agagagtgtc      1080
     gaactacttt acgaagaccc tgaggaatac acaagaagat actttgattt gaacaaagat      1140
     gggtcaatgg ctgattttgc ttcctctgat tttgtttaca tgctgggcac tgtaagacct      1200
     gataaattaa atgaagtttt agtattcatc aatgaggtct ttaccaattt cagtcaacac      1260
     aaaggtgaca aagaatggag cttcaagcaa gaaggtgcca tgcgtatgat cagcaccttg      1320
     ttttcccttt tccagaaccc tcaggacctt gaaggcatgt tttctaatta tattgtgaac      1380
     ttccttgctg atgatagcca ccattttcta gttgcgcgcg ccttagaaac agttgcatca      1440
     tatccatatg atattaacga tatggggaca ttgtcaaaat tatttgaaca aacttacggt      1500
     catttcctaa atagtgactg cttgccaatt caagttgagg ctgcagatgc attgaaatca      1560
     ctagtcgtgt tgaatccaaa tattcatggc cacatttcct cacaagtccc tggaattatg      1620
     gaaaagctac taaaattgtc caaggaattc gaaattgata ttctctccga agttatggaa      1680
     tcttttgttg agaactttgc cgacgaatta accccatttg ctaaagatct tgctgtaaat      1740
     ctagctgaac aatttttaaa tctaggaaga tcgattgtcg agagcactaa tggcgcctat      1800
     tccaccggtg atcaagacca agaaacgcaa gcttgcgctt tactcgccac tatgacaact      1860
     atggttatgt ccatgaacaa agtatcctta gtagagcaat ttgctcctgt tgttaagttt      1920
     gttattgtcc atgcacaaat ttcatttatc actgagatag ttgacttgat ggattcccta      1980
     gctttatcct caaaggcact tttcaatcag ttcacaccag aaatctggga aatgttccac      2040
     gatgttatgg attccttcca aacttatgct cttgactact ttgagtcata tttggtattt      2100
     tttgagacaa ttgttctaca aggatttcca caggaccaaa cgttcgttga gccattctta      2160
     tctctactgt ctgttaaatt ggagagcgaa atcgattatg atgttgaagg ggttatgaac      2220
     cttttgacat gttttgctct atcaatgaag gagacaccat tcttagagaa ggctttgagc      2280
     agagcaatgg atgaagaatt tggcctagat gataagcagg tgataaaaat ggtattagca      2340
     tatctatttg ttaagccaat agaaacttta caagtgatgg aatcatcagg tgtcactttg      2400
     aatatattaa agagatggtt tgatctaaaa ttcaagagcg tttttgctat caaattacaa      2460
     attctggcaa taatgtctat attaaagcta cctgagcttc caagttgtgt tagtggatat      2520
     ttgaaggaat tctctaacaa gctagtcaca ctagtagaac aattaccagt ggctattaga      2580
     aaccgtgagg cactaaacaa gggtgaagaa ttgagtggtg gcgctgatgg cactgatctg      2640
     cttgaccctc aagaagagga cgaatatcta gaagaatatg atgatgatct caaagaatct      2700
     atattggatc aagtaaatgc cttccaggaa gtctctgtat tcctaactag tctacagagt      2760
     gaaaacccgc aaagatacca agacataata tcgggaatgt cagacgataa aaaagaatct      2820
     ttacaagtca tccttgagtt cgtttcgaac aattga                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page