(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE63

CAGLA1_12.PE63       Location/Qualifiers
FT   CDS_pept        complement(174378..175595)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436709"
FT                   /gene_name="SHE9"
FT                   /locus_tag="CAGL0M01518g"
FT                   /product="Sensitive to high expression protein 9 homolog,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62387.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG252679"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniParc:UPI00003B701C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK33"
FT                   /transl_table=1
FT                   /translation="MYSYRYLRPVSRSGRAILIQRQAYLRNITFTHFRCEENKSSASKR
FT                   PTGNALNTKLNELNGSLNNLWNKFLEGRGVFQHHAKNIRKSIQEANKKIAEQEKESKDA
FT                   KINYKKDELTNEEIKDLPSERELHRKKWSRKLEFYLDSLQETLFTATKALNDVTGYSSI
FT                   QKLKNSINLINEKLDATRKARTDLKLQYTKAIESRTLSQKQLNELLQRKSSWSPSDLEN
FT                   FTKLYKDDAINQQTEKELKEKVRDIEKKEEQLTDDLYRAILTRYHEEQIWSDKIRRTST
FT                   WGTFILMGFNLVLFIIFQLLLEPWKRRRLTGSFEGKVRHALELHSQEQETKIRDFLEEI
FT                   KTKESNNIANEQKTITKLSFWDKLRNTFQNSTGLSLTQFNMLELTVTAINSFLVGILFT
FT                   LLLHAL"
     atgtacagtt atcgatacct gaggccggtc tcgcgtagtg gtcgagcaat tctgatacag        60
     aggcaagcat acttaagaaa cattaccttc actcatttcc gttgtgagga gaacaaatcc       120
     agtgcgagta aaagacctac aggtaatgca ctaaatacaa agttaaatga gctcaatggg       180
     tctctgaaca acctctggaa caagtttctg gagggcagag gtgtctttca acaccatgcc       240
     aaaaacatca gaaaatcaat acaggaggcc aacaaaaaga tagccgagca agagaaagaa       300
     tccaaggatg ctaaaataaa ctacaagaaa gatgaactca ccaatgaaga gataaaagat       360
     ctcccgtctg agagagagtt acataggaag aaatggtctc gaaagcttga gttttacctg       420
     gattcattgc aggagactct gttcactgcg acaaaagcat tgaatgacgt tactggttac       480
     tcatctattc agaagctaaa gaacagtata aatcttatca atgaaaagct tgacgccaca       540
     cggaaagcgc gcactgattt aaaattgcaa tacaccaagg ctatagagtc caggacatta       600
     tcccaaaagc aattgaatga gcttctacaa agaaagagca gttggtcccc ttccgacttg       660
     gagaacttca caaagcttta taaagacgat gcaatcaatc aacaaactga gaaggaactg       720
     aaagaaaagg tcagggatat tgaaaaaaag gaagagcaac tcaccgatga tctttataga       780
     gcaatactaa ccaggtatca tgaggagcag atatggtccg ataagattcg tagaacttca       840
     acttggggca catttatctt gatgggattc aatttggtac tattcataat cttccaattg       900
     ttgctagaac cttggaaaag acgtagactg accgggtcat ttgaaggaaa agtaaggcat       960
     gcgctagaat tacactcaca ggaacaagaa actaagatac gcgacttctt agaagagatt      1020
     aagacaaagg agagcaataa cattgctaat gagcagaaaa ccatcaccaa gctatccttt      1080
     tgggacaaat tgagaaacac atttcaaaac tctactggac tatcgcttac gcaattcaac      1140
     atgctagagc tgactgttac cgctataaac tcattcctag ttggtatact gttcacatta      1200
     ctgctacatg ccttgtga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page