(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE66

CAGLA1_12.PE66       Location/Qualifiers
FT   CDS_pept        178971..180869
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436710"
FT                   /locus_tag="CAGL0M01606g"
FT                   /product="Similar to uniprot|P52488 Saccharomyces
FT                   cerevisiae YDR390c UBA2 E1-like"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAG62390.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG326381"
FT                   /db_xref="HOGENOM:HBG517846"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI00003B701F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK30"
FT                   /transl_table=1
FT                   /translation="MAVRESNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLME
FT                   VGEIHVVDLDTIDLSNLNRQFLFRQKDIKKPKSAIAVNAVQSFSNSKLVPYQDNIMDTN
FT                   VFPLHWFQQFDIIFNALDNLAARRYVNKMTQFLSIPLLESGTSGFDGYIQPIIPGKTEC
FT                   FDCTKKETPKTFPVCTIRSTPSLPVHCIVWAKNFLFGQLFSSSANDIANEQMNEQDWGT
FT                   DDVEEINRIKNETNELKELQNIIISGDKSRIRDIISKLFIQDIEKLLLIENLWKTRAKP
FT                   VALTPKQLQESEQLGDVNHLNLNEIWDLETQIAKFTQITSKLMDRYNTESAIDFDKDDQ
FT                   DTLEFVATAANIRAHIFHIPVKSVFDIKQIAGNIIPAIATTNAIIAGLSSLMSLRVLNL
FT                   LKYAKVDKPTDINMAFTAKASNLAQNRYLSNPKLVSPNKKCAVCSKVIRGVFKVTKNQM
FT                   EKHSFMDFINALTSTSKLSDDISILDATTQRLLYDYDFEDLAEKKLVDLSLKNGSVLLI
FT                   TDEEEEAGLTKQIMEYYIEISDESEDKIEQLSLPQIIPQFSIPSETADENGGGDMLQND
FT                   SLMTSNDQTTPIVVSESDAVENGNNKRPLTEELEYQSIKSRKLNPIEDDDELVILD"
     atggcagtga gagaatcaaa cttggttaaa atcctgggtg atgaaggata ccagaagctt        60
     aggtctacga aatgcttgtt agtaggtgcc ggtggtattg gatcagaact actgaaggat       120
     ttggttttga tggaggttgg tgaaatacat gttgtcgacc tggatacaat agatttatca       180
     aacctgaata ggcagtttct gttcagacag aaagatataa agaagcccaa atcggccatt       240
     gcagttaatg cagtccaatc atttagcaac tctaagctgg taccatacca ggacaatatc       300
     atggacacaa atgtattccc acttcattgg ttccaacaat ttgacattat tttcaatgcg       360
     ctcgataact tagcagctag aaggtacgtt aataagatga cgcaattcct atctatacct       420
     ttgctggagt ccggtacttc aggctttgat ggctacatac aacctattat cccaggaaag       480
     actgagtgtt ttgattgtac gaagaaggaa acaccaaaga cattccctgt gtgtactatc       540
     agatcaacac catccctacc agttcattgt attgtatggg caaagaactt cttgttcggt       600
     caattattct cttcttcggc aaatgatata gcaaacgagc agatgaatga acaagattgg       660
     ggtacagatg atgtcgaaga aatcaaccgt atcaagaatg aaactaatga attgaaagag       720
     ctacaaaata taatcatttc aggtgacaag tctagaatac gggatataat cagcaagctg       780
     tttatacaag acatcgagaa gttacttcta attgagaacc tatggaaaac gagagctaag       840
     ccagttgctc ttaccccaaa gcaactgcag gagtcagagc agctaggaga tgtgaatcac       900
     ttgaacttga atgaaatctg ggacctggag actcaaattg caaaattcac ccaaattaca       960
     tctaaactta tggataggta taacacagaa agtgctatag attttgataa agacgatcaa      1020
     gatacattgg aatttgttgc cactgcagct aatattcgtg cccatatttt ccatattccc      1080
     gttaagtctg tgtttgatat aaaacagatt gcaggtaata tcattcctgc tattgctact      1140
     acgaatgcaa taatcgcagg tctgtcatct ctaatgtcat tgagagtttt gaatctccta      1200
     aaatatgcca aagttgataa gccaactgat atcaatatgg cattcacagc aaaggccagt      1260
     aatttagctc aaaacagata cttgtctaat cctaaattgg tatctccaaa caaaaaatgt      1320
     gcagtttgct ctaaagtcat tcgtggagtt ttcaaagtaa ctaaaaatca aatggaaaag      1380
     cattctttta tggactttat aaatgcactt acttcaacct caaaactatc tgatgacatt      1440
     tcaattttag atgccactac tcagagactg ttgtatgatt atgattttga agacctcgca      1500
     gaaaagaagc ttgttgatct ttctttgaaa aatggttcag tgctattaat tacagatgag      1560
     gaagaagaag ctggtctaac taaacaaatc atggaatact acattgaaat atctgatgaa      1620
     tccgaagata aaatagagca actgtcactt cctcaaatca taccacaatt cagcattcct      1680
     tccgaaactg ccgatgaaaa tggaggtggt gatatgttgc agaatgactc actaatgaca      1740
     agtaatgatc aaactacacc tatagtagtt tcagaatccg atgctgtaga aaatggtaac      1800
     aataaacgtc cattgacaga agaactagaa taccagagta ttaaaagtag gaagttaaat      1860
     ccaatcgaag atgatgatga gttagttata ttggattag                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page