(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE67

CAGLA1_12.PE67       Location/Qualifiers
FT   CDS_pept        complement(181274..183079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436711"
FT                   /locus_tag="CAGL0M01628g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62391.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG124178"
FT                   /db_xref="HOGENOM:HBG203279"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B7020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK29"
FT                   /transl_table=1
FT                   /translation="MPNKHSISPSRHMPFWKNFVNNPKSVSSENLSTPSRPVYQRGHSY
FT                   NHTAPKTGSPIKNEVGAAERQDFRDYRDQFLSGRNGFSGRVFGVSLEESLSVASAEVIV
FT                   QSELVSFGRIPIVVAKCGAYLKSNGLSTSGVFRIAGNSKRIKELQYIFSTPPDYGAKFS
FT                   NWEPYTVHDVASLLRRYLNNLEEPLIPLALYEKFRAPLMNRPRILKYMLNNEVSHPNAN
FT                   KENTLTMKLTESTKQDTDDRANDGDNENEDEQHITEEEAKRKQLRRKKKLSRCIRAAIK
FT                   EYEELFTDLLSDSKQLTIYLLDLLSLFARQSQLNLMSGSNLAAIFQPSILSHPQHDLDP
FT                   KEYELSRLVVEFLIEYTYKLLPHLLKSTKDDQQKKISESVHQKSTTESTTNRDKTSSPL
FT                   PNIQIQTETTTIKGTPDNSKTTSTATSQQNNIHSKPEAKSPALQVPKYQRPHSRSIGSA
FT                   PMVPDVIASNKRRSRLFPWLHKPGILSDTGDTATDGEGDDLLNDDENVDPHLSSPVHSS
FT                   NHRQHLLSIPKVQRSVSGRSITSNSSGRPLSLILNRSEDNLPKNGSSSTEKFERPRSPI
FT                   AYSQESIESKAKKRESWFARLTSRN"
     atgcctaaca agcactcgat atcgccatcg cgacacatgc cgttctggaa gaattttgtc        60
     aataatccca agagtgtctc ttctgagaac ctgtcgacgc catcgcggcc ggtgtaccag       120
     cggggccact cctacaacca cactgcgccg aagaccggct ccccgatcaa gaacgaggtt       180
     ggcgctgcgg agcgccagga cttcagggac taccgggacc agttcctgtc tggacgcaac       240
     gggttctccg ggcgggtgtt tggtgtctcg cttgaggagt ctctgtctgt ggccagcgct       300
     gaggtgattg tgcagagcga gctggtcagc ttcgggagga tacccattgt tgtggcgaag       360
     tgcggtgcgt acctgaagtc gaacgggctg agtacctcag gtgtgtttag aatcgcgggc       420
     aacagcaagc gtataaaaga gctgcaatac atcttttcca ccccgccgga ctacggtgcc       480
     aagttcagca actgggagcc ctacacggtg cacgacgtgg catcactgct gagacgctac       540
     ttgaacaacc tcgaggaacc actgataccg ctcgctctgt atgaaaaatt cagagctccg       600
     ctgatgaaca ggccccgcat attgaagtac atgctcaaca atgaggtcag ccaccctaac       660
     gccaacaagg agaacaccct aaccatgaag ctcacggaat ccacaaaaca agacacagac       720
     gatagggcca acgacggcga taacgagaac gaggacgagc aacacatcac cgaagaagag       780
     gccaagcgga agcaactgcg gagaaagaag aaactgtcta ggtgtatcag ggccgcgatc       840
     aaggagtacg aagagctgtt cactgattta ttgagtgata gcaaacaact gaccatatac       900
     cttctggatc tgctgagtct gtttgccaga caatcccaac tgaatctgat gtcaggctcc       960
     aatttggccg ccatttttca gccatcgatt ttgtcgcacc cacaacacga cctagacccc      1020
     aaagaatacg aactatcccg acttgtggtc gagtttctga tagaatatac atacaaacta      1080
     cttccacacc tgctgaagag cactaaagat gaccaacaga aaaaaataag tgaaagtgtc      1140
     catcaaaaga gcacaacgga atccaccact aacagagata agaccagttc accgttgcct      1200
     aatatacaga tacaaaccga gactaccaca ataaagggca cacccgataa tagcaagacg      1260
     acttctacag caacttcaca gcaaaataac atacattcta aacccgaggc gaagagccca      1320
     gctctacagg taccaaaata tcaacgacca cactcgagat ccatcggctc tgcaccaatg      1380
     gtccctgatg ttattgctag taacaaaagg cgttctagat tatttccttg gctacacaaa      1440
     ccgggcattc taagtgatac gggtgataca gctacggatg gcgaaggtga cgaccttttg      1500
     aatgatgatg aaaatgtaga tccccatcta tcatctccag tacactcatc aaatcataga      1560
     caacacctcc tttcaattcc aaaagttcaa agatcagtta gtggtagaag tatcacatca      1620
     aattcatctg gtagaccatt atcacttata ttaaaccgct ctgaagataa cctgccgaaa      1680
     aatggtagct cctctacaga gaagtttgaa agacctcgtt ccccaattgc atattcccaa      1740
     gagtctatag agagcaaagc taagaagaga gagtcatggt ttgcaagatt aaccagccgt      1800
     aattga                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page