(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE69

CAGLA1_12.PE69       Location/Qualifiers
FT   CDS_pept        186088..187731
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436712"
FT                   /locus_tag="CAGL0M01672g"
FT                   /product="Similar to uniprot|Q04162 Saccharomyces
FT                   cerevisiae YDR387c"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62393.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B7022"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK27"
FT                   /transl_table=1
FT                   /translation="MVDENSNNENGLDQEEEIDVYSDLYSTYTQVTSLTTNDVDNTTYP
FT                   MTWKTVALFGSSTVGGLLFGYDTGVISGVLLSLKPQDLGRATISDWDKELITSITCLGC
FT                   FVGSLLGSPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGTAAQ
FT                   CTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILFGLSAVPAI
FT                   IFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKLKHYQ
FT                   DEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEPRTK
FT                   RALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVYLV
FT                   DLVGRRSMLLNTIWIMTVGLLLSTIGFQHENVVVLLFAVSIFVAAYASAMGTIPWSSVE
FT                   FLPLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGTEDTMLFFALFSVMAWFFVYFW
FT                   YPEVKGLSLEEIGKVFENGIDVHYVYRNYY"
     atggttgatg agaatagcaa taatgagaat gggctagacc aggaggaaga aatagatgtg        60
     tattccgatc tgtattcgac gtatacgcag gttacttcgt tgactactaa tgatgttgat       120
     aacaccacat accccatgac ttggaagaca gtcgcccttt ttggcagctc cacagtgggt       180
     ggattactat ttggttacga tacaggtgtc atctcggggg tattgctcag tttaaagcca       240
     caggaccttg gcagagctac catttctgat tgggataaag agctgatcac ctccataaca       300
     tgccttggtt gctttgtggg atccctgctg gggtctccgc tggctgacaa gtatggcagg       360
     aggataactc tggcgatctt ttgcgtatta tttatagtcg ccgcactgtg gatggccttg       420
     gccagcaact tagtactgct ggtattcggt aggtttgttg tggggatcgc agtgggtact       480
     gccgcgcaat gtactccggt gtacctctgt gagatatcac ctgccaaaat tagaggtcaa       540
     atattagcac tgaattccat tgctgttact ggtgggcagt tcttgtctta catattcgct       600
     tatgagcttt acgacgtgaa tggctcttgg agaattttat ttggattgtc agccgtgcct       660
     gctataatat ttttatccat gttagacttc atacctgaat ctcctcgttg gttggtatct       720
     atgtctaaat atgatagcgc taaagcagcc ttgcgtatga tctatccgac tgcgtctcct       780
     ggtcagataa acctcaaatt caatgaacta gtcatcaatc taagcaagct caaacattac       840
     caagatgagc aaacttcgct gatggttcca ttatcggtgc gttcctctcg agttacaatc       900
     aattctgctg attacggttc ggtagcaaac ttgagatcat tacactctct aatgaatgaa       960
     ccttctggaa caaatcattc taataagaca gttcatcaca gaatggagcc taggacaaag      1020
     agagcattgt taatcggttg cgttcttatg tttttccagc aaattactgg tttcaacgcg      1080
     tttatgtatt acgctccgct aatattttcg aaattaaact ctcataaccc gctacttcca      1140
     gcaatgtcaa ttgcatttac taacttttta ttcacctttt tagctgtcta tctcgttgac      1200
     cttgttggga gacgttcgat gcttctaaat acaatttgga ttatgactgt tgggttgtta      1260
     ctgtctacaa ttgggtttca acatgaaaat gttgttgtat tattatttgc agtatctata      1320
     tttgtggcag catatgcttc tgccatgggc accataccct ggagttcagt agaattcctg      1380
     ccactgaata gaaggtcgtt cggagcatca tgtatatcat gtactaactg gttaacaaat      1440
     tttgttatta cagcatctta cctatctgtg atgaataaga tcggtacaga agacacaatg      1500
     ttattctttg cattatttag tgtgatggca tggttttttg tgtatttctg gtatcctgaa      1560
     gtcaagggac tatcactgga agaaattggg aaagtgtttg aaaatggtat tgatgtccat      1620
     tatgtttaca ggaactatta ctga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page