(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE70

CAGLA1_12.PE70       Location/Qualifiers
FT   CDS_pept        complement(187841..190675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436713"
FT                   /locus_tag="CAGL0M01694g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAG62394.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG181856"
FT                   /db_xref="HOGENOM:HBG677721"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI00003B7023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK26"
FT                   /transl_table=1
FT                   /translation="MLKFLRTNRYYHLLSGTKLSQKIIEQCRNEIDTIRKNHKFLPTLK
FT                   ILQVGNRLDSSAYVNMKLKKSEQSGVKCIVEKLPESITEFELLSKIEAINNDTSIHGLL
FT                   IQLPLPKHLDETTITSSVSVDKDVDGFHIYNAGELTKKNGHPKFIPCTPNGCIELLKEH
FT                   NITIAGKNAVVIGRSSIVGTPITSLLKNLDATVTQCHSKTVNLPEIVKTADIVIAACGQ
FT                   ANMIKGEWLKEGAVVIDVGINHVPDNTKKSGHRLVGDVDFDSASKKASYITPVPGGVGQ
FT                   MTVAMLVSNVVLAAKRSLANFEKVPEIKPLPLKLEKPVPSDFEISKSQEPKHIDNLAKE
FT                   LGIFQDELELHGHYKGKISTSILDRLESKKNGRYVLVAGITPTPLGEGKSTTTMGLVQA
FT                   LTGHLGKPSIANVRQPSMGPTFGVKGGAAGGGYAQVIPMDQFNLHLTGDIHAVGVANNL
FT                   LAAAIDTRMLHESTIKNDAKFYDKLVPKKNGIRSFSPAMTRRLERLGINKTNPDELTAE
FT                   EINKFVRLNINPDTINIKRVVDVNDRMLRKITIGQAATEKGRTRETGFDITVASELMAI
FT                   LALSTSLQDMKRRVSKLVVASDINGKPVTVDDIGCSGAIVALMTDTIKPNLMQTLEGSP
FT                   VLVHAGPFANISIGASSVMADKIALKLMGTCLDSQEPGYVVTEAGFDFSMGGERFFNIK
FT                   CRSSGLVPDTVVLVATVRAIKSHGGAPDVKPGQALPQEYIEENIEFVKKGVANLVKQIE
FT                   NVKKFGVPVVVAINKFSTDTENETKAIEESCKAAGANNVVVSNHWEEGGKGAIDLANAV
FT                   VQSCEEPKSFQFLYDTDLPIKEKLETIVKEMYGGAGIELSEKAQKQIALYTEQGFDKLP
FT                   ICIAKTQYSLSHDPKLKGVPQDFIVPIRDIRASIGAGYLYALAAEIQTIPGLSVHAGYL
FT                   NVEVDDKGNINGLF"
     atgctaaagt ttctcagaac caataggtac taccacctat tgtccgggac aaagctatcc        60
     cagaagataa ttgagcaatg tcgcaatgag atagacacca ttaggaagaa ccataagttt       120
     ttgcccactt tgaagattct acaagtcggc aatcggttgg actcatctgc ctatgtgaac       180
     atgaaattga agaaatccga acaaagtggc gtgaagtgca ttgtagaaaa actgccggag       240
     tcaattactg agtttgagct gttgagcaag atagaagcca taaacaacga tacctccata       300
     catggactgc tgatccaatt gcctttacca aagcacttgg atgagaccac aattactagc       360
     tctgtctctg ttgacaaaga cgttgacggg ttccacatat acaacgctgg tgaactcact       420
     aagaaaaacg gtcatccaaa gttcattcca tgcaccccca acgggtgtat agagcttttg       480
     aaggaacata atattactat tgcggggaag aatgccgttg ttatcggaag gtctagcatt       540
     gttggaactc caataacctc tttattgaaa aatttggacg ctactgtaac tcaatgtcat       600
     agcaagaccg ttaatttacc agaaatagtc aaaacagcag atattgtaat cgcagcttgt       660
     ggacaagcaa atatgatcaa gggtgaatgg ctaaaagaag gggcagttgt tattgatgtc       720
     ggcatcaacc atgtaccgga taacacgaag aaatctgggc ataggttggt tggtgacgtc       780
     gattttgact ccgcatcaaa gaaagcctca tacattactc cggttccagg tggtgttggc       840
     cagatgactg tcgctatgct agtttcgaat gttgtcctgg ccgccaagcg tagtttggcc       900
     aattttgaaa aagtgccaga aataaaacca ttacctctaa aattagaaaa acctgtccca       960
     tctgattttg aaatctcgaa gtctcaagaa ccaaaacata ttgataactt agctaaggaa      1020
     ttagggatat ttcaagatga actagaactc catggccatt acaagggtaa aatatctaca      1080
     tcaatactag atagacttga gtccaagaag aatggtagat atgttcttgt tgctggtatc      1140
     acacctactc ctttgggtga aggtaaatca acaacaacaa tgggtttggt acaggccttg      1200
     accggccatc tgggcaaacc atccattgct aatgtgcgtc agccatcaat gggacccaca      1260
     tttggtgtaa aaggtggagc tgctggaggc ggatatgctc aagtcatacc aatggatcaa      1320
     tttaatctgc acttaactgg tgatatccat gcagttggtg ttgcaaacaa tcttttggct      1380
     gctgcaatcg atactaggat gctacacgaa tctacaataa agaatgatgc caaattttat      1440
     gacaaacttg ttccaaaaaa gaatggtatc agatcttttt ctcctgctat gactagaagg      1500
     ttagagagac ttggaatcaa caaaactaat cctgatgaac ttacagcaga ggagataaat      1560
     aagttcgtga gactaaatat taaccctgat actatcaaca taaaaagagt tgttgatgtg      1620
     aacgatagaa tgctacgtaa aattacaatt ggtcaagctg ctaccgaaaa aggacggact      1680
     agagaaactg gttttgacat tactgttgcc tcggaactaa tggcaatctt agctctaagc      1740
     actagtttac aagacatgaa gcgtagagtt tccaagttgg tggttgctag cgacataaac      1800
     ggcaaacctg ttactgtcga tgatattggt tgctctggtg caatagtagc tttaatgacc      1860
     gatacgatca aaccaaacct catgcagaca cttgaaggct ccccagtgct tgttcacgca      1920
     ggtccatttg ccaatatctc aattggtgca tcttctgtta tggcagataa gattgcctta      1980
     aaattgatgg gtacatgttt agactctcaa gaaccaggtt acgttgttac cgaagcaggg      2040
     tttgattttt ccatgggcgg agaacgcttc tttaatatta aatgccggtc atcaggatta      2100
     gtcccggaca ctgtcgtttt agttgcaact gttagagcta ttaagtctca cggaggtgct      2160
     ccggacgtca agccaggcca agcgcttcca caagagtata tagaggagaa cattgaattt      2220
     gtaaagaaag gtgtcgctaa cttagttaaa caaattgaga atgttaagaa attcggagtc      2280
     ccagttgttg ttgcaatcaa caaattttcc actgacactg aaaatgaaac taaagctata      2340
     gaagaatcat gtaaagccgc tggtgcaaac aatgtggttg tctctaatca ttgggaagaa      2400
     ggtggaaaag gtgctattga tctagccaat gctgttgttc aatcttgtga ggaacccaaa      2460
     tcattccagt tcctatatga cacagatttg cctataaaag agaagctaga aactatcgtt      2520
     aaagagatgt atggtggtgc tggaatcgaa ctatctgaaa aagcccaaaa acagattgca      2580
     ttatacacag agcaaggttt tgataaattg ccaatttgca ttgctaaaac ccaatattca      2640
     ttatcacatg atccaaaact gaagggtgtt ccacaagact tcatagtccc tattagagat      2700
     atcagggcat ctattggtgc aggctatcta tatgcgttag cagctgaaat acaaacaatc      2760
     ccaggcttat ccgtccatgc aggatactta aatgtggagg ttgatgacaa gggtaacatt      2820
     aatggtctat tttag                                                       2835
//

If you have problems or comments...

PBIL Back to PBIL home page