(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE71

CAGLA1_12.PE71       Location/Qualifiers
FT   CDS_pept        complement(192389..193696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436714"
FT                   /locus_tag="CAGL0M01716g"
FT                   /product="Similar to uniprot|P18412 Saccharomyces
FT                   cerevisiae YBR083w TEC1"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62395.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124179"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI00003B7024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK25"
FT                   /transl_table=1
FT                   /translation="MTVSNDSSVSDRYNMNNSTSTSNVSSSNSTGSSNSSGHTQTTGSD
FT                   NKWPMDIESAFVEALGLIIKNGTSKIKIRDRNYGRNELISMYIWYRIGKYRTKKQISSH
FT                   IQVWKKSLLTKKKTGTLTNSNEIYVLDLIENGPQQTDESTRYFYTFFESIISTIMGNYP
FT                   AFAITHRPVLCPPNSTLPLPLPTGQQWFYAPQEGYYYQNQNSNSINYAGHQMTPNNGGN
FT                   QNQMDYMANDRNNIEINNMKLKSGSGMPMNTFNQRQQNVQQLPYPMISTQQGQNSHQFL
FT                   YHNGSNVDHKVPMSNTGNSANFNGNISSPQFNNSSNTPGVNNMHSNGSGFGMLYQYQQY
FT                   PNQSYYMQQSSLPIPPSIVQNSYTNNNTTNITTTPMSLPNVMSQFGQNGQSKTTNNLPP
FT                   PIRQPDILNKENKPLVKNEEINPYNEKKEVQGIQSN"
     atgactgtct caaatgacag ctcggtatca gataggtaca atatgaataa ctctaccagc        60
     acaagtaatg tcagcagctc aaatagcacc ggcagcagca acagcagcgg ccacacacag       120
     accaccggca gcgacaacaa gtggcccatg gacatcgagt ccgcctttgt cgaagctctg       180
     ggcctcatca tcaagaatgg tacttcgaag attaaaatca gagaccgtaa ctacggccgt       240
     aacgagctca tatcaatgta catatggtac agaataggta aatacagaac aaagaagcag       300
     atctcctccc acatccaggt ctggaagaaa tccctgctaa caaagaaaaa gaccggcact       360
     ttaacaaaca gcaacgaaat atacgtcctc gacctgatag aaaacgggcc acaacagact       420
     gatgagtcga ccagatattt ttacacattc ttcgaaagca tcatctccac tataatgggc       480
     aattacccgg cttttgcaat tacccataga cctgtgctct gcccgccaaa ctccacttta       540
     cccttgccct tgcccacagg ccagcagtgg ttttacgcgc cacaggaggg ttactactac       600
     cagaatcaga actcgaactc gattaactac gcaggtcatc aaatgacgcc caacaatggc       660
     ggtaaccaga accaaatgga ttacatggcc aatgaccgaa ataacataga aattaataat       720
     atgaagctga agtctggcag cggtatgccc atgaatacat ttaatcagcg gcaacaaaat       780
     gtacaacaat tgccatatcc aatgatttcc acccaacaag gccaaaatag tcaccaattc       840
     ctgtatcata atgggtctaa tgtggatcat aaagtaccca tgtctaacac aggaaatagt       900
     gccaatttta atgggaacat cagctcccca cagttcaaca actcttcaaa tactcctggg       960
     gtaaacaaca tgcattctaa tggaagtgga ttcggaatgc tgtatcaata ccagcagtac      1020
     ccaaaccaaa gctattatat gcagcaatct tcacttccaa tacctccctc catagtccag      1080
     aactcataca cgaataacaa cacaaccaat ataactacca ctcctatgtc tctaccaaat      1140
     gtgatgtctc aatttggcca aaatggtcaa tcaaagacta caaacaacct gccgcctccc      1200
     atccgccaac cagatatact aaataaggaa aacaagcctt tggttaaaaa tgaagagatc      1260
     aacccataca atgaaaagaa agaggtgcaa ggtattcagt ccaactga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page