(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE73

CAGLA1_12.PE73       Location/Qualifiers
FT   CDS_pept        203616..208115
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348725"
FT                   /locus_tag="CAGL0M01760g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62397.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B7026"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK23"
FT                   /transl_table=1
FT                   /translation="MSLASDKKDADVASTTTTAQDDDNLSTYHGFDHHVQDQVRQLART
FT                   LTQQSSLHQKKEHTLPEEGINPIFTNTEADDYNPRLDPTSDEFSSAEWVQNMSNISNSD
FT                   PDYYKPYSLGCYWKDLVATGESADIEYQANFLNGPYKGLKTVYNTVVPSTASSKDKNFK
FT                   ILKSMEGAVNPGELLVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPNDIRK
FT                   HFRGEVVYNAEADIHLPHLTVYQTLLTVARLKTPQNRLKGIDRETYARHLTEVAMATFG
FT                   LSHTRNTKVGNDLVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRAL
FT                   KVQASISNAAATVAIYQCSQDAYDLFDKVCVLYDGYQIYFGPAGKAKEYFQKMGYVSPE
FT                   RQTTADFLTAVTSPSERIINQDYINRGIFVPQTPKEMWEYWRASEDHADLIKEIDSKLS
FT                   DNYDANLAEIKDAHVARQSKRARPSSPYTVSYGMQIKYLLIRNFWRIKQSSGVTLFMVI
FT                   GNSSMAFILGSMFYKVMKHNTTSTFYFRGAAMFFAVLFNAFSSLLEIFSLFEARPITEK
FT                   HRTYSLYHPSADAFASILSEVPAKLITAVCFNIIYYFLVNFRRNGGVFFFYFLINIVAV
FT                   FAMSHLFRCVGSVSKTLSAAMVPASMLLLGLSMYSGFAIPRTKILGWSKWIWYINPLAY
FT                   LFESLMINEFHDRKFPCSQYIPSGSVYNNVPADSRICSSVGAIRGNDYVLGDDFLRESY
FT                   SYLHKHKWRGFGIGLAYVIFFLVLYLILCEYNEGAKQKGEILVFPQNIVRRMKKERKLK
FT                   NVSSDNDVEIGDVSDISDKKILADSSDESEESGANIGLSQSEAIFHWRNLCYDVQIKKE
FT                   TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSF
FT                   ARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIKILEMEQYADA
FT                   VVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHG
FT                   QAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGCKTMIDYFESHGSHKCPPDA
FT                   NPAEWMLEVVGAAPGSHANQDYHEVWRNSDEYQKVQEELEWMSNELPKKNTNNSETVHK
FT                   EFATGVLYQCKLVSLRLFQQYWRSPDYLWSKFFLTIFNNIFIGFTFFKADRSLQGLQNQ
FT                   MLAVFMFTVIFNPLLQQYLPSFVQQRDLYEARERPSRTFSWKAFIVSQILVEIPWNILA
FT                   GTVAFVIYYYAIGFYSNASVAHQLHERGALFWLFSCAFYVYIGSLALFCISFNQVAEAA
FT                   ANMASLMFTLSLSFCGVLVTPNGMPRFWIFMYRVSPLTYLIDGMLSTGVANVAIKCSNY
FT                   ELLRFSPAANLTCGEYLGPYLQTVKTGYIVDPSATDTCELCPYSHTNDFLSSVSSKYSR
FT                   RWRNWGIFICYIAFNYIAGIFLYWLARVPKKSGKLAKK"
     atgtctcttg caagtgacaa gaaggatgcc gatgtggcgt ctactactac aactgcgcaa        60
     gatgatgaca acttgtccac atatcatggt ttcgaccatc atgtgcagga ccaagtcaga       120
     cagcttgccc gcacattgac tcaacagagc agtctgcatc aaaagaaaga acacactctg       180
     cctgaggaag gtatcaaccc tatctttacc aacactgagg ccgatgacta caacccaaga       240
     ttggacccta cttccgatga gttctcctct gcagaatggg ttcagaacat gagcaacatt       300
     agcaactcag acccggatta ctacaaacca tactcccttg gctgttactg gaaggatttg       360
     gtcgcaactg gtgaatctgc tgatatcgaa taccaggcca acttcttgaa cggaccatat       420
     aaaggtctga aaactgttta taacacggtg gtgccatcca cagcctcttc aaaggacaag       480
     aatttcaaga ttttgaagtc tatggaaggt gccgtcaacc caggtgagct gctagttgtg       540
     ctaggtagac ctggttcagg gtgtaccact ttgctaaaat ctatctcgtc taatacccac       600
     ggtttcaaca tcgccaagga atctactatc tcctatagcg gcatgactcc aaacgacatc       660
     agaaaacact tccgtggtga agttgtctac aacgctgaag ccgatatcca tttaccacac       720
     ttgactgttt accaaacttt actgacagtt gcaagattaa agactccaca aaaccgtctg       780
     aaaggaatcg atagagagac ttacgctaga catttaacgg aagtggccat ggccactttt       840
     ggtctttcac atacaagaaa caccaaagtc ggtaacgact tagttagagg tgtgtctggt       900
     ggtgaacgta agcgtgtctc cattgctgaa gtctctattt gtggttctaa attccaatgt       960
     tgggataacg caacgagagg tttagattct gccaccgcac tggagtttat ccgtgcttta      1020
     aaagttcaag ccagtatttc caacgctgct gctactgtgg ctatctacca atgttctcaa      1080
     gatgcatacg atctattcga taaagtctgt gtgctttacg atggttatca aatttacttt      1140
     ggacctgctg gtaaggctaa ggaatatttt caaaagatgg gttacgttag tcctgaaaga      1200
     cagactactg ctgacttcct aacagctgtc acttctccat ctgaaagaat aataaaccag      1260
     gattacataa atagaggtat ctttgttcct caaactccta aggaaatgtg ggaatattgg      1320
     agagcctccg aagatcatgc tgacctaatt aaagaaattg acagtaagtt atctgataat      1380
     tacgatgcta atcttgcaga aataaaggat gctcatgtcg ctagacagtc taagagagct      1440
     agaccatctt ccccatatac cgtaagctat ggtatgcaaa taaaatactt attaattcgt      1500
     aatttctgga gaatcaaaca gagttcaggt gttacgttat ttatggtcat aggtaactcg      1560
     tcgatggcgt ttatattggg ttcaatgttc tacaaggtaa tgaaacataa tactacctcc      1620
     acattttatt tcagaggtgc tgccatgttc ttcgctgtct tatttaatgc cttctcatcc      1680
     ctattggaaa ttttctcttt attcgaagct agaccaatca ctgaaaaaca tagaacatac      1740
     tcgctatacc acccaagtgc tgatgcattt gcctctatcc tttctgaagt tccagctaaa      1800
     cttattactg ccgtttgttt caatattatt tactacttct tggtgaattt cagaagaaat      1860
     ggtggtgtct tcttcttcta tttcctgatc aacattgttg cagtatttgc catgtctcat      1920
     ttatttagat gtgttggttc tgtctcaaag acattatctg ctgcgatggt tcctgcttcc      1980
     atgttattgc ttggtttgtc aatgtattcc ggttttgcaa tcccaaggac taagattttg      2040
     ggatggtcta aatggatctg gtacatcaac ccacttgcat acttatttga atcgttgatg      2100
     atcaatgagt tccatgaccg taaattccca tgttcacaat atatcccatc tggttcagtt      2160
     tataataacg ttccagctga ctcaaggatt tgttctagtg ttggtgccat tagaggtaat      2220
     gactatgttt tgggtgacga cttcttgaga gagagttact cttacttgca caaacataag      2280
     tggcgtggtt ttggtattgg tctggcctat gtgattttct tccttgtttt gtacttaatc      2340
     ctttgtgagt acaatgaagg tgccaaacaa aagggtgaaa tcttggtctt cccacaaaat      2400
     attgttagaa gaatgaaaaa agaacgtaaa ctgaagaatg ttagctctga caatgatgtt      2460
     gaaattggtg atgttagtga tatctccgac aaaaagattc ttgctgattc atctgatgaa      2520
     tcggaagaaa gtggtgctaa cattggttta tctcaatctg aagccatctt ccactggaga      2580
     aacttgtgtt acgatgttca aattaaaaag gaaactagac gtatcttgaa taatgtggat      2640
     ggttgggtta aaccaggtac tttgactgcg ctaatgggtg catcgggtgc tggtaagact      2700
     acattattgg attgtttggc ggagagagta acgatgggtg ttattacagg tgaggtttca      2760
     gttgatggta agcaaagaga tgactctttt gctagatcta ttggttactg tcaacaacaa      2820
     gatttgcact tgaaaacatc gacagtcagg gaatcgctaa gattctccgc ttacctacgt      2880
     caacctgctg atgtgtctat tgaagaaaag aaccaatacg ttgaagatgt cattaagatt      2940
     ctagaaatgg aacaatatgc agatgctgtt gttggtgttc ctggtgaagg tttaaatgtt      3000
     gaacaaagaa agagactgac tattggtgtt gaattggctg ctaaaccaaa acttctggtc      3060
     tttttggatg aacctacttc aggtctggat tcacaaacag catggtccat ttgtcaacta      3120
     atgaagaaac tagctaatca tggccaagct attttgtgta caattcacca accttctgct      3180
     attttgatgc aagagtttga tagattgctg tttttgcaac gtggtggtaa gaccgtttac      3240
     tttggtgacc taggtgatgg ctgtaagact atgatcgatt attttgaaag ccatggctct      3300
     cacaagtgtc caccagatgc taacccagct gaatggatgt tagaagtcgt tggtgctgct      3360
     ccagggtctc atgctaatca ggattaccac gaagtatgga gaaattccga tgagtatcaa      3420
     aaggttcagg aagaattgga gtggatgtcc aacgagcttc caaagaaaaa tactaataac      3480
     tctgagacag tccataaaga atttgctact ggtgttcttt accaatgtaa gttggtttcc      3540
     cttcgtctgt tccaacaata ctggagatct ccagattacc tatggtcaaa gttcttcttg      3600
     actattttca acaatatctt tattggtttc acattcttca aagctgatag gtcattgcaa      3660
     ggtttgcaaa accaaatgtt agctgttttt atgtttacag tgatcttcaa cccattgcta      3720
     cagcagtatt tgccatcatt tgttcaacaa agagacttat acgaagcaag agaaagacct      3780
     tccagaacat tttcatggaa ggctttcatt gtttctcaaa tccttgttga aatcccatgg      3840
     aatatcctag ctggtactgt cgcttttgtg atttactatt atgctattgg gttctactcc      3900
     aatgcttctg tagcacatca actacacgaa cgtggtgctt tgttctggtt gttttcgtgc      3960
     gcattctatg tctacattgg atctcttgct ctattctgta tttcctttaa ccaggtggca      4020
     gaagcagcag caaacatggc atccttaatg ttcactctat cgctatcttt ctgtggtgtt      4080
     ctagttactc caaatggtat gccaagattc tggattttca tgtacagagt atcgccattg      4140
     acatatctga ttgatggtat gctttctact ggtgttgcta atgtcgccat taagtgttct      4200
     aactacgagt tactgcggtt ttctcctgct gcaaacttga cttgtggcga gtacttggga      4260
     ccatacctac aaaccgtgaa gactggctac attgttgacc catcagctac agacacatgt      4320
     gaactatgtc catactctca taccaatgac ttcttgagtt ctgttagttc caagtactct      4380
     cgtagatgga gaaattgggg tattttcatt tgttacattg ctttcaacta tatcgctggt      4440
     attttcttgt actggttggc cagagttcca aagaaatctg gtaaacttgc caagaaataa      4500
//

If you have problems or comments...

PBIL Back to PBIL home page