(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE75

CAGLA1_12.PE75       Location/Qualifiers
FT   CDS_pept        211439..214294
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044346"
FT                   /gene_name="TIF32"
FT                   /locus_tag="CAGL0M01804g"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit A"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62399.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG028011"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00003B7028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK21"
FT                   /transl_table=1
FT                   /translation="MAPPPLRPENALKRADELISVNEKPAALQSLYEFITARRIRYATP
FT                   SQVEPIVFKFLELGVELKKGKLIKDALYQYKKLVHGSAEGLVSVGAVLRKFIDYVETKL
FT                   ASEQAKAEEKQKEEVSDDLEGGVTPENLLSSVYEADHSVAGFNDEALNSWMRFSWESYR
FT                   TALDLLRNNSQLEITYSGVVSRTMQFCLKHQRKNEFKRLAEMLRQHLDTANYHQSKFGS
FT                   NQVDLSDADTLQRYLDQRFQLVDASVKLGLWHEAYKAAEDVYHLMKMTTRKPKSSTLAN
FT                   YFENLVQIFLVSGDQILHTLAWKKYFELYSTNPNATEEEFKKIASTIFLSALSIQLDDL
FT                   PNVRYNYQSRSYRLLDVETKPTRKEVIQSIVEDDTIFSRVDAETKTLYEIMEVEFDGES
FT                   FKGKFEAILPKLEGESYFANYSVSLRDVIIRRMFVFASQKYEDISLNDLYSSVTFSSSF
FT                   KLSEWDIEKQLLQAAVDDYVSFQLDHEQNKVTFVKDPLVNFAAIKEEEVEEEEEEEEEE
FT                   EEEEKEAEGAEGAEGDTEEGQEAVAEPEPVIKRNYYIRKRLSELYEKLLEDTDYNTVSY
FT                   LDKVRIAREALIKHTKDTIEDMKKNSEERAKMHQERRRQHMESAAMNAEKDAEQRQKRI
FT                   MEERASIEAKLEEEAHRRLIEKKKREFEEVKQREIRKLVDELNAKGNGTKVEYDEVKDM
FT                   DIPDITKYFVNRLSKNKDELEERMNFAVKRMDHLERAYRKVELPLLKKQADELRATDEV
FT                   NFGNMKKKIVDAAKAEYEAKMEDYNRVSSVFDDYKTLRDRMLAAHNEKFAAIRAENAAK
FT                   LEAAKKARIEEVRKQRYEELLARSEAEKKAAEEAERRAKLDEIARKQREMEEALERKSA
FT                   ARTFTQPRAPVVPNANLDEIARKQREMEEAIERKLAGKSAAPAPAPAPAASTPAASTPA
FT                   APGKMSFAERMRLKRQQQQQK"
     atggctccac caccactacg tcctgagaac gctctgaaga gagccgacga gttgatctcg        60
     gtcaatgaga agccagctgc tctacagtct ttgtatgagt tcattactgc cagaagaatt       120
     agatatgcta ctccttccca agttgagcca attgtgttca agtttttgga actaggtgtt       180
     gagttgaaga aaggtaagtt gatcaaggat gcactatacc aatacaagaa gctggtccac       240
     ggttctgctg aaggtttggt ttccgttggt gctgttctaa gaaagttcat tgactatgtt       300
     gagactaagt tggcctctga acaagccaag gctgaagaaa agcaaaaaga agaagtttct       360
     gatgatcttg aaggtggtgt taccccagaa aacttgttgt cctcagtcta cgaagccgac       420
     cactccgtcg ctggtttcaa cgatgaagct ttgaactctt ggatgagatt cagttgggaa       480
     tcataccgta ctgctctgga tctactaaga aacaactctc aactagaaat cacatattct       540
     ggtgttgttt ccagaaccat gcaattctgt ctaaagcacc aacgtaagaa tgaattcaag       600
     agattggctg agatgctgcg tcaacatttg gatactgcta attatcatca aagcaaattt       660
     ggcagcaacc aagttgattt gagtgacgct gacactctac aacgttactt ggatcaaaga       720
     ttccaattgg ttgatgcttc tgttaagtta ggtctgtggc atgaggctta caaggccgcc       780
     gaagatgtct atcacttgat gaagatgacc acacgtaagc caaagagctc caccttggct       840
     aactactttg aaaacttggt tcaaattttc ttggtttctg gtgatcaaat tttgcatact       900
     ttggcttgga agaagtactt tgaattgtac tccactaacc caaatgccac tgaagaggag       960
     tttaagaaga ttgcctctac catcttctta tctgctttgt ccatccaatt ggatgatttg      1020
     ccaaatgttc gttacaacta ccaatctcgt tcctaccgtc tactagatgt tgagactaag      1080
     ccaaccagaa aggaagtcat tcaatctatt gttgaagatg atactatctt ctccagagtt      1140
     gatgccgaga caaagacctt atatgaaatc atggaggttg aattcgatgg tgaaagcttc      1200
     aagggtaagt ttgaagccat tctgccaaaa ctagaaggtg aatcctattt cgctaactac      1260
     tctgtatctt tgagagatgt catcattaga agaatgtttg tctttgcctc tcaaaaatat      1320
     gaagacatct cattgaatga cctatactcc tctgtcacat tttcttcttc ttttaaacta      1380
     agtgaatggg atattgaaaa gcaattgttg caagctgctg ttgatgacta cgtctctttc      1440
     caattggacc atgaacaaaa caaggtcact ttcgtgaagg atccattagt taacttcgct      1500
     gctattaagg aagaagaagt tgaagaagag gaagaagaag aagaggaaga ggaagaggaa      1560
     gagaaggaag ctgagggtgc agaaggtgca gaaggtgata ccgaagaagg tcaagaagcc      1620
     gttgccgaac cagagcctgt catcaagcgt aactactaca tccgtaagag actttctgag      1680
     ctttacgaga agttgcttga ggacaccgat tacaacactg tttcttatct agataaggtt      1740
     agaattgccc gtgaagcttt gatcaagcac accaaggaca ctatcgaaga tatgaagaag      1800
     aactctgagg aaagagctaa gatgcaccaa gagagaagaa gacaacacat ggaatctgct      1860
     gctatgaacg ctgagaagga tgctgagcaa agacaaaagc gtatcatgga agaaagagcc      1920
     tccattgaag ccaagttgga ggaagaagct caccgtcgtc tgatcgaaaa gaaaaagcgt      1980
     gagtttgaag aagttaagca acgtgaaatc cgtaagttgg ttgatgaatt gaatgccaag      2040
     ggtaacggta ccaaggttga atacgatgaa gtcaaggata tggatatccc agatatcacg      2100
     aagtacttcg ttaacagatt gtctaagaac aaggatgaat tggaagaacg tatgaacttt      2160
     gctgtcaaga gaatggatca cttggagaga gcatacagaa aggttgaatt gcctttgtta      2220
     aagaagcaag ccgatgaatt gcgagcaact gacgaggtca acttcggtaa catgaagaag      2280
     aagattgttg atgctgctaa ggctgagtat gaggctaaga tggaagacta caacagagta      2340
     tcatctgtgt ttgacgacta caagaccttg agagaccgca tgttggctgc acacaacgaa      2400
     aagtttgctg ctattcgtgc tgagaatgcc gctaagttag aggctgccaa gaaggctaga      2460
     attgaggaag tccgtaaaca gcgttacgaa gagttgcttg ctagaagcga agccgagaag      2520
     aaggctgctg aggaagctga aagaagagcc aagcttgacg aaattgctag aaagcaaaga      2580
     gagatggaag aggctttgga aaggaagtct gctgccagaa ctttcaccca accaagagca      2640
     ccagttgttc caaacgccaa cttggacgag atcgccagaa agcaaagaga aatggaagaa      2700
     gccattgaaa gaaagcttgc tggtaagtct gctgctccag ctccagctcc agctccagct      2760
     gcttccaccc cagctgcttc taccccagct gctccaggta agatgtcctt cgctgagaga      2820
     atgagattga agagacaaca acaacaacaa aaataa                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page