(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE76

CAGLA1_12.PE76       Location/Qualifiers
FT   CDS_pept        complement(215340..216605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500877"
FT                   /locus_tag="CAGL0M01826g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62400.1"
FT                   /db_xref="HOGENOM:HBG398340"
FT                   /db_xref="HOGENOM:HBG429547"
FT                   /db_xref="UniParc:UPI00003B7029"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK20"
FT                   /transl_table=1
FT                   /translation="MKVTSLVYAAMATSVLGQNSTSDDVPSGCSLGSSATATAQSDLDK
FT                   YSGCETIVGNLTITGALGSAALAGVKKIDGSLRIYNATSLGSFAADSVKEITGALNMQD
FT                   LTILTTASFGALEEVDTINLITLPAISTFNTNLQSANNIVVSDTSLESVEGFGSLKEVN
FT                   VLNINNNRYLNSFKSSLESVSGALQFASNADETAVSFDNLIWANNITLRDVQNASFAKL
FT                   ESVNASLGFINNTISTLNLTHLSKVGQSLSVVSNDDLTQLSFLNLTSVGGGLVVANNTN
FT                   LKTIDGLKNVQTVGGAIDITGNFTTLDLSSLKSVRGGATFNTVSGNFSCSPLKSLQSKG
FT                   AIQGDSFVCKNGATSTSISMSSRSRSSSASSSASATVTARSNDTASTSSTKTKKSKGAA
FT                   AQEVFPAGSFFGAVAAVAVALL"
     atgaaggtca catcattggt atatgccgct atggctactt ctgttttggg tcagaactct        60
     acatctgacg atgttccatc tgggtgttct cttggtagca gtgctactgc tactgcacag       120
     tctgatctgg acaagtacag cgggtgtgag accattgttg gtaacttgac catcactggt       180
     gctcttggct ctgctgcgct agccggtgtc aagaagatcg atggttcttt gagaatctac       240
     aatgccacct ccttgggctc ttttgctgct gactccgtca aggagatcac cggtgctttg       300
     aacatgcagg acttgaccat cttgaccact gcgtccttcg gtgcgctgga agaagtcgac       360
     accatcaact tgatcactct gccagccatc tccactttca acactaactt gcaatccgcc       420
     aacaacatcg tcgtctccga cacctctttg gagtccgtcg aaggtttcgg ctctttgaaa       480
     gaggtcaacg tcctaaacat caacaacaac agatacttga actctttcaa gtcctctttg       540
     gaatccgtgt caggtgcttt gcaattcgcc tccaacgccg atgaaaccgc cgtgtccttt       600
     gacaacttga tctgggccaa caacatcacc ttgagagacg tccaaaacgc ctctttcgcc       660
     aagctggagt ccgttaacgc ctccctgggt ttcatcaaca acaccatctc cactttgaac       720
     ttgacccact tgtccaaggt cggtcaatcc ctatccgttg tctccaacga tgacttgacc       780
     cagttgtcct tcttgaactt gacctccgtc ggcggtggtc tggtcgtcgc caacaacact       840
     aacttgaaga ccatcgacgg tttgaagaac gtccaaactg tcggcggtgc catcgacatc       900
     accggtaact tcaccacttt ggacttgtcc tccttgaagt ccgtcagagg tggtgccact       960
     ttcaacaccg tctccggtaa cttctcctgc tctcctttga agtccctaca aagcaagggt      1020
     gccatccaag gtgactcctt cgtctgcaag aacggtgcta cttccacttc catcagcatg      1080
     tcttccagat cccgctcttc ttccgcctct tcctccgctt ccgctactgt taccgccaga      1140
     tccaacgaca ctgcttccac ttcctccacc aagaccaaga agtctaaggg tgccgccgcc      1200
     caagaagtct tcccagccgg ctccttcttc ggtgccgtcg ctgctgtcgc cgtcgctttg      1260
     ctatga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page