(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE78

CAGLA1_12.PE78       Location/Qualifiers
FT   CDS_pept        complement(219813..220760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044347"
FT                   /locus_tag="CAGL0M01870g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62402.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124181"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B702B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK18"
FT                   /transl_table=1
FT                   /translation="MIFESNPLNSFMLDDEERFKIDDYLDCFNDMSLPAIQNTTVIQPF
FT                   SMYNESYEKLFNETDSIISDEPSSVFELDTNSRRDTLKSEGFISLEHPDMLQKRDSDSQ
FT                   YHFKNELPYPRDEVVKMAEAYPPSLQKVEESVSPKSSCIQPADDETSNAFDEKFSAQAE
FT                   INKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHY
FT                   KLHFKLSNGAYILPTGEICAEKPTAKQLLQSSKRTSSRVQKKRKTSNTTTSTYVSDGYP
FT                   SEVDVSGSATPLNNDVLCKPYLNVLHQGGEASSI"
     atgatttttg aaagtaatcc tttaaactcc ttcatgctag atgatgaaga gcgtttcaag        60
     atagacgact acttagactg cttcaatgac atgagtctcc ccgctatcca aaacaccacg       120
     gttattcagc ctttctccat gtacaacgaa agttacgaaa agcttttcaa tgaaacagac       180
     tctataatat cagatgaacc atctagtgtt ttcgaactgg atacaaactc cagaagagat       240
     actctaaagt ccgaaggttt tatctcatta gaacacccag atatgctaca aaagcgcgat       300
     agcgattctc aataccactt caaaaacgaa cttccatacc caagagatga agtagtaaag       360
     atggctgaag cttacccacc atcattgcag aaagttgaag aaagtgtatc gcccaagtct       420
     tcctgcatac aacctgcaga tgatgaaact tcaaacgctt ttgatgagaa gttctctgca       480
     caagccgaga taaataagac atcagaagac actaaattca tttgcaaagt atgtctcaag       540
     aagttcaaaa gaccaagctc gctaagtaca cacatgaata tccacacagg tgaaaagcct       600
     tacccatgtc catttgataa ctgtacgaag agcttcaacg ccaagtctaa catgttgaga       660
     cactacaagc tacacttcaa actaagtaat ggtgcttaca ttctaccgac cggtgagatc       720
     tgtgctgaga agccaactgc aaagcagctt cttcaaagta gtaaaagaac ttcatcaaga       780
     gtacagaaaa agagaaagac ttcaaacact acaacatcca cttacgtaag cgatggctac       840
     ccatcagagg tggatgtttc tggttctgct actccactaa ataatgatgt tctatgcaaa       900
     ccatacctaa atgttttaca ccaaggaggt gaagcttcat caatatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page