(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE83

CAGLA1_12.PE83       Location/Qualifiers
FT   CDS_pept        241386..243596
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436718"
FT                   /locus_tag="CAGL0M01980g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAG62407.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG124185"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B7030"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK13"
FT                   /transl_table=1
FT                   /translation="MIHVLPKETWQVLRADTQITGIDSVLRELLQNAVDAGASTVDVSF
FT                   SIKKNMCMVADDGCGMTRKDLDLLGRPHITSKIRNFRDLERFGNGNGTMGFRGEAIFAI
FT                   SQISELTMMTKHSDFRAHYWRDFPMTSVLTTEEDIRSSLHAQYLSTTPFYEDIWARSSG
FT                   TVVIVSDLFKYIPVRKKTLENVPVATITDSIREDFYQILVRNPNLKLNIFTFDDNYKNF
FT                   EFLNHVKEQYLHSLGSIPIHNAFIRVYGHVVPDPSIKIVKLSFREYNITGLISNCQVRS
FT                   KSFQFVFVNGRRYSNSEFLGKINRIFDQSTFATNAVEKDTRLGKRSARSYPLFVIKIDG
FT                   PAHVQDLIQSTSKDIIHLSDGKLINILILKVIYSFLKDQGFLTEIPTQLNDDNCDRIDQ
FT                   LGTLEEPIFMDNDFHRDFVIRNNVKMAKYNKVSHANISHPWKRQRLDYPVRRTSKWWKE
FT                   RSVNELHQSRISTKFAPIKKWAAYEKLHVFDYKDRFLSRSDDLKEVDVVNQVDQKFILL
FT                   RQKSARGNFELYIIDQHACDERIRLESFLKQYICDIMANALAVQKIFQSRIEIAISEKE
FT                   NFEQYRHEFSKWGIYYNVVHSNNNYSLDIFALPDMLADKIKANEELKDMMLQHIFDLKD
FT                   GSRSRIKTISSLDAQFLSGGWWSNVNKIPSFIRRFFDSKACRSAIMFGDTLNLQECRDL
FT                   VRRLNGCIQPNFCAHGRPSVVELIGHQHQWELKNFTADYDYD"
     atgatacacg ttcttccgaa agaaacatgg caggttttgc gcgcggatac tcagataacc        60
     ggtattgaca gtgttttgag agagctgtta cagaatgcag tggatgcagg tgccagtaca       120
     gtcgatgtaa gctttagtat caagaagaac atgtgtatgg tggcagatga tggctgtggt       180
     atgactagaa aggatttgga tttgttggga aggcctcata ttacatccaa gatacgcaac       240
     tttcgggact tagagagatt tggtaatggc aatggtacta tgggcttccg tggggaagcc       300
     atatttgcga tatcacagat ctcggagctc acaatgatga ctaagcatag cgattttagg       360
     gcgcattact ggcgcgattt tccaatgaca tccgtgctta ctacagaaga agacataaga       420
     agctcgttgc atgcacaata tctgtcaacc acaccatttt acgaagatat ctgggcaaga       480
     tcgtcaggaa cagtagtaat agtgtcagat ttgttcaaat atatacctgt taggaagaaa       540
     acattggaaa atgtgcctgt agcaactatt acagactcca tcagagaaga tttttatcag       600
     attttggtca ggaatccgaa tcttaagtta aatattttta cttttgacga taactataaa       660
     aattttgagt ttctaaatca tgtcaaggaa caatatttac actcattagg ctccatcccc       720
     attcacaatg cctttattcg agtgtatgga catgttgtcc cggatccttc tatcaaaatc       780
     gtaaaattaa gcttcagaga atataatata actggactta tatctaactg tcaagtgcga       840
     agcaagagtt ttcaatttgt gtttgttaat ggtagaagat attcaaactc ggaatttctc       900
     ggaaagatca ataggatatt tgatcaaagt acatttgcga ctaacgcagt cgagaaagat       960
     accaggctag gaaagagaag cgccagatct tatcctttat ttgtcatcaa gattgatgga      1020
     ccagctcacg tgcaagatct tattcagagc acctcaaagg atattatcca cttgtcagat      1080
     ggtaaattaa taaatatact gattctgaaa gtaatatatt cgttccttaa ggatcaaggc      1140
     tttctgactg agattcctac ccagctaaat gatgataatt gcgatcgtat agaccaattg      1200
     ggtactcttg aagaacctat atttatggat aatgattttc atcgagattt tgtaataagg      1260
     aacaatgtca aaatggcaaa atataataag gttagccatg ctaacattag ccacccatgg      1320
     aaaaggcaaa ggttggatta tcctgttcgc agaacttcaa aatggtggaa ggaaaggtct      1380
     gtaaatgaac tacaccaatc aagaatatct actaagtttg cacctataaa gaaatgggcc      1440
     gcatacgaaa aattgcatgt atttgattat aaagacaggt ttctgagtag gtctgatgat      1500
     ttgaaggagg tagatgtcgt aaatcaggtt gatcagaagt ttatcctact aagacagaaa      1560
     tcggcgcgtg ggaacttcga attatatata atcgatcagc atgcctgcga tgaaagaata      1620
     agattagaat cctttttgaa acaatatatt tgtgatataa tggccaatgc attggctgta      1680
     caaaaaatat tccaaagtag gattgagata gccatctccg agaaagaaaa ttttgagcaa      1740
     taccgccatg aattttctaa atggggtata tactataatg ttgttcattc taataacaac      1800
     tattcattgg atatttttgc tttgcctgat atgctcgccg ataagattaa agctaatgaa      1860
     gaacttaagg atatgatgct acagcatata tttgatttaa aagatggttc acgatccagg      1920
     attaaaacaa tttctagttt ggatgcacaa tttttatcag gtggttggtg gagcaacgtc      1980
     aataagattc catcatttat tagaagattc tttgacagta aagcttgtag aagcgctata      2040
     atgttcggag atacattgaa cttgcaggaa tgtcgagact tggttaggag attaaatgga      2100
     tgcattcaac ctaatttttg tgcccacgga agaccgtctg ttgttgaact aattggtcat      2160
     caacatcagt gggaactgaa aaacttcact gctgattacg actatgatta a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page