(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE88

CAGLA1_12.PE88       Location/Qualifiers
FT   CDS_pept        complement(251658..253472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436720"
FT                   /locus_tag="CAGL0M02079g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62412.1"
FT                   /db_xref="HOGENOM:HBG124186"
FT                   /db_xref="UniParc:UPI00003B7035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK08"
FT                   /transl_table=1
FT                   /translation="MDYETLLFELKPLLDIEQLKVANIDESNVQVYTSALEKCSQGARI
FT                   ESNRTIIGRSGLLDSLTESLAFLLEQEFTVDTQSNKNILLIISEIVRVLANSFADNDDN
FT                   RNIFFDKNRFLANPIIETYFAKVLALNLQQNDPDVIITLQMRLAAMVKNLIVDNRNYVT
FT                   HYAAFLCPTSYLRLDSINLTSENEVQMALFIAELIDAILEFDKKGATLDEMKIVSTLYY
FT                   QLSTYITSASVEIDDGDDEEPLIELLATLTNIAEIVFSIDGTFNFDKQQETKDIIQKNI
FT                   LQTIDNLEELKFHNKLIIMRRLVTTSGYIASDKSNTTHSEMNMCLNHLRNENPSPYTIG
FT                   AIFINITNAIRSTEESKELEQTLSIPDIICYSKKLSDPVQFQGVLDLLKKVLNLSNTLL
FT                   LPNDSLQGIANLLTYSNEQAQYFQGLIPLVNGLLNKLLTVIPSSKIEFIFQGNISEGFV
FT                   KLICKNGSISASLALDKLLLVKNPIKKDITDRLWECLFHFDQVAKENNTSESANVYLLF
FT                   QVAKTLGVYLRNTIDKPTEIQDFLLYQYEDQLVFLLSQILDLRDKNVRGSESAMNNGKF
FT                   VAGLIIDAKKSVRTTDDDRLLAICKQFF"
     atggattatg agacgctgtt atttgagttg aagcctctac tagatattga acaattgaaa        60
     gtggcaaaca tcgatgaatc taatgtccaa gtatacacga gtgctttaga gaaatgctca       120
     cagggtgcta gaatagaaag caatagaaca ataattggtc ggtcgggatt gctcgactcg       180
     ctaactgaat cattggcatt tcttttagag caggagttca ctgttgatac ccagtcgaat       240
     aaaaatatat tattgataat ctcagagata gtacgagtac tcgcgaatag ttttgcagat       300
     aacgatgata ataggaacat attcttcgat aaaaatagat tcttggcgaa tcctataatt       360
     gaaacctatt ttgctaaggt actagcctta aatcttcagc aaaatgatcc tgatgttatc       420
     ataacactac aaatgagact agcagctatg gttaagaatt tgatagttga taaccggaat       480
     tatgtcaccc attatgcagc ttttctatgt cctaccagct atttgaggtt ggatagcatt       540
     aatttgacat ctgaaaacga agtacaaatg gcattgttta ttgctgaact tattgatgct       600
     atcctagaat tcgacaaaaa gggcgctaca ttagatgaaa tgaagattgt gagtactctt       660
     tattatcaat tgtccaccta catcacatcg gcttctgtag aaattgatga tggcgatgat       720
     gaagagccac taatcgagct tttggcaaca ttaacaaata tagctgagat tgtttttagt       780
     atcgatggta catttaactt tgacaaacaa caggagacta aagatataat ccaaaaaaac       840
     attctacaga caatagacaa cttggaagaa ctaaagtttc ataataaatt gatcatcatg       900
     agacgcctgg tcacgacatc agggtatatc gcctctgata aatcaaatac tactcactcg       960
     gagatgaata tgtgtttaaa tcatctaaga aatgagaatc cttcgccgta cacaatcggt      1020
     gctattttta tcaatattac aaacgctatc agatcaactg aggaatcaaa ggaactagaa      1080
     caaacgttat caataccgga cattatttgc tactcaaaaa agctttctga cccagtacaa      1140
     ttccaaggtg ttttggatct tctcaaaaag gttttaaact taagtaatac cctattactc      1200
     cctaatgaca gtttacaagg cattgctaat cttctaacat atagtaacga gcaagcacaa      1260
     tactttcaag gattaattcc tttggtaaac ggtttgctga acaagttact aacagttata      1320
     cctagttcta aaatagaatt tattttccag ggtaatatct cagaaggatt cgtgaaacta      1380
     atatgcaaaa atggatccat ttctgcatct ttggcattgg acaagctgct gcttgttaaa      1440
     aatccaatca aaaaggacat tacagataga ttatgggaat gcttattcca tttcgatcaa      1500
     gtagctaaag aaaataacac atcagaatcc gctaacgttt atcttctatt tcaagttgca      1560
     aagactcttg gtgtttactt gagaaatacc attgataaac ccactgaaat acaggatttc      1620
     ctactctatc aatatgagga tcaattggta ttcctcttgt cccaaatctt agatttgaga      1680
     gataagaatg ttagaggcag tgaaagtgca atgaataacg ggaaatttgt agctggatta      1740
     atcattgatg ctaaaaagtc tgtacgtact acagatgacg atagattact agcgatttgt      1800
     aagcagtttt tctaa                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page