(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE89

CAGLA1_12.PE89       Location/Qualifiers
FT   CDS_pept        complement(254024..254827)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436721"
FT                   /gene_name="PET20"
FT                   /locus_tag="CAGL0M02101g"
FT                   /product="Protein PET20, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62413.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG124187"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniParc:UPI00003B7036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK07"
FT                   /transl_table=1
FT                   /translation="MSVSLVLCTWGGAARTARVYRVVKQAMIRTMFVRLRSAGQVRYQS
FT                   SFSFPSSQSLLQKGQLGKKKRSVRKLGLGISDKKQYNSGVTSAAQEAGGAVRDLKSEKA
FT                   QTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEFAMK
FT                   LEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPFTPPVVNSRKLNGATGENANDF
FT                   DEQGNFQKKAFFDKVQSILNRNGKGGRKRPGVTVLKHLKKLKEQN"
     atgagtgtct ctttggttct ttgtacctgg gggggagcgg ctaggacagc aagagtctat        60
     agagttgtta agcaggcgat gatacgtacg atgtttgtta gattgcggag cgctgggcag       120
     gttcggtacc agtcgtcatt ctcgtttccc agcagtcagt cgttgttgca gaagggtcag       180
     ttgggaaaga agaagcggag tgttcggaag cttggattgg ggatcagcga caagaagcag       240
     tacaacagtg gtgtgacgag tgctgctcag gaggctgggg gcgctgtgag ggatctgaag       300
     tccgagaagg ctcagacgaa gaagaaagtg tatgattact ctactttgcc ccgtgtggag       360
     cagatatctg atacaaagct gaagaacatg agcacggagg tgttgtactc tggttatagg       420
     ccgctgtttt tcgacgtcga gcccaaaaac agccaggagg gcaagactct gtatgagttt       480
     gccatgaagt tagaagagtt tcaggaagcc atgagcccct gggtgtcgtc cgctacaggt       540
     agtgagatgt atgccgagtg ggataatgtg cccggtgatg tgataaagga cttaaaacca       600
     ttcacgccac cggtagtaaa tagtaggaaa ctgaacggtg ccactggaga aaatgcgaat       660
     gattttgatg agcaagggaa tttccaaaag aaagcgttct tcgacaaagt gcaaagcata       720
     cttaatagaa acggcaaagg tggcagaaaa aggcccggtg tgacagtgct gaagcacttg       780
     aagaagctca aagaacaaaa ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page