(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE92

CAGLA1_12.PE92       Location/Qualifiers
FT   CDS_pept        complement(259132..259833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436723"
FT                   /locus_tag="CAGL0M02167g"
FT                   /product="Similarities with uniprot|Q12498 Saccharomyces
FT                   cerevisiae YPL156c PRM4"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62416.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG124189"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B7039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK04"
FT                   /transl_table=1
FT                   /translation="MSKEKADNIQWTRAKRGLGGTVFVLVLLLLTFGNVLGIFSTDIPI
FT                   QSIIASTDSLNSNALIGKASVNSIKKESNNLNSVAHTSMSSSSVAKDGTVIEYDPEKNF
FT                   KQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHK
FT                   IKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENI
FT                   VFNKRDLPSNS"
     atgtctaaag agaaggccga taatatacaa tggactagag ccaagagggg tcttggtggg        60
     acggtatttg tgctagtcct gctgcttcta acgttcggga acgttcttgg tatattcagc       120
     actgatatac ccatccaatc cataatagca agcacagata gcctcaacag caatgcttta       180
     attggaaagg ccagtgtcaa ttccatcaag aaagagagca ataacttaaa cagcgtggca       240
     catacttcca tgtcttcctc atcagtggct aaagacggca cagtgattga atatgatcca       300
     gaaaagaact ttaagcagat tatcaacact tcccctgctg tcttgttcat taggtcatct       360
     gagtacgagt ctaacatact gaggaaattg cttacaaggg attacgagat tacgccagaa       420
     ttggccattg tagacttaga taaacatgac cacgatgttc tcttagagag acacatcctg       480
     tcccacaaga ttaagtctac aaaagttgaa gttctaaaga gtacctctgt taaacaggca       540
     aaagcacctt acttatttat caacggacac tccttgatca ataatggaat tgccgatgat       600
     atattgaaat ttcacgagaa aggccaacta ctaacaaagt tgaaagcatt cgcaggtgag       660
     aatattgtct ttaataaaag agatttacct tccaattcct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page