(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE93

CAGLA1_12.PE93       Location/Qualifiers
FT   CDS_pept        complement(261290..263308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195509"
FT                   /locus_tag="CAGL0M02189g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAG62417.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG396482"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI00003B703A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK03"
FT                   /transl_table=1
FT                   /translation="MSASRDSEKYRFETPRVMKSPSPSLDSAVSISSYARSRSSVTRGF
FT                   RNGSSSGSSSRSSSPLRPGSFGGDPYLQYGKIRNRSESSSYENGSGNLDKYTGTIKVVI
FT                   RPKPYPTEKIVSWKIHGDKVISHNDIGDFTFDHVFSTGCSNFDIYGKTTQPLIDRLIEG
FT                   YNATIFAYGMTGSGKTFTMSGTEEEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLE
FT                   IYNEKINDLLDVASGSNVQNTPSRLFTSTHTSSSGDLKIRDDSECGVRVVGLTQKRCDT
FT                   SEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLSLCDLAG
FT                   SERGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSSS
FT                   GNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNVALDVS
FT                   RVYKRINRSAHPFSSPSKLDGGDDRSEQRIQELLIQLQTRDRELAKLREVSAGVASGTM
FT                   NGAQQNLHPDTQLLTKENLLLKNKLKHYESLLVEDGMGVSGASTRNTSNSSSSSTLVSS
FT                   SPALDNKGRYAGTNSTGVDAELEEIAQLLPSEVAVMLETKFDNLRRQLQSAHRYSESLE
FT                   KQLNDSHTETEQLKRSLQTKDKLIEALTSAKRLQQQQ"
     atgagcgcat cgagggacag cgaaaaatat agatttgaga ctccaagggt aatgaaatca        60
     ccctcgccat cattggattc agctgtatcg atatccagct atgctaggag caggagttcc       120
     gtgactaggg gttttagaaa tggttctagt tcgggctcct cttctagaag cagctcacca       180
     ctgaggcctg gatcattcgg aggcgatccg tacttgcaat acggtaaaat aaggaacaga       240
     tcggaatcat caagttatga gaatgggagc ggtaatttag ataagtatac aggaactatt       300
     aaagtagtga tacggcctaa gccataccca acggaaaaaa ttgtatcctg gaaaattcat       360
     ggcgataaag taatatcaca taatgatatt ggtgacttta cgttcgacca tgtattttca       420
     actggttgct caaattttga catatatgga aagactacgc aacccctgat agacaggtta       480
     attgaaggtt acaacgccac tatcttcgca tatggtatga ctggttcagg gaaaacattt       540
     acgatgagtg gtactgaaga ggaaaagggg ctaataccac tatcagtttc gtatttgttc       600
     agctcattgc ttgagaaaac taatactgaa aatgaaaaaa gtgaagtgtg ggtgtcatac       660
     ctggaaatat acaatgagaa aataaatgac cttttagacg tagcgagcgg cagcaacgta       720
     caaaacactc cgtcaagatt attcacatct acacatacta gcagttcagg tgatttgaaa       780
     ataagagatg actctgaatg cggtgtgcga gtcgtagggt taacccaaaa gaggtgtgac       840
     actagtgaag aagttttgga ttggatcaac aaaggcaata agaatcgtaa aaccagtgaa       900
     actgagttca atactaggag ctcgagatct catgcaattg tgatgatacg gcttatttct       960
     aaggatatta gaactggaga acaaaatata agaacgctat cattgtgtga tttagcgggg      1020
     tcagagcgag gagtaggtca gaatgaaaga cgtaaagaag gtgcattcat taatcgttca      1080
     ttactggcat taggaacagt aatatctaga ctaagtgcag aaaacaatgg atcacatcat      1140
     actggtagag cagctaattc ccaacagtca ttggcgtctc caaatggaag tagttccggg      1200
     aatcatatac catatagaga ttctaagtta accagattat tgcaacctgc tctaagcggt      1260
     gatagtgttg tcgttgcact atgtacaata gatttggcac acgagagtag cagtgagacc      1320
     ttgaacacgc tgaggtttgc gagccggtct aagaacgttg cactcgatgt ttcacgtgtc      1380
     tacaagcgga taaatcgatc tgctcatcca tttagttcac cctcaaagtt agacggtggt      1440
     gatgacagaa gcgaacaaag aattcaagag ctattgattc aattgcaaac aagggatcga      1500
     gaattagcaa aacttcggga agtctctgcc ggagttgcat ccggaacaat gaatggtgca      1560
     caacaaaatt tgcatccaga tacgcagcta ttaaccaagg agaacttgtt gttgaaaaac      1620
     aagttgaagc attatgagag cttgctggta gaagacggaa tgggtgtatc gggtgcgagc      1680
     acaagaaaca ccagtaatag cagcagttct tccactctgg ttagctcttc gcctgccctt      1740
     gataacaaag gaaggtatgc aggtacgaat agcactggcg tggatgctga gttagaagaa      1800
     attgcgcaat tgctaccatc agaagttgcc gttatgctag agaccaaatt cgacaacttg      1860
     aggcgtcaac tacagtcggc acaccgttac tcggagtccc tagagaagca attgaacgac      1920
     tctcacactg aaacagagca attaaagagg tcgctgcaaa caaaggataa actgattgag      1980
     gctttgacaa gtgctaagag attgcaacag cagcaataa                             2019
//

If you have problems or comments...

PBIL Back to PBIL home page