(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE94

CAGLA1_12.PE94       Location/Qualifiers
FT   CDS_pept        complement(264202..265449)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436724"
FT                   /locus_tag="CAGL0M02211g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62418.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG590923"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B703B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK02"
FT                   /transl_table=1
FT                   /translation="MRLSLSVLMPLALMLLGDYADAKVFQAELKKEKLTKEMLELGFEA
FT                   HVQQLGHKYVSQYEKANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQKF
FT                   KVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYISE
FT                   DNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHL
FT                   LDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLIPLHVRRQAYWEVPLN
FT                   AIKLGDQSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQYTLECSTRAK
FT                   LPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVF
FT                   DLDANVVSLAEAVHSA"
     atgagactat cactaagtgt attaatgcca ttggcattaa tgctattggg agactatgct        60
     gatgccaagg tattccaagc agaattaaag aaggaaaaat tgaccaagga aatgttggag       120
     ttgggctttg aggctcacgt ccagcaacta ggtcacaagt acgtgagtca atatgagaag       180
     gctaaccccg ggactgtgct accaagggac catctgtttt atcctgatca ggttcacaac       240
     gttccattgt caaactatat ggatgcccaa tattttgctg acatttcttt gggtactcca       300
     cctcaaaagt ttaaggttat acttgacact ggttcgtcaa atctttgggt gccaagtgtc       360
     gattgtggtt cattagcctg ctttttgcac aacaaatacg atcattctca atccagtacg       420
     tatattaagg atggtcgacc attatctatc agttatggct ctggttcgat cgaaggttat       480
     atttctgaag ataatttgca gattggtgat ttgactattc agaatcagaa gtttggtgaa       540
     accaccagtg aaccagggtt ggcttttgcc ttcggtaaat ttgacggtat tttgggtctt       600
     gcttatgata caattgcaca agatgatatc acaccaccat tttactcagc tattcaacag       660
     cacctattag atgagtcaaa gtttagtttt tatctgaaga gtgtcaatga cccagcagcg       720
     gaaggaggat ccgcaagtga cggaggtgtg ttcacactgg gtggagttga ttcatcaaaa       780
     ttcaaaggtg acttgatacc attacatgtt cgccgtcagg cttattggga agttccattg       840
     aatgcaatta aacttggtga tcagagtacc ggcaaactag aaaacactgg tgctgcgatt       900
     gatactggta cctcgttgat tacattaccc tctgatatgg ctgagattat taacgcacaa       960
     attggtgcaa agaagggttg gactggtcaa tatactctgg aatgttctac tagagctaaa      1020
     ctacctgatt taacatttac ccttgatgga catgattttg ttctgtcacc atttgaatat      1080
     acactagaag tttctggtag ctgtatctct gttattactc caatggattt cccagagcca      1140
     atcggaagaa tggctatttt gggtgacgct ttcttacgca gatactattc tgtgtttgat      1200
     cttgatgcca atgttgtcag tttagctgag gctgtacact ctgcttga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page