(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE95

CAGLA1_12.PE95       Location/Qualifiers
FT   CDS_pept        complement(267332..269635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436725"
FT                   /locus_tag="CAGL0M02233g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62419.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058433"
FT                   /db_xref="HOGENOM:HBG396675"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI00003B703C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK01"
FT                   /transl_table=1
FT                   /translation="MMETQPTQQATQATQKYLIDNFTQEQIKKNSVYRVICTSGQIPIK
FT                   DMEVDVEQIAKKKESIKKIWTFGRNNACDYHLGNISRLSNKHFQILLGEDGNLLLRDIS
FT                   TNGTWLNNQRIEKDRNHLLSQGDEITVGLGVSSDIISLVIFINEKFRDYLEEVRQELSS
FT                   QGLKVSSKSNANPNINLTGIYKDFSINDEVVGTGAFATVKKAVERNTGKTFAVKIINKR
FT                   KVVGNMDGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAV
FT                   GEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS
FT                   IMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF
FT                   SGSTQEQLYEQIRKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIK
FT                   QCSSQFDANSMSSQVSLSQSMSQQKALESLDDAQYEFLKAQKKLQQDEPINDKLKDFKV
FT                   PTQPPTRFTQPKVINPIENIKKYTKSVKKKGSGKFMTFKPLPESVIQESFEIKQGINPF
FT                   FIGRSDDCNCRIDDNRLSRVHCFILKKRHPIGKSIYESPAQGLDDIWYCHSGSNDSYVN
FT                   DIRMTPGKKYLLQEGDEIKIIKDKQKDFVIGFQVELNDTTGLFNNGLGIPNEERSVTSQ
FT                   TEDELKLVSRLAKIMAAQRSSTKEANETMDQNRNLLKKVHSVSLSQSITDPSRKVKRAK
FT                   LDQTDHNAENMQFF"
     atgatggaga cgcaaccgac ccagcaggca acacaggcta cgcagaagta cttgattgac        60
     aattttactc aggagcagat caagaagaat agcgtgtata gagttatatg cacatcggga       120
     cagattccga tcaaggacat ggaagtggat gtggaacaga tagcaaagaa gaaagaatcg       180
     atcaagaaaa tatggacttt tggtagaaac aacgcttgcg attaccatct aggaaacata       240
     tcacggttgt caaataagca ttttcaaata cttcttggtg aagacggtaa cttattgctt       300
     cgagatatct ctacaaatgg aacttggttg aataatcaga ggatagaaaa ggatagaaat       360
     cacttgctgt cacagggaga tgaaataact gttggtttag gtgtttcctc agatattata       420
     tcactggtga tatttatcaa tgaaaagttt agagattatc tggaagaagt gagacaagag       480
     ttgagtagtc aaggtctgaa ggtaagctcc aaaagcaatg ccaaccctaa cattaatcta       540
     acgggtatat acaaggattt ctccattaat gatgaagtgg tcggcactgg tgcttttgct       600
     actgtcaaaa aggctgtaga gagaaataca ggtaaaactt ttgctgtaaa aatcattaat       660
     aagcggaaag tagttggtaa tatggacggt gtttcaagag aattagaggt tttgcagaaa       720
     ttaaaccacc ctcgtatagt aagtctgaaa gctttttatg aggatgaagc aaactactat       780
     atggtaatgg agtttatttc tggcggtgac ctgatggact tcgttgctgc acatggcgct       840
     gtaggagaag aagctggtag agaaatatcg cgacagatat tggaggctat acagtatata       900
     cattcaaagg ggattagtca tagagactta aagcctgata atatcttgat agaacaggat       960
     gaccctgtgt tggttaaaat aactgatttt ggtttggcta aagtgcaagg caacggatct      1020
     attatgaaga cattctgtgg cacattagca tatgttgctc cagaagtaat tggaggattt      1080
     acaggtgcta caggcgaaga agagacagag gaagaacgta tagagtactc ttccctagtt      1140
     gatatgtggt cgatgggttg tcttgtattt gttatattga ctgggcattt acccttcagc      1200
     ggtagtactc aggaacaact ctatgagcaa ataagaaaag gttcttatca tgaagggcca      1260
     ctgaaagact ttcggatatc tgatgaagca agagatttca ttgatggtct tttacaggtc      1320
     gatcaaagta agaggatgac tgttgacgat gcactgaatc atccatggat taaacaatgc      1380
     tcatctcaat ttgatgctaa ctccatgagt tcacaagttt ccttgtcaca atccatgtcg      1440
     caacaaaaag cacttgaaag tctcgatgat gcgcaatacg agttcttgaa agctcagaag      1500
     aaacttcaac aggatgagcc gatcaatgat aaattaaagg atttcaaagt gccgacgcaa      1560
     ccgccaacac gttttacaca acctaaagta atcaacccta ttgaaaatat aaagaagtac      1620
     acgaaaagtg ttaagaaaaa aggttccggt aagtttatga ctttcaaacc attgccggag      1680
     agtgtaattc aagaaagttt tgagataaag caaggtatca atcctttctt tattggacgg      1740
     tcagatgatt gtaattgcag aatagatgac aacaggctct cgcgagtcca ttgtttcatt      1800
     ttgaaaaaga gacatccgat tggtaaaagt atatatgagt ccccagctca aggtctagat      1860
     gatatatggt attgccattc tggttcaaat gacagttatg tgaacgacat tcgaatgact      1920
     ccaggaaaga aatatctact tcaagaaggt gatgaaatca agattattaa ggataagcag      1980
     aaagacttcg tcattggttt tcaagttgaa ttgaacgata caacgggttt gttcaataac      2040
     gggttaggga ttccaaatga ggagagatct gtgacctcgc agacagaaga tgagctaaag      2100
     ttagtgtcaa gattggccaa gataatggcc gcccagaggt ccagcactaa agaagcaaac      2160
     gaaacaatgg atcaaaatag gaacctgttg aagaaagtgc attcagtttc gctttcacaa      2220
     tcaataaccg acccatctag gaaagttaag agagctaagc ttgaccaaac tgaccataac      2280
     gctgaaaata tgcaattttt ttga                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page