(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE96

CAGLA1_12.PE96       Location/Qualifiers
FT   CDS_pept        270614..271690
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436726"
FT                   /gene_name="RRD2"
FT                   /locus_tag="CAGL0M02255g"
FT                   /product="Serine/threonine-protein phosphatase 2A activator
FT                   2"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62420.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG191557"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI00003B703D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK00"
FT                   /transl_table=1
FT                   /translation="MIPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVS
FT                   EPVSDSVQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHF
FT                   PALTSEQIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVL
FT                   VLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNE
FT                   ELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDISGVKKWSKVAEGMIKMYKAEV
FT                   LGKLPIMQHFYFSEFLVCPEGISEPRTHIHNGDEDDDQCCQDGAAHNTWGDCCGIKIPS
FT                   LYAANAMEKQSHKPIPFD"
     atgataccta gcaaaaggat attgacagat aaggatgtta agatatggga ggagtctgaa        60
     accagagagg atatactaag ttttattgag tctttggcta aggcggtgga aggctttgaa       120
     aacgatcaag ttagtgaacc tgtaagtgac agtgtgcaga gcaccatagc ggtgttaaca       180
     gagatcgata agctaatcaa gttacacccg gtaatacagg ataaaaacac ttccagattt       240
     ggtaaggtcg agtttcggga tttctacgat gatgtatgtg aaaaggctga tgaccttttg       300
     agttctcatt tccccgcgct aacctctgag caaatcgagc aactgtcaat atacttacag       360
     gagtcttggg gaaacaagag aagaatagac tatggatcag gccatgaact caacttcatt       420
     tgtttcctgt acggcctaac tcattataaa atttttgatc ttcagcgtga tgccagaaat       480
     ttagttctag tgttgtttat cgagtatctg aagataatga gggaaatcga gaccttatat       540
     tggctagagc ctgctggctc acatggagtc tggggtttgg atgattatca tttcttgcct       600
     ttcctctttg gggcatttca actcgcacct cataaacact tgaaaccaaa atctattcac       660
     aacgaggagt tggtagagat gtttgcagat aagtatctat attttggctg catagctttt       720
     atcaattccg tcaagacatc aacgtctctt agatggcatt caccaatgct ggacgatata       780
     agtggagtaa aaaagtggtc aaaggttgct gagggtatga taaagatgta caaggcagag       840
     gttctaggga aacttcccat catgcaacat ttctatttta gtgagttcct ggtatgccca       900
     gaaggtatct ccgaaccccg tactcatatc cacaacggtg atgaagatga tgaccagtgc       960
     tgccaggatg gtgcagcaca taatacctgg ggtgattgct gtggtataaa gatacctagt      1020
     ttgtatgctg caaatgctat ggaaaagcag tcacacaagc caataccgtt tgactag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page