(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE98

CAGLA1_12.PE98       Location/Qualifiers
FT   CDS_pept        273725..276406
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500880"
FT                   /locus_tag="CAGL0M02299g"
FT                   /product="Similar to uniprot|Q12152 Saccharomyces
FT                   cerevisiae YPL150w"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62422.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124190"
FT                   /db_xref="HOGENOM:HBG203877"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020658"
FT                   /db_xref="UniParc:UPI00003B703F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ8"
FT                   /transl_table=1
FT                   /translation="MINAIQPPTKAEQNNIKAIIGNSYNRLYSQFSSSELTEVGNYKIQ
FT                   KQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYITKLYEVIVT
FT                   ETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLNCVHRDLKLEN
FT                   VLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVI
FT                   LYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSA
FT                   ILLHPFLQPYGTLILEQTNKIILKQKQGGSQFSSRLERRLIKKMKRIGYDTQAIRQSVI
FT                   KKKCDSLSGLWFLLAEKEKKIDDKNRPRRSRSLLSVRKVFDDSTQDLLTGDDGLLTTSL
FT                   EVTRVGSIGKILNKQAERVTSLAPMGVKKSIDFSTRSLNLTLTNTNQSQDNNTKNQESV
FT                   TFSKEQVRRVQSGTNASTQNEQSPKKTNIFKKMSKFFKEKKYFSNLNNEESASSTNTMR
FT                   RSLETSLGASSHNKESVSPEKGNSINEDENRNEKFDSTDKRKPIKQSEKATMVLLPEDR
FT                   HKLTITEPNVTRLKSSSVTSRQTSTDNDDSESMDNSRSGSAEIKKRNLVPTARPFSGLS
FT                   EISNDTYNSDYSTDGNTSSYRVNDPPLSQIMKTNSGGTSQYSGNSEKLTNGTGRRYIRR
FT                   NQSLISNASSASEKSSRTDSFYDITTASPPAFIDNRSKNNFGLKESILPRFGAHHSWGP
FT                   KRSYASNRVGSLGRRAQKRNYLKNNSSRTTQSIIKEEDSSDNDETDVSYHSYRYNNNKS
FT                   PLNAFRSGGTPEYGEDKLISSSPLQTFGNVEHTPPKSATDSPEAFNGIYAPVVSNRIPS
FT                   KNIVEDEELISAADLEDNFSDD"
     atgataaatg cgatacaacc ccctactaag gcggaacaga ataatattaa agccattatc        60
     ggtaactcat ataacaggct ctatagccaa ttctcatcta gcgaattaac agaggtgggg       120
     aattataaga tacagaaaca gataggagag ggcagttttg gtaaagtata tttagcaaca       180
     catcgaccca cgaaacagaa agttgttctg aagactggtg ataaaagtga ccccaatgtg       240
     gtacgagaag tattttacca tagacagttt gactacccat acattactaa gctgtatgaa       300
     gttatagtga ccgagactaa agtatggatg gctcttgaat attgcccagg aaaagagctt       360
     tacgatcatt tgttatcgaa gagtagacta cctacattgg aatgcgccga actttttgct       420
     caaatcaccg gtgctgtaca ctacgcccat actctaaact gtgttcatag agacttaaaa       480
     ctggaaaatg tcctcctgga taaaaatgga aatgcaaaat tgacggattt tggtttcaca       540
     agagaatcca tgacaaaggc agtgcttgag actgtgtgcg gaactaccgt gtatatggct       600
     ccagaaatga ttcagcataa accttatgat ggttttaaag tggacatttg gtctcttggt       660
     gttatattgt atactttact atgcggctgt ctaccatttg atgaagatga tgacttacta       720
     acaaagcaaa aaattatcaa cgatacccca gtaattgatg aacgaatcac catacccgaa       780
     gcgcaaaatc tcattgaaca attactttca aaggatccca cagagagacc aaatacaagt       840
     gccatattac tacacccatt cttacaacct tatggaacct tgattctgga gcagaccaac       900
     aagattatcc tgaaacaaaa acaaggtggg tctcaattca gctcgcgatt agaaagaaga       960
     ctaataaaaa aaatgaagag aataggttat gatactcaag caattagaca atctgttatc      1020
     aaaaagaaat gtgactcttt gtcaggcttg tggtttttat tagcggaaaa agagaagaaa      1080
     attgatgata agaaccgacc aagaagaagc cgttcattgc tttcagtccg aaaggtgttt      1140
     gatgactcca cacaagacct attgactggt gatgacggac ttttaactac ttctcttgag      1200
     gttacaagag ttggttcgat aggtaagata ttaaacaagc aagctgaaag agtgacatcg      1260
     ttagcaccta tgggagtgaa aaagtccatc gatttttcaa caaggtcact gaatcttact      1320
     ttaactaaca cgaaccaaag ccaagataat aatacaaaaa accaagagtc tgtcacattt      1380
     tcaaaagaac aagtaagaag ggtacaaagt ggtaccaatg caagtacaca aaacgagcaa      1440
     tcaccaaaga agacaaatat attcaagaag atgtccaaat tttttaaaga gaagaaatat      1500
     tttagcaact taaacaatga agagagtgca agtagtacaa atactatgag aagaagctta      1560
     gagacatctc taggtgcttc ttcgcacaat aaagaaagcg tttcacctga aaagggtaat      1620
     tccattaacg aagatgaaaa tcgaaatgag aagtttgatt caactgacaa aagaaaacca      1680
     atcaaacaat cagaaaaggc aactatggtc cttttaccag aagacagaca caaacttacc      1740
     ataactgagc caaatgtgac gaggctgaaa tcctccagtg taacatctcg acaaacctcc      1800
     actgacaacg atgacagcga atcaatggat aactctagat caggatctgc tgaaataaaa      1860
     aagcgaaact tagtgccgac ggcacgtcca ttttctgggt tatcagaaat ttctaatgat      1920
     acttacaact ctgattattc aactgatggt aacacatcct cttacagagt taatgaccca      1980
     cctctatcac agataatgaa aactaattct ggaggtactt ctcaatattc cggaaattct      2040
     gaaaaactca caaatggaac tggaagaaga tatattagaa gaaaccaaag cttgatatcc      2100
     aatgcttcaa gtgcctcaga aaaaagctcc agaaccgatt cattttatga tatcactaca      2160
     gcatcaccac cagcatttat tgataaccga tctaagaata attttggctt aaaagagtca      2220
     attttaccta gatttggagc acatcattcc tgggggccaa aaagatccta tgcaagcaac      2280
     agagttggct ctttaggaag aagagcgcaa aagaggaact atctaaaaaa taactccagt      2340
     agaactaccc aatccataat caaggaggaa gattcttcag acaacgacga aactgatgtc      2400
     tcctaccata gctacaggta taataataac aaatcacccc tcaatgcttt ccgttcgggt      2460
     ggtactccag aatacggtga ggataagtta atctcatcct ctccattaca gacatttggt      2520
     aatgtcgaac atacaccccc aaagtccgca actgattcac ctgaggcatt taatggtatt      2580
     tatgcacctg ttgtttcaaa tcgcatccca tccaaaaata tagtcgaaga tgaagaatta      2640
     attagtgcgg ctgacttgga agataacttt tcagatgact aa                         2682
//

If you have problems or comments...

PBIL Back to PBIL home page