(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_2

ID   CAGLA1_2; SV 2; linear; genomic DNA; GRV; FUN; 491328 BP.
XX
AC   CR380947_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 21)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome A, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380947.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..491328
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome A"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        complement(18037..18876)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197366"
FT                   /locus_tag="CAGL0A00165g"
FT                   /product="Similarities with KLLA0E10593g Kluyveromyces
FT                   lactis"
FT                   /protein_id="CAG57670.1"
FT                   /db_xref="HOGENOM:HBG124231"
FT                   /db_xref="UniParc:UPI00003B5E42"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW0"
FT                   /transl_table=1
FT                   /translation="MYELNNEEVLRKRKERFSKFGKEAIINDPLRDVALLSRSGESNTI
FT                   IDLKINHDKRSEMVSMLKLLFYDEKQLTTVEHGLRKLREVFMSIRQDHRDEDESFWKQA
FT                   SEVYKLSYDFLLRHGQYNKLGGLVLNAIHEWFPLQYRKPYAKIYALYLSHIEKDVPKCV
FT                   DFLQYSSVSQSESLDIINMANIYVLKSESPRIWFHYCKNLKDDELNFLELSSVMQVMIN
FT                   RTDNLLQLCYNQLSVKVAQQLWFGDHFTSNLETRIKDKYDMRAGTDIILFKKRQIKG"
FT   CDS_pept        complement(19487..21757)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046220"
FT                   /locus_tag="CAGL0A00187g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG57671.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124233"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI00003B5E43"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV9"
FT                   /transl_table=1
FT                   /translation="MSVLEREHGNGSSGSTENPAPTGEKPDGDGPSDGHGSGRGKQQGF
FT                   TSNGINKDQTRSEGKSVAFEVGDERETSQDTILGDGGMTQNGDTSGEFTDRDDTSQNRM
FT                   NGSLQSEGLVFEKRKVIPQRRTQSQQSMLSSISLRSMIQEQQHVNNQQQQQQQSMHRNS
FT                   MGSNNTNNDQNLISHSLLNMSQQIRSPAMFSIKRTGSLMHSASRTASNFGKQETIYDSN
FT                   SLDSNEIGKKLPFTNDERIQIGSKKESPTVPRIRNEIVDNATPTALRELPEVISDLKPE
FT                   DEDEISQKDLTTQALRKLSNFKGSNLNEAFSEHTTSTGTPTTNVSENEKGKIMRESSNF
FT                   LVADKSSPSPMKASSEAPKKTVKLNDQSSTDTDLSRTSSSNILNFTTNSHSMMNMKFGD
FT                   RNITVENNPEMTTNTHAQNFIADAKQPQVRTITKMHSLDMLQKPVRYRSNSNNPTLQKQ
FT                   GVNRRHAKQINDPKKPLYMPVVLRNVVETNITNDDLQEISPRLSGRTTPAANKKSPGYR
FT                   TDINYAGSQKSGTSNTSSVVETYKRYISSFLFPNRQQQVTDDAISSILHKRNITPSTIG
FT                   SYSSSIVSATSRSPQLPTRTHWIPDSKRSACHQCHKLFTFFDRKHHCRHCGDIYCQKHL
FT                   RHWLYLDSDAKFVVGGGGVGTLSKVCDACHIEYEDLARTSLTPSVVVPNKKYGPFSNGI
FT                   VTKSNLNVEMSLDSALSSGEHSKAKPIEVAGSESEDKQNKKDEPTVNSVVGSIPADWNW
FT                   SSF"
FT   CDS_pept        22260..24440
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444382"
FT                   /locus_tag="CAGL0A00209g"
FT                   /product="Similar to uniprot|P39007 Saccharomyces
FT                   cerevisiae YGL022w STT3"
FT                   /function="oligosaccharyl transferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57672.1"
FT                   /db_xref="GO:0004576"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG269471"
FT                   /db_xref="HOGENOM:HBG314442"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniParc:UPI00003B5E44"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV8"
FT                   /transl_table=1
FT                   /translation="MSSAVSDRQTVQWVLVVLKALVFMAIFGAAISSRLFAVINFESII
FT                   HEYDPWFNFRATKYLVSHSFHEFLNWFDDRTWYPLGRVTGGTLYPGLMTTSAFVWHMLR
FT                   KIGLPVDIRNICVLFAPAFAGITAIATYQFTKELKDSSAGLLAAVFMAIVPGYISRSVA
FT                   GSYDNEAISITLLMITFMFWIKAQKTGSIMHATFAALFYFYMVSAWGGYVFITNLIPLH
FT                   VFILILMGRYNSRLYTAYSTWYAIGTLASMQIPFVGFLPIRSNDHMAALGVFGFIQIVA
FT                   FGDFVKARVPAQKFKVISLVSLLVLMAVGILGLFGLTYFGLIAPWTGRFYSLWDTGYAK
FT                   VHIPIIASVSEHQPVAWPSFFFDQHFLIWLFPAGVFLLFMDLKDEHVFVICYSVLCSYF
FT                   TGVMIRLMLTLTPIVCVSAAIALSKIFDIYLDFSKRDADGKAVPSLDKPASILAKLVIS
FT                   GSFIFYLYLYVLHCTWVTKTAYSSPSVVLQTRDQVGNNIIIDDFREAYYWLRMNTAEDA
FT                   KIASWWDYGYQIGGLADRTTLVDNNTWNNTHIAIVGKAMAAPEEVSYKLLKEHDVDYVL
FT                   VIFGGVLGFGGDDINKFLWMIRISSGIWPDEIQEKNYFSDSGEYRVDAMASRAMRQSVM
FT                   YKMCYQGFADLFPNGQAVDRVRNQQIDNSHVEPLDYFDEVFTSENWLVRVYKLKDEDPE
FT                   GRELGDVGLINRHPATFRKNSLKKPELNMRIL"
FT   CDS_pept        25241..27622
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033904" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444383"
FT                   /locus_tag="CAGL0A00231g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57673.1"
FT                   /db_xref="HOGENOM:HBG124244"
FT                   /db_xref="UniParc:UPI00003B5E45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV7"
FT                   /transl_table=1
FT                   /translation="MDTSFEEYVNGNRNVLALVVSDNEDDYDSSMDSVSISTELNGSST
FT                   NLDRQDTIQDQSSPVPKQELVVPRQRANEKGEKGTKSGGSKRWSFISNHSSSSKKRWST
FT                   LSSIPSESASRVLSGTKDPIKRLSSASNFSVDSMGFDAVSRRQTSSDKNSVPSLKRSST
FT                   GLSLRQLFNKIVVAEDDTLSQGGDKENTGNKKETASLRNSASSRYPLRTLTNENASGLY
FT                   QAQSRTTYSNTARHSVHFNPTGPETSNTSRLSKSSSITSLSSKLKFWKRAPGVPKSESK
FT                   RNLNISEPLELGNSDSNIRTKTSYSDLHKSIYSSYHYSKTFLSEPLESGMPMRELQQKK
FT                   SRTSILNKKKSGSSLSVNTGLKHFSSTSSLSLGGLKNKSSHSSINMNVSMKHKSSHSSL
FT                   HKLAKHRRKSNNGDDRSSISSTTASTISANYQISLPVPDQVSREKIRNKLKNSTSLLSL
FT                   NSSIPVFKKEFDESLLQELLDYCNCKYVIKRLNSLDDDDVPIFHTFNNANQISKNIWRI
FT                   SGPFNWTKEKSIIFRRIELGSVDDITYSKKAIALHELKAHNYTSQMAGITKVLRSYVVT
FT                   SDIASPGDNIDTDDLKNLYLIMVMKDHGSSLAKLTPINDWKTSVNIFWNTVSILAGLEQ
FT                   RLQFEHRNLLLDHILVDERNGSITISNLNSSRFQQDDMNTIAFTRLDDPLFFQRNARDD
FT                   QYEVYSTMRMFLSENFNNQANGCPVWARFEPRTNLLWAHNLCKRLIQETTDSKHQSERD
FT                   HLTRICSAIDPVMLSRRSMLKRNDGDIKSLMDILKWKKTF"
FT   CDS_pept        complement(27915..28586)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444384"
FT                   /gene_name="GET1"
FT                   /locus_tag="CAGL0A00253g"
FT                   /product="Golgi to ER traffic protein 1 "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57674.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG124248"
FT                   /db_xref="HOGENOM:HBG204323"
FT                   /db_xref="InterPro:IPR007514"
FT                   /db_xref="UniParc:UPI00003B5E46"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXV6"
FT                   /transl_table=1
FT                   /translation="MSWVVAIAVVFVVVLKVLEYSTSYHDLVLQSLFFKNSPISVKFET
FT                   LVKERRSIQEENKSISAQDNYAKWTKNNRKLDKLDKEITELGAQLKAHNEQIKGHLKKV
FT                   KLLLLTVPFLCFKLWKGKHIVYNLPHHQMFPQLVAGVWSQGWLYLAILPLQLAKSIVTG
FT                   SSFAIETASFPHMGVSLGIWLWALNSVISNIEFMTMQLWAKPVSKPSKKLEIVTDEIKV
FT                   D"
FT   mat_peptide     complement(27918..28517)
FT                   /gene_name="GET1"
FT                   /locus_tag="CAGL0A00253g"
FT                   /product="Golgi to ER traffic protein 1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXV6 "
FT   sig_peptide     complement(28518..28586)
FT                   /gene_name="GET1"
FT                   /locus_tag="CAGL0A00253g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXV6 "
FT   CDS_pept        29069..29869
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046221"
FT                   /locus_tag="CAGL0A00275g"
FT                   /product="Similar to uniprot|P43639 Saccharomyces
FT                   cerevisiae YGL019w CKB1"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="CAG57675.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG211728"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI00003B5E47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV5"
FT                   /transl_table=1
FT                   /translation="MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDF
FT                   NMTSLAQEVPHYRKALDLILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRN
FT                   IIGHAAEQLYGLIHARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIG
FT                   KQAVRLYCPSCQDLYLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYEL
FT                   KVFGFRINDQAVSGPRMKWLRQYPVTEEDWEEFNKCEFEMPIVE"
FT   CDS_pept        complement(30179..30775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046222"
FT                   /locus_tag="CAGL0A00297g"
FT                   /product="Similar to uniprot|P53193 Saccharomyces
FT                   cerevisiae YGL018c JAC1 molecular chaperone "
FT                   /function="chaperone binding"
FT                   /function="heat shock protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG57676.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG277816"
FT                   /db_xref="HOGENOM:HBG396151"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="UniParc:UPI00003B5E48"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV4"
FT                   /transl_table=1
FT                   /translation="MLRCARLPTSGIRQVLQRRWIVSYYELFPGTFPDSQPRWDVDLGK
FT                   LRKEYRKLQAEVHPDKIQKEQEADSEQSSLLNKAYHALKDPLTRSQHMIQILKDVDLTV
FT                   DSVAREYTQMDPELLMDVMDVHEQLLDANSRDEVREIEKVNKQRIEKIEAELKECYDNK
FT                   EYERAINLTARLKYWKNVASAVKDWAPGKPIDLKH"
FT   CDS_pept        30978..32507
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444385"
FT                   /locus_tag="CAGL0A00319g"
FT                   /product="Arginyl-tRNA--protein transferase 1 "
FT                   /EC_number="2.3.2.8"
FT                   /function="acyltransferase activity"
FT                   /function="arginyltransferase activity"
FT                   /biological_process="protein arginylation"
FT                   /protein_id="CAG57677.1"
FT                   /db_xref="GO:0004057"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016598"
FT                   /db_xref="HOGENOM:HBG059975"
FT                   /db_xref="HOGENOM:HBG396111"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017137"
FT                   /db_xref="UniParc:UPI00003B5E49"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV3"
FT                   /transl_table=1
FT                   /translation="MENKLIIHRPLYFSDKSDCGYCHGKKAKGSDFYSLESWYERIKEN
FT                   ADSEVEELPVRSCTVGFQCENMTVAMYDQMCNMGFRRSGLFVYKMDALRSCCRLYTIRT
FT                   RPDWFKLTKDMRKCINRFRKHVLGEPVANAKTQGYVEDIVDIEGQSDSINFYTRFGPAV
FT                   YTDEKYELFSIYQERVHQDFDHSKKGFKRFLCDAPFTQGVIMGTEEEWEQLNNWKSMKP
FT                   GERLLRTGPVHESYYYKGKLIALAVTDFLPSGISSVYFIWHPDYHKWSLGKLSALRELS
FT                   LVSKTNLKYYYLGYYIDDCKKMNYKANYGGELLDSCTERYFKLSQVKDMIRGGKLFMVG
FT                   TQGHDISREVALSDAIRDCIYQTDAFDIASDDNVAEKVYGTSSNIYRPQYLKEVISFLK
FT                   TSGLEYDFPIYNDGVFNQYAKRIAKDGEDPDFTIPSICPGLIPLWELKDLLMSGKLQKE
FT                   LTGRTLVFDTSFGFIRKLEPWEDEDSTTKTAICDVVRLLGLEMASNSIVVV"
FT   CDS_pept        33056..33625
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000263779" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444386"
FT                   /locus_tag="CAGL0A00341g"
FT                   /product="Similar to uniprot|P25338 Saccharomyces
FT                   cerevisiae YGL010w"
FT                   /protein_id="CAG57678.1"
FT                   /db_xref="HOGENOM:HBG097682"
FT                   /db_xref="HOGENOM:HBG688529"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniParc:UPI00003B5E4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV2"
FT                   /transl_table=1
FT                   /translation="MVTSAAATVTGTNTEVGGLRKELGFYKFYHHNTVNVLIHSVCVPT
FT                   ILFTTICILHRVSLPFQIMGVYLTLGHLLALRFATTYCRLHIPVGICATAILVCTLYAL
FT                   DAGLVGLTLKQESEIFVAAWIMQFIGHGVFEKKKPALLDSLEQSLVLAPYFILFEFLFL
FT                   LGFFPKLRAELESDVTKLKLQEKRQS"
FT   CDS_pept        complement(33995..36349)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350582"
FT                   /locus_tag="CAGL0A00363g"
FT                   /product="3-isopropylmalate dehydratase "
FT                   /EC_number="4.2.1.33"
FT                   /function="3-isopropylmalate dehydratase activity "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /biological_process="leucine biosynthetic process "
FT                   /cellular_component="3-isopropylmalate dehydratase complex "
FT                   /protein_id="CAG57679.1"
FT                   /db_xref="GO:0003861"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="GO:0009316"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG051944"
FT                   /db_xref="HOGENOM:HBG330745"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015936"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00003B5E4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXV1"
FT                   /transl_table=1
FT                   /translation="MVTTETKGPRTLYDKVFDAHVVHKDENGSYLLYIDRHLVHEVTSP
FT                   QAFEGLTNANRPVRRVDCTLATVDHNIPTESRKSFKNLDSFITQTDSRLQVKTLEQNVK
FT                   QFGVPYFGLTEKRQGIVHTIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTSEVE
FT                   HVLATQTIIQSKSKNMRIRVDGKLSPGITSKDLILHIIGVIGTAGGTGSVIEFAGEAIE
FT                   NLSMEARMSMCNMSIEAGARAGMIKPDNVTFEYFKGRPLAPTGAEWDKAVAYWKTLHSD
FT                   EGAKFDHEIVIKGSEIIPTITWGTSPQDALPISASVPDPANVDDPIKKSGMERALEYMG
FT                   LKPNTPLKSIYVDKVFIGSCTNGRIEDLRNAAKVLNGHKIAPNIKRAMVVPGSGLVKVQ
FT                   AEEEGLDKVFIAAGFEWREAGCSMCLGMNPDILDKYERCASTSNRNFEGRQGALSRTHL
FT                   MSPAMAAATAVAGHFVDIREFKYNNADDAKVTISSDEDEELEEAAYEHTEPQQPGDAPT
FT                   DVENDQLKDIPVESETKRLKTDDTKPVAGGMDPFVVLNGLAAPLEKANVDTDAIIPKQF
FT                   LKTIKRTGLRSGLFYEWRFVKDDSGKDKETDFVLNVNPWRKAEVLVVTGDNFGCGSSRE
FT                   HAPWALKDFGIKSIIAPSFGDIFYNNSFKNGLLPIRIDQDTIVNKLVPVAKAGKNLVIN
FT                   LPDQTISDSDGNVLVEHFEVEAFRKHCLVNGLDDIGITLQKEQYIDQYEKIRREKYSFY
FT                   EGGSKLLHFPAKQFPKKRTPLTTYDTVHQDW"
FT   CDS_pept        complement(37162..40371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502804"
FT                   /gene_name="kap122"
FT                   /locus_tag="CAGL0A00385g"
FT                   /product="Putative karyopherin beta "
FT                   /function="binding"
FT                   /protein_id="CAG57680.1"
FT                   /db_xref="EMBL:CAD89601.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059976"
FT                   /db_xref="HOGENOM:HBG204324"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000190784"
FT                   /db_xref="UniProtKB/TrEMBL:Q6KEZ7"
FT                   /transl_table=1
FT                   /translation="MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSA
FT                   LLSGPYSTNVKYFGALTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSA
FT                   LSSYSIVIKKLMSNLSILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKS
FT                   HWYGTNNNSESDKIILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQ
FT                   KHAMNSIHGVVHEHLYISTMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQ
FT                   GRMDLSELLESLLKVMLQSNENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFL
FT                   GVSHGDTNADKSQYQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTI
FT                   QTQDQAASDNTQEYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKP
FT                   NSQQLSIEIFQQVINIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLV
FT                   LGNENLTNVLIAGVGSTEIASETELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKF
FT                   LVANVQTLLRTGLDNSGPLSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKC
FT                   AFSTGGANAFTKVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTRR
FT                   SLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDC
FT                   ISELGNGLVYPQEMDDPKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSS
FT                   LIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFS
FT                   CYKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWS
FT                   SFILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVM
FT                   AGLYHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLVDKPQAHEKFINKLFITRG
FT                   SRAAGNVILTWWLECSGLPGY"
FT   CDS_pept        41556..42320
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350583"
FT                   /locus_tag="CAGL0A00407g"
FT                   /product="Similar to uniprot|P21243 Saccharomyces
FT                   cerevisiae YGL011c SCL1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAG57681.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00003B5E4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU9"
FT                   /transl_table=1
FT                   /translation="MSGGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNLNSLA
FT                   VRGKNCSVIINQKKVPDKLLDPSTVSYIFKISKTIGMVANGPIPDARNAAARAKGEAAE
FT                   FRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFISVDEELGPSIYKCDPAGY
FT                   YVGYKATATGPKQQELTTSLENYYKKKNVGSHLDMEEWEKVVEFGITQMIDSLGTEFSK
FT                   KDLEIGVATENKFIILTPDEIEERLVAIAEQD"
FT   CDS_pept        complement(42636..44030)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444387"
FT                   /gene_name="ERG4"
FT                   /locus_tag="CAGL0A00429g"
FT                   /product="C24 sterol reductase"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57682.1"
FT                   /db_xref="EMBL:AAY42961.1"
FT                   /db_xref="EMBL:AAY42962.1"
FT                   /db_xref="EMBL:ACA58063.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051733"
FT                   /db_xref="HOGENOM:HBG592488"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniParc:UPI00003B5E4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU8"
FT                   /transl_table=1
FT                   /translation="MSGSKEEKKTQSTGFLPQGKYLKPEEIEYEFGGTAGVLGMLIGFP
FT                   LLMYYMWICAEFYGGRIALPAQNETWAQFIGKLYHIFCDNAIPEKYDLVIFFTFWAFQI
FT                   FFYYTLPGVWTKGQPLTHLKNKQLPYYCNAMWTLYTSTALVVLLHVTGVFKLYTIIDRF
FT                   GRIMTCAIASGFAFSIGLYIWTLFVTHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFF
FT                   EVRLPWFTLYFITLGACFKQYETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMA
FT                   YEKFGFMLIFWNIAGVPYTYCHCTLYLYYHNPSEYNWSWQYNLSLYVVLLTAYYFFDTT
FT                   NGQKNSFRKQMSGDKTVRKTFPFLPYQVLKDPKYMVTSNGSYLLIDGWYRYARKIHYTA
FT                   DWTQSLIWAMSCGFNSFFPWFFPIFFFVVLIHRALRDQAKCEKKYGKDWVEYCKHCPYL
FT                   FIPYVF"
FT   CDS_pept        47557..50880
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046223"
FT                   /gene_name="PDR1"
FT                   /locus_tag="CAGL0A00451g"
FT                   /product="Pdr1p"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57683.1"
FT                   /db_xref="EMBL:ACM07362.1"
FT                   /db_xref="EMBL:ACM07411.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG204327"
FT                   /db_xref="HOGENOM:HBG429917"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B5E4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU7"
FT                   /transl_table=1
FT                   /translation="MQTLETTSKSNPGEVKAQKPSTRRTKVGKACDSCRRRKIKCNGLK
FT                   PCPSCTIYGCECTYTDAKSTKNLKSNDAGKSKPTGRVSKNKETTRVDKDIRKLEQQYVP
FT                   INANIHVGPRFPSENILNGYPQCGAPQNNVVGNPLAVNTQCHRGLSETPMSSTFKESNL
FT                   RDDRLLQSSDTDDMRNGDSEERDLKGSDSENVKSKDNKSDPLIIYKDDTHIESTVNKLT
FT                   QAVNELKSLQNAPSSIKSSIDAIELQLRNILDNWKPEVDFEKAKINESATTKSLETNLL
FT                   RNKYTNHVHLTRFRIWIDYKNANKNNHFMGECGFSLAESFFASNQPLVDELFGLYSQVE
FT                   AFSLQGLGYCVHLYEPYMKTEEAIKLMKETLYIILRFIDICVHHINEESISIANPLETY
FT                   LRKKHLMPMTPTPRSSYGSPQSASTKSLVSKIIERIPQPFIESVTNVSSLQLLDLRDDE
FT                   SKMFGTLLNMCKSIRRKFDSVMSDYDSIVTEKSEGEQNDGKVTVAEFTSLCEAEEMLLA
FT                   LCYNYYNLTLYSFFEFGTNIEYMEHLLLLLEEQLALDEYYGFEKVLNVAVANAKKMGFH
FT                   RWEFYVGYEESTAEKRRLLWWKLYNYEKASTMKKGFFSVIDDATVNCLLPKIFRNFGYL
FT                   DRVEFLENIQKPMDLSVFSDVPISVLCKYGELALTIVTSEFHEKFLYADRYTSIRNSAK
FT                   PPTLKNQLIKEIVDGIAYTETSYEAIRKQTAKLWDIALGKVTKDKINKEDTAAASKFTL
FT                   SYEYHRFRLINMADNLIARLMVKPKSDWLISVMKGHLNRLYEHWKVMNEIILSMDNDYS
FT                   IATTFEYYAPSCLCLATQTFLIVRNMEMDDVKMMVAVYKRFLNLGMFLQSAKVCSLADS
FT                   HTFRDFSRSFSFITIISRLMIIEFMQIKELTKVEFIEKFSEVCPDLADLPPMLLDPNSC
FT                   LYFSLLQQIKKSGFTLSFKKILEDARMMDFNYDRNLDSEAIKKCNGEFSKSMPSCTNVS
FT                   DTTTAVSDNSAKKKASMGSARVNSTDTLTASPLSGLRNQTQLDSKDSVPSLEAYTPIDS
FT                   VSDVPTGEINVPFPPVYNQNGLDQQTTYNLGTLDEFVNKGDLNELYNSLWGDLFSDVYL
FT                   "
FT   CDS_pept        complement(51137..53497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046224"
FT                   /locus_tag="CAGL0A00473g"
FT                   /product="Similar to uniprot|P25339 Saccharomyces
FT                   cerevisiae YGL014w"
FT                   /function="RNA binding"
FT                   /protein_id="CAG57684.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG059840"
FT                   /db_xref="HOGENOM:HBG204326"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B5E4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU6"
FT                   /transl_table=1
FT                   /translation="MTDKTQNQEKIDDKVVAETVNSALEQLHMDDVESPEPPATGDQPT
FT                   QHAPTAMQSTSPSHMFPPPQMYGFMPYSQMMHMPHPQGFFHPPEFQENMPNPSGNGRIP
FT                   TVFNNSNDASMFPPLGASFPPLGVVPDGENSTGINDPFVPSNDQLWNSSNLQASAAIDV
FT                   AGNTGAVPEDNGSKLTEKDAAPTAGAFRRQTFHAISTSTISDSAISDGIPTSVNDLPEK
FT                   NFETAKNRTQSISFDKADSTLSEGKDTKDTEKGTNATADIQNVPVNYTAAYPYGGPPFQ
FT                   GSPVPGVGPHQIPHSGYGVRSPFPGAFGDFGAPFQSFSPTLGGPAPPMHPHSPIPMTHS
FT                   PIQIGPMPEFMKGMRPESGEGKKDENVAMIPQGFPVMQHQQNGTPPPWMYGNPAFNGMM
FT                   PHSAGMNQGPQSQYPRSKDGMHDKHDKGHYNNRHRGRRNNNYYNHEDRQRKMDNSQYAD
FT                   ATLDQFIGNIYSLCKDQHGCRFLQKQLDVLGKKASDAIFEETKEYTVELMTDSFGNYLI
FT                   QKLLERVTDDQRVELAKIAAPKMVEISKDPHGTRALQKLIECISTKEEAEIVVKSLQPD
FT                   TVILSKDLNGNHVIQKCLQKLNPEDSQFIFDAAGNECGEIATHRHGCCVLQRCLDHGTK
FT                   TQFKDLCEKLLKYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKIVNQLKPRFTELSV
FT                   HKFGSNVVEKVLRTPVVSETIINELINEGSAEVQALLNDSFGNYVLQTALDISRDTNPY
FT                   MYKKLVDLVTPLLVGNIRNTPHGKRIMGILNIE"
FT   CDS_pept        complement(55014..57722)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046225"
FT                   /locus_tag="CAGL0A00495g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57685.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="HOGENOM:HBG706356"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B5E50"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU5"
FT                   /transl_table=1
FT                   /translation="MSDVESNNEKPPQDVYEDEEMSEDDDIDALIEELQSHHGMGDDDD
FT                   SEDEGHHTGSARVVPEEYLQTDPSYGLTSDEVAHRRKKYGLNQMADERESMIVKFVMFF
FT                   VGPIQFVMEAAAILAAGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANV
FT                   AVVIRDGQLVEVPANEVVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVD
FT                   KGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQGHFTEVLNGIGILL
FT                   LVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK
FT                   QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRK
FT                   KKGLDAIDKAFLKSLINYPKAKDALTKYKVIEFHPFDPVSKKVTAVVESPEGERIVCVK
FT                   GAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCM
FT                   DPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDM
FT                   PGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV
FT                   EGASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLELFLGLWI
FT                   IILNHSLDIELIVFIAIFADVATLAIAYDNAPFSQTPVKWNLPRLWGMSIILGIVLAIG
FT                   TWICLTTMFLPRGGIIQNFGSIDGVLFLQISLTENWLIFVTRAVGPFWSSIPSWQLAGA
FT                   VFAVDIIATMFTLFGWFSQNWTDIVTVVKIYIWSIGVFCVLGGFYYIMSESVVFDRLMN
FT                   GKPLKEEKSTRSVEDFLAAMQRVSTQHEKEN"
FT   CDS_pept        58830..62198
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197367"
FT                   /locus_tag="CAGL0A00517g"
FT                   /product="Similar to uniprot|P38929 Saccharomyces
FT                   cerevisiae YGL006w PMC1"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57686.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B5E51"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU4"
FT                   /transl_table=1
FT                   /translation="MPHNMNFHSPKSVGAFVEQVGGSAEALARRLSTDLANGIATDKDA
FT                   ELPPLKRRDAYGSNRLPERAPKSFWALVREAFQDRTMLLLTGAAVVSFTLGIYEVLTQP
FT                   PELDPEGNPITQVDWIEGLAIMMAVLVVVLVSAANDYQKELQFQQLNRKREDRQVVVVR
FT                   DAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLPLADA
FT                   LEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHG
FT                   KTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHDL
FT                   PPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETM
FT                   GSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYD
FT                   NIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENLLAHAAEGRQ
FT                   EPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIV
FT                   VKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAK
FT                   DALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHLEGLTLDAIVGIQDP
FT                   LRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLNDSACAMEGPAFRK
FT                   LSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVGFS
FT                   MGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAVLLTFV
FT                   TSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLITPSTW
FT                   KMIIGQAILQLSVTFTLYSHGAQYFFGKPKEDLPGHEHQQINAMIFNTFVWLQWFTLLV
FT                   SRKLDEADGIKDWRKRLTASNLNFFQDLFRNYYFIFIMSLIAVLQVLIMFFGGAPFSIA
FT                   HQTKKMWLVSVSSGILAIPVGALIRICPDEWAQAVFPARLAKAIKYFAGLEFLRNTESE
FT                   SRSDSEEEERLLTPA"
FT   CDS_pept        complement(62416..63225)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197368"
FT                   /locus_tag="CAGL0A00539g"
FT                   /product="Similar to uniprot|P53195 Saccharomyces
FT                   cerevisiae YGL005c"
FT                   /protein_id="CAG57687.1"
FT                   /db_xref="HOGENOM:HBG059336"
FT                   /db_xref="HOGENOM:HBG204330"
FT                   /db_xref="UniParc:UPI00003B5E52"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU3"
FT                   /transl_table=1
FT                   /translation="MSGTTDMASQDEDAVLKMFFDEQFVPQAFVDILLSKANGTGLNEV
FT                   RVVTSGLQSRLDYYTEHLTKELEGTISSLEKISDTLPGTWNTSDSYGADGNIGSSKLEY
FT                   YLDTLANAVRSLESDIKTLNSQIDTAETESEEQTQKAAVLGRLRDFEKAKSRLNEVLLY
FT                   FNQLEAIATITGKKSEQKIAPITIKDFKLSLDTLQETIVNTLDESEKKESANEKNEDIL
FT                   EKIDMFIELETVLKDIDPFYQEYHKFIESITKRANEYINTKNIENDL"
FT   CDS_pept        complement(63710..64948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142386" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197369"
FT                   /locus_tag="CAGL0A00561g"
FT                   /product="Similar to uniprot|P53196 Saccharomyces
FT                   cerevisiae YGL004c"
FT                   /protein_id="CAG57688.1"
FT                   /db_xref="HOGENOM:HBG059337"
FT                   /db_xref="HOGENOM:HBG204331"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B5E53"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU2"
FT                   /transl_table=1
FT                   /translation="MANVPIAHIQSDFETDYENGGEFYINVDVSPNSVIEYRVHIDAGS
FT                   ATEVSRVDNGLRTICNDSSFTRQSNGSYKFEVNGKIYWFKTPKRLVSTEELGISESLDL
FT                   ISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM
FT                   QLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKFC
FT                   RKENTTDGVTSMSLLVGEESTSMSAQVTDRETGDRLEFGTEGKQVFAGHLSGTITVHDL
FT                   FNKQQILQIPSSFVAPCNTIAQISEHAIVSGYEDGTVATWDIRKPQQYLQKLDFAGNAI
FT                   NKILNWKDKLFLSSGLDNTFEIASDSGNGKIDITSATHLATEEVNNFVIVPSAPSSRLL
FT                   AVGKWGLCGIYDI"
FT   CDS_pept        65286..67226
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142388" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350584"
FT                   /locus_tag="CAGL0A00583g"
FT                   /product="Similar to uniprot|Q06149 Saccharomyces
FT                   cerevisiae YLR266c"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57689.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124224"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B5E54"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY4"
FT                   /transl_table=1
FT                   /translation="MTTKGRSKIIRRRVIKSCQYCYAHKLKCNRESPCLTCQQQGTQDQ
FT                   CVYNFQDNDTLTHRKSLEQFKVLKEPRYTLRSSTQYKLFKPKTFYPFFSSSLTDKLVFS
FT                   SIYDDVALTPNFTRNPITRLNKLDKQNLPDSIDDVISILPKSLEEALSQLDIFQSSIHA
FT                   IIPVLSISESRQAITNFYEDLSSSQINTTDALVLLGILFCSSYSAIASGIVIDTDICTN
FT                   YYNGYRFLLHHSDFPRYPTIEALQVFTVVNFVIDPNMLDMTGHSAMLIRVAQQLGLHKN
FT                   DQYRGDKTNQRLNFLWNYLLYIDGSTSVVHGFPFSTRTWLYQQTDIDLKYRDPDLAIPV
FT                   EFSLGRFCINKVFRSVMDMSIDEETIGDRLRLQKEISELCSVLIRLSKDLESRLGRIKA
FT                   QYFNSTLFIFLFRLHSRFILLTSGQLPQDKILESQNTDNKKVEYSINNITWILDKPQKF
FT                   DVKVTTLSLLILIQTLRRITQDSIDKYLWYTKGSTVMQYLFVLLKDLYQHPSSDLHIED
FT                   VFPEYGTVVGEEILNSYSNNPNVFKIVLLDILIGVLELKLAPLWSNSDLFQFTLVKSLK
FT                   EAVEVKFSDFIDANDAKIHLLKESVDLFRLAEKCLVNKSSICLEDCLRIWENDDEFLQY
FT                   TKSFAEWLTEL"
FT   CDS_pept        complement(67281..69203)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444388"
FT                   /locus_tag="CAGL0A00605g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57690.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B5E55"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY3"
FT                   /transl_table=1
FT                   /translation="MSENSNSLRNPFVSNTPQASPYKKQQLEYHRRGSVEDVTRRPTSS
FT                   SSSLSSPGKHSRRPRSSLQRYADRYLPTRTDLDLRTIRSIGSSNATKNNTPVVPTSPTS
FT                   PNSSCADHLEVRRERESMEKFDTILKNELFGDYLAKDRDLSPERDSIYNSSTSRFTSPR
FT                   KSLQASSIDQIRNTVNFSANSSPLKSASSIQFYRENQSDSDSDIGTDTDSDGANSSGLN
FT                   NPYTSPSRRRHSNLFFNNIGTSVSLPVTPKKLTFSAGASTEEVGSTKRGASLLKYMTQS
FT                   STRPSTASVLHSHFESLDVSPIRRDSKKLLLSPVKQFKNISKVPYRVLDAPSLADDFYY
FT                   SLVDWSSTDILAVALGKSVFLSEHQTGEVIHLCDTPNEYTSLSWMGAGSHLAIGQGNGI
FT                   VEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIETH
FT                   EQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGIL
FT                   ATGGGTADRTLKMWNVNTSVKLNDVDTGSQVCNMVWSTNTDEIVTSHGYSKYNLTIWEA
FT                   SNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFEKQKRKATADSTILNA
FT                   LNQIR"
FT   CDS_pept        69832..70485
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046226"
FT                   /locus_tag="CAGL0A00627g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57691.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="HOGENOM:HBG559015"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI00003B5E56"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY2"
FT                   /transl_table=1
FT                   /translation="MQFFIFVSILCLFLENVGAFYMYSNSGDRKCFFKELPQGALLRST
FT                   YKVQVHDSTTNRYVPIAASNGRDMTIDIEEVFDDNHRVVHQFSSIQSGEVTFVAVESGE
FT                   HKICFQPNQSDLGRKKLRIDVEFTTGSVDDIDSKKTTKLKTLHRRVIALIESVREIKYE
FT                   QEMVRERETLFRDASEKVNSRAIWWILSQIVVLVAICVLQMSYLGKFFVKQKII"
FT   CDS_pept        70937..71320
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197370"
FT                   /locus_tag="CAGL0A00649g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57692.1"
FT                   /db_xref="HOGENOM:HBG124225"
FT                   /db_xref="UniParc:UPI00003B5E57"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY1"
FT                   /transl_table=1
FT                   /translation="MKFIKFTIRSGAVGVYFNDIHIKISLRSINYTKLVSYNKPIPYQD
FT                   RSIELLENSTSEVIQYKPCAPSHQGTNIKTTIIERQAMRFTKELSPEEIEFVDMSLSGM
FT                   RPSVCEYLSHVSYRETGILSVRN"
FT   tRNA            join(complement(71699..71735),complement(71627..71663))
FT                   /gene_name="tRNA-Pro (TGG)"
FT   CDS_pept        73333..73623
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444389"
FT                   /locus_tag="CAGL0A00715g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57693.1"
FT                   /db_xref="HOGENOM:HBG124226"
FT                   /db_xref="UniParc:UPI00003B5E58"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY0"
FT                   /transl_table=1
FT                   /translation="MSYSVETKKHVRGISDHILSEHKISTTPAITGMGPFTTAVRVSLS
FT                   AIDDTVHYRSKVPDSTTPCNHGCFAGNMKGTSIVAERNLREVRMAHIIYVI"
FT   CDS_pept        74767..76416
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350585"
FT                   /locus_tag="CAGL0A00737g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57694.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E59"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX9"
FT                   /transl_table=1
FT                   /translation="MSEESQSAFSASNSKVEREEDFKAYADEDGQPMVEIPKKPASAYT
FT                   LIFILCLFIAFGGFVFGWDTGTISGFVAEEDFIKRLGQRRANNTYYLSKVRTGLIVSIF
FT                   NIGCAIGGVVLSKFGDMYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFIGRIVSGLGV
FT                   GGIAVLSPMLISEVSPKHMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSVQWRVPLG
FT                   LCFAWALFMIGGMLCVPESPRYLVEVGKFEEARRSIAISNKLTPEDPAVTFELENVQAG
FT                   VEAERLAGSASWGELFSTKTKVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFKAVGLED
FT                   SFQTSIVIGIVNFASTFVALYVVDRFGRRKCLLWGAASMTACMVVFASVGVTRLYPNGM
FT                   DQPSSKGAGNCMIVFTCFYIFCFATTWAPTPWVINSETFPLRVKAKCMAICQAANWIWG
FT                   FLIAFFTPFITGAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLPW
FT                   KSPDWIPPSKRDATYDADAMMHDDKPWYRRMW"
FT   CDS_pept        77746..81366
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350586"
FT                   /locus_tag="CAGL0A00781g"
FT                   /product="Similar to uniprot|P39702 Saccharomyces
FT                   cerevisiae YAL002w VPS8"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG57695.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124227"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B5E5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX8"
FT                   /transl_table=1
FT                   /translation="MLEQLPLDYFTKSEMARSLIKWSSYSHIYSSLTPYGYPTCFLPTR
FT                   SHLVIGTSKGMILIFDFREFLHGILIPQSSTSDADNALRDAVKILKISEDGTHVAGAYE
FT                   SGHVFLWDINITGSNGSDDSKIEPIRAILYVDDYINMTVIGLDFYGNRHTGLIVGVQET
FT                   GTITYHSGKRNHLWKLVYTNAIVLKVPSNERLLLCNCKAYEDVVFCGILTSKYFAVMKL
FT                   GEVPKLIYNEPIKATSQQLGLNYSMSWNANISRVAYSVNTNLSCVALEGNNAYELMKVH
FT                   DYTTSESISSLQWLSRDLVGVLTISHQFLLLDSSNGFKANAIVDLLEQDILRPPSTHFQ
FT                   WYDSKAFLFSTYSFKIGHLMTWSQLVLTSVQKGNYIESLLLLEYFLNEESKLNNILFYE
FT                   NKDTPKKKVLFEPFYNLAMAAVGFLIKSEIASNSKYEELFTLIFRIWGQFTNGRQSSIV
FT                   ANEDLIDKISELLPNEKKSLYYEALALAVVYGKVKRLPAESFKELIQDQATKRHVIRLQ
FT                   EILTSLDVANLDIDLAVRVCNKEGLIDLSIYIWNMIFNDYLTPFIEFLQSIATSNGTKT
FT                   TAAQNLSIGINDPRMVFKYLECIFGSKQYPLGNRNIPVKSAQIAFEQILSVLFSGTSIR
FT                   WPLSSTNNFQLYKMDEEPAFPYLTLLLDYNVESCLQMLDHLFESDILNVDESDLDGDSV
FT                   FSRQYITEILMDYMLNNKNNGNGVAVGTFIARNCPKYPQFIHVSNKYYDSIIDVICNNK
FT                   IESLKKRSETALEAIISKYTPKDENQFVEMIKKNMFLKALVMFYRISNKFSDMIEIIVG
FT                   DESASAFTSQETSDILNFVLRNVKESIDKLKIKDAIACHFNQIIQNVDLDEFITICQNF
FT                   DPALHDSILLNEDEDLKYRYINILFDDTKLLPEERPALLGWYLHESVKRGDEKKLIDLL
FT                   NKITRPPKDVNNLIEYLIHSTFFESASILYSLLGDKFQQLRTLLSAVECLNKNNINQEL
FT                   IKPHIFKAVSIANSAVVDEKKYWCAILECLIRLFISDNISTVNGGFQLYSMMVNVFVSI
FT                   SEKGYDIDNEDTKRFSKIFENALENQELLLVKSNRFRDGFVEIFNQYNLSENVLKLVLA
FT                   VVMNYSSESDILYLLSQRRGWSIGSDVCEICGKKLWGIGLAKKDFETWKIRFENESDFY
FT                   KLSLNHDVVVFKCRHAFHDKCLGNLGQNGEYHCLFCRYKV"
FT   CDS_pept        complement(81425..84913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444390"
FT                   /locus_tag="CAGL0A00803g"
FT                   /product="Similar to uniprot|P34111 Saccharomyces
FT                   cerevisiae YAL001c TFC3"
FT                   /protein_id="CAG57696.1"
FT                   /db_xref="HOGENOM:HBG059341"
FT                   /db_xref="HOGENOM:HBG203637"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="UniParc:UPI00003B5E5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX7"
FT                   /transl_table=1
FT                   /translation="MVLYPDELVSQLCEEIAYEKGAVSLAQLWNIAETVMGVTALDDDE
FT                   PMQRYILQSLFSDPEVLVMDGEGNSVTKSVTEIDSACVVSISEEKLWQVLTGGYSKKDS
FT                   SIGNSAFQLLVEIAHARGQGINTMELAQITKQDPRSITGRLKKLDNLIKSVQVIHNGHV
FT                   VKNLRLRKFITDINEEENEEVYISMRDHLAEIVDVVKNSKNCIRQVSDLKRQLQFDKTK
FT                   RLSRAFISAIAWLDENGYLRKVIVVSPVNPDVKIRCVKFLKDYKPSQDANEFSDSDMGE
FT                   MSNDEDEAENDDDEAIERLNSTSTTDVLQGQELVLQEPSNTTSTTNGNNNIYMNRFYPI
FT                   QNQTYAMVEKTGVKGLPTMDIINSLTGRDYKRPFGKISDYYMVSKNSKAKGANFKKNNK
FT                   YQLTRLYDFEGKKKFYRFFTKENFEKLTDTTVGNAEVKNYNWPSDLKKQNQNIYQLSKK
FT                   LFSPLNVTLRTTLDNSGKRIFFWNGELDIERPEIPSGSKKRKITVSEGERKSKSVQEKR
FT                   SRNISDNLVEKDVEGTKLPLLNIDGFSASSLRSLSRQKAIMKVLEKSGGVSLLREQFFE
FT                   DVTNYMSSSTVIDKKTLKGDVDLMIGNSKLTLYTDPDTQKKVIHFPDVPMAKISDLLTD
FT                   TKDNKKNFFKDILHDTDIYFYDQNAKDRFNRKMKATERIRKYQNGRKNNNSEVRNTNSS
FT                   SVKLFEERKRSRKERIDRTKKHNGNITPIVEDKQLEKASRDFNISTKLGIAKLIKLVVI
FT                   SKSIKNEVVWSQITTLFPYNSIDNLKRQWTARRIKMGQHGWKALLSKWRKILLQGISEE
FT                   LVTLEQTENLELSILLRLWEDKEKEVDSERVKLLYNYQENLKQLTFLKKGDNKTVSTHS
FT                   SIAMSSMIQREIASLKHTPTLSHECLPDVEQKARRQDQIRTIVRSILVESKEMNKNEID
FT                   ILKDVPRDELDAIIMDMAKQKQLYLHSSKLKPTERIFELLQTKGDFSAFKKAANLSEKI
FT                   AQMLNSSYGIVINEEFEDVCSWIFIDLIDTGDACISIMPLERHVRPLKYTTRSFEIKTL
FT                   TPPLVLYNGNGSTGINFDVKQIPVPLGKPFSKLWIDSEGSLRSDIWKSLLTIVLTDILF
FT                   KPGVQSTTIASDCESLIGVEEIEVICQWLINKNLIVKDDNDGFTVQSRWYNLLKV"
FT   CDS_pept        85331..86425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444391"
FT                   /locus_tag="CAGL0A00825g"
FT                   /product="Similar to uniprot|Q06168 Saccharomyces
FT                   cerevisiae YLR321c SFH1"
FT                   /biological_process="chromatin remodeling"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="CAG57697.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="HOGENOM:HBG059342"
FT                   /db_xref="HOGENOM:HBG202542"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="UniParc:UPI00003B5E5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX6"
FT                   /transl_table=1
FT                   /translation="MVKAVERRLVPQGVVTNFYNRVKEDGTIVQSLQRGGGSRRSRAVN
FT                   YSEVDAFEDFEESDDERQGSNNRSASTEAVVDDKLPENVVLPDLEDIITGESDPSLNVL
FT                   KFRKVRDTFFGGRIAIRYKLELDQNEVRSSSLAVPIIVPITLKLEDTADGISITDSLLW
FT                   NINDTSVTPEQFSLVYCRDLGILGNNYIQQQIATLIRDQIENYRTLSGHLLQANENMRS
FT                   YPDFHVHLNIACNLNSRYYEDNFQWNINDESLTPEKFATIVVKDLGLTRDFLPSISQVL
FT                   HEQLLQIKKEWIKGEFNHELIHPDENNRMVRIEANQGELDRAWSPRVEVLSMDEIQKRE
FT                   VERERQLRRMKRDSDRLGRRGRRK"
FT   CDS_pept        complement(86551..87540)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046227"
FT                   /locus_tag="CAGL0A00847g"
FT                   /product="Similar to uniprot|Q9URQ3 Saccharomyces
FT                   cerevisiae YLR316c TAD3"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG57698.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059600"
FT                   /db_xref="HOGENOM:HBG202539"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00003B5E5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX5"
FT                   /transl_table=1
FT                   /translation="MVKKVDNKIKIDFKRCIVEDRLLQIQPLDISNVPELCNVWTIDIQ
FT                   PQLSKSFIELVKLNTRDQDPIPLAHCKRIRKVINEEGNSLLRCIICSTLMYDNIDEVRE
FT                   LIKFDYENLNSSNKVPKRGPYDKDLVKEWSEKYWPLVWNGNPNDQILNDSEFKMDEINF
FT                   YLKIIQEESKRIGKESGSLPIVSVFVDPKFKGDFIIAVDQRSHSEEEHLSLKIDHSIMV
FT                   GINKVANTEKKRRSLEDCNNVPQNYLCLDFDVYTTHEPCSMCSMALIHSRIKRCIFIEQ
FT                   MARTGALMANSGNSYCMHANKKLNSKYEVYKWIGDEYKVPTINKNICV"
FT   CDS_pept        87841..90396
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444392"
FT                   /locus_tag="CAGL0A00869g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="DNA binding"
FT                   /function="RNA binding"
FT                   /function="telomeric template RNA reverse transcriptase
FT                   activity"
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57699.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003721"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="HOGENOM:HBG059601"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniParc:UPI00003B5E5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX4"
FT                   /transl_table=1
FT                   /translation="MKVLREVVTTNENSLRQLGVLLDSTFVIENEVQIDIDKDFFDSSA
FT                   GHRKLIDQCIVFLLQKRLLNNVLVAGYKLAKNNTVRSILHCENSNSAVKTLKSSSWELL
FT                   HTNIGSPKFVNLILNHSIFTFNGEFTQQVAGNSLNKPHLPPSWIIDNDYEQETDINCFS
FT                   INNRPYLYHNTRGFCIKSIILDRDMLNETLDIQVKYLMREIFENDIKLNKKALRTTVIE
FT                   TVLKQVLENQQRIPIIPILDKICPKTYSNYHLDRATPVKCVNKFIVVILEKLKILQLIG
FT                   SRKNSFVLFSKISQLLKLPLNGKINVKEFFTKLNVNAVRRYLSIDPIGQQKQSMRLYLT
FT                   CVVNYLLSKLIPSLLKSFFYCTEVSSYSKILYFRNDEWNSISTPFLKEYLDKYLVQNTH
FT                   CNSHFSYMESQFNHCNFRLIPKKGNNEFRVIGIPYKGNNAEELLQYKQNHTKVIVPTKL
FT                   ILDYLRKSRQTTQKLLFSAMQISDHICQYKCHLHSKYGYIPKLFYLKFDIHNCYDSIPI
FT                   AKAKSVLNSLINNCGYEEFYVRSVTILNTKNNEVRYDTIVNGHINIRDFEIMVDNSTTT
FT                   FLTKEDIMDLIEFEMEMTSIRLFDKCYLRKDGLFQGLSLSATIVDILYDDMLEKNRVFK
FT                   DILNNDGLVLRHADDFLLISPSKEIISYARLKINEGFTEYNAQVNHRKIVFSESDNIAN
FT                   TAIPFCGVEIIPRTLEVIKRFSAMNETDISDHEGNIYSKCAVLFKMRLNYGTMNANLNS
FT                   ISTMLKQVENATINIVRIILNSNHIATSVSSFSSFVNELYNICLLSSRNLNLLNHRDLQ
FT                   RFLTSIKKTILTVLLKNLKRKYSIYNGISRNMNSKRTSK"
FT   CDS_pept        complement(90494..92752)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046228"
FT                   /locus_tag="CAGL0A00891g"
FT                   /product="Similar to uniprot|P41697 Saccharomyces
FT                   cerevisiae YLR319c BUD6"
FT                   /protein_id="CAG57700.1"
FT                   /db_xref="HOGENOM:HBG059602"
FT                   /db_xref="HOGENOM:HBG395809"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniParc:UPI00003B5E5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX3"
FT                   /transl_table=1
FT                   /translation="MSEEKLPLGKTHSSIETTVTKLLMSTKLLLQTLTQWSRGSVGPRA
FT                   VSDAYVHLGNDFKIVSKFFTHAKVDISDLGDVPLALRKVLEVALREPPSDESLNKYLPQ
FT                   IREIIVTLLDKLKVKQALLKTMKQEQKMMMTSPQHRKQHSITSSISLESERGGVSTAGS
FT                   RVNSIVSNVQSQRNSATVDQQFVDADTESTTTSAGLTSVTAVEDSQPEEGDALAQLKKG
FT                   NNLQRKASKRYSAYHMAKLTNHSATEAANAAALASNGLPQSLDNDLSSERIISQGSKRL
FT                   SSTGNKLTERLQNELEDKHEDEINPEAVQISDIDKVEAMKQVEATDKAEAKGVLFLKLD
FT                   NRVKKCEATFPITMTGLRLLFVEMFAYSPGGDSFPDIYINDPVHNISYELDEHGLKEVK
FT                   EGSLVELHSRPTQAPPSSAGSDLIDLLKDELQKNQQVMLDRISSLQINSAPVQASSSEK
FT                   ENVATNKEYSNTLKEVQHEIAIVRQVYIDNKKALEKTIKFILEKVDAFKSVNLATNNSS
FT                   NRQYIEQSQTELGDVSDKLLSKVDDLQDLIEIIRKDVAERGAQPSKRKLELVQKELNDA
FT                   EHDLQRMKSFIDTEKPHWKKIWETELDKVCEEQQFLTLQEDLIVDLKEDLKKAVETFDL
FT                   IDQCCKEQEKTPAKPRRNPVLPLLKPGTFNQVREEMLMAVQQLNPDHESRVEALERAEK
FT                   IWERERGYRDEDEFRDELGNFVENSNLKKSGGVEEVERRRREKDEENLRANFGGGQLL"
FT   CDS_pept        92985..97265
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444393"
FT                   /locus_tag="CAGL0A00913g"
FT                   /product="Similar to uniprot|Q06164 Saccharomyces
FT                   cerevisiae YLR320w"
FT                   /protein_id="CAG57701.1"
FT                   /db_xref="HOGENOM:HBG124229"
FT                   /db_xref="InterPro:IPR013220"
FT                   /db_xref="InterPro:IPR019021"
FT                   /db_xref="UniParc:UPI00003B5E60"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX2"
FT                   /transl_table=1
FT                   /translation="MSDEVVLGSETEDQEVLFQQDWQDTDVPSSQLREPLSQAPVAGEL
FT                   GVRQSETAPLDASGDTNESRDQPVPAIGLRWSLRKRKAIQKMPYSLDRLKHKQLLQGYD
FT                   VSNDMMSQLELPAPTAADLDTYFQLPESDSDSESDPEASIEIKDDDELGNDSLEVVVPR
FT                   RYRGIRLDRSLDDDSDTDSDGDDTVNSQSNQKSSQSEIMFRGRKINLKTGFKGLLPRSV
FT                   WEKNMKSQQSKPKSNTSSTSRAHKGVALRKRVANRHSSTLNDGFLIDDISEVEEEVTPL
FT                   NLNSAQSHLIAEDMATSHERPPYILEDESGIDYISNNKQDVQGRYSTYMAGEILDGNKN
FT                   LTRELNPAYNFDEPSLSMMLHRTSPNKSKKDNKSRAPRSNKPGSLIKRRKKEKSTYNPI
FT                   TKEYSMVGIKYSRRSIRRPPKEKPYNNYEANITSKKASGDLSNLQPYLKIPDVDKKDHK
FT                   GDRQQKTKSRSRPYEIAPPENAIFKRNDIRSFSTVVEKIGDEIVVQHNPNSKLQVTEDA
FT                   PPGLQNGFLYLRERFPAIESLFNHKAIEIPNVIKISLGNESYVLSKMDYKALKDNLTKL
FT                   FTEIVNNGASDDEIFDFNVHVTSILLYLNKSDIYEIIEDFHRKFRTKLSSIYQKAKPIH
FT                   FFQIVMCQLMLFEITKYADISTQYKKILQDRLSNHTVSFFNLLDICYETLKTQESLYLN
FT                   EAFHIISLIISDFEDGIELIWERLGKNTYSPSLFSIIITTLPILEPQWQSVKIINSYEN
FT                   LKGVLKLVRYCNSYYKWKPNDLLILQLNKIFKERRFEDFPEEHMESELNHVISSPTEKI
FT                   KRKTIFNKYLSILRSSNVHSSIIEKITPMSEILTTDTTSILINRVNLIIILSWFSNLNI
FT                   EKRLSELLKPVLNDSYLHDRDSGTTRIVARSVLESFLALIRTTAKKNGKISLKLNIFHL
FT                   FFKEYVSKHDYLVSMWISFINRTAKISANLPTRTLKSVLKYLVICFEDMQGDIETPLLS
FT                   ANLSLMKFMVKHLENIHMSIINSRLLSLSKQLAKTCRPWIKYYTIICDYMIQRSEMTFW
FT                   TYFQYSGINFDKPNGLYFLRKALSIADDASYQIIRERLYSTLIDKLYIDESDDYYALYN
FT                   TVLGRDLGIKLEFKKISGESHQLELVKRLVRTLAKLQMYPKINILVQHIISVFNKKFIS
FT                   ENFAVNFVQFIDENYRDYLIDYQDFSILKRLLSMNDIKNERLLFKESFRKCEGRMQQML
FT                   FIQKNILSIIHKFAKDEADSASMILKDKIVQLMVSPILDCEVHFIRLMIESNIMPSDNV
FT                   EIYSSSQIFISFMMDVLKGYLDSINWIIDSDSFQDYYLIALKLIMAYPASLCLEGKCFF
FT                   KILTFVDVLLNNYCLGLEEYSFLYQRTINAIDKNAKPQFFEVEMTNEMSKLLASIKFPI
FT                   NRHEDHERNDTTRLISRLRNYTCQ"
FT   CDS_pept        complement(97372..98052)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046229"
FT                   /gene_name="CWC24"
FT                   /locus_tag="CAGL0A00935g"
FT                   /product="Pre-mRNA-splicing factor CWC24 "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG57702.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG124230"
FT                   /db_xref="HOGENOM:HBG396146"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B5E61"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXX1"
FT                   /transl_table=1
FT                   /translation="MFKKRSAASKTRKRVKVETPVQKPAVQKPAVAVKPVLDKSHVAKL
FT                   EEEIASRPELDQKAVGEADATAVRLKRLKEQATKHDRLNSEPVASSKKIQQAANLRNTI
FT                   LTDFQPDVCKDFKQTGYCGYGDSCKFLHSRDDFKAGWTLATDWKIDEQKEETRKEAVPF
FT                   KCVLCKESYERPVKTNCGHYFCQKCFVNRIKIDKSCFICGENTEGIAKMATDLVPMDNA
FT                   NKDK"
FT   CDS_pept        98272..99483
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197371"
FT                   /locus_tag="CAGL0A00957g"
FT                   /product="Similar to uniprot|Q06169 Saccharomyces
FT                   cerevisiae YLR324w"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57703.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG192550"
FT                   /db_xref="HOGENOM:HBG396085"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI00003B5E62"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXX0"
FT                   /transl_table=1
FT                   /translation="MSDKVVRAKFVESVQPRLGGDTTRVILKALHQGQVKEVKDGEDVE
FT                   VDEEQEGKSGMVVMPSPLLSSTPPSVVRSMVRLYPYLKLTDKALGVLTWSDFSIWNSIV
FT                   LVPAYLLFVLYYEVFVAYLGHMIVIFCVLGLMWIYNFVESPQDVPILEDIVLKMNRVQY
FT                   KFDKFIEPVITLKEQDITKLLYVSMLISPIYVLLGCLLGNEFIRFNIASFGVLILTYHS
FT                   PWCKTLRRLLWKFKFVRTVIYRVMGIQTYEVQEPKINLDKKYKFTYVLYENQRRWLGIG
FT                   WKSSMLSYERTPWTDEFLNEAPKPSDFQLPNKEWKWLDSEWKLDLSNDGAIEVPGERFL
FT                   TNPKENDGYIYYDNTWKNPSIEDTFSKYTRRRRWIRTAELIEKLPTAATTTATSTSTTT
FT                   PSVK"
FT   CDS_pept        complement(100410..100646)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350587"
FT                   /locus_tag="CAGL0A00979g"
FT                   /product="Similar to uniprot|P49167 Saccharomyces
FT                   cerevisiae YLR325c RPL38"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57704.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG374836"
FT                   /db_xref="HOGENOM:HBG748692"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="UniParc:UPI00003B5E63"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW9"
FT                   /transl_table=1
FT                   /translation="MAREVTDIKQFLELTRRNDVQSATVKINKKLNKNGKQFRQTKFKV
FT                   RGSRHLYTLTVNDAGKAKKLIQSLPPTLKVNKL"
FT   CDS_pept        101642..102301
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444394"
FT                   /locus_tag="CAGL0A01001g"
FT                   /product="Similar to uniprot|Q06170 Saccharomyces
FT                   cerevisiae YLR326w"
FT                   /protein_id="CAG57705.1"
FT                   /db_xref="HOGENOM:HBG058985"
FT                   /db_xref="HOGENOM:HBG512070"
FT                   /db_xref="UniParc:UPI00003B5E64"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW8"
FT                   /transl_table=1
FT                   /translation="MSGLVRDFIVGYAEDFANEYAQENFQPVIDPYYARVGPQKKKVRR
FT                   ELPAELFSKQERKRFKTLQSKSWTHDRSMCGCCCWTECIGWAPVFSIIPVVGPIIMYMI
FT                   HNSLVTYAERNLYNNRLPTGLKTKLLANITFDLCITLVPVLGALFSWLNGCSTRNTALI
FT                   YNDLVEKRMKQVPQYQQAQAQQAQTQQAQAQQVPQYRTQQQAPAQQVPQYRTQQYR"
FT   CDS_pept        102793..104028
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444395"
FT                   /locus_tag="CAGL0A01023g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="CAG57706.1"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG397934"
FT                   /db_xref="HOGENOM:HBG405239"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B5E65"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW7"
FT                   /transl_table=1
FT                   /translation="MDPTRDPDFKPRDPDAKLLPPPDPTSKIPKSGPITPYVLADYNAS
FT                   IDAPLQMKKNTTHLPHSQGNHQRIPLNKSEFQPLSTTGSSEEDFELDDENMDSDSGSKR
FT                   ESLGQLSGHGIGIGVHKNQIADLEEVPHGIVRQARFLEDYEFPTHRLANRLQDPNKMPL
FT                   VIVACGSFSPITYLHLRMFEMALDAISEMTRFEVVGGYYSPVSDNYKKQGLAPSYHRVR
FT                   MCELACERTSSWLMVDAWESLQPSYTRTAKVLDHFNHEINVKRGGITVHEKKRNADNSG
FT                   YHMEEHKRGVKIMLLAGGDLIESMGEPGVWADEDLHHILGNYGCLIVERTGSDVRSFLL
FT                   SHDIMYEHRRNVLVIKQLIYNDISSTKVRLFIRRNMSVQYLLPNSVIRYIQEHKLYINQ
FT                   SEPVKQVLSGKE"
FT   CDS_pept        complement(104865..106316)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000061736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197372"
FT                   /locus_tag="CAGL0A01045g"
FT                   /product="Similar to uniprot|P08417 Saccharomyces
FT                   cerevisiae YPL262w FUM1 fumarate hydratase "
FT                   /function="fumarate hydratase activity"
FT                   /biological_process="fumarate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="tricarboxylic acid cycle enzyme
FT                   complex"
FT                   /protein_id="CAG57707.1"
FT                   /db_xref="GO:0004333"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006106"
FT                   /db_xref="GO:0045239"
FT                   /db_xref="HOGENOM:HBG000141"
FT                   /db_xref="HOGENOM:HBG284369"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR003031"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI00003B5E66"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW6"
FT                   /transl_table=1
FT                   /translation="MLRASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQ
FT                   RSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGK
FT                   LNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTF
FT                   PSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSG
FT                   YVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAP
FT                   NKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIM
FT                   PGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADAC
FT                   HSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESA
FT                   LELKYLTSEEFDEWVIPENMVGPTK"
FT   CDS_pept        106866..108791
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350588"
FT                   /locus_tag="CAGL0A01067g"
FT                   /product="Similar to uniprot|Q08979 Saccharomyces
FT                   cerevisiae YPL263c KEL3"
FT                   /protein_id="CAG57708.1"
FT                   /db_xref="HOGENOM:HBG137866"
FT                   /db_xref="HOGENOM:HBG445740"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI00003B5E67"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW5"
FT                   /transl_table=1
FT                   /translation="MAKKKKDKEAKKARAEQKLKKNQAKAESKDKKRAKKLDEDDDDMD
FT                   IEEVLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQT
FT                   STTTFYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTF
FT                   YHYSDTWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDC
FT                   WLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKIL
FT                   SDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE
FT                   SNFFNDLFSYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKAN
FT                   LQDKSDDDEDDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFI
FT                   FGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDD
FT                   DEDDDEEDDNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGA
FT                   AFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKS
FT                   ASSKRR"
FT   CDS_pept        complement(109009..110616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502805"
FT                   /locus_tag="CAGL0A01089g"
FT                   /product="Similar to uniprot|Q08984 Saccharomyces
FT                   cerevisiae YPL272c"
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAG57709.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG058375"
FT                   /db_xref="HOGENOM:HBG203859"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI00003B5E68"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW4"
FT                   /transl_table=1
FT                   /translation="MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDD
FT                   DNDTLAATRVESRSTKKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRT
FT                   PDVISVVTFDNEKDEKVNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVF
FT                   HCQDILFDIFSAANFHKLFLKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYD
FT                   NLKLHLPATRPELLNLQTQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVIS
FT                   QEGNQLKLFRTRYTNILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAIT
FT                   MLCLKPMVKSFNGTLIFSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGL
FT                   NESDPEYNEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPN
FT                   TRLIKINDVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPD
FT                   GYNMENFVDCFESFMEEQ"
FT   CDS_pept        111480..111689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197373"
FT                   /locus_tag="CAGL0A01111g"
FT                   /product="Similar to uniprot|P21306 Saccharomyces
FT                   cerevisiae YPL271w ATP15"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, catalytic core F(1)"
FT                   /protein_id="CAG57710.1"
FT                   /db_xref="GO:0000275"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG062564"
FT                   /db_xref="HOGENOM:HBG203865"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="UniParc:UPI00003B5E69"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW3"
FT                   /transl_table=1
FT                   /translation="MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGR
FT                   GKTDAAYTKYEKGSPKSDPIPLQE"
FT   CDS_pept        112037..114442
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20197374"
FT                   /locus_tag="CAGL0A01133g"
FT                   /product="Similar to uniprot|P33311 Saccharomyces
FT                   cerevisiae YPL270w MDL2"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57711.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B5E6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXW2"
FT                   /transl_table=1
FT                   /translation="MKYSGIAVLRGVRVTPLALPRAGSRYLSLLARPPTRQIIHNTGAG
FT                   YGVWVSHKVLTSSTIRRPFTAHRALNNEYNTTAGNASVKSQSATKEKNEEDRKYSKKEK
FT                   EEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLK
FT                   NALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERL
FT                   VARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSV
FT                   GIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGI
FT                   KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYL
FT                   VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTK
FT                   GVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLL
FT                   EKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD
FT                   EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEA
FT                   TSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK
FT                   ELWDDPTSELSQLLNEKSTPHQTTNITVTPPPTTMAEKVVEEVVENAEPETVIEDPGSP
FT                   PMYISTVSEVSAEGHELINEQIEDTIENVMKDVTSERKPLKLQKDENL"
FT   CDS_pept        114809..116638
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350589"
FT                   /locus_tag="CAGL0A01155g"
FT                   /product="Similar to uniprot|P32526 Saccharomyces
FT                   cerevisiae YPL269w KAR9"
FT                   /protein_id="CAG57712.1"
FT                   /db_xref="HOGENOM:HBG124232"
FT                   /db_xref="HOGENOM:HBG203876"
FT                   /db_xref="InterPro:IPR013889"
FT                   /db_xref="UniParc:UPI00003B5E6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY01"
FT                   /transl_table=1
FT                   /translation="MSNHELTFNNDLQMLLETQLPEIHDTISKLRSVQFIKGDDSSIED
FT                   LCDVLEWITTQMNRILEIFPQIIDSTGIEVSSLLEYLDWLQERKELLFELVNDINSIGP
FT                   FLSDILEGIEANLNTDPNKSLDEHEMHLIDLIERCSTLRDDLDPWLNKLRKLLDATLEF
FT                   KEISNDHMDGLDKVVSENIQSCFDIQEERFTSPVRHAPSFTLEQIVDLLKQNSDSNAIS
FT                   VPTFNKQEKLISERFLELRRSVPAIEKSLTDILPNRIDNFARRDMTNIDSLAEFLRDKY
FT                   KVLMKKYEFMSSEISELNAELIDKRWNILFVNLNHEINFILDDYEKLKKKLNSVEEIGI
FT                   NVQIREKMSHQMTQKSLTIERTFKVIFKAQEFSLLDAGIASKTNEMKNRWEKVRVDDKL
FT                   LRSVSVDSGPEISSVTKDFESLTLKNGSSHGASNRRSVSEGTPSASRQFGSVLLKRMRI
FT                   KPVSNTNKDQLLDDPNPFFDKKSRNSGKLVLNSIPALPHNKDPVTEPTKISKPQTISSS
FT                   TPVKTAKSLEELEGERIMYYKTHGTTKLPSLMKKAERTQFSKYKETGTIATPQRTPKSM
FT                   NAWGPSSKRGNVLRPPTPLSALITPTSSRRRPF"
FT   CDS_pept        117020..119572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046230"
FT                   /locus_tag="CAGL0A01177g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="calcium ion binding"
FT                   /function="phosphatidylinositol phospholipase C activity "
FT                   /function="signal transducer activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG57713.1"
FT                   /db_xref="GO:0004435"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG058379"
FT                   /db_xref="HOGENOM:HBG207053"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B5E6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY00"
FT                   /transl_table=1
FT                   /translation="MKVSDGSKEVVCRERKLSSESRTSSESFSFLRRSNSSRSLLDDIL
FT                   SSSSSTSVKKNLKSVKKMAPFLNYKDLGESIGAITYPYSMAPWVPNLLEVDNSGIKLDS
FT                   DLERVMGVMREGVVLKKVTRKKQREYMFKLEKNKYITWKDGLKKLNLDSIKSIRPGELG
FT                   SNYREEYNVDASYSKYWVTIIYKVSNKLKALHVIARDESDYNVFCSLVFGLVRTRRELM
FT                   ESLAVPDHDKFADIHWNRALSRNPDEKAEEVLGFEDVRQMCQRFHIYCSAGYLRRFFDA
FT                   ADTNNSGTLSFEEFQVFVKLLKARKEIDDVWQEAVGLHEDKLTFDTFYKFLTEIQRERM
FT                   DEDEARHLYERYETAGGGINKQGFEKYLTTSPYMLPNNEDYSRPMNQYYIASSHNTYLT
FT                   GKQIGGAPSVEGYIQALQQGCRSVEIDMWDGESSPVVCHGVLTSALPLSSVTQIIRKYA
FT                   FITSPYPLIISMEVRCNSKNQRIAASIFKDTFGDLLYTCEDRSELPSPLELRHRILLKI
FT                   KKTKTVIGDCHSDKSMNVVVSSSSSSRSSYDESTAMTKTGSRIRRLSFSKRQVAIVDEL
FT                   YELAGLRGVKFRNFSLPESKTLYHCFSLDERRLDKMLGDAQVAAAVDKHNRRHMMRVYP
FT                   HALRYRSTNFEDPVRFWRLGVQMVATNWQTNDVGHQLNVAMFQLNTRNQQQMPSGYVLK
FT                   PGWLARPPSKRRRERCGAVLRVTFEVISAQLLPNLSESTETKSQAASIGAAETEDPYYT
FT                   QVTCEMFSCGSTVEKSSKCHENGFSPVWRSALSQDVRRDEYPFVFVRVVVRRCEEVVAT
FT                   TCVRVCQLREGYRHIPLCSPDGEQYVFSTLFVRYRVTV"
FT   CDS_pept        119731..120042
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350590"
FT                   /locus_tag="CAGL0A01193g"
FT                   /product="Similarity"
FT                   /protein_id="CAR57993.1"
FT                   /db_xref="UniParc:UPI00017BD5BF"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMW9"
FT                   /transl_table=1
FT                   /translation="MRVTKVRSPVKVYEESRETRQRVLSSVKARLELHDDKENITQNIT
FT                   QNITKSSTLNSATHNCTTANGSPKTTTRRTSLPLRPLDTSRHKGYLHDLRRDTVRALQ"
FT   CDS_pept        121067..122908
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444396"
FT                   /locus_tag="CAGL0A01199g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57714.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B5E6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXZ9"
FT                   /transl_table=1
FT                   /translation="MTTTLSVPPVFSENHSMVSLGASDSRGHHLTEHTHHEHHVNHVNH
FT                   DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSI
FT                   GTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCD
FT                   PALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG
FT                   VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSID
FT                   GSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTI
FT                   FLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNS
FT                   DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNY
FT                   FVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA
FT                   FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAID
FT                   EEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF"
FT   CDS_pept        125780..126661
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444397"
FT                   /locus_tag="CAGL0A01221g"
FT                   /product="Similar to uniprot|P53386 Saccharomyces
FT                   cerevisiae YPR192w AQY1"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57715.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541897"
FT                   /db_xref="HOGENOM:HBG705794"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR012269"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniParc:UPI00003B5E6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXZ8"
FT                   /transl_table=1
FT                   /translation="MDSDLEIQNKTQVEHVDKMGDSDVPESVSNSANMLRSRFNIGPDS
FT                   VRNHVIAFMGELCGTFMFLWCAYVIANIANHDVSLKDSPPHGSHPGQLIMIALGFGFSV
FT                   MFSIWCFVGVSGGALNPAVSLSLALARAITPTRCVVMWIAQILGGMAAGGAASAMTPGP
FT                   VKFDNGLGLGCSRTRGLFLEMFGTAILCLTVLMTAVEKGESNFMCALPIGISLFIGHLA
FT                   LTAYTGTGVNPARSFGAALAKRYFPHYHWIYWIGPLLGAILAWFVWQVLQWLDYANYVA
FT                   REKEAAEKAKTH"
FT   CDS_pept        complement(127506..129101)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444398"
FT                   /locus_tag="CAGL0A01243g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57716.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056482"
FT                   /db_xref="HOGENOM:HBG325091"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXZ7"
FT                   /transl_table=1
FT                   /translation="MSKHLRNPVLRDIPTSASEWKYAICGRHKHEIYPIGASKANDDNH
FT                   DNDNDNDNDSTEHKKGFQKYWPIITTGAGLFSDGYINNSISTVSTCLSLLYGKEYSESH
FT                   AIRNISSIVFAGTVCGMLIFGYLADHHSRKFSMLLGTSMLILFTILCAGAWGKGTTNTH
FT                   AGGLFAALTAYRFFLGIAIGSEYSSSSPAAAEASNLLPRGKRNRYFIWFTNTMIDFGFV
FT                   IGAFVPLVLLWICGSHHLTPVWRITIGLGAIPPCSLFVLRLFYKEGKKFRETRFNRKVP
FT                   VWRIIKFYWFRVAIVSIIWFLYDFSSYAFGTYSSIIIGLVLPKDAPLYKNFGWNVVFNL
FT                   FYMPGSIVGALLSDYFGPRLVISVGLIVQAAIGFALAGSLDHLKRHIVGFVFMYGVFIT
FT                   LGELSAGNNMGVVASKVNATPVRATLYGVAAMIGKVGAFVGTYVFPSLIKNHGLSSPYY
FT                   VSSALCCFSALLAFLFLPDLDQDAMKREDDKFMEYLASTGYDLSTMGIQTDDESELSTI
FT                   SVKNSEINEKAFDK"
FT   CDS_pept        131362..135567
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072571" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444399"
FT                   /locus_tag="CAGL0A01284g"
FT                   /product="Similarity"
FT                   /protein_id="CAR57994.1"
FT                   /db_xref="HOGENOM:HBG398775"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00017BD5C0"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX0"
FT                   /transl_table=1
FT                   /translation="MNEKIFRYLTLLFLFELASSLPVEDKLNIKKVFEKRAVDFTPFAH
FT                   YPRPEGCSSPPNSVSVGLHMNLYNYPYLYVKPSTKGMFTNDTNSDSDGETDGDSAGGIE
FT                   GRAGQCWNPEYQDPNFPRFGYKQYGEFGASDNVNGDISWDHNEFTEGCKPVLAALPPGY
FT                   NYPDEITFSNFTMVLSGYFKPKTSGVYKFELKADDFILFNFGAKNAFECCNREESIDNF
FT                   GPYVAYAMWPNQADQELEVYLFEDSYYPLRLFYNNRDYHSKFKIGFYPPGQTTITFDFD
FT                   GYLFMLDDTGNECRDSIRYRTVCDDKVVDDTTYSTRYSTSMVPGGGSDVITIYYIRMKC
FT                   EEEDCLGQWDPINNVCYSPDDCADDGGYWNGQMCDQSCKLEGGIVNPDTGDCDKSCIES
FT                   GGFLDENGNCDTTCRDDGGMLVEGQCDYQCKEAGGILVGDHCDTTCVDSGGKLNEDGTC
FT                   DHSCRDQGGQLDESGECDTSCKDSGGMLIEGECDTSCKDEGGQLDENNECINHCKDQGG
FT                   IIDENGNCDTSCKDSGGKLDENGACDTSCRDEGGIIDENGNCNTTCRDDGGILVGDHCD
FT                   TSCRDAGGILEDGICNSTCRDSGGKLNDDGTCDYSCRDQGGQLDENGDCDYSCKNGGGK
FT                   LDEDGNCDMSCKENGGQLDEDGDCDLSCKEDGGKLDGNGDCDYSCKEEGGIIDESGNCN
FT                   TTCKDSGGQIIDGECNYGCIEVGGVVIDGECDTSCVDSGGILDGDGNCDRSCIESGGVL
FT                   EDGACNTTCRDSGGKLNVDGTCDTSCRDDGGMLVEGQCDYQCKEAGGILEDGECVFPPT
FT                   SSSTSETSSTTDQSSSQSDDSSVESSSTPMDSSTIESSSSEIITSESESESVPIASSSS
FT                   EVMTSESESESIPILTSSSEIPIASSSSEIIIPESESESVPVASSSSEIPVASSSSEII
FT                   IPESESESVPIASSSSEIPVASSSSEIIIPESESESIPIESTSSEAVSSRSESDSSYPT
FT                   STPTTTTSTTWPNPIQPTTSNSSPIVSSSTETPGIAESSSRISDLESSRRTSILGDDRT
FT                   RTRTTITSTITEDGQIITITTTVTGFVPEPTGETEGNGSDDENLENPIENNTDENEFVD
FT                   PEFTDDIPDDPAGPEDNGNGPVNPEQGNDNDPVNLEDSGNNGAVNPEQAPVNDEDNGGN
FT                   DPVNPEQDNNNGPANPGQDNTNGSSNSDQIDNNPPTPEENAGDGNSNGNDPADPSRRTS
FT                   ILGDERTRASPGGTSQPTGANGNVNGNSPGANVNGGGTGNSNNNNNNNNNNNNNNNNGN
FT                   APNGGDGSNGDANQGPSRRTSLLGDERTRAGQAAPTGGSSPNNGVAGDTSNNGGAIVSQ
FT                   QVDDGGAGSPRRTSILGDVRSRTTLNGEVLNFEGSGVRRAVAGNLALPLMMVGLVFNL"
FT   CDS_pept        136262..137695
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444400"
FT                   /locus_tag="CAGL0A01325g"
FT                   /product="Similar to uniprot|P40356 Saccharomyces
FT                   cerevisiae YGL025c PGD1"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAR57995.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG398776"
FT                   /db_xref="InterPro:IPR020998"
FT                   /db_xref="UniParc:UPI00017BD5FC"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX1"
FT                   /transl_table=1
FT                   /translation="MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIK
FT                   KAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFE
FT                   ELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPG
FT                   AGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAA
FT                   AAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMN
FT                   NMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQ
FT                   LNQMFPMQNHNQNGHFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNM
FT                   GMNMNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQNQNQNQSMNMNMNNDSNNPKSA
FT                   YDLVDFNSLDLSSLNMDFL"
FT   CDS_pept        140305..144693
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072571" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444401"
FT                   /locus_tag="CAGL0A01366g"
FT                   /product="Similarity"
FT                   /protein_id="CAR57996.1"
FT                   /db_xref="HOGENOM:HBG398775"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00017BD5FD"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX2"
FT                   /transl_table=1
FT                   /translation="MNEKIFWYLTLLFLFNLASSLPVEDKLSIKRVFQKRAVDITPFAH
FT                   YPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKNPRTGFTNDTDSDADGETDGDSAGGIEG
FT                   RAGQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYN
FT                   YPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFG
FT                   PYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDG
FT                   YLYMLDDTGNECKDSIRYKTVCDDDVVDDTTFSTQYSTIMEPGGGTEVITIYYIRMKCE
FT                   EEDCIGQWDPINNICYTPEDCANDGGYWNGDMCDQSCKMEGGIVNPDTGDCDKSCIESG
FT                   GFLDENGNCDTTCRDDGGMLVEGQCDYQCKEAGGILVGDHCDTTCVDSGGKLNEDGTCD
FT                   HSCRDQGGQLDESGECDTSCKDSGGMLIEGECDTSCKDEGGQLDENNECDTHCKDQGGI
FT                   IDENGNCDTSCKDSGGKLDENGACDTSCRDDGGIIDENGNCNTTCRDDGGIIVGDHCDT
FT                   SCRDAGGILIEDHCDTTCRDSGGKLNEDGTCDHSCRDQGGQLDENGKCDYSCKNGGGKL
FT                   DEDGNCDMSCKENGGKLDENGDCDLSCKEDGGKLDEDGNCDYSCKEEGGIIDESGNCNT
FT                   TCKDSGGQIIDGECNYGCKEVGGVVIDGECDTSCVDSGGILDGDGNCDRSCIESGGVLE
FT                   DGACNTTCRDSGGKLNVDGTCDTSCRDDGGMLVGDECDYQCKEAGGILVGDHCDTTCVD
FT                   SGGKLNEDGTCDHSCRDQGGQLDESGECDTSCKDSGGMLIEGECDTSCKDEGGQLDENN
FT                   ECDTHCKDQGGIIDENGNCDTSCKDSGGKLDENGACDTSCRDDGGIIDENGNCNTTCRD
FT                   DGGIIVGDHCDTSCRDAGGILIEDHCDTTCRDSGGKLNEDGTCDHSCRDQGGQLDENGD
FT                   CDTSCIDAGGVLENGECVFPPTSSSTSETSSTTDQSSSQSDDSSVESSSTPMDSSTIES
FT                   SSSEIITSESESESVPIASSSSEVMTSESESESIPILTSSSQIPIASSSSEEVTSESES
FT                   ETVPILTSSSKIISSESGSQSVPISSSSSEIVTSQSESNIPSPNPEPRTTTITTIITED
FT                   GQIITITTTVTGFVPEPTGESEGNGESDDENPENRIENNSDENEFVDPEFADDIPDDPA
FT                   GPEDNGGNDPVNPEQDNNNGPANPGQDSTNGSGNSDQIDNNPPTPEENAGDGNSNGNDP
FT                   ADPSRRTSILGDERTRASPGGTSQPTGANGNVNGNSPGANVNGGGTGNSNNNNNNNNNN
FT                   GNAPNGGDGSNGDANQGPSRRTSLLGDERTRAGQAAPTGGSSPNNGVAGDTSNNGGAIV
FT                   SQQVDDGGAGSPRRTSILGDVRSRTTLNGEVLNFEGSGVRRAVAGNLALPLMMVGLVFN
FT                   L"
FT   CDS_pept        145388..146833
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444402"
FT                   /gene_name="PGD1"
FT                   /gene_synonym="MED3"
FT                   /locus_tag="CAGL0A01408g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 3"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG57721.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG124238"
FT                   /db_xref="HOGENOM:HBG398776"
FT                   /db_xref="InterPro:IPR020998"
FT                   /db_xref="UniParc:UPI00003B5E72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXZ4"
FT                   /transl_table=1
FT                   /translation="MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIK
FT                   KAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFE
FT                   ELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPG
FT                   AGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAA
FT                   AAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMN
FT                   NMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQ
FT                   LNQMFPMQNHNQNGQFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNM
FT                   GMNLNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQSQNQSQNQNQSMNMNMNNDSNN
FT                   PKSAYDLVDFNSLDLSSLNMDFL"
FT   CDS_pept        147313..149436
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502806"
FT                   /locus_tag="CAGL0A01430g"
FT                   /product="Similar to uniprot|P00931 Saccharomyces
FT                   cerevisiae YGL026c TRP5"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="tryptophan synthase activity"
FT                   /protein_id="CAG57722.1"
FT                   /db_xref="GO:0004834"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG052090"
FT                   /db_xref="HOGENOM:HBG303148"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniParc:UPI00003B5E73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXZ3"
FT                   /transl_table=1
FT                   /translation="MSHQLKQTFANAKNEGRNALVTFMTAGYPRVAETIPIMKGFQEGG
FT                   VDVIELGMPFSDPIADGPTIQVANTKALENGVTLVQTLDLLKKARDEGVTVPVILMGYY
FT                   NPILNYGEEKFIQDAADAGANGFIIVDLPPEEAIKVRNMMKKHGLSLVPLVAPSTTDSR
FT                   LELLAKIADSFVYVVSRMGTTGVQSSVASDLDTLVSRVRKYTKETPIAVGFGVSTREHF
FT                   ESVGSLSDGVVIGSKIVTLCGEAPEGKCGEVAKKYVEEILNGKKHKILSGEEYQLMKTA
FT                   TNELESDSDHHEFEEDHKHPIRFGDFGGQYVPEALHTCLKELEEGFEDAIADPTFWEEF
FT                   KSLYSYIGRPSSLHKAERLTEHCGGAQIWLKREDLNHTGSHKINNALAQVLIARRLGKT
FT                   EIIAETGAGQHGVATATACAKFGLKCTVFMGAEDVRRQALNVFRMRILGAKVVSVTNGT
FT                   KTLRDATSEAFRFWVTNLKSTHYVVGSAIGPHPYPTLVRTFQSVIGNETKEQFAALNNG
FT                   KLPDVVVACVGGGSNSTGMFSPFEHDTSVKLLGVEAGGDGIDTDYHSATLTAGRPGVFH
FT                   GVKTYVLQDQDGQVHDTHSVSAGLDYPGVGPELAFWKATGRAEFIAATDAQALEGFKLI
FT                   SQLEGIIPALESSHAVYGACERAKTMKPDEHLIINISGRGDKDVQSVAEVLPKLGPQIG
FT                   WDLRFEEDPSVGN"
FT   CDS_pept        149750..152194
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444403"
FT                   /locus_tag="CAGL0A01452g"
FT                   /product="Similar to uniprot|P53008 Saccharomyces
FT                   cerevisiae YGL027c CWH41"
FT                   /function="mannosyl-oligosaccharide glucosidase activity "
FT                   /biological_process="oligosaccharide metabolic process "
FT                   /protein_id="CAG57723.1"
FT                   /db_xref="GO:0004573"
FT                   /db_xref="GO:0009311"
FT                   /db_xref="HOGENOM:HBG056213"
FT                   /db_xref="HOGENOM:HBG327845"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI00003B5E74"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXZ2"
FT                   /transl_table=1
FT                   /translation="MLRTLILSTILELICFVQSQNFETYQDYRKHNNDSLLWGAYRPHT
FT                   YFSVKPRYVDKSPFILGLMWMDSYSNNGIEGLRHFVEPHEQGLEHYGWQTYDPRIGGVE
FT                   TIVDKKNNLNLTVSLAKSKDGANWVTRVSGKAMDPKRKSTGSIFLYLNQQTTKDDQKSM
FT                   LHLTPNELKGKMTFKGVSSELGKYNVDVIDKKGKYYRSRGKDKPYSKLVDASQTRHVSF
FT                   RVPEDNYWKAHDLVKTLISESLTDLLHNYDVAKVTKNEFPDFYSIRDMFNFNEGNFHII
FT                   QKTFDTSGSDGEFEIEIIYNSIESKQKIKPAETNALITQSLLEIDRKFNKHFQLSESQK
FT                   DKTEFVKSTLANLLGGIGYFYGNQRVDRITTVDEKHFDEIKLSHGDEDGPYSLFTSVPS
FT                   RSQFPRGFYWDEGFHLLQIMEYDYDLAFEIISSWFNMIDEKGWVAREVILGEEARTRVP
FT                   DEFITQNPNIANPPTILLAFSEMLQRASNSYKLVGELGDSGADKDSDTLEYNHKFLIEY
FT                   SREIYPKLVKHFDWFVNSQRGFTEEYEGLIEENAISDKVHLNEIFAWVGRTNSHCLPSG
FT                   LDDYPRSKPCDVTELHVDALSWVGVMARSLKQIATILDEDADILKYEEVENNVIENLEL
FT                   LHWSEKDQCFCDVVVDEYGEGISYDCHEGYVSLLPFALKLVPKESKAIASVLKLISDKS
FT                   KLFSPYGLLSLSKQDKYFGQDENYWRGPIWLNINYLCLDALRYYFPEIHGTSNNNKASV
FT                   LSKTAKTTYTQLSQNLIKNVYDNWKATGYCYENYSPVDGRGTGAKQFTGWTSLIVNIIN
FT                   WN"
FT   CDS_pept        153155..154933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046231"
FT                   /locus_tag="CAGL0A01474g"
FT                   /product="Similar to uniprot|P53189 Saccharomyces
FT                   cerevisiae YGL028c SCW11"
FT                   /protein_id="CAG57724.1"
FT                   /db_xref="HOGENOM:HBG124239"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B5E75"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXZ1"
FT                   /transl_table=1
FT                   /translation="MTLSFSIFLLLLATIQAFPVYRKREIVTRMHTASTTNTVTDFYST
FT                   TTEVIIAPTVEFIVSGSVTFTTTLYPEGVNPTAVASTITTIQKNVAPTPQPDNSGDNNS
FT                   KNNSNNSDGNSASQNNSENSSNSNNNSDNNNSDNNNSDNNNSDNNNSDNSNGNNSNNSN
FT                   NSNNSNNSNNSNNSNNSNNSNNSNNSNNSNNNNNDNSNNNNNNNNNNNNSGSQSSKMSS
FT                   STSSSSSKTITLSPTASSLKSSSSSTTTSSVSSVSNTVTFSKSSSAESTSTTTITTTEW
FT                   DTSYTTTFTTISGSSGINSATKTVSSSSKVSNSDSPTSSTSPSGLLKGVPHSLTYSPYN
FT                   NDGSCKSADQVFSDLSQIKAKGVSNVRIYGTDCNSLGTVQPAAAKLGIKINQGLWITAA
FT                   GVDSLDAGLQLLINYGKTNGWDIFNYITIGNEAIHSDYCSVEQLIAKIKSVKQALKDAG
FT                   YSGQVTTSEPPVVFENSPDLCTQSGIDFVGINAHAYFDQYASAQTAGSFVKGQVQLIQN
FT                   VCGTNNVVVTETGYPSAGKQNGNNIPSPENQRIAIQQILDEMNGQVTVLSSFDDMWKNP
FT                   GPYGIEQSFGIIDILA"
FT   tRNA            join(155457..155494,155518..155554)
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        join(complement(156340..156342),complement(155862..156176))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000055224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444404"
FT                   /gene_name="RPL30"
FT                   /locus_tag="CAGL0A01540g"
FT                   /product="60S ribosomal protein L30 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57725.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG553631"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="UniParc:UPI00003B5E76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXZ0"
FT                   /transl_table=1
FT                   /translation="MAPIKTQESINQKLALVVKSGKFTLGYKSTIKSLRQGKSKLIIIA
FT                   ANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSVLDAGDSDILTAL
FT                   A"
FT   CDS_pept        157645..158112
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197375"
FT                   /gene_name="RPL24"
FT                   /locus_tag="CAGL0A01562g"
FT                   /product="60S ribosomal protein L24 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57726.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniParc:UPI00003B5E77"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXY9"
FT                   /transl_table=1
FT                   /translation="MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKN
FT                   PRRVAWTVLYRRHHKKGITEEVAKKRSRKTVKAQRAIVGASLELIKERRSLKPEVRKAK
FT                   RDDKAKADKEKKKADKAARKAEKAKLAAAQGSKVSKQQAKGAFQKVAATSR"
FT   CDS_pept        158780..159037
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444405"
FT                   /locus_tag="CAGL0A01584g"
FT                   /product="Similar to uniprot|P32781 Saccharomyces
FT                   cerevisiae YGL032c AGA2"
FT                   /protein_id="CAG57727.1"
FT                   /db_xref="HOGENOM:HBG124240"
FT                   /db_xref="InterPro:IPR014404"
FT                   /db_xref="UniParc:UPI00003B5E78"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY8"
FT                   /transl_table=1
FT                   /translation="MKLSIVCLLFAMIIDYVSSDIVTTICDKTIPPNTLETTPYSSSTT
FT                   NIVANGKKMIGVFQYYRSIKYISDCEEKEDVVDTKIIHGF"
FT   CDS_pept        complement(159192..159914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197376"
FT                   /locus_tag="CAGL0A01606g"
FT                   /product="Similar to uniprot|P53187 Saccharomyces
FT                   cerevisiae YGL033w HOP2"
FT                   /protein_id="CAG57728.1"
FT                   /db_xref="HOGENOM:HBG204317"
FT                   /db_xref="HOGENOM:HBG253112"
FT                   /db_xref="InterPro:IPR010776"
FT                   /db_xref="UniParc:UPI00003B5E79"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY7"
FT                   /transl_table=1
FT                   /translation="MPPKKKACLKQDGDVCGVIQAYLEKQYKPFAINDIVSNLQKDYKF
FT                   SKPVVLKALDTLVDEGRIVSKPFGKVTIYCCKEQDLELPKGVDVNKVTYDLISELREEL
FT                   RLLEKEKSTLLEKKNALFSEPENDKLLDVLATLRESERDIDAKLDDLERNWDPTNQKEI
FT                   NELKNLEKNLKKDLASRKKLINDLLAIIKESGLLKKGETMAELLVCVMEIKSIFYLSLF
FT                   ILISLFFIDRILTKQNFI"
FT   CDS_pept        161327..162601
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502807"
FT                   /locus_tag="CAGL0A01628g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG57729.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124241"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B5E7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY6"
FT                   /transl_table=1
FT                   /translation="MSASASPEPHTPENNPSSVTNGSSTPNSGKSKAGKGDDAPRPHVC
FT                   PICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNPLPKGKR
FT                   GRKKKPETILAEQRAREEAERNKNNPNYKPPSKSSLRRKTKRNTTFELGESTPSSSLTP
FT                   PQQPNPQVQLPSSPMVGDETTNAPHSDGMTPIEPQRFLSSPPNHVRPVFGSANNSNSSS
FT                   RIRLNALSSLQMMTPLSGRNSSSTMNLSQQASTTFLDNPDGSKNQNIILPRPKSLTDFA
FT                   SMHANGSSTNLTTLMQQPNMGNLMKRPNSVLSLNELVTQSGAGTHGYDTGNNSSLEEDD
FT                   LKDPELENDQLRKKSKTATPTTGLSRSASGLNLSLKTKSLTNMQDMNKVNEKLLQYQKN
FT                   VVSPQIAPQDGLPPLRSLHLQFPTG"
FT   CDS_pept        163770..164126
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444406"
FT                   /locus_tag="CAGL0A01650g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57730.1"
FT                   /db_xref="HOGENOM:HBG124242"
FT                   /db_xref="UniParc:UPI00003B5E7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXY5"
FT                   /transl_table=1
FT                   /translation="MSSLDEQELIFEDDIAQEVEFDMTEIEVNRLIRSPLLMPQDRDHM
FT                   TPQSDAAYYGTSIANELMNTEGEWPSYDDYNRQERSQQSYDIPRGFSGCMQPLSSIVEH
FT                   MAETNYKLWLHSKN"
FT   CDS_pept        complement(164836..166920)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046232"
FT                   /gene_name="SEC9"
FT                   /locus_tag="CAGL0A01672g"
FT                   /product="Protein transport protein SEC9 "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG57731.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG192167"
FT                   /db_xref="HOGENOM:HBG398658"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI00003B5E7C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY22"
FT                   /transl_table=1
FT                   /translation="MGIKKFFKIKPPKEDTVEQNRENLMDIGIATKSTTKKPQSKFAAY
FT                   GQFAKDRATSKIYAPPGYEDFARPPEELEKKEGEEDDLNKSELDEKETKKDKKKKKKKH
FT                   QQEDEPAAVQDPYARTEKSYRYNPDPYGAGAAGEKAFSSSGVYNEFNNYENGPSYGNEY
FT                   GRRDRSEDLNAYNGTPGQPMKPVNRATPVLDRRDSAREDPAYGYNNQNRSNPYAGAGVG
FT                   ALAGGAAGGAVGAMGSVVSGSNPYGGASYGSGYGSSATTSAPVSKPISRTNTSASNPYG
FT                   NASYGSTPGVNDRPAGSNPYAAISGDSYLNGTRSGNISRSGTNPYLRRNASNSVPPQAG
FT                   YITPDSNNVALAEEENQQNQDELDLNDAPEDANEFVFEDKYMGRESKYAENSAALDELD
FT                   LNATINDRGEDLNATGYGNMYEQQQQPQWQREEEEYGYGTQDDMNRGYKTFDEIQREEE
FT                   ERQKEEEDQAVDEIKEQIRFTKQSSVASTRNTLKMAQEAEMAGMNTLGMLGHQSEKLNN
FT                   VERNLDLIKIQNTAADEKVAELKKLNRNILAVHVSNPFNSKRRRREREDMIKGRKMEDK
FT                   MRAEHMSQELHQSTQRIEGALGGGNETSAVREKYQREKVLAAAKKYQFENDEEDDEMEV
FT                   EIDRNLDKIQQISGRLKKLALATGEELDSQQRRIRDIEENTDEMDIKIHMNTTRLADIR
FT                   "
FT   CDS_pept        complement(167242..169167)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350591"
FT                   /locus_tag="CAGL0A01694g"
FT                   /product="Similarities with uniprot|P53185 Saccharomyces
FT                   cerevisiae YGL036w MTC2"
FT                   /protein_id="CAG57732.1"
FT                   /db_xref="HOGENOM:HBG124243"
FT                   /db_xref="UniParc:UPI00003B5E7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY21"
FT                   /transl_table=1
FT                   /translation="MEGIENGIRKLSESWDVNLATTVLEALRSIDLDVLRHSGLKDVTV
FT                   RSESSLQYILLCYVLLVVSPDDIAIETSETLEASCRDANDSPETRIDNDVGIFEVLLIH
FT                   RSSKTTNFQDFHYPIRELLSLISSKDYNCNTGNLATDLLICRSMHNGDTNDLLDSIDKY
FT                   QQYSVMSRVLQFPKIISDAVYQRCYKELIVKNSVCEMTQPLPNVRLSLMTLMEIIDQPD
FT                   INLLQFPRLVTLLGSSFVFLSESHTDISELHYELDELGTTQTLLALLSYVQYCLSKFLL
FT                   GFINGCKVLQKTSESYDISTGAAVKEAFKNITSFEFQLPPWFDKTMIFPLPPIFKSLFI
FT                   YGKDDSLIKASYSDMIVTILDSLMLCIEISSKILNQYRSASINPFEIEGKEEINLKHSK
FT                   FQLIKNVHLLTFIPIFSSLLLAEQMQSLSEAMVISNETWNMYAEILTNNIKEQVTNILL
FT                   VNESVALYHLLKIVSRVSIDDTGFQRISIKLLNYLFFQSKHTKFKIWCKQNELCRSTIK
FT                   TYVHLWNDGSSDYSLIYTKIINTKQPDVDHKKTILAEYLDLLPEDMKFGFSREEENKTI
FT                   MPAKFNAYAAPTFMPAESAVKANSQVNPFLPIDQNKVQESVQMNKLTPIMESSVKWTNA
FT                   PTTGQK"
FT   CDS_pept        169567..170202
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350592"
FT                   /locus_tag="CAGL0A01716g"
FT                   /product="Similar to uniprot|P53184 Saccharomyces
FT                   cerevisiae YGL037c PNC1"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG57733.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG462377"
FT                   /db_xref="HOGENOM:HBG752434"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI00003B5E7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY20"
FT                   /transl_table=1
FT                   /translation="MKTLLVIDVQNDFITPDHSMYVPQGEEVVSPIVELMKDPQWHRVV
FT                   VSRDWHPQNHISFAKNHGVEDYTETTYKSPRPGDDSTQPATLWPVHCVQNTRGAQLAPD
FT                   ILELVNSKHIKIVDKGYLSNCEYYSAFNDTWEWHKTELDEYLKKHHTTEVYVVGLALDF
FT                   CVKNTAISAAKLGYDTTILKDYTKPIYTDEDHQQQLEKDLKEHNVKVK"
FT   CDS_pept        170940..172349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444407"
FT                   /locus_tag="CAGL0A01738g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57734.1"
FT                   /db_xref="HOGENOM:HBG059571"
FT                   /db_xref="HOGENOM:HBG332675"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B5E7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY19"
FT                   /transl_table=1
FT                   /translation="MSKWQKRHIVLAVLVLVVFLRVHGNLRGLSGQFRAKYPKNYLVSN
FT                   GDTSGLNLKQLKFNSNDLRSDLSKAFPYDPSKPIPRRVWQTWKVPIDSPEFPGDLKPYV
FT                   SRWESNSYEVDEDEIYSQENEQNYYLLPDDQIESILESFYGEVPIIVQAYKLMPSNILK
FT                   ADFLRYLLLYARGGIYSDIDTFPLKDFRDWPSMNQEDMKKLKKAKIIPYKNFDKTMING
FT                   MNFIDPGLVVGIEADPDRPDWADWYSRRVQFCQWTIQSKPGHPVLRELILNITATTIYS
FT                   SAKTPAHLKSLIDNSADEKDFNINYRHRRRFDKEYDHSQKKQRKNVDGTDIMNWTGPGI
FT                   FSDSILNYLTNIIRKNRNILLLNSNLDSKQKEIPSSAAGSQEEEEEEDLTYSTKKFYNE
FT                   ISTSLLSSAKMPWEFFSLITEPLLVDDIMVLPITSFSPDVMQMQAESSQHELALVKHMF
FT                   HGSWKEEADGH"
FT   CDS_pept        complement(172608..174425)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502808"
FT                   /locus_tag="CAGL0A01760g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="ATP binding"
FT                   /function="arginine-tRNA ligase activity"
FT                   /biological_process="arginyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57735.1"
FT                   /db_xref="GO:0004814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006420"
FT                   /db_xref="HOGENOM:HBG450640"
FT                   /db_xref="HOGENOM:HBG695395"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniParc:UPI00003B5E80"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY18"
FT                   /transl_table=1
FT                   /translation="MLPSRCLSSTRILVFSRSYSVAKVSFPEHNVLDIIKENLSNKLSS
FT                   LSGVDNNKVFNSIDVTSGLEKGDLIIPLPKIVAHKEDLVSLARTWGEKLSDQPYMAKVV
FT                   ANGPFLQFFIEPHYLTGKLLPKILEERERYGQIPLVKDKKVLIEFSSPNIAKPFHAGHL
FT                   RSTIIGGFLSNLFQNFGWNVTKMNYLGDWGKQFGVLAVGFERYGDEKMLETDAINHLFE
FT                   VYVKINKDIENEKSSNGKSLIDEQAKEYFCKLENNDTDAIKLWKKFRNLSIRKYKETYS
FT                   KLNIDYDVYSGESQVSKETILLVNNMLQASGLLKESNGAKVVDLSKAQKSLGAVVVQKS
FT                   DGASLYITRDIAAAIERKREYNFDKMIYVVASQQDLHMKQLYQILKELKFEWATSLEHI
FT                   NFGMVQGMSTRKGTVIFLDNILEEAQQQMLSVMSKNDVKFTQVKNPSEIAYLIGTSAVM
FT                   IQDMQSKRKNNYKFKWERMLTFEGDTGPYLEYAHSRLKSIELKNKHLHESLTPVNYELI
FT                   GEQDALDLVRVMSRYHEVLKKALETREPSTLVTYLFKIAHQVSKCYRTVWVSGQPDDVA
FT                   KARLHLFMASRQILYNGLKLLGVTPVDRM"
FT   CDS_pept        complement(175018..176724)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444408"
FT                   /locus_tag="CAGL0A01782g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57736.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E81"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY17"
FT                   /transl_table=1
FT                   /translation="MLFSKKKEDPQAVPEASPENDFSPSLSQQDSSASPYENDVKKLEE
FT                   EAEQTPIVDIPKKPASAYVTVSIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQKR
FT                   ANGTHYLSKVRTGLVVSIFNIGCAIGGVILSKLGDVYGRKPGLIIVVVIYVVGIIIQIA
FT                   TIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRATLVACYQLMITLGIFLGYC
FT                   TNFGTKNYSNSVQWRVPLGLCFAWAIFMISGMTFVPESPRFLVEKGRIEDAKRSIASSN
FT                   KVSVDDPAVVAEVDSVQAAVEAERLAGSASWGELFSTKTKIFQRLVMGIMIQSLQQLTG
FT                   DNYFFYYGTIVFKAVGLEDSFETSIVIGVVNFFSTFVGIFLVGRFGRRTCLLWGAATMT
FT                   ACMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVFTCFYIFCFATTWAPLAFVICSETFP
FT                   LRVKAKCMALAQASNWIWGFLISFFTPFITDAINFNYGYVFMGCLCFSYFYVFFFVPET
FT                   KGLTLEEVNTMWEEGVLPWKASQWVPPSRRGADYDADALMHDDTPWYKRFL"
FT   CDS_pept        complement(180180..181871)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444409"
FT                   /locus_tag="CAGL0A01804g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57737.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E82"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY16"
FT                   /transl_table=1
FT                   /translation="MNSQPDLISPQKSSSSNEVDSHESKYLNQVGKNDMADEFVQNEMI
FT                   ANPNTGKGAFVGVIISCFMVAFGGFVFGWDTGTISGFVAQKDFIHRFGMKHPDGTEYLS
FT                   KVRTGLIVSIFNIGCAIGGIILSKLGDTKGRKMGLVVVVVIYIVGIIIQIASINKWYQY
FT                   FIGRIISGLGVGGISVLSPMLISEVAPSDLRGSLVSCYQLMITLGIFLGYCTNFGTKNY
FT                   TNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQIEEARSSLARINKCSPDHPY
FT                   IQQELDLIQASVDEARSAGSASWGELFTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYG
FT                   TIVFKAVGLEDSFETSIVFGVVNFFSTCCSLLTVDRFGRRNCLLYGAIGMVCCYVVYAS
FT                   VGVTRLWPHGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIAYVIISETFPLRIKAKAM
FT                   SIATAANWMWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFYVFFFVSETKGLTLEEV
FT                   NEMYAEGVLPWKSSKWVPASRRGADYDADALMHDDTPWYKRVVGRG"
FT   CDS_pept        complement(184013..185779)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197377"
FT                   /locus_tag="CAGL0A01826g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57738.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00017BD634"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY15"
FT                   /transl_table=1
FT                   /translation="MSNVDPTNPAYIPPTQTTNAGYIPPTQATISDEGSKSGSDYIYDA
FT                   NGVKQTRTDSMISGPKEELQKEVEEELHHKKKSDLIFVSLCCIMVAFGGFVFGWDTGTI
FT                   SGFVNQTDFLRRFGQQRSDGTYYLSNVRTGLIVAIFNIGCAIGGITLSKLGDIWGRRLG
FT                   LVTVVVVYTIGIVIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKQLRGTL
FT                   VSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIFGVMCVPESPRYL
FT                   VEVGKLEEAKRSLARANKTTVDSPIVLLELDKYQASVEAERLAGSASWGELVTGKPQML
FT                   RRTIMGMMIQSLQQLTGANYFFYYGTTIFRAVGLDDSFQTAIVLGVVNFVSTFYALYTV
FT                   DHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMIVFACFFIFCF
FT                   ATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWIWGFLIAFFTPFITSAINFYYGYVFM
FT                   GCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLPWKSSSWVPPDRRTAEYNLDDYSHD
FT                   DKPWYKRVFSRN"
FT   CDS_pept        complement(187900..190704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444410"
FT                   /locus_tag="CAGL0A01848g"
FT                   /product="Similar to uniprot|P38810 Saccharomyces
FT                   cerevisiae YHR098c SFB3"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAG57739.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG203772"
FT                   /db_xref="HOGENOM:HBG353109"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI00003B5E84"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY14"
FT                   /transl_table=1
FT                   /translation="MSFELAGSMSDLSLEQSQSNELKKGKSKRPTRAFHTFSGNPVQSS
FT                   PTTNMYAFQSNYQTPKVADNNGVFTPKRVESQTVNSPVLQYGNPPRTPVMGGNASPRAH
FT                   SPGYFFPNGNNENVFSHIVPTQRWEEQLRYLTKAFDTTRDSVPPSSTTEFYSSDSGSCD
FT                   PRLMQLSMYNIPEDQHLRAATKLPLGVTIQPFADITPGSVPVSGDGIAADTMKNLEGPM
FT                   RCKRCRCYINPKFQFNYDSKAICNICQIKQPAPYDYSSAVGPNGQRTDAEIRPELSKGA
FT                   VDFIVPPIYNAHPDKPSVPLHYVFLIDVTSLANENGSSLAVIEGIRSSVDYIIENQPNC
FT                   KLAIIAYDNKLKFFNLKPELETAQEYVISELDDVFLPFYNGLFADPAESKHVIDQTLSR
FT                   LAAFITNDKYYHVPQACFGSAIQAAKLALKTFTGDEGGKVVCSLNSLPTIGNGNLYLKK
FT                   DNAHVHHMRCDNDFYKKLAHDLLASYVSIDLIVTSGGFVDLTNVGHPTLVTHGSLKYYP
FT                   HFIQQNDEARLVQDMVSNIANTVGYQAVLKLRCSTGVGVDMYYTDASGYTDKDVILPVL
FT                   TKDTTIDVLLKYQEKLKAGTDIHFQCALLYTDVHGIRKVRSLNTNGAVSNNVREVFKFV
FT                   NQNSVLRIIVKDVIRTLGDCDFAAIRKSLDTKLVDILTQYRGLVSGNSSSQLVLPDSLK
FT                   TLPSYILSFQKQDLMKPNQQSTRGNERVYDLIRYETINPAELLYKLYPQIIPMHVLLEE
FT                   NDFSFYDANDKLLQIQEDSLDEVSVRNMHSNLTDGGCYLIFNGDSVYLWFNVHTNRLLL
FT                   QDLLGIDPDFPINQITLYGGMLPETGTEINNKAFNLIRYWGQMVNKKSLPIIPLRPNID
FT                   QYYSSIISQVLCEDKSINMIESGDNYFVALHRQIQEKLKKEDYIKISTKSRGGDDIHQK
FT                   FVQF"
FT   CDS_pept        complement(191335..193719)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444411"
FT                   /locus_tag="CAGL0A01870g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57740.1"
FT                   /db_xref="HOGENOM:HBG124245"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI00003B5E85"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY13"
FT                   /transl_table=1
FT                   /translation="MIYSLIFLCALASLSCAFTPNATSFNATESESVAVFSNSSSLLRY
FT                   NSSSVLFSNNYGKNWTVLLNNTATPQRHNGSNRTFNYFDFLNSEYFDDMESYYEPEVII
FT                   DPLYSESRAFYGFKNVFYVFDAQGRNETSGPISNLTNSSMLFDVSTNVHNKSLIISNFI
FT                   EVLDTKHYRGRSFISVNNGTSFREIKPSIPNLNDSVVDKFLCHFLASTPTTKFKNSSDL
FT                   VCFFTSTNRGFNNTVFFSGDFGVTLQAVNLSSGIYPLDVQITDSYVIMQTANTTAANWL
FT                   FNLGDDNGNSDDDSDDSDDLPPTPTVSDFPGISNFPGIPGISGFPSISGIPGISDIPHL
FT                   SGIPGISGIPGIPGMPGIPGASGIPGTSGIPGASGVPGVDGVDGVPGVDGVDGIPGVDG
FT                   IPGIDGISGIDGIDGAIGDLFSQISELFRTVDLYVSKDGKDFNRANIPAITYNVFSVSE
FT                   IMGGKLIFSNGFSPFTLGFTEVTNSTASNSSTNVSSVFISDSTGLNFTSANISYSDSLF
FT                   SQLYTFGDLNGTIIMAPLGIWNSTSKISTDNGATWNDLKVNSSSVKGNYSCIAHNNCTL
FT                   QLSAILGYSKTGIMVAQGNINLTPQDFNRTFNITNLDDLYDDYNLTDIETDSDDYFDNF
FT                   YLLTTTFLSKDGGMTWEQILDYSKAVALGNFGNIIVAEDNGLRNTTGFVYSLNMGATWD
FT                   RLPTSVPLFSNDVISTTPDSSGLQFILTGESRRGFRNVAEVVDFSSLFNGKLCSSSSDL
FT                   EQFKLNNGTCLNGSRYEINRRAPSAQCLLNINNTRWDISSC"
FT   CDS_pept        194560..194826
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444412"
FT                   /locus_tag="CAGL0A01892g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57741.1"
FT                   /db_xref="HOGENOM:HBG124246"
FT                   /db_xref="UniParc:UPI00003B5E86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY12"
FT                   /transl_table=1
FT                   /translation="MGHSPQTHHRHNKGKQSPPESALQKPALSTTYLTLSGKGPGVLYT
FT                   ANVERPQVFTHLSHYLGIVLLSKVAFLKVFPNRVIDHVITMLS"
FT   CDS_pept        195146..206377
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444413"
FT                   /locus_tag="CAGL0A01914g"
FT                   /product="Similar to uniprot|P38811 Saccharomyces
FT                   cerevisiae YHR099w TRA1"
FT                   /function="binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAG57742.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG023370"
FT                   /db_xref="HOGENOM:HBG330287"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B5E87"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY11"
FT                   /transl_table=1
FT                   /translation="MASADQISEYAEKLKDDQQSLASRYSTVSELYDLMQLLNTPEEFQ
FT                   MFLTSMVPIILEQLEKIDISFESNSYEQKLRFSLLEILNKCMVNQSFEPYAVRVADALL
FT                   DILPKENEKNGVIITKILTILFKSFKNILGEKVNSFIDIIIQFYKNRPELVEKTFYSDE
FT                   NGGLENSSSNDDDDTNNNSNDESTMESNNDSTNILDVKSSRGSVDDDVHENSTKGQKLR
FT                   PSLHSFKILSECPITMVTLYSSYKQLTTTSLPEFAPYIMTLLSIEVKQQKQAREEAEKR
FT                   GERFVSVSPLINDKAAYNDFILAQIKATSFLAYVFIRGYAANSLQNYIPIVPDLIIRLL
FT                   QDCPPELPSARKELLHATRHILSTNYKKLFLPKLDYLFDKSVLIGNGFTMYETLRPLAY
FT                   STVADFIHNIRSELKLNEIEKTIKMYTEYLMDESLALTVQIMSAKLLLNLVERILKLGK
FT                   ENPQEAPRAKKLLMIIVHAYVTRFKKLNRQYNTIMKQHKKIEKEKNIKQHSKKNPLPEV
FT                   ADDTDNFIKSVLKENYLEDTTAKNKEDKSEGKVEEIEVDEPVNIELFELHDLLPIQLSP
FT                   KSHNDPVKDAFYLYRTLMSFLKTVVYDLKIFNPSANEYTLAHPKLWASVSRVFSYEEVL
FT                   VLRDLFHECIIGLRFFSSENPVNKDLLSKKHFDITMPSLPVSATKDGRELMDYLAFTFM
FT                   QVDSATFNEVVNAEMDFLYDRMLEDSALLHVAQSFLTSELTSPNFAGILLRFLKRKLKT
FT                   LGNTDFNTSNILIRLFKLSFMSVNLFPNINEIVLLPHLNGLILDSLEYSKTAEEPLVYF
FT                   YLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNEKIVSARLPHERELYVELCITVPVR
FT                   LSVLAPYLPYLMEPLVYALQEYPDLVSQGLRTLELCIDNLTAEYFDPILEPVVDQVSKA
FT                   LFKLLQPQPFNHTISHNVVRILGKLGGRNRQFLKTPTDLKTVESLNVDLVTEAMANGKN
FT                   GSMSLSVTPGVEAAVSIIENHASDLEAKLSAYKYLKSVFLLFIKSSTKFPDDYHNIIKK
FT                   AIDLLQQDKLELKEDYSLECYVHRKEFYDQEALLIKIFESIFLATSTPELKEDAMKLLN
FT                   KLADHFSLLQVNKALQQKRFQSDTFNIDIKYSDPMFSTNILTKALMSALSSYKEDVRES
FT                   SILTIKRICERSLLIFGSKLVFKYSLVPDLMKDAIHLCFDEAFYNKRAGVLGIGAIIDN
FT                   IEASEEYLKSLRFELIDGLLFVLKDTPEEAPVLITNEAENLFNKILERTCSEISEDDLS
FT                   SKGLQNTLTDIVCELSNANPVVRKACKNALELISKNSNMPIVKLMDHSKHFLLSPIFAK
FT                   PLRALPFTMQIGNLDAVTFCLSLPGTFLQFNEELFRLLQEAIVLADAEDESLSTAQRAA
FT                   EYKTSQQLTQLRVSCIKLLALALKNEDFANAQQGNIRIRILAVFFKTMLKTSPVIIETT
FT                   YEALKDALSENSRLPKELLQNGLKPLLMNLSDHQKLTVPGLDALSKLLELLIAYFKVEI
FT                   GKKLLDHLNAWCRVEVLDTLFGQDIHEQTPTKIIVSIINIFHLLPPQADMFLNDLLLKV
FT                   MLLERKLRLQIDSPFRVPLAKYMNRFSSSVIEYFKKNMALRQLVVFMCSIIQKEEAKDL
FT                   ATRFENELSNFYEFYMTSIPSNQVRVVSFLTNMLDIFTTVWKIRGNEWLKDQKDFVMKL
FT                   KDMVALTIDTIKENKFYIDHLQLSQSIEKFQFIYVNLLTHYPNEQSLFFEFIEFLNAKD
FT                   ICMTDCFDDFIFKNIVSLSDKDKQNSLLEESIEYSLKTKSLNVSVFIYKKIVNPSLIFE
FT                   VAQNQDLKCYGEAKLPAWLELIDSKIWKTKNSLLLGTTANCHDKFRFELLQLTAILIKY
FT                   APKILTDVKRDIIKFTWHFIKLDDIILKQSAYLTTALYIKEFDFPIKVATQVFVSLLRS
FT                   SPSEGKFLVKQSLDVLAPVIDERLKTTEDPDIWINWVKRVMFENTSSQNIILYQFIIDH
FT                   PDLFFKSRNLFVSNIIHQMNKMSFMLNSNPENHILAIDLASLILRWENRSAGQANQQLL
FT                   DKDGDISMSDANDTNEIKTEHGEGEVVISTIPMNLRETCIAFLIRYICASNNRASDSEL
FT                   GSRTLQILSEFLSEQSWENVNVKLEYFEKFLLSQDMETENLLYYCINALDVLYIFFQNK
FT                   TDKWIYENLANIEHLLSKCIRAHHHDLQEALQKVLGLVLRAIRLQESQDSSEEEQPGKG
FT                   FISSLINVIEKNLQETASVAAGVTLSWTLFKTFPDSIESLLLPLMKTFSKLCKDQLSMT
FT                   QPKDAVAMEEAQLTTKLLEKVLFILSIRIGSLGDSRRPFLSTMALLIDHSMDQNFLRKI
FT                   VSITRYWIFNNVSFPTVKEKAAILTKMLAFEVRGEPTLSELFYNTVLKLFDDGQSTNPE
FT                   ITSRMEQPFLVGTCTSNKDIRKKFMSILNSSIKDDIKERIYYIICDLNWEFIADYPWLN
FT                   QALQLLYGCLDSTQSYEIINSYELSTPLTLKSLLEETNSESSADETTEELTAFITTHKN
FT                   DIEQICEIKKADIFDPLVEIFYKDHKSIQRAWVNFFPEAYKCIPKDEKYGFIRSLIVLL
FT                   SKPNPTRQNSNRLNVINMWLESFGKIESFEVPPHLVKYLAISCNSWYQSINILESMQNN
FT                   SQIENGKIIEAVEDSLLELYINLQEEDMFYGLWRRKAKYTETNIALSYEQVGLWEKAQQ
FT                   LYEVAQVKARSGALPYSEPEYALWEDNWIICAEKLQHWDVLTELAKHEGFTDLLLECGW
FT                   RVADWNTDREALEQSVKSVMDVPTPRRQMFKTFLALQNFADTRKGDQDVRKLCGEGIQL
FT                   SLHKWVSLPERYTPAHKWLLHGFQQYIEFMEATQIYGNLHTTTVQNLDAKAQEIKRVLQ
FT                   AWRDRLPNIWDDVNMWNDLVTWRQHAFQVINNSYLPLIPALQQANNNGNINTHAYRGYH
FT                   EIAWVINRFAHVARKHNMPDVCINQLARIYTLPNIEIQEAFLKLREQAKCHYQNTNELT
FT                   TGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAYDEANQAFATAVQIDLNLAKAWAQ
FT                   WGFFNDRRLTEEPNNISFASNAISCYLQAAGLYKNSKIHELLCRILWLISMDDSSGSIA
FT                   NAFESFRGEVPVWYWITFIPQLLTSLSHKEANMVRQILIRIAKSYPQALHFQLRTTKED
FT                   FAVIQRQTMNSSAEKKDKNEQIVSNGDHRQPWEYLQELNNILKTAYPLLALSLESLVAQ
FT                   INERFKTSTDEDLFRLINVLLIDGTFNYNRLPFPRKNPKLPTTTENNLMKFANTLLAPY
FT                   IRPKFNADFIESKPDFETYIKRLRYWRKRLESKLDRAPAVENLERICPHLSNFHHQKFE
FT                   DIEIPGQYLLNKDNNLHFVKIARFLSRVDFVYGTHFSYRRITIRGHDGSLHSFAVQYPA
FT                   VRHSRREERMFQLYRLFNKTLSKNVETRRRNIEFHLPIAVPLSPQVRIMNDSSSFVTMQ
FT                   QIYDQYCEKNKIDPYMIQDFISEKLNSAYDKALPPPDSTVLKVEIFSSIQSLYVPTTVM
FT                   KDYFLNLFTSFEEFWLFRKQFASQYSAFVFMSFMMMINSRSPHKIHVDKNSGNVFTLEM
FT                   LPSRYPYERVKPLLKNQELNLPSDAPIFHNNEPVPFRMTSNIQTLIGETALEGVFAVDL
FT                   FTIAKALIEPENELNTLLTLFIRDEIISWYSNLHRPIIENPQLRDMVQTNVDLIIRRVA
FT                   QMGHVSSTPTVITQFILDCISASVNPRNLAKTDISFMPWF"
FT   tRNA            complement(206530..206600)
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        206981..208201
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444414"
FT                   /locus_tag="CAGL0A01958g"
FT                   /product="Similar to uniprot|P25040 Saccharomyces
FT                   cerevisiae YOL022c"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57743.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG398669"
FT                   /db_xref="HOGENOM:HBG435361"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniParc:UPI00003B5E88"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY10"
FT                   /transl_table=1
FT                   /translation="MSDTEHSTFEDDEYISKPGDVYLAFVDTPVKEDDELTIEDTFIGG
FT                   EPVWLAEDSLPPKDMLRCGACKGSNNFKLLLQAFSPLDIAQVEEVQKKLSVQDLTHVNP
FT                   DDDRVLYVFICTKCQRKPNSVRCIRGIKKNKSTTNRESVDKKMQQLSEPKEFKINPFDI
FT                   TKSDTSNPFSNPFGSQDNSNPFSTNVKSGEIDDIKEPQLSTKAQLKAAQSEHDKKKNKE
FT                   FDTSKVFKSYLLYVEEESFKNKKPDHLKLPKNLKIDKEALDLTGTDEDDLEKDPIKLDP
FT                   RTEKLSKFLDDDTFQKFQEVVAYNPHQVLRYDLGGMPLLYADMKTEQPPFRVPNPSYNS
FT                   QSCRVFEMQLMPKLIMDLEDETDVNEGMEWGTILIYTDIQNFTPQCDENDVAYVEEYVK
FT                   VQWESRK"
FT   CDS_pept        complement(208311..210338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046233"
FT                   /locus_tag="CAGL0A01980g"
FT                   /product="Similar to uniprot|P25038 Saccharomyces
FT                   cerevisiae YOL023w IFM1"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG57744.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG141178"
FT                   /db_xref="HOGENOM:HBG635083"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI00003B5E89"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY09"
FT                   /transl_table=1
FT                   /translation="MLKHTLRTARPSSRWLLPYRTSMVNWYTSTAPKLSRNNKLKNKRK
FT                   LAELRPLTFSIPNYISVNKLSNLINCRVEDLIRDLRKLGFESITNNYILSKELTELILQ
FT                   EYNYDISSSASALTISNVYDELKSPINPKLLKKRPPVVTIMGHVDHGKTTIIDYLRKSS
FT                   MVEQEHGGITQHIGAFQVVTPLSGRKITFLDTPGHAAFLKMRERGANITDIIVLVVSLE
FT                   DSVMPQTIEAIKHIKNSGNQLIVAITKIDKMPDKSQRNKYLEKVENDLISQGIEIEKIG
FT                   GDVQVIPVSAKNGENMDTFEESIVLLSDIMDIRSENGPRTVAEGWILESKVRKTIGNAA
FT                   TVLVKKGTIKKGDILLCGNTYCKVRSMRGSDENNKSLNLAPPAEAVEISGWKDLPDVGD
FT                   EIIQVKSESVAKKYITKRQKLLDAEKGAELVEKMNEESVQVALQKQAQKSDDVDEFEND
FT                   DVEDEIPKVKDINFIVKTDVSGSVEAVVGSISHLGNEEVQCKVVSSSVGIPTESDLQLA
FT                   NITNSTILCFNLGPLPNDVLNNTLKVQVRQYNVIYKLIEDVTQILIDNLKPVFEKKIVA
FT                   SAEIRDIFEYSLKKKKLKIAGCKVLNGQINRNSLVQLTRGSDKNIVYDGKLSTLKHGKD
FT                   DVATVTKGHECGITFDSGFENYEKGDIIQVYENIQQQRYL"
FT   CDS_pept        complement(210707..211087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444415"
FT                   /locus_tag="CAGL0A02002g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57745.1"
FT                   /db_xref="HOGENOM:HBG124247"
FT                   /db_xref="UniParc:UPI00003B5E8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY08"
FT                   /transl_table=1
FT                   /translation="MMNHSYTHIEEAPEAKEQDIQTPPQFLNRRRSSNYIDALSSKRNE
FT                   ESDPISMDMQNARHQLSSIEQSDHDSKTSNCNKVAEEDEVDYMKRNNHSRQQERPLTGR
FT                   RRSSFEYEDFKKNIYNRSKLFE"
FT   CDS_pept        complement(211829..213901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444416"
FT                   /locus_tag="CAGL0A02024g"
FT                   /product="Similar to uniprot|Q92325 Saccharomyces
FT                   cerevisiae YOL025w LAG2"
FT                   /protein_id="CAG57746.1"
FT                   /db_xref="HOGENOM:HBG124249"
FT                   /db_xref="UniParc:UPI00003B5E8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY07"
FT                   /transl_table=1
FT                   /translation="MEVSSIIEEYNNAKDNDFRYMTLKQPVLIRSIQKDFDKLMANLYL
FT                   PVLTHNVDSELQQLVSFEVLPRAVLSLFDSQVEEYNSNGLMWAYIERYVFYPIIDSLES
FT                   GNETITNLLVQSLRNILNILISNDLNIKSVTRNDQILSDNYQSKYQDEEFMKLVSFMLK
FT                   ESQKETTVAGLQGYQETIQKLIEVSYDGRLRFLSPKALKMCIESLHDYEDYNTSSEMLL
FT                   NKVIENTDIAAVAQTQQYFSLSNLKFMSKNWYKFAECCSGIIPKLIDEITKETEKSDIS
FT                   KMLEIISNLKDYLLQGTITNEGHPKLPSDLSILLLDRVLNILTNIIPSIESRDVINKHH
FT                   NNNDLVTTESDTDIVVEDIDQQAYLDELDAGMSSNYDEDLSFTVDFEGDDTSSNLLEVT
FT                   EEELQDIDIYNRDYDVIVKHSLNILYDVFLAERTGVIQFGPHLATAREKLNCIKSKVSD
FT                   SNLDSKTFSLFTHFFERLEDFDRKVFETYEVLSIEELKTEISTPIPERKGAVVFTLIEY
FT                   LGKDQVSLEELQSIIELIDHLIDVRVTDGDNDKYLSGNDENLIAEALLPHLRMNKSFVH
FT                   TFKAGNISKKVDNGATLRTMIYTTLSRLDITKHLLVCKVIECLLHYGIKDKQDLIRDIA
FT                   QSILKKLLDEHYEEILALETTWYSKYLVPIIAESTLPTNNFLTAYPPFTFHTVDS"
FT   CDS_pept        215768..218098
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046234"
FT                   /locus_tag="CAGL0A02046g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57747.1"
FT                   /db_xref="HOGENOM:HBG396106"
FT                   /db_xref="HOGENOM:HBG434341"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003B5E8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY06"
FT                   /transl_table=1
FT                   /translation="MVVSKNSSSRDPLLFDIRLQSTEDGIILLKGSPEEASSIFLSGTI
FT                   VVSVQQPIYIKNLTLRLNGRILMHVPITTNTPKGSYTRYTKFQKRFYHHQWDDFNIKNY
FT                   FANLYDNYGKAAIESESNVSKEERKATENLLKRKRAKSTNSILSFTGTSSNASSNYHTL
FT                   VRGNYEFPFTAILPGSLTESVEGHPNATVMYYLEAVIERPKQSDLISKKHLRVIRTLRP
FT                   DALELTETISVDNTWPEKVEYSISIPSKAVPIGSSSPIDISITPLMKGLKLGPVKVQLV
FT                   EVGQLCSATGVSSLDDRLVSKTKIKDPFGHLAKLRKKKYTAKSLTDPNFNTGSDDDSDM
FT                   DFQDKWDINTTIEIPPNLLACVQDCTVLNNVKIRHKLKFVICLINPDGHMSELRASLPI
FT                   QLFISPFVPIKTKSPEAIERDIKLYGTNYANGSCRPTITIGRSSGNNSPIIQQESTFSN
FT                   NDNSGASENEDLIFSKSLSAVELSSMNVNTSESVSSLNGLMVPPNYANHVYDRLWNGRM
FT                   SPVDVVQKDTEPSFSPDNRSGYSTPVANRNNFNVEQLQGSLQNLVIENEQEGTNENETQ
FT                   QLTAIQQDMLLASPSLEPDYVHISRSASFSRLASSASLKSDWQVKDLTSVPSYDRAMKS
FT                   DLVGDDLPPAYPDEDNQDSKDAIVLERPQFIHQKSNSSLNVPGRRYSHNFSRSNNSSST
FT                   SLNNLSMATSGYGQNLGVNNYNKGSTASKKFAFEMTPVDSNHNFEESHSSIPMERASSR
FT                   ASLNSNHRSGSFASLVELFTKKR"
FT   tRNA            218415..218487
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        complement(218655..220676)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197378"
FT                   /locus_tag="CAGL0A02090g"
FT                   /product="Similar to uniprot|P38708 Saccharomyces
FT                   cerevisiae YHR020w"
FT                   /function="ATP binding"
FT                   /function="proline-tRNA ligase activity"
FT                   /biological_process="prolyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57748.1"
FT                   /db_xref="GO:0004827"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006433"
FT                   /db_xref="HOGENOM:HBG052301"
FT                   /db_xref="HOGENOM:HBG334108"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniParc:UPI00003B5E8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY05"
FT                   /transl_table=1
FT                   /translation="MPVDFAKLCLSDKPADAVAVKSLVFKPKTAKTATPVPIVVVALQS
FT                   TNTPSPAIAHHSGLKDPRLARDELFQSFFKCETAKGFTLAYLTNAESEFKLLIDNNLES
FT                   VAPETLLQLNDELSIKKSDLCSFLSQFDQYKQIVDFSVEIKKEAQPKQKKEKPAQTNAA
FT                   IEDAKLIGITVDKSLDFSGWYQQVVTKGEMLDYYDISGCYILRPNSYAIWESIQDYFNA
FT                   KIKAIGVKNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRAGSSELEEPIAIRPTSETV
FT                   IYPYYAKWIQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAFLDQDDAEK
FT                   EVLQVLDFYAGIYNELLAVPVVKGKKTEKEKFAGAAFTTTVEGYIPETGRGIQGATSHH
FT                   LGQNFSKMFNLSVENPLGPEHPKVYAYQNSWGLSTRTLGVMVMTHSDNKGLVVPPRVAQ
FT                   HQAVVIPVGITKKTTDEQRKSIHDAAKNVEDRLLKASVRAFGDYNDNYTPGWKFSQYEL
FT                   KGIPLRVELGPKDIEQGQVVVVRRNDSRKYVVKLDELESRIPEIMDEMHNDMYNKAKEL
FT                   FDSHRIIVDEWKDFVPALNKKNVILSPWCGVMDCEEDIKDASARKDDGEEFEQDEKAPS
FT                   MGAKSLCIPFEQPPLKEGQKCVKCDRAAIQYCMFGRSY"
FT   CDS_pept        221288..222934
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350593"
FT                   /locus_tag="CAGL0A02112g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="ATP binding"
FT                   /function="asparagine-tRNA ligase activity"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="asparaginyl-tRNA aminoacylation "
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57749.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0004816"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006421"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI00003B5E8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY04"
FT                   /transl_table=1
FT                   /translation="MSVYIHEVKGVDETGVAGTQEQPFKTAAFALFCSETEPKLFVYKE
FT                   ADGEYQEISASALKKARKGCEGLKKKAIKQKEQDAKKQQQDADNAAKQMAALNIKIEED
FT                   KSLPEAKKCKIGQSYELVGQRVKISGWIHRLRSNKKVMFIVLRDGYGYLQSVLTGDLAI
FT                   AQQSLDLTIESTVTLYGTITKVPEGKSAPGGVELLVDYYEVVGLAPSGDEAFTNKIAEG
FT                   ADPSLLLDQRHLALRGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPCMVQTQVEGGS
FT                   TLFKLDYYGEQAYLTQSSQLYLETCLPSLGDVYCVQESFRAEKSHTRRHLSEYTHIEAE
FT                   LAFLTFEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKMPFMRLEYKDAIEW
FT                   LKEHDIKNEDGEEFKFGDDIAEAAERKMTDTIGVPILLTKFPAEIKSFYMPRCKDDNRV
FT                   TESVDVLMPTVGEITGGSMRINTEEELLAGFKRENIDPKAYYWFIDQRKYGTCPHGGYG
FT                   LGTERILAWLCNRFTVRDCSLYPRFSGRCKP"
FT   CDS_pept        complement(223148..224017)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350594"
FT                   /locus_tag="CAGL0A02134g"
FT                   /product="Similar to uniprot|P32792 Saccharomyces
FT                   cerevisiae YHR017w YSC83"
FT                   /protein_id="CAG57750.1"
FT                   /db_xref="HOGENOM:HBG124250"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="UniParc:UPI00003B5E8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY03"
FT                   /transl_table=1
FT                   /translation="MAIPAVSIALYWGSTQLKVRPILSTTENQCILVFGDMRDPIIRGQ
FT                   VMDLYRRGFTLFVCLENAGTYKTHNDEDDFLNYIDPKSTSDWAKFSEFFRKFPTNTLSA
FT                   ILLIPKLSYHPTGQVTLEQLENELHSNVLIYYSTLVAISPHLPQNSNSNRIPTLIYNPS
FT                   LSVNMKNVEHPVEWLISGLMTTIFEELKHSHIFDPYMINVGLFQLGGQLSNYKYLNVKG
FT                   SNIYNDLYWPIYCFIKMKGGNTFQKLHVAICSLFGLKRTFYLGKFSYLFTLPFTSKLYK
FT                   LLNEWYVL"
FT   CDS_pept        join(224026..224036,225280..226444)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444417"
FT                   /locus_tag="CAGL0A02145g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57751.1"
FT                   /db_xref="HOGENOM:HBG056492"
FT                   /db_xref="HOGENOM:HBG656384"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI00003B5E90"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY02"
FT                   /transl_table=1
FT                   /translation="MIFCLTNPVPRGLANEAQKAAKILEGFIDPRQAYGPDQVIPPSVL
FT                   RNAKGLVIISILKAGFLFSGRAGSGIIVARLRDGTWSAPSAIAMGGAGAGGLIGMELTE
FT                   FVFILNTDEVVDSFSEFGTVTLGGNVSVAAGPVGRDAEADASASAAGIASVFTYSKSKG
FT                   LFAGVSVEGSAIVERRDENRKVYGDRGTTRRILNGEVEPLPSMDRLYRILESPNFTPQP
FT                   GEGYRTSSYSEEQARPDERYGRERYDRRYDEALYDEKPRSRARWDSGDMPHSRGGVERQ
FT                   DHLQRNDYDSHNRGGYPPPPCERNKDVQGHGSDAHALNRNRPVPPPPPAERSFPKVRAL
FT                   YDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYVADL"
FT   tRNA            complement(226620..226691)
FT                   /gene_name="tRNA-Gln (TTG)"
FT   CDS_pept        complement(226945..228762)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444418"
FT                   /locus_tag="CAGL0A02189g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="ATP binding"
FT                   /function="arginine-tRNA ligase activity"
FT                   /biological_process="arginyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57752.1"
FT                   /db_xref="GO:0004814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006420"
FT                   /db_xref="HOGENOM:HBG450640"
FT                   /db_xref="HOGENOM:HBG695395"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniParc:UPI00003B5E91"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY43"
FT                   /transl_table=1
FT                   /translation="MTSLTAQLKNLSIEEPKALEGSFPEVNVVDLMRNYIAQELSKISG
FT                   VDAAQIFPALEWTNTMDRGDLLIPVPRLVRTKGSNPREIATEWAEKFPCGDFLEKVEAN
FT                   GAFVQFFFKPEFLYKTVIPDVITRGEEYGACKMVDNKKIIIEFSSPNIAKPFHAGHLRS
FT                   TIIGGFLSNLYEKLGWDVTRMNYLGDWGKQFGVLAVGFERYGDEEKLAKDPIHHLYEVY
FT                   VRINKDIEEEGDSLPESESTNGKAREYFKRMEDGDPEALKIWKRFRDFSIEKYIDTYAR
FT                   LNIKYDVYSGESQVSKESMQTALKMFHEKNLTHEDRGATLIDLTKFNKKLGKVIVQKSD
FT                   GTTLYLTRDVGAAMDRYEKYHFDKMIYVIATQQDLHTAQFFEILKQLGFDWANKLQHVN
FT                   FGMVQGMSTRKGTVVFLDNILEETKEKMHEVMKKNEAKYAQIDNPDEVADLVGISAVMI
FT                   QDMQSKRINNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNAAEIPKEKWASADFSQL
FT                   KEPAAALLVRLLGQYPDVLRNAMKTNEPATVVTYLFKLTHQVSSCYDVLWVAGQTEEVA
FT                   TARLALYGAARQVLYNGMRLLGLTPVERM"
FT   CDS_pept        complement(229556..231214)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444419"
FT                   /locus_tag="CAGL0A02211g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57753.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E92"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY42"
FT                   /transl_table=1
FT                   /translation="MSDQESRSQSVLSASNSKADREDEFKAYVDEEGQPMVEIPKKPAS
FT                   AYVSISIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQTRANGTHYLSKVRTGLVV
FT                   SIFNIGCAIGGIVLSKLGDMYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISG
FT                   LGVGGIAVLSPMLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRV
FT                   PLGLCFAWALFMIGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENV
FT                   QAAVEAERLAGSASWGELFSTKTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVG
FT                   LEDSFETSIVIGIVNFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLWP
FT                   NGQDQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNW
FT                   IWGFLIAFFTPFITNAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTLWEEGV
FT                   LPWKSPNWVPPSKRDASYDADAMMHDDKPWYKRFV"
FT   CDS_pept        complement(235820..237469)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444420"
FT                   /locus_tag="CAGL0A02233g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57754.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E93"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY41"
FT                   /transl_table=1
FT                   /translation="MSEESQSALSASNSKVEREDEFKAYTDEDGQPMVEIPKKPASAYV
FT                   AISIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRMGQTRANGTHYLSKVRTGLIVSIF
FT                   NIGCAIGGVVLSKLGDVYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGV
FT                   GGIAVLSPMLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLG
FT                   LCFAWALFMIGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAG
FT                   VEAERLAGSASWGELFSTKTKIFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLED
FT                   SFETSIVIGIVNFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLYPHGM
FT                   KQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWG
FT                   FLIAFFTPFITNAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLAW
FT                   KSPNWVPPSKRDASYDADALMHDDKPWYKRFY"
FT   CDS_pept        244683..245501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444421"
FT                   /locus_tag="CAGL0A02255g"
FT                   /product="Similarities with uniprot|P25577 Saccharomyces
FT                   cerevisiae YCL049c"
FT                   /protein_id="CAG57755.1"
FT                   /db_xref="HOGENOM:HBG124251"
FT                   /db_xref="UniParc:UPI00003B5E94"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY39"
FT                   /transl_table=1
FT                   /translation="MKFGGFSTLTQAAAALALFNAVDAFDASSPGRTDLNTTEIDTGAF
FT                   LGDLDVVKVPESANLSEYILTYAGSDKALLDEKTGYVLLNITQNYAGNDTMAKRDVKVY
FT                   GYDGWYQTWHQMQTVNKGEWWSPWYPISQCVSNGLNDAEASISVNFAYTYTWSLEWGLN
FT                   AGPDVVGASIGYSISDSVGWGGQFQCNIAPHTRGQIWYQQRVAWADIQKQDCRRENNGK
FT                   VTCSPWSAFNRVNAPLKGADNVHLGCSSGEDNIQCDAHFDSRLGQIFRNI"
FT   CDS_pept        248522..249340
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350595"
FT                   /locus_tag="CAGL0A02277g"
FT                   /product="Similarities with uniprot|P25577 Saccharomyces
FT                   cerevisiae YCL049c"
FT                   /protein_id="CAG57756.1"
FT                   /db_xref="HOGENOM:HBG124251"
FT                   /db_xref="UniParc:UPI00003B5E94"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY39"
FT                   /transl_table=1
FT                   /translation="MKFGGFSTLTQAAAALALFNAVDAFDASSPGRTDLNTTEIDTGAF
FT                   LGDLDVVKVPESANLSEYILTYAGSDKALLDEKTGYVLLNITQNYAGNDTMAKRDVKVY
FT                   GYDGWYQTWHQMQTVNKGEWWSPWYPISQCVSNGLNDAEASISVNFAYTYTWSLEWGLN
FT                   AGPDVVGASIGYSISDSVGWGGQFQCNIAPHTRGQIWYQQRVAWADIQKQDCRRENNGK
FT                   VTCSPWSAFNRVNAPLKGADNVHLGCSSGEDNIQCDAHFDSRLGQIFRNI"
FT   CDS_pept        250851..251690
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046235"
FT                   /locus_tag="CAGL0A02299g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57757.1"
FT                   /db_xref="HOGENOM:HBG124252"
FT                   /db_xref="UniParc:UPI00003B5E95"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY38"
FT                   /transl_table=1
FT                   /translation="MSALNGRAYVPKFALKLVCLLLCFELVSIVSAMGGIPTGLPEPQL
FT                   QNNLDVDDSDNLVTIPDEGNFHDYIEKYAGKNTPLLDKRSGNLIVDIKKVKDASDSSSI
FT                   QPHTTKVYSKNKKTHTFKVMSLNSTEEVWSDWFPVSKCDIGLGDNDNQIKLKYAYHYNW
FT                   TKEDTLDADFKHIKSLLKLPISKEVGIGNTFKCGAEAGQTVQVWLQQRCIKALIQTQEC
FT                   TKESSRVIKCNDWDNGTYIMAPLKGIGNVQFGCSGTDNHTECDAKMDPKLGKKFKKS"
FT   CDS_pept        complement(252192..253862)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444422"
FT                   /locus_tag="CAGL0A02321g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57758.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5E96"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY37"
FT                   /transl_table=1
FT                   /translation="MSSSNKDSESFENYPSQNSDNSYKRDDLDPDTLEKEAKIENPNGK
FT                   SAYIAVSISCALVAFGGFIFGWDTGTISGFVNQTDFIRRIGSKHADGTSYLSKVRTGLV
FT                   VGIFNIGCAIGGVVLSKIGDTKGRKAGLVTVVLIYIVGIVIQIATIDKWYQYFIGRIIS
FT                   GLGVGGISVLSPTLISEVAPKELRGSLVSLYQIMITLGIFLGYCTNYGTKNYSNSVQWR
FT                   VPLGLCFAWALLMIGGMTFVPESPRYLIEAGDDDAARKSLCAANKLPAEHPFIEQEFTI
FT                   LKAKVEEANAAGTASWSELITGKPAMLRRTIMGIMIQSLQQLTGDNYFFYYGTTVFKAV
FT                   GLEDSFQTSIVFGVVNFFSTFLSLFTVDRFGRRNCLLYGAAGMVCCYVVYASVGVTRLW
FT                   PNGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIAYVIISESFPLRIKTKAMSIASASN
FT                   WIWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFYVFFFVNETRGLTLEEVDEMYAEG
FT                   VLPWKSSKWVPESERDDSYDADALLHDDTPWYKRVIGRN"
FT   CDS_pept        254861..255127
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502809"
FT                   /locus_tag="CAGL0A02343g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57759.1"
FT                   /db_xref="HOGENOM:HBG124253"
FT                   /db_xref="UniParc:UPI00003B5E97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY36"
FT                   /transl_table=1
FT                   /translation="MELYGCSTLETNPAPTLPSPIEKALVRDDQANQHLQIRKTDASSV
FT                   HLCLCESLFSSVPKNGIYGENSAGISINYHYKSNCSRKQKKKK"
FT   CDS_pept        complement(256250..257581)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444423"
FT                   /gene_name="SVF1"
FT                   /locus_tag="CAGL0A02365g"
FT                   /product="Survival factor 1"
FT                   /biological_process="response to oxidative stress "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57760.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="HOGENOM:HBG055858"
FT                   /db_xref="HOGENOM:HBG329155"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="UniParc:UPI00003B5E98"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY35"
FT                   /transl_table=1
FT                   /translation="MLKWIQGGLSAVTGIAEPEYGKEYIHTVTERVEGKQPYRETTRED
FT                   FFWKSPDHTNVETVTFYFSNLATGVVGFAQIIHSNIIGLHTAAQFTFRIFDSKNPEKLN
FT                   LWTSTKLENFRIEDANFYADDLSVELNADNTQYRLISKVNEQSIVDLTVTRLTPGAKLG
FT                   DDPSTYYGDNVEQPWGSMRHVFWPRNTCVGEIKVKIPKETAEKTAEEQAQEKEQQEEQE
FT                   QEGEDEAVEETIEYEERTLKFGEDDPSYCMFVMAFQGMKPHHAAKAWNFMFFHSKENTM
FT                   VLMEFTTPKSYSNTKVSIGIITNDKEILAVTHDNSALHLNQEIDSVGWNVPKQIRVELK
FT                   GHKSSAKDEDVEADNDEHKIKAVVEGPLENMVERIDVMGEVPNFVKNIVSGVAGTKPYI
FT                   YQFGDAENFHFQLDDGEKKNGLAWVEVTFISESEVVTEESYNEE"
FT   CDS_pept        258667..259626
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444424"
FT                   /locus_tag="CAGL0A02387g"
FT                   /product="Similar to uniprot|P10662 Saccharomyces
FT                   cerevisiae YDR347w MRP1"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAG57761.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058438"
FT                   /db_xref="HOGENOM:HBG396577"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniParc:UPI00003B5E99"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY34"
FT                   /transl_table=1
FT                   /translation="MFCSRSVPRLRACARRWYQRPSLQHVSPDKELPGVFTARGLQNAW
FT                   FERADHYAAQLNKYTQGTQETALENIIYEESRSYIKRHITNYASLLYNLEFAMQSLQGN
FT                   PQNKIPQGPIGRESLLETPATEQLIKNEPRSSGNTDLHQLLENSFGSIAEFKTLLLNSA
FT                   LAISGEGFTWLVARKVTQSEMDRVSNSTGDKILFDKLFVLNTYNAGSPFNFNRAGSITT
FT                   LNKTEKAKEAKSEQNSTTEVDEFSKTLKDIRRAKEEAVDPELAYIPLLAIDSSPKAWLH
FT                   NYGAFGKRQYLENVWEATEWKVVESRLAGLTRSLDSSI"
FT   CDS_pept        complement(260084..261421)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197379"
FT                   /locus_tag="CAGL0A02409g"
FT                   /product="Similar to uniprot|Q05518 Saccharomyces
FT                   cerevisiae YDR348c"
FT                   /protein_id="CAG57762.1"
FT                   /db_xref="HOGENOM:HBG190999"
FT                   /db_xref="HOGENOM:HBG512136"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniParc:UPI00003B5E9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY33"
FT                   /transl_table=1
FT                   /translation="MTGRPFSVNNPFRSAGMETRYQHDQQYQEWVRGNTSPSRGGSVSP
FT                   PLGMAEKPVPVRQNTNPFLDDGDMHDSGHMGAPVQPVQPVHSPPQGYGKALSAEEEKEQ
FT                   LRQKYQRDREREERPSHRRDLPPSYEEVAGGRGKGYPREKESYSGNVHREHSRSSGHRE
FT                   EYSRSAERAPHRHHSHRRHQDNSSPAKKEKRKNKVATPKNVDTIDKLDVTGLFGGSFHH
FT                   DGPFDAVTPHRNKNTKAAPVLAFPADGPNSTIGGVTSKKSAMNEVFGVEEDDDDNDLYR
FT                   ISGQVAGSTTSVNTKDAIKPNVGDIKQMDIKSKTEKIHGPTTVGLGSTTFLDGAPASAA
FT                   AIRQDIKQHSHTNRSGVQRHKSLSQRLGIGSDSSRPSRSDSYKGAGLSRTRSGPTEERP
FT                   HQARHNSSHADDDEEDVYLGLPTSSLKKSSGSKFMKRVRSLKVGRK"
FT   CDS_pept        complement(261812..263575)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141723" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445439"
FT                   /locus_tag="CAGL0A02431g"
FT                   /product="Similar to uniprot|Q06325 Saccharomyces
FT                   cerevisiae YDR349c YPS7"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG57763.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG124254"
FT                   /db_xref="HOGENOM:HBG203259"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B5E9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY32"
FT                   /transl_table=1
FT                   /translation="MATRTMLFLLLLVQYVFASNSSEVPLEQYFKSDLRFPNIPVGLTR
FT                   DGMYYVNATLGTPGQWQQLGLGLAQPYVWVVSGDADSQCNRLDSGCLSGPLYYPQESRT
FT                   SSTGGDKYSINFIDGISLNGTRYMDVMRLMNVSSSLNVSGVDSGVSFRNHTLTVQNLSF
FT                   FNADYSSGYLYGSLGLGGTLNSDTELEGDFINHSFFFLDALKEARLINSSSYSLWLGSQ
FT                   KRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYPVVPMGPI
FT                   YITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSC
FT                   DVASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGY
FT                   NVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEIITRQASIVTFTDSLNKTSVAT
FT                   FSTVPSSMTSGYIPYATYESDSAYDSMQLYPSKVGSRITSIPGQIAGTVYPGGVIAGDG
FT                   RSFYDTSRTTTKLQTSTQFDSFSLSGTLGWNDSLASTSSTSRRNTAQHTSPAWLVSLLG
FT                   TACVLLGSMVI"
FT   tRNA            263902..263974
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        complement(264152..265873)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445440"
FT                   /gene_name="ATP22"
FT                   /locus_tag="CAGL0A02475g"
FT                   /product="Mitochondrial translation factor ATP22 "
FT                   /biological_process="protein complex assembly"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG57764.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="HOGENOM:HBG124255"
FT                   /db_xref="InterPro:IPR017207"
FT                   /db_xref="UniParc:UPI00003B5E9C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY31"
FT                   /transl_table=1
FT                   /translation="MMGRVNSQLLRVVQDRSVANGEKLQRLYKLISATGSKTATATTTA
FT                   TTTTTATATGGGRVLALDSHVHRWFNTHVRGSKFYSHYHFLIKHGVHLAHATRFFNKLL
FT                   TGSEVEFQLATFQIFLINEENQQVFFEKFHRLYTFDMMLQIFDRLIARRDFRYVKFYLA
FT                   ALTRKMSELATDRTRTVQDAELMYIKFNNSLLYYLLMEGNVPMFLRTFKNEVEYIKSST
FT                   LQNSDSAEVQQALLKPVHLFVQMLRKNNSPDLIFELLPALQTKSRSKVFNAYLTSTVAS
FT                   TIRTFNDPTLMLKFLLTTAKGTKFPELLNELGLWRYIVHGEPGKIDPKSLQEDRDKFEK
FT                   ANSVSALKAMKRVDVVLLTELYRVFLSYSSSVMSPDKFRHCCIDLYSHYVQFCEQNKHK
FT                   LRGWKFDTGVLNVILYHIRYRLRDDKLAYEVLVDFYGRESMVQSVKNTAKKCPFSMVIY
FT                   DNGTVTTQQLHALLQLMQRYNVPLSFQICYTMVKRLLQMNEPEQAFEWYTRILESGFDV
FT                   RHHGLVELVLQQGWSLPHHFNHDLLEDDKLDSIIEEEPTEECAELVEDVKELMQSV"
FT   CDS_pept        266055..268655
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445441"
FT                   /gene_name="SBE2"
FT                   /locus_tag="CAGL0A02486g"
FT                   /product="Protein SBE2"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi apparatus"
FT                   /protein_id="CAG57765.1"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058314"
FT                   /db_xref="HOGENOM:HBG203774"
FT                   /db_xref="UniParc:UPI00003B5E9D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY30"
FT                   /transl_table=1
FT                   /translation="MQKISVASMLKPVRLHTVREEAVAGAEAKAKVGAKTGAKMGAKTG
FT                   AKSGLEADTAAGETLDAGASSEVLQLHVPRSRSHSQSISKSNSVISGSSYSSAGRIIGV
FT                   NSARRPSDNLMLQISAHSDGDSDDEAGGDTPSKAAETHANAVPKPVRPTSDNSIRSNDT
FT                   ALFSANPTDSSNGSASDSDYDEQHDTSMVSGKSATTMMSPSLALSIGSGMTRSDVITPN
FT                   KYSNLDSGSLGIAETPKARYIFSNVNRNRSQSSIKSSENSSPLRFVDGPNQRRTLPGAS
FT                   NTYLHSNSTSAILPTSRAMTPSHRYRLRKEMRDVALKKSIKQKEKFYEEQDSNLDLKDD
FT                   NVDASLIWNIPMASYSTSSFLNTTDSKHKDTNIKVTSPENNRVINNKIERQDRRFPQKN
FT                   QVHSRSQPNLPRLQQRPMKRPVHQQQQPITCFEDIPATPIPGVSNVTDTEFIQDTIQNL
FT                   SSVYLHSQEMKSRGQLEKRQSSTQYLPLNVKEMSDLGMEDLVLVSDKKLEAVSSSRPTY
FT                   LPPKSTKEKQMHEHEISKYMKMASDEQIQRKISQTKHMEEDKANHERYAHLLQRGITRK
FT                   SSLFDLRKISWKTAISDELRCSIYHTILESDAQLVSSKYLENFDYLNSILDQMDFPTDK
FT                   ESEIKQIIEKNITTKIGYSSVKDKELTLLLKLKSISKQGLMVGDAQLFHNFLNCKSFKT
FT                   LKDIWEIANLIQLTCFNDTCKDKFDSRIIDPRGITARILHSPSFKAEMTSSIMNFNTWW
FT                   NIMSRIDNNLFMWIMDIIVIENCQCFTNKQINKDQLRDKNWDYYVNKYVVVNYKILASL
FT                   AASVLLDYHFGFNDLKHLERIDKKFCIPLYSEDTECNIINSSFIKKWHHQYKKY"
FT   CDS_pept        269090..270040
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065936" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046505"
FT                   /locus_tag="CAGL0A02508g"
FT                   /product="Similar to uniprot|Q06328 Saccharomyces
FT                   cerevisiae YDR352w"
FT                   /protein_id="CAG57766.1"
FT                   /db_xref="HOGENOM:HBG058313"
FT                   /db_xref="HOGENOM:HBG396669"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI00003B5E9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY29"
FT                   /transl_table=1
FT                   /translation="MSCARSLWPFISNINGSVSFLSSFVSLFPQIIETYKDKTVEGLSP
FT                   LFLMCWLSGDITSLIGALMTGQLKFQIALAIYFLFNDLFVCCQYYYYGVLHENKLATVG
FT                   HETVPVISSLIDDGIITVDENGLQNTDSRPETNMEGSRLSNSSIYSGSRATRSLLANAL
FT                   VSVKSSNAQQILSSLQVPPNAPYPGHTGRGQMGVTLSWLGASFYVGARIPQLIKNYQRK
FT                   STDGLSPFLFATTLLGNITYNISIFTSCNFLDTEDKMAFIFNELPFIFGSAGTVAFDLI
FT                   YFYQYYVLYSRDNKLRELEREIYDNNEDETTPLID"
FT   CDS_pept        270481..271440
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350853"
FT                   /locus_tag="CAGL0A02530g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="thioredoxin-disulfide reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="removal of superoxide radicals "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57767.1"
FT                   /db_xref="GO:0004791"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019430"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG237873"
FT                   /db_xref="HOGENOM:HBG669726"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI00003B5E9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY28"
FT                   /transl_table=1
FT                   /translation="MPHNRVTIIGSGPAAHTAAIYLARAEMKPTLYEGMLANGIAAGGQ
FT                   LTTTTEIENFPGFPEGLTGTELMDRMRAQSTKFGTNIITETISKVDLSAKPFKLWTEFN
FT                   EDGEPITTDAIVMATGASAKRLDLPGEDKYWQQGISACAVCDGAVPIFRNKPLAVVGGG
FT                   DSACEEAEFLTKYGSKVFMIVRKDHLRASTIMQRRVEKNEKIEVLFNSVSLEAKGDGKF
FT                   LNALRIKNVKTNEESDLPVNGLFYAIGHNPATDIVKGQVETDESGYIKTVPGSSLTSIP
FT                   GFFAAGDVQDSRYRQAITSAGSGCMAALDAERYLTELE"
FT   CDS_pept        complement(271684..272874)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445442"
FT                   /locus_tag="CAGL0A02552g"
FT                   /product="Similar to uniprot|P32468 Saccharomyces
FT                   cerevisiae YHR107c CDC12"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAG57768.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00003B5EA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY27"
FT                   /transl_table=1
FT                   /translation="MTMTTMTTMVGVAALPNQVFKKVHDAGSVFNMLVCGESGLGKTTF
FT                   INTLFPGLKQRKGKKVSTEAVDIVRAQLTEKGFTMRFNVVDTPAFGDKVDNNRAWQPVV
FT                   DFIDDQYDSYLRQEQQPFRDVRFDFRVHAVLYFIRPTAHGLKPLDIWTMKHLSQRCNLI
FT                   PVISKADTLTAQELQLFKSRIRQVIEAQEIAIFTPPLDYTDGAEGAAGSLDEANAPALE
FT                   HARQLIESMPFAIVGSEDRYDNGSGTMVLARKYPWGLVEVENDEHCDFRKLRALLLGTY
FT                   MLDLITSTEQTHYENYRRTRLEGINRDEPNDSEKLASLTYKTPARKLSNNPKYKEEENA
FT                   LKSYFTEQVKAEEHRFRQWEQNIINERTKLNGDLEEIQAKVKRMEEEVRRLQARKH"
FT   CDS_pept        276915..278054
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197677"
FT                   /locus_tag="CAGL0A02574g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="anthranilate phosphoribosyltransferase activity "
FT                   /biological_process="tryptophan biosynthetic process "
FT                   /protein_id="CAG57769.1"
FT                   /db_xref="GO:0000162"
FT                   /db_xref="GO:0004048"
FT                   /db_xref="HOGENOM:HBG123375"
FT                   /db_xref="HOGENOM:HBG559996"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR020072"
FT                   /db_xref="UniParc:UPI00003B5EA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY26"
FT                   /transl_table=1
FT                   /translation="MSSEDELVQLTKTLLEPVPTLTPKQLYRAMVIILELTASQDIDSL
FT                   IDTLTLSTHVKIASFLSCLKASRLDHRAEYIAEAAKAVLGFSHVVELDLVEKTHREHRE
FT                   EVVLDIVGTGGDGQNTFNVSTSAAIVAAGIPGLKVCKHGGKASTSNSGSGDLINTLGVQ
FT                   SSKVTAETVPALWENKFMFLLAPYFHYGFGKTSNLRKLMHIPTIFNILGPLLHPVAHVD
FT                   KRVLGVYSKDLAPEYAKAASIVYPNSETFVVWGHVGLDEVSPIGKTTVWHVTTTGQVDI
FT                   FELEPAMFGLQEHPLDVCKSYGPERNAEILRDDILSGKYKLGDNHPVYDYILLNTAVLY
FT                   CLSQGHRNWKQGVEVANESIQSGNAVKALEHFIKDVQDL"
FT   CDS_pept        278467..281085
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503079"
FT                   /locus_tag="CAGL0A02596g"
FT                   /product="Similar to uniprot|P32380 Saccharomyces
FT                   cerevisiae YDR356w NUF1"
FT                   /protein_id="CAG57770.1"
FT                   /db_xref="HOGENOM:HBG059157"
FT                   /db_xref="UniParc:UPI00003B5EA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY25"
FT                   /transl_table=1
FT                   /translation="MSDIKNFEFTPIGYIKSKSGENDAKETLMSPTGASVRSPGSVGHV
FT                   RKARRRSINDTVNSSRVENDNDTFDETLPELEMRKLPQYRRVPESRTSARNSGAAPQEE
FT                   QNRNDYSDILSKTSNPIKDQEQKIKDLEHENTVLKVKNVSYRSLLANYSGGSSQNNINL
FT                   VEEVSIWKTKYLETNEKLLKVKQDFESYVQKMEQEKEVNTDQEKTKEPEVIPIDNPEYI
FT                   KEREHILEELERVTEDFKNLRDRYNDLEIKFLSIQNELDEKKQEFESSTARLNEEIHTL
FT                   KSTIDDKDATISEFKRKLGNAEDQLASIDDQNGNQNQKLLHDLKEREDAIDGLKEDIIE
FT                   KENAIVHYKEEIQDKQNQLKESESKYAEVQKEFEDFKRELKKQTFEFEDGKKSTSRQLQ
FT                   ELSVEKIQLEKQVCNLRGQIEKLEQQHRLTQSENDGLRTKLKHIESDLKNEKSRTEVKI
FT                   KDLTSDLEDARKNLGEANNTIKELHHEIIKNATKSKDQLSEEVVEKDKEIDQLKHRVQR
FT                   LDEELRTSQAELDKATKNREVDHELEIRRLQNKHEIEQESLKRELAHMTDEKERLVDLH
FT                   RLDIETWERQIEALRKENENLISREHKESNNIEITLQDKNIQIRRLEADIVQLNEERND
FT                   ILNKLRSLEQAKDRYKSEMKDALETISRLRVDLENNKSLKDSKDSLIERKYEKLKDEFK
FT                   LMKKGYLDEMIKLQSRNRELNSDLQKRMDPSISTSANTTLADKLDYYKLKYNDEVRHNN
FT                   DLRVINEYLNRVLRASAQDIRLNLLKVENDLNIDIHKENVPLSAPLSSSGGRPYSSSYT
FT                   REFDKYDYRYRQKGKRFKTVALAVLAVIRMYRAAKKHNWNEQRIRYLQRKIIAKEDRIT
FT                   W"
FT   CDS_pept        complement(281161..281463)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445443"
FT                   /locus_tag="CAGL0A02618g"
FT                   /product="Similar to uniprot|Q06333 Saccharomyces
FT                   cerevisiae YDR357c"
FT                   /protein_id="CAG57771.1"
FT                   /db_xref="HOGENOM:HBG124192"
FT                   /db_xref="HOGENOM:HBG203262"
FT                   /db_xref="UniParc:UPI00003B5EA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY24"
FT                   /transl_table=1
FT                   /translation="MALQDESLGIDQLSVDYDYLVYRISDRVKSLELEATRLVQRQNEL
FT                   VGQVSERVIDENIERFRGVLRGLDELEEYFAMMEQIGMITDSFKERLDSAMAALK"
FT   CDS_pept        281637..283403
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445444"
FT                   /locus_tag="CAGL0A02629g"
FT                   /product="Similar to uniprot|P38817 Saccharomyces
FT                   cerevisiae YHR108w GGA2 Arf-binding protein "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAG57772.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="HOGENOM:HBG059158"
FT                   /db_xref="HOGENOM:HBG329335"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR018205"
FT                   /db_xref="UniParc:UPI00003B5EA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY23"
FT                   /transl_table=1
FT                   /translation="MPTGIYLTEGPVRRSQVSGNPLLRKIQRACRMSLPEPDLALNLDV
FT                   ADYINEKQGAAPRDAVFAIVKLINCHDTHTAVFALALLDVLVKNCGYPVHLQISRKEFL
FT                   NELVKRFPERPPMRYSKVQRLILTAIEEWYQTICKTASYKDDLGYIRDMHRLLKYKGYA
FT                   FPKIQDEHLAVMRPNDQLKTASEIQKEQEIAQAAKLEELIRRGRPEDLREANKLMKVMA
FT                   GFKEDNIIQAKQTINHELNKLRRKADLLNEMLSQEQPDLSSETMEELYSALKVAQPKFQ
FT                   KIIEEEHEDDTLVQSLLKFNDTVNQLLEKYNLLKIGNKQAAAAINPENISEVPAGSNAG
FT                   ALANEINLIDFDDEPARDSSNDQQGASNGNNTSLDDLFGDLTLGQADTNNNNNQSLVGG
FT                   GISLGAGKPSVATTGASAGLSNDSSDLLDSVLASPPPSLVQASNTPASTNISAADDLLG
FT                   DFVSSPSPVANASASQKLSLFKSGDIEIELDLARESDSTLKLKVFFNNLTFQTINNLVF
FT                   SIATPKSVQLRLEPQSGNLLLANSKGGITQNAWIDNAPTTLTKPLKLKWKVSYTYNSSN
FT                   KEETAVYTLPKI"
FT   CDS_pept        complement(283634..286783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445445"
FT                   /locus_tag="CAGL0A02651g"
FT                   /product="Similar to uniprot|Q06337 Saccharomyces
FT                   cerevisiae YDR359c VID21"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAG57773.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059159"
FT                   /db_xref="HOGENOM:HBG203264"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI00003B5EA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY62"
FT                   /transl_table=1
FT                   /translation="MSVSSSRSVTPTTAGEGKKEILSQRSSKLSQLYCLSRLDDVMLVK
FT                   GKREEFVRDLHRFLEENDVDKSIAKLNQKTEERYVLKPLKIQRFRKSLGMGSKVFRGIK
FT                   RSEHDIIRTKDNAIVYVREENPYSPSIEWVTRKRKLAEDQTQDVSYKRQKRSYEPIHQY
FT                   QISKLPPKPTPIEKPSAVSKTLNEKLNEVYDTEERLDSRYNEGSIDSLESVYLMMKEIA
FT                   PSMIPGGIPLAELRYMAQTLPLISLIPRAHKVLTSDMINQALHESRITVVSSRIEELRR
FT                   SGLWSLRQPKRFVDGWNRENTHRGTLLKEAKWMREDFVEGKKYKIAVCTTLAQAVQDYW
FT                   TYGKVCCVRCKPIHVPGEDTPNSNDRSDKSVDETLAKTVLVEPLVEPVDVDIVQDSVIE
FT                   NDEKGDDTKNVQANKETEKESQVANEDVDDVMKDVTEQDVDNDIAIDRNDGSDDNDNGN
FT                   GNDNDNGNGNDNDNGNDSDNAIDTWLLQRRANPKDEIVPKKLPEISDEEYQRMKQSDKK
FT                   SKIFKLTITENDLSGFQSTLLSEFPVYKGIDDEDSHINLDTLEMIPVSKSLVLPDFDHY
FT                   YKIVEKQLIDEEQTLLQLSKRRGLFYGNRRNHYLRPPSVPSLKYLQNRTPTIWLPEDDQ
FT                   ELVKNISTYAYNWDLISAQMTRMPSNSYLSNIERRTPWQCFERFVQLNEKFSFSDLKGP
FT                   RAHAAQQWLIEAHKFQQRQNRRISPLGVGPESIQRGHRRLRWASIFEAMRKTIKKRENA
FT                   PRPNPTQPRKMLDSKNMKVPTPAEMSALKAQRDEAIRRDIQLRRTAKNRLQVKQNPQVS
FT                   KSKQSQKQGSPSLSRQQHPVPPNGQRPVNLPVGSQFRVDNMQQQQQQQKQYDARFVQKQ
FT                   AMQGNAGKIVSSAAAPEKVPNTSYTNVVNKQITPAMQAQNEQRIAAENKLINSYVKKII
FT                   KQNPGVSPEIALKAAQSYLTTMKNQQAQKRFKDSKLNSASGAQVKNIPQPGESVNLSQQ
FT                   GMSVMNRGVPSPVQTDPRQIYAGRASNAPGKPVTTVDTIPETVQTMKSPTPQEILKKFQ
FT                   K"
FT   CDS_pept        complement(287318..288148)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176971" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445446"
FT                   /gene_name="BCP1"
FT                   /locus_tag="CAGL0A02673g"
FT                   /product="Protein BCP1"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57774.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG327701"
FT                   /db_xref="HOGENOM:HBG349324"
FT                   /db_xref="UniParc:UPI00003B5EA6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY61"
FT                   /transl_table=1
FT                   /translation="MVQAIKLSELGNRKRRNDPVNEDEESEIDISSTDSEEENAGDEEQ
FT                   EIVNIDFDFFDGNPDVDFHAVKHLIRQLLGPQESNRVQLSALSDLILSSPTTTIKTDGK
FT                   ESDPYCFLSFINYKENKDSDYAKYLRKLDTRIETFLQTLDNTGNKSCALVMSERLINMP
FT                   PEVVTPLYRITMEDAAAANEGKPFDFYVIVSRKYEVNFDMDEAEGDASARSKKRVRGKS
FT                   EVDYFHEEDRFFEKHAKVHFDGESKKGLIASYIIIDHDSLVKSINEFEQEVSTW"
FT   CDS_pept        complement(288373..290448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197678"
FT                   /locus_tag="CAGL0A02695g"
FT                   /product="Similar to uniprot|Q06339 Saccharomyces
FT                   cerevisiae YDR362c TFC6"
FT                   /function="DNA binding"
FT                   /protein_id="CAG57775.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG124193"
FT                   /db_xref="HOGENOM:HBG203265"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI00003B5EA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY60"
FT                   /transl_table=1
FT                   /translation="MDKKRGRGRPRKHAIDETASESIAVAALKSMEGAVANASTAKGKG
FT                   TAKDEGAGRKLRRRGRPRKVVEAAAVTPIDDAAAAGAAGAAAVDDAVIDAKLKDDDGDE
FT                   EYVHQEDDGDDGDDGDDGDDYVDGDDAIDVEFQPRAKKQKKVRILSKKRGIASTLLQKG
FT                   RIIRTLKDLSSARDKIERIYGLDRAKLLKLAIVKECFENDLFNVRQETIEPTSPFWFES
FT                   KHSSELPNAGRDLQDDIAHIWASMDAHPAQFGAVSEKEYNALFKVRAEPIDCQIGETGI
FT                   SLSAGQKAELPVLPTYQRYGLVYNAGAFVTDMAWHTTKRGDEQVQYLVLALSQYGQEPD
FT                   DKHLRMFGKEEHIACLQVFRFDPHTLSLEKIHDILHPYGEVWDLKWHEALDQTEDTIGA
FT                   LFFACQEGTVRSLNIPTTASEEPVLCQATNIALGVKGNCVTTFDFVSVSRVICGFQNGY
FT                   VAEFDLCDTQALQRPSYYLQVCSTYISTIVTAHSEFEASTIGAVSLDGYFYIFDPASIH
FT                   TSKVKTSRYRGGNQFPIVYMPKLYSFFCTDGANIVRAVPPRASFAQHSMGSMPTTVTAL
FT                   SASTLHPMLLSGLSSGGLYITNAVRRLLTGVKNVASVGRTLRLWKWDYNPSADQYRLDP
FT                   NYEVEKAGGGEISTIELDAPQVAITATKWNESTECGRFYSFSISAGIVTIERIGEK"
FT   CDS_pept        290595..291704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046506"
FT                   /locus_tag="CAGL0A02706g"
FT                   /product="Similar to uniprot|Q06340 Saccharomyces
FT                   cerevisiae YDR363w ESC2"
FT                   /protein_id="CAG57776.1"
FT                   /db_xref="HOGENOM:HBG124194"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI00003B5EA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY59"
FT                   /transl_table=1
FT                   /translation="MDFSDEDSDEFFMGTSEDVEERLQQAMASRAPQAPNAEPAPVQEP
FT                   HAEAEAELEPEAEGPSQEQVRGQDVVVIEGDTEGSGSEGSSDSEGSSDSGAQDTYRGDK
FT                   EYEVRTRSGMKRARTVEDENDLFFQSIAKRSQSLPVQDGSGAVRQDKVYYVQFISHVDG
FT                   TKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFM
FT                   TCDTLRVPQRYGSDYLEIQLVPVKEEAQYLEQEVFEEPERAPTPEEDAEEEFERELRDA
FT                   KEVRAPVVDLESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITL
FT                   ALDDEPLDPHATVKSQDIEDEDMLEVRLS"
FT   CDS_pept        291888..292160
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197679"
FT                   /locus_tag="CAGL0A02728g"
FT                   /product="Similar to uniprot|O94742 Saccharomyces
FT                   cerevisiae YDR363wa SEM1P"
FT                   /protein_id="CAG57777.1"
FT                   /db_xref="HOGENOM:HBG124195"
FT                   /db_xref="InterPro:IPR007834"
FT                   /db_xref="UniParc:UPI00003B5EA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY58"
FT                   /transl_table=1
FT                   /translation="MDEKNVEERRTLEEDDEFEDFPVDTWGDKDTVASTSATNGTSATN
FT                   GTSATNGIGGTSGTNGKRNIIWEENWDDVEADDDFTQELRAELQK"
FT   CDS_pept        292470..293759
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445447"
FT                   /locus_tag="CAGL0A02750g"
FT                   /product="Similar to uniprot|P33297 Saccharomyces
FT                   cerevisiae YOR117w YTA1"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57778.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI00003B5EAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY57"
FT                   /transl_table=1
FT                   /translation="MSTLEELDVEDGLDQEILGLSAQELQTRSKLLDNEIRIFRSELQR
FT                   LSHENNVMLEKIKDNKEKIKNNRKLPYLVANIVEVMDMDEIEDKENSESATQGGNVNLD
FT                   NTANGKAAVIKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVK
FT                   AMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTG
FT                   KTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAI
FT                   GTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDR
FT                   KIEFPLPTEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALR
FT                   NGQSSVKHEDFVEAIGEVQARKSKSVSFYA"
FT   CDS_pept        complement(293966..295291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350854"
FT                   /locus_tag="CAGL0A02772g"
FT                   /product="Similar to uniprot|P40968 Saccharomyces
FT                   cerevisiae YDR364c CDC40"
FT                   /protein_id="CAG57779.1"
FT                   /db_xref="HOGENOM:HBG141421"
FT                   /db_xref="HOGENOM:HBG395553"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B5EAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY56"
FT                   /transl_table=1
FT                   /translation="MDLLAHYSDSSDELSDQEVVAKPVAEESFDKNGKRKFKFSKAELK
FT                   RRRKQRKGDGPWGSWDVEVDQKTVQDIDDGGAHDLFDSDHDQETANGPTKLLNEKSTFY
FT                   GRKERDYQGRSYLHPPADVDVDFKRTQFKCYLPKKVIYRYKGHHNGTTSLRLLPGTGHL
FT                   ILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTE
FT                   TGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDHHLSS
FT                   ILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIKQISDTTQHSMPYIGIHPEHNYFSTQ
FT                   SMDSVIYSYSMKPKYKMHPNKKFKGHNSAGYGIGLTFSPDGRFLCSGDARGQLFLWDWN
FT                   TNRKLCDLKLPTKSPITQVSWHPKETSKVICSGPDGRIFVLD"
FT   CDS_pept        join(295534..295563,295751..296371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350855"
FT                   /locus_tag="CAGL0A02794g"
FT                   /product="Similar to uniprot|Q06346 Saccharomyces
FT                   cerevisiae YDR367w"
FT                   /protein_id="CAG57780.1"
FT                   /db_xref="HOGENOM:HBG059162"
FT                   /db_xref="HOGENOM:HBG203269"
FT                   /db_xref="InterPro:IPR013862"
FT                   /db_xref="UniParc:UPI00003B5EAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY55"
FT                   /transl_table=1
FT                   /translation="MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFT
FT                   GHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFS
FT                   AQWFQSANEEKHETSAPVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFN
FT                   FILASFVQELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ"
FT   CDS_pept        296851..297783
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197680"
FT                   /locus_tag="CAGL0A02816g"
FT                   /product="Similar to uniprot|Q12458 Saccharomyces
FT                   cerevisiae YDR368w YPR1"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG57781.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B5EAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY54"
FT                   /transl_table=1
FT                   /translation="MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGY
FT                   RHIDAAAIYGNEDQVGRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYV
FT                   DLYLMHWPVALKAHGSEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKA
FT                   IGVSNFSINNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGS
FT                   ADAPVLKEPELHKLAEKYNISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDE
FT                   DMETITNLSKVKGEKRLVQLDWSPFPTFE"
FT   CDS_pept        complement(297872..300358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445448"
FT                   /locus_tag="CAGL0A02838g"
FT                   /product="Similar to uniprot|P33301 Saccharomyces
FT                   cerevisiae YDR369c XRS2"
FT                   /protein_id="CAG57782.1"
FT                   /db_xref="HOGENOM:HBG124196"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI00003B5EAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY53"
FT                   /transl_table=1
FT                   /translation="MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKS
FT                   ISRQHVSLKWSSSKNCIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKI
FT                   ILSRIDELFDIPNSLSQFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDI
FT                   NIYSSGLLTEICNKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYK
FT                   IDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTL
FT                   QIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTS
FT                   LESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTR
FT                   EQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPD
FT                   RKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMS
FT                   TEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIE
FT                   DSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKS
FT                   EQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSF
FT                   VHQILPEIGDENENSFSFTRTAIGNGNNNSANEINNSNQQLFVVDDDFEDSQDVGHLLN
FT                   KADTTEPPQQLQDHEDTMNDGPGSTTPVRNKRNRGKVSVTNGGNRVRSVVKGFTNEDDD
FT                   DDDDDDEPTFKFSRHR"
FT   CDS_pept        complement(300736..301944)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445449"
FT                   /locus_tag="CAGL0A02860g"
FT                   /product="Similar to uniprot|Q06349 Saccharomyces
FT                   cerevisiae YDR370c"
FT                   /protein_id="CAG57783.1"
FT                   /db_xref="HOGENOM:HBG124197"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="UniParc:UPI00003B5EAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY52"
FT                   /transl_table=1
FT                   /translation="MEEVVNQLEALSLSNDKRRVKGQRKGKKKKHGNSRARDDHTVVIR
FT                   GNKQRLKTSHHKNMPQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEK
FT                   TQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTA
FT                   RHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICF
FT                   SGFALEDILTESANDEERNPTFLIVENEIANTRLLMRCEIDAYNPITSHYTELKCYAKY
FT                   NFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLP
FT                   RCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQ
FT                   NPN"
FT   CDS_pept        302262..302576
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000118147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197681"
FT                   /locus_tag="CAGL0A02882g"
FT                   /product="Similar to KLLA0E02266g Kluyveromyces lactis "
FT                   /protein_id="CAG57784.1"
FT                   /db_xref="HOGENOM:HBG058446"
FT                   /db_xref="HOGENOM:HBG395810"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI00003B5EB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY51"
FT                   /transl_table=1
FT                   /translation="MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNE
FT                   PAQAGGERTFAGSHLQIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA
FT                   "
FT   CDS_pept        302938..304443
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046507"
FT                   /locus_tag="CAGL0A02904g"
FT                   /product="Similar to uniprot|Q06350 Saccharomyces
FT                   cerevisiae YDR371w"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAG57785.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG058461"
FT                   /db_xref="HOGENOM:HBG203272"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B5EB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY50"
FT                   /transl_table=1
FT                   /translation="MHIGHRKRLGTFIVILITSLILQMSLHYKIFQKLKRRSQSDDYRM
FT                   PESDVLSNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSD
FT                   EWSDTQLNLAKQCREYMFKRFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKL
FT                   IMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAY
FT                   LRMARELKLQLQKLEANILGDHSNKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMT
FT                   YDYYGEWSERTGLHANLYNEKGKLLHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVILG
FT                   MAAYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHV
FT                   GAYCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIR
FT                   VIRNVKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDIIQES"
FT   CDS_pept        complement(304789..305775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503080"
FT                   /locus_tag="CAGL0A02926g"
FT                   /product="Similar to uniprot|Q06385 Saccharomyces
FT                   cerevisiae YDR372c"
FT                   /protein_id="CAG57786.1"
FT                   /db_xref="HOGENOM:HBG027300"
FT                   /db_xref="HOGENOM:HBG329330"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniParc:UPI00003B5EB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY49"
FT                   /transl_table=1
FT                   /translation="MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQNDS
FT                   KQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRF
FT                   DISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQV
FT                   RERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNS
FT                   YFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDL
FT                   QKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL"
FT   CDS_pept        306353..306925
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445450"
FT                   /locus_tag="CAGL0A02948g"
FT                   /product="Similar to uniprot|Q06389 Saccharomyces
FT                   cerevisiae YDR373w FRQ1"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG57787.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B5EB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY48"
FT                   /transl_table=1
FT                   /translation="MGAKASKLSKEDLTSLKQSTYFDRREIQQWHKGFLRDCPNGYLTR
FT                   DDFIRIYKQFFPFGSPEEFAGHLFSVFDKDNNGYIDFKEFITVLSTTSRGTLEEKLVWA
FT                   FQLYDLNHDGFITFDEMLTIVASVYKMMGSMVKLDEDEATPELRVRKVFKIMDKDEDGY
FT                   ITLEEFREGSKVDPSIISALNIYDGLV"
FT   CDS_pept        complement(307103..308032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445451"
FT                   /locus_tag="CAGL0A02970g"
FT                   /product="Similar to uniprot|Q06390 Saccharomyces
FT                   cerevisiae YDR374c"
FT                   /protein_id="CAG57788.1"
FT                   /db_xref="HOGENOM:HBG124198"
FT                   /db_xref="HOGENOM:HBG203273"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="UniParc:UPI00003B5EB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY47"
FT                   /transl_table=1
FT                   /translation="MKLIAAETPQKKFAMRTIEDSLKELEGLLHGGRVLRLPDLDHRYT
FT                   IMSYENYEQRSADVPRQQICDTSRQRDNAYKVVPVTHTTHSADINSDFITNYKLSTPTQ
FT                   GLTTNVRTNPTVDVLTESKPNYQYYNKPTKLKASVKRKKSLAIVPAWVNVPEFSRFFVI
FT                   KSISLDHIKKSFYNSIWSSTHFGNRKLSQAYKELKAGAKIFLFFSVNASGRFCGVAEMS
FT                   SDLQDCLDTSLWDDSSKYGAAFRVRWVLVKDLKNAHLKRFLIPENEMKPITKSRDTQEI
FT                   PFYIGQAVLQLFKSDNTNIKCFLDQDYN"
FT   CDS_pept        complement(308689..310062)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197682"
FT                   /locus_tag="CAGL0A02992g"
FT                   /product="Similar to uniprot|P32839 Saccharomyces
FT                   cerevisiae YDR375c BCS1"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG57789.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG022336"
FT                   /db_xref="HOGENOM:HBG521794"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniParc:UPI00003B5EB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY46"
FT                   /transl_table=1
FT                   /translation="MNSGNGQSTLPPDAPTTGADTIGNELTSTLASGEKGTIRSLIDSA
FT                   MQNNPYFAAGGGLMLLGTGLALAKSGMVKASRLAYKQMIVDLEIQSRDKSYSWFLSWMS
FT                   KHPQRISKHLSVRTSYIQHDNGSVSTKFSLVPGPGNHWIRYKGAFIRIKRERSAKMVDI
FT                   SNGTPFETVTLTTLYRDRHLFQDILNEAKDIALKTTAGKTVIYTSFGPEWRKFGQPKAK
FT                   RLLPSVVLDKGIKEDIIEDVHDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQALA
FT                   GELDYNICILNLSENNLTDDRLNHLMNNMPERSILLLEDIDAAFNKREQTGEQGFHSAV
FT                   TFSGLLNALDGVTSSEETITFMTTNHPEKLDKAIMRPGRIDYKVFIGNATSYQIEKMFL
FT                   KFYPGEVNNCKKFVEAVESLGSSVSTAQLQGLFVMNKDDPESAIKMVHTMKTNEEFVV"
FT   CDS_pept        310323..311828
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000249250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046508"
FT                   /locus_tag="CAGL0A03014g"
FT                   /product="Similar to uniprot|P48360 Saccharomyces
FT                   cerevisiae YDR376w ARH1"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG57790.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058463"
FT                   /db_xref="HOGENOM:HBG522200"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="UniParc:UPI00003B5EB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY45"
FT                   /transl_table=1
FT                   /translation="MIFIRQLSSQVERKSVSVVGSGPSGFYTAYHLLSKSPIPLHVTIW
FT                   EKLPVPFGLSRYGVAPDHPEVKNCEDTFTNCAEQYISGEINDKNPLGHKFDFIGGVKIG
FT                   EDVPLKTLIDNQDAVILSYGCGGDKRLGIPGETDTAGVLSSREFVSWYNGHPDFASKEK
FT                   LNSFDWSRVKNVAIIGNGNVALDISRVLLSNGIPEIWDKTDISKHALNILKHAPIETVK
FT                   MIARRDFIHSKFTNKEFRELWELEKYGIKGHISSKYFSEDMFDFEKHQGSPLYDRAFKR
FT                   RVEMCSEYLKPFDQRLKKNYKKFPPVNPIGKEWELDYLKSPVEIIKDDSSGKIKGLKLT
FT                   ENEVTQDNKVISTGKTLQYEVDLLITSLGYGGIPLQDFKTLDIGFHDSRGHIINNNGKV
FT                   LDNKGQVVPHLYTSGWIRKGSQGVIASTMMDAFEVGDNVLADLYATRDTYKHTDLAQLL
FT                   RTHRHTTWFDWQRIDKHERDAGSAEGRPRAKIEDKEEMLEYAQ"
FT   CDS_pept        312174..312479
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503081"
FT                   /locus_tag="CAGL0A03036g"
FT                   /product="Similar to uniprot|Q06405 Saccharomyces
FT                   cerevisiae YDR377w ATP17"
FT                   /protein_id="CAG57791.1"
FT                   /db_xref="HOGENOM:HBG052744"
FT                   /db_xref="HOGENOM:HBG397889"
FT                   /db_xref="InterPro:IPR019727"
FT                   /db_xref="UniParc:UPI00003B5EB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY44"
FT                   /transl_table=1
FT                   /translation="MIFKRAVSTLIPPKVVSAQQLGAAPNAKRIANVVSFYKSLPQGPA
FT                   TAANNAGYGRFLGKYKSKYYDGENASGKPIWHLSLAVITFGYSLEYFFHLRHHKDH"
FT   CDS_pept        join(complement(313260..313334),complement(312728..313000))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197683"
FT                   /gene_name="LSM6"
FT                   /locus_tag="CAGL0A03051g"
FT                   /product="U6 snRNA-associated Sm-like protein LSm6 "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAR57997.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00017BD72F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FYB6"
FT                   /transl_table=1
FT                   /translation="MFTSISSLYSTWSKVPRGEANKMCRGKQSREYIYRAMAEESVSTQ
FT                   FLSNIIGKPVHVKLYSGMLYSGVLESIDGFMNVALSETREHYEHPNNNLLKKYASDVFL
FT                   RGTQVMYISEA"
FT   CDS_pept        313662..316040
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445452"
FT                   /locus_tag="CAGL0A03058g"
FT                   /product="Similarities with uniprot|Q06407 Saccharomyces
FT                   cerevisiae YDR379w RGA2"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG57793.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG124199"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B5EB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYB5"
FT                   /transl_table=1
FT                   /translation="MAKPPDIHVPLHDNDLRGRGREYSAHTPYISQSHDPPMPVLPDHL
FT                   LILSLYGKTVDDVLDATLTVDELDSLEQWDMPSGASASGSASDSATGSGSGSGSSSGST
FT                   SGRSQSDKNEEDSYKNLWSPRMFQPGLIRKNANDMDFDTPGLGISHSRTPSASQSHTSQ
FT                   THTNQTQTLVQTPSSSSNSHSRKSSNPNPQTPMARKTSLDDKDKRIARSLSRKSKVFLG
FT                   NLSFKKPSKTTESDTHSGWGVASAQTTEPRLESPRLGGATPNLTPKASDRRGKSDSLIF
FT                   AQQASPRVGSSPVGRRNGSVTNTPTVGSRKDSIGFSANTTPSIGMAFNVTQPLTLEEPR
FT                   PHVDVLGHRSSNSLGSANLGTHNSSTIAASMYRTPPLTHHDTFDKVTSPSTTLGNSASV
FT                   LSKRTNSYTNLEGRKRMGSGDAALMVDSNGVNDELFDSELKLRKLRLEIRELTLSKKHL
FT                   VDEIEHLTVTRENLLQEVESLKHDKEKSSLSSFEIFDSHQGETNSQTSRKSSNSANKLL
FT                   AEVRTEPKPKFWRIFGSNRSGGSSEDSYVIPCESTPAPNVSLTSVCERDGTEIPLVIKV
FT                   CITYLEVDEDLLKAEGLYRKSASNGLVESIEREIVKLCDSLEVTDTDGIIECLRDTELL
FT                   SLMQRDENAVASVLKRYLRSFSEPVFTYEVYDPLINLVKKDDLINTLPLLNGKPKDKFE
FT                   NEEEEENMGKLFRTTLGSVIRILQLLPEAHYETLKVLCGHICLVSHYSDTNLMNLHNLA
FT                   IVFSPGLLHDQHGDKDLSDMRERYYIVEFILGHRKEIFD"
FT   CDS_pept        complement(316567..316806)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445453"
FT                   /locus_tag="CAGL0A03080g"
FT                   /product="Similar to uniprot|Q3E785 Saccharomyces
FT                   cerevisiae YDR379C-A"
FT                   /protein_id="CAG57794.1"
FT                   /db_xref="HOGENOM:HBG523495"
FT                   /db_xref="HOGENOM:HBG561071"
FT                   /db_xref="UniParc:UPI00003B5EBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYB4"
FT                   /transl_table=1
FT                   /translation="MARKLSGLQREVIHLYRSAVRVAHTKPVENQPHFLQFIHAEFSKY
FT                   RDLPRKDFTTIEHLLRVGNRRLKMYSQPELKDIH"
FT   CDS_pept        317961..319910
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503082"
FT                   /locus_tag="CAGL0A03102g"
FT                   /product="Similar to uniprot|Q06408 Saccharomyces
FT                   cerevisiae YDR380w"
FT                   /function="carboxy-lyase activity"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /protein_id="CAG57795.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG055646"
FT                   /db_xref="HOGENOM:HBG479104"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniParc:UPI00003B5EBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYB3"
FT                   /transl_table=1
FT                   /translation="MAPVTLDPKVTADTSRYSGVQSNSGFAYGEITFGEYVFRRLLSCG
FT                   TKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAADGYSRYTNKIGCLITT
FT                   YGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHHLIPALNDSNFVSPN
FT                   HKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLFIPADFADMMVSTR
FT                   NLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGDVLTDRYGVSQQL
FT                   NSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKCDLILHFGIERN
FT                   EINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVLNRLQPAIQAD
FT                   KLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCETGSVQFGVRD
FT                   YRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEPKLILFEGDG
FT                   SAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWTKMFEAFGD
FT                   GLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPEQLKCMVS
FT                   AAMYNKKKEQSMSN"
FT   CDS_pept        join(320671..320955,322253..322666)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445454"
FT                   /locus_tag="CAGL0A03117g"
FT                   /product="Similar to uniprot|Q12159 Saccharomyces
FT                   cerevisiae YDR381w YRA1"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG57796.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059414"
FT                   /db_xref="HOGENOM:HBG396717"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B5EBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYB2"
FT                   /transl_table=1
FT                   /translation="MSANLDKSLDEIIGSKKTARPSNRTRAGHAARPKRAAKQINPRRR
FT                   VVPGRRAVSKPVAAPASAAVARAASLLHGTREARVTVEGLPRDIKQDAVREFFQSQVGG
FT                   VQRVLLSYNERGQSTGMANVTFRNGELAKKAVAQFSGAPIDGGKSRLRLNIVVDPTVQP
FT                   ARPLTERIRAISRERVVAQKAKPVKGPSKKAAAVKARKQKPKAKKEKQPKKNLEDLDKE
FT                   MADYFGEGKN"
FT   CDS_pept        complement(323030..323377)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445455"
FT                   /locus_tag="CAGL0A03146g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57797.1"
FT                   /db_xref="HOGENOM:HBG059413"
FT                   /db_xref="HOGENOM:HBG203276"
FT                   /db_xref="UniParc:UPI00003B5EBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYB1"
FT                   /transl_table=1
FT                   /translation="MSNPFKNIGKNLLYISGVGVLSLVIVKSIVRARRDAKFKPHALVG
FT                   DEASSAQDYYDNLAQVKPGFPLPKKLDKDEEFSIVDAATTRKSKYEAGGVSAVTRKRGD
FT                   RLGFLDRRNND"
FT   CDS_pept        324013..324342
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445456"
FT                   /locus_tag="CAGL0A03168g"
FT                   /product="Similar to uniprot|P02400 Saccharomyces
FT                   cerevisiae YDR382w RPLA4"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57798.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG351554"
FT                   /db_xref="HOGENOM:HBG744999"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI00003B5EBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYB0"
FT                   /transl_table=1
FT                   /translation="MKYLAAYLLLTQGGNESPAAADIKKVIESVGIEADEARINELLSA
FT                   LEGKSLDELIAEGQQKFASVPVGGAAAGGASAAAGGAAAGEAAEEKEEEAAEESDDDMG
FT                   FGLFD"
FT   CDS_pept        complement(324581..325306)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445457"
FT                   /locus_tag="CAGL0A03190g"
FT                   /product="Similar to uniprot|Q12493 Saccharomyces
FT                   cerevisiae YDR383c"
FT                   /protein_id="CAG57799.1"
FT                   /db_xref="HOGENOM:HBG124200"
FT                   /db_xref="UniParc:UPI00003B5EBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA9"
FT                   /transl_table=1
FT                   /translation="MDISVPESQVYADITGFIEQQQRELTNINEYLDDSDAVPVEVQEL
FT                   VELGYRNKLRSKTRTTSTDLLVKNVYELENEWKLRTMTEMMDIIGDIPKHSIGSELRES
FT                   IEDPAGHSHNAAIDDLIEDILKLPQLQLADTAHEDDDNAQLLREYRNLKNDVIDKCNEI
FT                   VASRQELRDMDINLEPVRSLLKAIPHSSEGDIRQYFIDYQGQLESVVKELSLVVEEAYK
FT                   QSENDPIMRGKLADIINNM"
FT   CDS_pept        complement(325788..326594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445458"
FT                   /locus_tag="CAGL0A03212g"
FT                   /product="Similar to uniprot|Q12359 Saccharomyces
FT                   cerevisiae YDR384c"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57800.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191130"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI00003B5EC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA8"
FT                   /transl_table=1
FT                   /translation="MSSSSSQIDIEKAPVTMEKAVSLPGVTVSESRSQPIQEIYADSEF
FT                   VTLGGYTYRRTQLLTALGIDEHREQHTPVVKKLANPVPLGLASFSICCLVLSLINANVR
FT                   GVTSNQFVISMYMLFGGAIELFAGLLCFVIGDTFSMTVFSSFGGFWLSYGLDFVPSMAA
FT                   ISEYDKDPNMLNNVIGFYLAAWCVFTFLMLMCCLKSAWGLFLLLFFLDFTFLMLCIGNF
FT                   INDNNCKMAGGYFGILASVCGFYMLYCCVSSKENSYVPLRAIMMPN"
FT   CDS_pept        328577..331105
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445459"
FT                   /gene_name="EFT1"
FT                   /locus_tag="CAGL0A03234g"
FT                   /product="Elongation factor 2 "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57801.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B5EC1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FYA7"
FT                   /transl_table=1
FT                   /translation="MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQKAGI
FT                   ISAAKAGEARFMDTRKDEQERGITIKSTAISLYSDLPEEDVKEIPQKSDGNSFLINLID
FT                   SPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVCINKVDRA
FT                   LLELQVSKEDLYQSFSRTVESVNVIISTYSDEVLGDVQVYPSKGTVAFGSGLHGWAFTI
FT                   RQFATRYAKKFGVDKQKMMERLWGDSFFNPKTKKWTNKETDTDGKPLERAFNMFVLDPI
FT                   FRLFAAIMNFKKDEIPTLLEKLEINLKSDEKDLEGKALLKVVMRKFLPAADALLEMIVM
FT                   HLPSPVTAQNYRAEQLYEGPADDANCIAIKKCDPTADLMLYVSKMVPTSDKGRFYAFGR
FT                   VFAGTVKSGQKIRIQGPNYVPGKKDDLFLKAVQRVVLMMGSRVEPIDDCPAGNIVGLVG
FT                   IDQFLLKTGTLTTSETAYNMKVMKFSVSPVVQVAVDVKNANDLPKLVEGLKRLSKSDPC
FT                   VLTQMSESGEHIVAGTGELHLEICLQDLENEHAGIPLKISPPVVAYRETVEAESSQVAL
FT                   SKSPNKHNRIYLKAEPMDEEVSLAIEQGKINPRDDFKARARVMADEYGWDVTDARKIWC
FT                   FGPDGNGPNLVVDQTKAVQYLNEIKDSVVSAFQWATKEGPILGETMRSVRVNILDVTLH
FT                   ADAIHRGAGQIMPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQ
FT                   VVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWATLNSDPLDPT
FT                   SKAGEIVTAARKRHGMKEEVPGWQEYYDKL"
FT   CDS_pept        331579..333465
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503083"
FT                   /gene_name="MUS81"
FT                   /locus_tag="CAGL0A03256g"
FT                   /product="Crossover junction endonuclease MUS81 "
FT                   /EC_number="3.1.22.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57802.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG053750"
FT                   /db_xref="HOGENOM:HBG398626"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI00003B5EC2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FYA6"
FT                   /transl_table=1
FT                   /translation="MLPDNLKDLYVQWLQELIDSLSEKQEQLINTYSKAKKNLIDHDGV
FT                   FYYPKDLLKVKGIGATIAKRLEARLVKHCEEIGVDVPRKQLPIDNGTQGSKSLKRVRTQ
FT                   LRIDGINTNDTDINKPVRKKRKYIPKKRSGAYAILLALLELGAQNKGVIKPDIIEAAQK
FT                   YTDHSMTPNYTTKEFYSAWSSIAQLKKHELVLIEGRPQQYTLTEEGLQLADTLRLADGI
FT                   DIDGKSIASSMDTNNAYYSDEHTADFSALKHDLSGLTCAPIKDGTNSSGNYSILEKTFG
FT                   SQDFNVRHHEIGMVQRSHTFGNGDSNNSIEPLPRDTSEFTTQPSLIQRRRFESVSYELW
FT                   QPGTYEIYPVIDHREVRSHSDREFFFNAFKARDMKSEIRQLSLGDIIWVAKNKTTGQQC
FT                   ILNTIIERKRLDDLAMSIRDNRFMEQKNRLEKSGCKHKYYLIEETIGSSIGNMADALKT
FT                   TLWIILVYYRFSMIRTVNAEDSVDKLHALHTVICESYKHKALVVLYPTDLKSQDHYRGI
FT                   LSIFQNEFERSGNLECCHTFDTFQDIMGKRELKTIKEITIHILMLVRGVSLEKAVFIQR
FT                   HFPTLNHLLNAYRKCNSQMEAKLMMFQKFGNAPGAKKITKQLSEKLAETFAF"
FT   CDS_pept        join(complement(335068..335069),complement(333822..334389))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197684"
FT                   /locus_tag="CAGL0A03278g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57803.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG385598"
FT                   /db_xref="HOGENOM:HBG748852"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="UniParc:UPI00003B5EC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA5"
FT                   /transl_table=1
FT                   /translation="MANLRTQKRLAASVIGAGKRKVWLDPNETSEIAQANSRNAIRKLV
FT                   KNGTIVKKAVTVHSRSRTREHALSKRNGRHTGYGKRKGTKEARLPSQVVWIRRLRVLRR
FT                   LLAKYRDAGKIDKHLYHVLYKEAKGNAFKHKRALVEHIIQAKADAQREKALSEQAEARR
FT                   MKNRAARERRAQRVAEKREALLKESA"
FT   CDS_pept        complement(336117..337583)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247956" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445460"
FT                   /locus_tag="CAGL0A03300g"
FT                   /product="Similar to uniprot|P41833 Saccharomyces
FT                   cerevisiae YGL192w IME4"
FT                   /function="methyltransferase activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="CAG57804.1"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG059423"
FT                   /db_xref="HOGENOM:HBG396087"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniParc:UPI00003B5EC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY82"
FT                   /transl_table=1
FT                   /translation="MHCDTVEVVKFLMDNHIEIMSPPISGELSQVFVIYKATNVKIEAF
FT                   KRIINAIHEISHGIELKIGDLNEEPIITYIDCAILHEFHCILKNRKRQHPKGDELKLNG
FT                   LKQEEKFRRLIEDKSSDFQKRIEAILTTRTQATQLGIERAKQLEPVEPVIPRCNSLEHR
FT                   ELLSKCTMISNNKIISLKWPIFINQKQEFIQCVQNKIHFVPNMKPKTDPNLGDCSYLDT
FT                   CHKMHCCRYVHYLQFTPQILETKYNSWLADENIARSKNSWISLYTRGECCSNLSRNVAP
FT                   PQWIQCDVRKFDLSLLGKFSAVIADPAWNIHMHLPYGTCNDTELLNLPLNILQDEGILL
FT                   LWVTGRAIELGKESLKKWGYKVINEISWVKTNQLGRTIVTGRTGHWLNHSKEHLLLGLK
FT                   GDPEWLNRNIDLDIIVSPTRETSRKPDEVYGIVERLVGSKSRKLEIFGRVHNLRPGWIT
FT                   IGNQLEGTHVIDPEIKNRLLIQELANKKST"
FT   CDS_pept        338516..339868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503084"
FT                   /locus_tag="CAGL0A03322g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="CAG57805.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="HOGENOM:HBG460465"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI00003B5EC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY81"
FT                   /transl_table=1
FT                   /translation="MSGTFSVDSKTKEFQPLYEFGSNYAPRVSYHINPEVSHYHYGVRH
FT                   PMKPFRLMLTDHLVSGYGLHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKL
FT                   PRGTLEKFNIGDDCPIFPNIFQYSSLYTGASLDASRKLINNQSDIAINWSGGLHHAKKN
FT                   SPSGFCYINDIVLAILNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYNGE
FT                   FFPGTGKNDETGCADGKHFAMNVPLEDGIDDDSYINLFKSIIDPLITTFKPTVILQQCG
FT                   ADSLGHDRLGCFNLNIKAHGECVKFVRSFGIPMLVVGGGGYTPRNVSRLWTYETGILNN
FT                   VLLPEELPDNLPFKESFGPDYSLYPVLDNLYENRNSKKFLEDIRIRCLENIRFLQGAPS
FT                   VRMDAENIPTQDISGLTEEEEELIKEMNEEDEDWRLQEIEKENAKMMELIY"
FT   CDS_pept        340501..342378
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350856"
FT                   /locus_tag="CAGL0A03344g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57806.1"
FT                   /db_xref="HOGENOM:HBG124201"
FT                   /db_xref="UniParc:UPI00003B5EC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY80"
FT                   /transl_table=1
FT                   /translation="MAIFSGVTVDLSVIFTNVYIMAYLVSRIISNILIRICSMRTRMTP
FT                   IKLPVWSRIMFHGISAVYAVMLLVRIEHLLGNIDIGMNVTLEDLCVQVYLCVLMFGCVE
FT                   EFTATTTNRKVIKATFSSPILLAADMVQAINGTTSLKLDLLRVTLRYCVVENLLVQLIE
FT                   LIDKRNLRFLSSLLVEFFRTFTILKIMIREENGYEFGSTFAYGQFLNFFWPATLFILTY
FT                   IPYQVAKLVRWDPFENNSKIKTQRNASKLQYYMFFEGLKSTLNFTGSESVEELLVTYLN
FT                   RLCNIFFFDKQSVQNEMEELQLPNKISHSYVISGYLNPIKGAPEDVIKGDVTDNDGKAP
FT                   VSGVEKAFSILPFYSPLLFANVKTIKSVISWIFMKVRSFYKTTEDIESTEEKRKNDLNK
FT                   VDFNSYITEKNYYKFLTKPITNAIPQPNKNVENILPLLLPEEDNSEDYVPDNDELDDDD
FT                   YDENITDDNEHDDSNEDKEKSNSSRISNNDLQKELVSLITPLPEEVETLDGMTWNTSVW
FT                   TRYKYRDSLNQCLTRNKYSELNPDGVLTEAFIERVSHNANKIHTHEDLEGELDLSCVIC
FT                   KVNTRKIVLWPCRCLAICDECRVSLGTRGFKKCACCNTNIEAYSKLNIV"
FT   ncRNA           342845..343420
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR30"
FT                   /db_xref="Rfam:RF01271"
FT   CDS_pept        complement(343987..345759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445461"
FT                   /locus_tag="CAGL0A03366g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="IMP cyclohydrolase activity"
FT                   /function="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase activity"
FT                   /biological_process="IMP biosynthetic process"
FT                   /protein_id="CAG57807.1"
FT                   /db_xref="GO:0003937"
FT                   /db_xref="GO:0004643"
FT                   /db_xref="GO:0006188"
FT                   /db_xref="HOGENOM:HBG236844"
FT                   /db_xref="HOGENOM:HBG498048"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR013982"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00003B5EC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY79"
FT                   /transl_table=1
FT                   /translation="MYKKTAILSVYDKTGLLDLAKGLIENDVRILASGGTANMVREAGF
FT                   PVDDVSSITHAPEMLGGRVKTLHPAVHGGILARNLESDEKDLKDQHIDKVDFVVCNLYP
FT                   FKETVAKVGVTVPEAVEEIDIGGVTLLRAAAKNHSRVTILSDPNDYAIFLHELKEHGEV
FT                   SQELRNRLALKAFEHTADYDAAISDFFRKQYSENRAQLPLRYGANPHQRPAQAFVTQLE
FT                   ELPFKVLSGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGIPLSDVE
FT                   KQIYFVSDIENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTATIISKEVSDGVIA
FT                   PGFEPEALEILKKKKNGKYCILQIDPNYIPDAMESRDVYGITLQQKRNDAIINQSSFKE
FT                   IVSANKNLTEQAVIDLTVASLALKYTQSNSVCYAKNGMVIGLGAGQQSRIHCTRLAGDK
FT                   ADNWWLRQHPKVLAFKWAKGVKRPDKSNAIDLYVTGQIPEEDPEKSEYESKFAEIPTPL
FT                   TPEERKEWLSKLNNVSLSSDAFFPFPDNVYRAVKSGVKYIAAPSGSVQDKAVFAAADSF
FT                   DLVYVENPIRLFHH"
FT   CDS_pept        complement(346748..347362)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350857"
FT                   /locus_tag="CAGL0A03388g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57808.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG129246"
FT                   /db_xref="HOGENOM:HBG577798"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniParc:UPI00003B5EC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY78"
FT                   /transl_table=1
FT                   /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRASRPSRP
FT                   DKARRMGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEE
FT                   RVGRRASNLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWICNPVHKHREARG
FT                   LTATGKKSRGINKGHRYTNTKAGRRKTWKRHNTLSLWRYRK"
FT   CDS_pept        348708..349451
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503085"
FT                   /locus_tag="CAGL0A03410g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57809.1"
FT                   /db_xref="HOGENOM:HBG124202"
FT                   /db_xref="UniParc:UPI00003B5EC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY77"
FT                   /transl_table=1
FT                   /translation="MTTESFKFQKVSVKKICLPEPLQWEPDTAIVEEQKSYLRTPRTAN
FT                   DDDQSILASILSKWSQMIRKSIRNYKQRKRNRLKFCHNLNGKYLGLNNTKLSTNFILPD
FT                   IPVTMSTNEREWLPQIEPIMVRDMVIEFPTIESITYSEADITTLSNDVPQIIDFYLDND
FT                   IDDIESLKHRKNMISIKKRLVEQKITDLTNLLQRKTPEHCYRQRTSRDKVISMMNDLQR
FT                   LNFEVETKKRTIELLKSQNLRMPKY"
FT   CDS_pept        349884..353339
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046509"
FT                   /gene_name="RAD5"
FT                   /locus_tag="CAGL0A03432g"
FT                   /product="DNA repair protein RAD5 "
FT                   /EC_number="3.6.4.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57810.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059448"
FT                   /db_xref="HOGENOM:HBG396181"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B5ECA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY76"
FT                   /transl_table=1
FT                   /translation="MDQNANQKKRFFKDELESSIETTLTDKSSFLFEPQVDAIQEENAN
FT                   DPEEQIAQGTQESPFIEQLRAVLPTIRLEVALALEEKYRDIDDGLDLAISEYFDQYQTG
FT                   NDDAPPSSLELQHSQEVLTVPDNEEKDTDLQLVSVKRKREDDFMQSSQSKKPQRANSSW
FT                   KKFVGSLQVTVMVTRPTMRPVPYGTPLIFKRSNNNVPLKKIYEQLNKKKTGLAAFVKIY
FT                   SANDEREIGRVPEDIARIVFPLLHRNEVHFKLTMIYPGDKRLSIGDNIIIQMDSFLTST
FT                   LFNRKENPTFSTQNGNGRERFGAIVETEQELEERNIRMGLIMLFDKIKLRPVKDEAKFL
FT                   EKLKQDGDDNEIVDLEDDESFGNFLSQEPLNDELPTQHQEDTMNINQLTSFYKATQSSK
FT                   QLNSLIPTTPPPELVKVELRKYQKQGLTWMLRREGISIGHDNEDKSEDDTTLLNPLWRQ
FT                   FQWPRNMSWHNQSTGSENDNSNPKLIFFYGNLHTGEFSLERPTMNSFKNGGILSDEMGL
FT                   GKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAYKTTLIIVPMS
FT                   LLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRKNPPTVVLTTYGIVQNEWTKL
FT                   SKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITSKAVLELSSKYRWILTGTPI
FT                   INRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEERNFKQAFDVVNAIMEPVLLRRTKQ
FT                   MKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQRAEKTFRSGLQSGDLLKKYSTI
FT                   LVHILRLRQVCCDSNLIGTLDENDEDLSSGNNKLITESVDVKTLIPDTEEEEDEVPPFE
FT                   NDELDKLIESVEAKFIDSNQLIPVECSICTAEPIESSSAVVTECEHVFCKECLEEYGNF
FT                   QKEKSLQQKCPNCRRDINLNRCLAFEKGSDGILKLIHFDRKERPAKLNALIRHLQQLQD
FT                   SSAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKVKDY
FT                   AVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFV
FT                   IDGSIEEKMLRIQDRKRTLGEAMDTDEDERRKRRIEEIQMLFES"
FT   CDS_pept        353884..355344
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350858"
FT                   /locus_tag="CAGL0A03454g"
FT                   /product="Similar to uniprot|Q07979 Saccharomyces
FT                   cerevisiae YLR033w"
FT                   /protein_id="CAG57811.1"
FT                   /db_xref="HOGENOM:HBG059450"
FT                   /db_xref="HOGENOM:HBG512130"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI00003B5ECB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY75"
FT                   /transl_table=1
FT                   /translation="MSQTAEKGIADLINNLFRIFRVAGAKCRVLDEPFPSKFHESDPLK
FT                   IYESYNRFLKSKTDHDGSIKNEDKLPLTTITERNDKKEYNVSHGGLYKLYHDIKLVCIM
FT                   LINYFPQGSKKYQMVDKFYKFATELMLREAYKIGAQLVYETNLDDDERETDSSRTELEK
FT                   AISADFIKIATNYTVPVTETYHITTKDLELFSSTIERSEIDYRPHELPNSNFEINKVIP
FT                   QTSLLDEAPKLGFLAANTSGIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYNGFSSWAP
FT                   SFNENGTVIDSTTKGTIWLNRVGYMQELIKKEKELHEDLSKEQETTKDEEKKTDMLDDA
FT                   DLDQTKKNEKTANEAEVKTEEENLRNDSNNNIKIENLFAWTPSNQLTDSDIALLKDGKG
FT                   EQLVNDTLSRIARLRKSRIAKRLREPTDDERNLYFKARLLLKEIMLSKTDQPLKLSNHT
FT                   SFPIVQVNYNGTIPVVRTQPVKKKKYRR"
FT   CDS_pept        complement(355620..357035)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000152204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503086"
FT                   /locus_tag="CAGL0A03476g"
FT                   /product="Similar to uniprot|Q12078 Saccharomyces
FT                   cerevisiae YLR034c"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57812.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG312498"
FT                   /db_xref="HOGENOM:HBG370455"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniParc:UPI00003B5ECC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY74"
FT                   /transl_table=1
FT                   /translation="MLPRTIDILKKFATFVGPGIMVSVAYMDPGNYSTSVSGGAQYKYK
FT                   LLFSIFVSNIFAVLLQCLCVKLGTVTGYDLAENCRRNLPKKVNYVLYFFAEIAIIATDL
FT                   AEVVGTAIALQILFNIPLTLGVILTVLDVLLILMFYRPDGQSMKKVRMFELFVGVLVIC
FT                   TVLCFVLELFKINIPNKRELFEGFMPTSIIFKEKQALYISLGILGATVMPHSLYLGSSL
FT                   VKPRLYDYDIKKYGKVGSSPSLSAIKYSLNYSYAELIISLFLIATFVNSAILIVAGATL
FT                   AGQPEAEDADLLSIYNLLVHYISPAAGLIFAAAMLFSGQSAGIICTLAGQIVSEGFLEW
FT                   SLPPWATRLCTRLIAIIPCLFVTLTLGERGISNILNFSQVVLSLILPIVSAPLIYFTAN
FT                   RSIMTVEDHHLHVADINDVDESTPLNSSAQRKKKDFTNSKLLTGAAVFVWALIGGLNCY
FT                   LVGSWLNGADVHF"
FT   CDS_pept        complement(357639..359678)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046510"
FT                   /locus_tag="CAGL0A03498g"
FT                   /product="Similar to uniprot|Q07980 Saccharomyces
FT                   cerevisiae YLR035c MLH2"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAG57813.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG059452"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B5ECD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY73"
FT                   /transl_table=1
FT                   /translation="MPIKGIIADEKWKIFASSFIVEPKAAVRELIDNSIDSGCQNIYVS
FT                   IDSKTGGCEYISVRDDGPGVPQPDRKLMCLNNTTSKINSLDDLDKISTLGFRGEALFLI
FT                   ANLCCEVGTLEIITKCKDESVGEKWYIQKNGSIKPKSVRKAPATTGTVVTLRKLLGGFK
FT                   SREIDQSSKARKTIEDLKTILYHYALNFRNIRFSFELVSLNKNGSIAQKQLQLSVAPNL
FT                   TRPRLLSLIANLRKPTNINFVENASLEITDKIDIQLILPTMIPQSDAVNVKKSYKFLSV
FT                   NNRALSRKLAFGKEFDRMLSSIYRRLQLLEPNVWYVNIISEPQLIDVNIEPEKDDILLK
FT                   DETKVIQKMDNIIELYLREKLNINPTVSITNSPSFKQFAANTSVMLEHNESCDEPVDQS
FT                   TMPILTPTSKNITEAIIESENGNNSEPRITYEADSTNMGFKSISEVNRTGISNSQIHNL
FT                   PNDSSNSHFDNTTKLSHGINQDNLNSSDQVNTQQNTFRNSMTHVGHEYDARRENTKPKP
FT                   YNSELASNVKDTVVQVKEEPHEPISSNLATIDKDKENTFEYPYNTHKSGLSDLGASNVH
FT                   DISNQTIRPQDMHVKRPHTSMNIAPVHKRVKTNEAKRKLRMFSEYTTRLTTNAIYKPNP
FT                   QPTMSDFDQAPFKDRVLQYIKSKQFEEVDLEETSQGWQKLVKGK"
FT   tRNA            complement(360141..360213)
FT                   /gene_name="tRNA-Ala (TGC)"
FT   CDS_pept        complement(360779..361030)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046511"
FT                   /locus_tag="CAGL0A03542g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG57814.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG111964"
FT                   /db_xref="HOGENOM:HBG330644"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="UniParc:UPI00003B5ECE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY72"
FT                   /transl_table=1
FT                   /translation="MSDSPLHTVGFDPRFPNQNQTRHCWQAYVDYHKCINLKGEDFAPC
FT                   KVFWKTYSSLCPVEWVEKWDDQREKGIFAGDISPEESK"
FT   CDS_pept        complement(361832..364813)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503087"
FT                   /locus_tag="CAGL0A03564g"
FT                   /product="Similar to uniprot|P40395 Saccharomyces
FT                   cerevisiae YLR039c RIC1"
FT                   /protein_id="CAG57815.1"
FT                   /db_xref="HOGENOM:HBG058809"
FT                   /db_xref="HOGENOM:HBG202420"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="UniParc:UPI00003B5ECF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY71"
FT                   /transl_table=1
FT                   /translation="MQLWPVSPPNHFCIPPRCSERDKIDDDLDILATIPLTHSNVVIII
FT                   TKTRVLVYNFKPFALVAAHERTSESLAEFGDNKGLVPSIAFRDKVSGVTDSKPPTYMSW
FT                   YQGKLVFYTTTTKNYVLAYQVLRNSTSESIFKDYGLPIIEVSQINEFESAAYDANLDDD
FT                   VLTVFDKVKSSKVIQNGYVLNKDRGILQFLSAKSEDPNEIPIKKLELRLKVVFKFEYDI
FT                   IDFIGFKRFSDEDDGKFEENLLVLFADKIQLLKLQDFKFNSSQVVEIANSKKICICDNK
FT                   LYVISQDKETKKLIIHLIDLNEQKVLEKTEHDCNSELVNAFSIGSRMLVSTKDSVNFFC
FT                   TEKNQFTYHRKFDFSIKLAEKLTDECFVIITENDRLEICSKFGNKLFSTISEDDSSSNK
FT                   IHNDTLNYTALVYIDKTLITTCESGYYQIWNFWQEFPQSTFDFRVPKVSAIANNNNDIK
FT                   FYSSSGDSPLNRIQLQSLKLPTKSLNNNISHIKLNSNLKLVAINISNKNSLLIQNLETS
FT                   LWYQFTDVHIIDMHWIANNYLVCHLKEYNSDTVSVKCYNLPLKGLENYELEDLEIWAYE
FT                   IPENVDILKFWVNTHHKYKYLKMKNQKLDSSELSSSDRFFKTAEIILSTSSSIVVFDVI
FT                   SKVQLTGLNTIVNIHQYSSLEIANSLPTRTLEWVSTWKDGFIIYASDMLFRLEKLSDGT
FT                   IHTTQLLDNVEKIVDVVKHHIYMVQEDKFTIYDINGLWEDRKPILSIKLDEEHYPICIS
FT                   SDAAIVQSLYCVFNKNLSKLIMKNSSYLDKLISVKIDRGDDLYDISRQFSNLKHYKFAL
FT                   EKNLSIKLMEGESITKTLELIKLLNDKPTGHGKISRYSDMLEIISNCLRKSEMKNWKTL
FT                   FDDLSMSPRELLALCIDNRESKMLGVLLLVFLNYGETEVLGDIQEEKPVELHNPTMDDV
FT                   LKDEELMFKVLKHLVESSASSSNAIKASEEWELCLQLVRLLKALDKENNTNLMEKATQI
FT                   ILKS"
FT   CDS_pept        complement(365127..365696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350859"
FT                   /locus_tag="CAGL0A03586g"
FT                   /product="Similar to uniprot|Q07988 Saccharomyces
FT                   cerevisiae YLR040c"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG57816.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG124203"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniParc:UPI00003B5ED0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY70"
FT                   /transl_table=1
FT                   /translation="MRYALFANVVTLTIGVFAVVEDAKSMAADADMSFFLAFLDDFNER
FT                   YTEYTSYMIREHHTLPQEVANYYYHLNGVDEYDLKSDIINQFPFTIFKSFITVFPWYSS
FT                   LLSEGGITDMVLPGDFLSTPTLDLYTSTTDAPTVSLLTSVVSSVTLSNKDITKAAKAAA
FT                   STYLVSNYMWILLLCMVFDLIGFLTL"
FT   CDS_pept        complement(366290..366934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046512"
FT                   /locus_tag="CAGL0A03608g"
FT                   /product="Similarities with to uniprot|Q07990 Saccharomyces
FT                   cerevisiae YLR042c"
FT                   /protein_id="CAG57817.1"
FT                   /db_xref="HOGENOM:HBG124204"
FT                   /db_xref="UniParc:UPI00003B5ED1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY69"
FT                   /transl_table=1
FT                   /translation="MFICIFQILLFITGTLARSGNVPYRPNNVNNGLLALNNNNNNNDG
FT                   SDVATAGSAAVSGSVLFLPSSLISSYTADTESQYNTGDESSDLSQFLNGGGLQTALQKT
FT                   TTGTDDLFGSAATSVVLEEAYSSDRQKELETTLSTTSVVPSSSTSITTSQSSVTSASSS
FT                   STSSMPNDPEYSKQISAVSKSLARGSTYKGAGSALAPGISILLSALVSLLT"
FT   CDS_pept        complement(369404..372592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350860"
FT                   /locus_tag="CAGL0A03630g"
FT                   /product="Similar to uniprot|P33339 Saccharomyces
FT                   cerevisiae YGR047c TFC4"
FT                   /function="binding"
FT                   /protein_id="CAG57818.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059683"
FT                   /db_xref="HOGENOM:HBG396623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B5ED2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY68"
FT                   /transl_table=1
FT                   /translation="MIRSESDPEDSVSNGDMHEEVDMSPDEEGQFYENIEGLRNIIDYD
FT                   HDRDGAYRINDGEVYDGSKEGDDSLLAIFTDVEDFEEDEEDEEDNFMDAIREANNFKVK
FT                   RKKNNKSNNKKSSKKRPMARVKAINDPEVAQLISQANEAFVKQDLPEAERLFNEVIKKD
FT                   PRNFAAYETLGDIYQLQGRMNDCCNSWFLAAHLNASDWEFWKIVAILSSDLGHIRQAIY
FT                   CFSRVIHLNKEEWECIYRRALLYKQTGQIARALDGFQKMYTKSPSDANILRELAILYVD
FT                   YNKVEKAIELYLESFEKNIKRRQAIIRASEAVFESSDDDDDDDPNSKNSDEDQGDEDDY
FT                   DIQNPEELNMYPTVDFKKINKKYNCVFFEWSSLNILAELCLKSNQKKLDSISLIKRCAR
FT                   WIQHREGQTFWDDVHDDSEFDDRRAKNGRYDALPESEKTKSYSMPIDIRIRLGLLHLRN
FT                   ENVMEALNHFQFLYDEPFSDVSDLYFEVGLALTKSEKYKEAIDFFTPLLSIPEWCTIEL
FT                   YEPLTKCYKEIEDYEKAKEYGDKVLEMDPKSMDAKLNVAEINYYLGDKTTFRQLLVDVI
FT                   EERKRQAESIYDQGPTKKPRIEEFVSETEPEPEPEHESEHEQRVDKDTSEKPLLEDSKY
FT                   RVFNTKKKRTPLDAERERLDREKKMRSKVIKKYEKVHEYKEGMLMGSDQDTKKWIDIVS
FT                   ELIDIFSSVKNFFAKSRSKKFVGIIKRTKKFTTPIDYKVEQLSKLVEGESFVNDLPVLE
FT                   ERVILSSTTELRGLTYDQWFELFMELSLVITKHQSVEDGLSVIDTAQEVNVFFQDPIRA
FT                   KIMRFVKLGILLENKDESELTESLRGLLNQFQFNRKVLQVFMYSLAHGQDALNILSSTV
FT                   QQKFFLRQLKAFDSIRYDTHVTGQASLTNKEVENPERRPSPYLYYIYAVLLYSSRGFLS
FT                   ALQYLSFLEKDMPDDPMVNLMMGLAHMHRSMQRLTANRHFQLMHGLRYLKKYYSIRQSM
FT                   YTRIERQEADYNMGRAYHMIGLVSKAIEYYKKVLDSYEDGALKKHAAYNSMLIYQESGN
FT                   LELANSIMEKYLSV"
FT   CDS_pept        complement(373100..375301)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000290702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445462"
FT                   /gene_name="MAK5"
FT                   /locus_tag="CAGL0A03652g"
FT                   /product="ATP-dependent RNA helicase MAK5 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG57819.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B5ED3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY67"
FT                   /transl_table=1
FT                   /translation="MGKRVVATDKELKWKKVDIPDTLDDFGGFYGLEEIDGVDVKVVNG
FT                   QVQFIASEAQVKEEEESSESDFPDFDAMEQEDDGDVEEAEEEEEEEEDVAEADEPEVKQ
FT                   KQEQARVEQIDKGVDSEKHEDEKETPEDDLATNVFDIDVDLSDVGSGELPGWTDTVDLS
FT                   MTTINGLSNLGFTEMTPIQKLSIPAALEGKDIMGKASTGSGKTLAYGIPIIEKMIKSKD
FT                   NLRTNGIIFTPTRELAQQVTKHLQNVCSMLLKKNPYMILSLTGGLSIQKQERLLKYDGS
FT                   ARIVVATPGRFLELIEKNEELMKRFAKIDVLVLDEADRLLQDGHFDEFEKILKHLGRIR
FT                   KSLKNMEYWQTLIYSATFSTDLFDKLANSSWKKKNNSKDESEMESVLKHLMTKINFKSK
FT                   PMMIDANPEDKISAQIKESLIECAPLERDLYCYYFVTLYPGTTLIFCNSIESVKKLNAY
FT                   LINLGINSFQIHSSMTQKNRLKNLEKFEAMASKNNHLGKPTVLIASDVAARGLDIKGIK
FT                   HVVHYHLPHSADTYIHRSGRTARGDNEGVAVMICSPQEAMGPLRKLRRLLASKEQISKS
FT                   TKNKKWQQTVPLLPIEIDILQQLRERSSLANDIAEHELASRSLRKDSNWLKQAADELGI
FT                   DMDSDEEDKDIILAKNKNKKMNKTLDKNELKSMKAELTHLLKIPIRKDMRRSYLTGGLV
FT                   NLADSLVKKRGHHNIIGHEKTDALNVLKKGKSNKKQKTK"
FT   CDS_pept        375610..376602
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350861"
FT                   /locus_tag="CAGL0A03674g"
FT                   /product="Similar to uniprot|P38278 Saccharomyces
FT                   cerevisiae YBR141c"
FT                   /protein_id="CAG57820.1"
FT                   /db_xref="HOGENOM:HBG396270"
FT                   /db_xref="HOGENOM:HBG527326"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI00003B5ED4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY66"
FT                   /transl_table=1
FT                   /translation="MLSRKRVSISGKKPLKEVRIKPSKARRIIRRFHFLTSKRALICEL
FT                   LELERLRDNDEEYNSRVIDAYLGGKLLRKRYEEGQAVAAQDGMMESRLLQIRSHSDKPA
FT                   KEELLRCLGYIQREIRDGGLKNYQMASKIGQDKDRGGDSSKLLVKWLKELNYDQHTELR
FT                   ALEIGSLSVSNHISRCKIFEEVERIDLNSNDPKGIKRQDFMKRPLPRTGEEKFHLISCS
FT                   LVLNFVNTPAERGQMCQRFSEFLFPPTSDVPSYVFVVLPLPCVNNSRYMTIDHFTMIMD
FT                   SLGYELIRSHTSHKLFYCLLRLSHRESKRKFQKKEINPGPGRNNFAIVI"
FT   CDS_pept        377255..378502
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445463"
FT                   /locus_tag="CAGL0A03696g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57821.1"
FT                   /db_xref="HOGENOM:HBG123820"
FT                   /db_xref="HOGENOM:HBG396432"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="UniParc:UPI00003B5ED5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY65"
FT                   /transl_table=1
FT                   /translation="MAENRSGSNRDASMLDVSDASHQDLNNKSDSLSYSFSQMNVDSPN
FT                   ELEPQLNTRSRSRSTLIFDDDDEIPPYSKHQEHYSGTLSDFEGENSSVASSIDSAENTS
FT                   ESNTVFNNATSTDNTDNTASSQSGTASQQSQSAMNQSGQFDSDSSGSRDPRASNMVPVD
FT                   ITWQQGGNKVYVTGSFTGWRKMIGLVPMPDQPNVLHVKLQLPPGTHRFRFIVDNELRFS
FT                   DFLPTATDQMGNFVNYLEIAPVAGTDEKPPPLTPQVSGKSGDERKEPMSARSRIALEIE
FT                   REPDDLGNGYSRFHDTSPLETKYEYTQDIPAVFTDPNVMEQYYLTLDQQKNNHQNMAWL
FT                   TPPQLPPHLENVILNSYSNAQGESNENNSGALPIPNHVILNHLATSSIKHNTLCVASIV
FT                   RYKRKYVTQILYAPLQ"
FT   CDS_pept        complement(378874..383832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350862"
FT                   /locus_tag="CAGL0A03718g"
FT                   /product="Similar to uniprot|P22137 Saccharomyces
FT                   cerevisiae YGL206c CHC1"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin coat of coated pit "
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /protein_id="CAG57822.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030130"
FT                   /db_xref="GO:0030132"
FT                   /db_xref="HOGENOM:HBG023001"
FT                   /db_xref="HOGENOM:HBG317411"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001473"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniParc:UPI00003B5ED6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY64"
FT                   /transl_table=1
FT                   /translation="MSDLPIEFTELTDLTALGISPQSLDFRSTTFESDHYVTVRETVDG
FT                   ANSVAIVDLANGNQVTRKNMGGDSAIMHPSQNVISVRANGTIVQIFNLETKSKLKSFTL
FT                   DEPVIFWKWLTENTLGFVTARSILTCNVFDGNVSAKPQVLTQRHQSLNNTQIINFISNE
FT                   KEDWFAVIGILQENGRIAGKIQLYSKQRNISQAVDGHVAIFTKILLEGNGSAPVQVFVT
FT                   GNRNVQTGNGELRIIEIDHDASLAVQYQKKTTDIFFPPDATNDFPLSVQVSEKYGIIYI
FT                   LTKYGFIHLYELETGTNLFVNRITAESVFTSTSYNQKNGIACINKKGQVLAVEIDTTQI
FT                   VPYILNKLANVSLALTVATRGGLPGADDLFSKQFESLLNQGDYQNAAKVAASSTSLRNQ
FT                   NTINRLKNLQAAPGAISPILLYFSTLLDKGKLNKEETIELARPVLQQDRKQLFEKWLKE
FT                   DKLECSEELGDIVKPFDTTLALACYLRANAHAKVISCLAELQQFEKIIPYCQKVSYQPN
FT                   FLVLLSQLIRTSPDRASEFAISLLQNPETASQVDIEKLADLFFSQNHIQQGTSLLLDAL
FT                   KGDTPDQGHLQTRVLEVNLMNAPQVADAILGNNIFSHYDKPTIASLAEKAGLYQRALEN
FT                   YTDLKDTKRCIVHTSSLPVDWLISYFGKLNVEQSLACLRALMDDNLQGNIQIVIQVATK
FT                   YSDLIGSSTLIKLFEEYRATEGLYYYLASLVNLTEDKDVVYKYIEAAAKMKQYKEIERI
FT                   VRDNNVYDAERVKNFLKEANLEDQLPLIIVCDRHNFVHELILYLYKAQNMNYIETYVTQ
FT                   VNPSKTPQVVGALLDMDCDEKFIQNLLQSVIGQVPINDLTEEVEKRNRLKLLLPYLEQT
FT                   LSQGTQEQAVYNALAKIYIDSNNAPEKFLKENDQYDTLDVGRYCEKRDPYLAYIAYDKG
FT                   SNDDDLIRITNENTMYKYQARYLLKRSDPELWNKVLDSENIHRRQLIDSVISVGIPELK
FT                   DPEPVSLTVQAFMTNGLKLELIELLEKIILEPSPFNENTALQGLLMLSAIKYEPTKVSG
FT                   YIEKLENYDADEIAQLCVEHGLNEEAFEIYDKHEMNSKALKVLIEDIMSLDRGYTYADK
FT                   INSSELWSQLGTAQLDGLRIPDAIDSYIKANDPSNYENVIDLAEQAEKFEELIPYLLMA
FT                   RDTLKASKIDNALVLSYAQLNKLHEIENLLAGSNSANLEEVGDKLLDSKNYKAAKLCYS
FT                   SVSNYSKLASTLVYLGDYQTAVDTARKASNIKVWKLVNNACIDKKEFRLAQICGLNLII
FT                   HAEELDELVEKYESNGYFEELISLFEAGLGLERAHMGMFTELAILYAKYDTSKTYDHIK
FT                   LFWSRINIPKVIKAAEDAHLWRELVFLYAHYDEWDNAALTMIEKSADNFDHPYFKEVIV
FT                   KVANLEIYYKAINFYVNEHPSLLVDLLSVLTPRLDIPRTVKIFSQSDNLPLIKPFLINV
FT                   LQKNNSVVNKAYHDLMIEEEDHQALQNAVDSYDKFDQLELAGRLEKHDLIYFKKIAALL
FT                   YRRNKKWSKALDILKEQRLWKEAIETAAISQDTKVVHDLLSYFVDTGNREAFVALLYTA
FT                   YNLIKYDFVLEVSWLNSLEDFIKPYEISVKKEQNAAVEKLSEEFAKKNNTSDDREGQPL
FT                   MLMNSSMHPQATGF"
FT   CDS_pept        384820..387066
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197685"
FT                   /gene_name="POX1"
FT                   /locus_tag="CAGL0A03740g"
FT                   /product="Acyl-coenzyme A oxidase "
FT                   /EC_number="1.3.3.6"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAG57823.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG483086"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI00003B5ED7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY63"
FT                   /transl_table=1
FT                   /translation="MTKLSTVDPNASVLNPQRFIQRERENCSIDIDQVNTFLESDPRSR
FT                   DLTHLIVDQLVNDPIIKADSATYDQTKLTQREVTVKKIARMALYMEQDIKTVRKHFRDT
FT                   DLLKSLQDFGDTTTPPLTNKDLAIFDKRLSLVANMDPQLSTRIGVHLGLFGNCIKGNGT
FT                   DEQIKYWLQTRGAILIKGIYGCFAMTELGHGSNVAQLQTTATYDQESDTFIINTPDLAA
FT                   TKWWIGGAAHSATHTACYARLLVNGKDYGVKTFVVPLRDPSSLQLMPGIAIGDIGAKMG
FT                   RDGIDNGWIQFRNVVIPREFMLSRFTKVHRNPGATPTVEVDPQLDQISGYSALLSGRVN
FT                   MVMDSFRFGSKFATIATRYAVGRQQFADKPGQPEKQLIDYPLHQYRVLPQIVIPYIISP
FT                   AAFSLLNFYYSTLDELYAASSKNDKRALVVVSQKLKNLFIDSASLKATNTWLVAQLIDE
FT                   LRQTCGGHGYSGYNAFGKGYNDWVVQCTWEGDNNILSLTSAKSILKKFVDSATKGKYNK
FT                   ELDKRSFRYLDPQFIRKVFTSSSENKLDDLYDYTNIWAVALLKLLRHIAKQVDSTKDLD
FT                   GASKLLVLVSKFHALYVMLNTYYEKLNSPTDSYVTCPKTKEQLWNVYKLFSLYFIDKHA
FT                   GEFQQFKILSPDQISQVVQPRLLKLLPEIRKECISLTDSFKWPDGMLNAPIGYYDGDIY
FT                   HNYFNEVVKNNPVEKDGAGIPPYHELLANMLTRGDEFARLGGANNAEILSKLTK"
FT   tRNA            complement(387505..387576)
FT                   /gene_name="tRNA-His (GTG)"
FT   CDS_pept        complement(387856..388401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350863"
FT                   /locus_tag="CAGL0A03784g"
FT                   /product="Similarities with uniprot|Q08749 Saccharomyces
FT                   cerevisiae YOR297c TIM18"
FT                   /function="heme binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="CAG57824.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG124205"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="UniParc:UPI00003B5ED8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA4"
FT                   /transl_table=1
FT                   /translation="MMRLGLMGPRNANVYLRRCISHVRFNSVVSSAKDAPRTTETHDKE
FT                   LSAEMKGPQMYKCEQPTQPEDSFQNDYHKYINYTLLPLTVGTFGSVIYTGEVHPMLDFT
FT                   ISSLFLFSTHYHFTSLILDYIPKEKFKRLHKLAIYLLYSATGFGLFGIYELETSNNGVV
FT                   DLVRKLWSEDDSQIFFRK"
FT   CDS_pept        388858..390270
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445464"
FT                   /locus_tag="CAGL0A03806g"
FT                   /product="Similar to uniprot|Q08750 Saccharomyces
FT                   cerevisiae YOR298w MUM3"
FT                   /protein_id="CAG57825.1"
FT                   /db_xref="HOGENOM:HBG124206"
FT                   /db_xref="UniParc:UPI00003B5ED9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA3"
FT                   /transl_table=1
FT                   /translation="MGFVTFVESYVVGSSQDISTWWYTDWIVVGWKAAIIGAYLGIHTL
FT                   LTMTRLVLQTIILTPLFLRCYSIYRRFWWHVPFFGPILLEAGSYCLTSIPRVINPTLSL
FT                   ICEIIEIIFQIHVTELMFGHEKESVRIVYGEDCAEVDLFDEENQLMTTLVLSNHRSLVD
FT                   YLLIQHLLMKGAKQHTTLRKKDVIYNYFKQRILKGMQVQFLSWGQIVKFPTLLFGFNVI
FT                   NSDENCFVPSDDLETFLKSTNQCMVHFPETNILTTELFLVQRSINSSKTFAVKYNNLLN
FT                   PRFKTFVNVIDCFAKCTEIPRLPHIPIVTETKKFINKKLDDIITNSNGDVQQNAVVTHI
FT                   IAHSDVKSNQESKPHKTKKQHRVRINSHIYDITIVYLRVKYVTNVHDHIDGSIVPRSGY
FT                   QLDEIAPSLLEFLRPDSKVDRDPIITYVNIKRFDTDAILCLKDRHLEKWLEDIWKQKDL
FT                   EISKVIEKITVN"
FT   CDS_pept        390687..392117
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046513"
FT                   /locus_tag="CAGL0A03828g"
FT                   /product="Similar to uniprot|Q08760 Saccharomyces
FT                   cerevisiae YOR301w RAX1"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAG57826.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG059619"
FT                   /db_xref="HOGENOM:HBG202907"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00003B5EDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA2"
FT                   /transl_table=1
FT                   /translation="MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPY
FT                   AINYLDFWIDLMAHIRLCKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASV
FT                   TTSILMNTLLSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHL
FT                   QSTQAGIDISRKESMQSVSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQ
FT                   HSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHN
FT                   IHDELSDWRFHPSNKNPHRTSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGC
FT                   MWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMY
FT                   SHKKGNIEEGRQVYGATYNDDVPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVV
FT                   IFTAIFTVIFCCVPGRRL"
FT   tRNA            complement(392268..392339)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        complement(392922..394454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445465"
FT                   /locus_tag="CAGL0A03872g"
FT                   /product="Similar to uniprot|Q05785 Saccharomyces
FT                   cerevisiae YLR206w ENT2"
FT                   /protein_id="CAG57827.1"
FT                   /db_xref="HOGENOM:HBG252769"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI00003B5EDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA1"
FT                   /transl_table=1
FT                   /translation="MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADK
FT                   TYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKT
FT                   LREFRHEDEVSGSDEGQIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRS
FT                   RSRSTSYRNAYDDDLQKALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEEL
FT                   KKLQDMQRMQELQAQQQQQNVYYDIFGNPISPEEYYQYQEQQAALLAQQQQAVLLAQQQ
FT                   QQAALLQQQQQQLYYDQMQQLQLQQPTLATGSNNPFSRDNISNNNNTSANNALLPDLQP
FT                   KPAPSPQPQQQQPQQQPLQKTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQ
FT                   HTKTGTFINSQGTGYKQVTNEPKNNPFLSSQYTGLPSTNIVPSHTGYGFGNQQQQQQQQ
FT                   QQQQQQQQQQPQQNYNYNQQQNYQYQQQPQQYQQQQQQQFATPDQGVSLIDL"
FT   CDS_pept        394613..395029
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445466"
FT                   /locus_tag="CAGL0A03883g"
FT                   /product="Similar to uniprot|P32344 Saccharomyces
FT                   cerevisiae YLR204w QRI5"
FT                   /protein_id="CAG57828.1"
FT                   /db_xref="HOGENOM:HBG124207"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniParc:UPI00003B5EDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FYA0"
FT                   /transl_table=1
FT                   /translation="MQKLKLKLMLNCSSIATTTSARMSLLRMVRPFMAVVPGVRRVSSV
FT                   PVAGVRVSMPMPFGKMPLPLRASIQTTVQATVQATVQTMQPTVQPLPVTPQALDKEVYV
FT                   DSVMRKRRKKMKKHKLRKRRRKEKAERRKLSQGR"
FT   CDS_pept        complement(395219..396067)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445467"
FT                   /locus_tag="CAGL0A03905g"
FT                   /product="Similar to uniprot|P32339 Saccharomyces
FT                   cerevisiae YLR205c"
FT                   /function="heme oxygenase (decyclizing) activity "
FT                   /biological_process="heme oxidation"
FT                   /protein_id="CAG57829.1"
FT                   /db_xref="GO:0004392"
FT                   /db_xref="GO:0006788"
FT                   /db_xref="HOGENOM:HBG192447"
FT                   /db_xref="HOGENOM:HBG395523"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI00003B5EDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY99"
FT                   /transl_table=1
FT                   /translation="MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGA
FT                   TGATDVSDQKLLASKIVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLP
FT                   PQLQGFVDMVHATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSK
FT                   ELARKGTNFFTFSDAGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNM
FT                   DIIQEIGQLNKEALTNNKLDLLQYVFEELKFYNKDRSHQQLVYAVLVLLALLVLYRIVY
FT                   R"
FT   CDS_pept        397179..398492
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350864"
FT                   /locus_tag="CAGL0A03927g"
FT                   /product="Similar to uniprot|P32335 Saccharomyces
FT                   cerevisiae YLR203c MSS51"
FT                   /protein_id="CAG57830.1"
FT                   /db_xref="HOGENOM:HBG058514"
FT                   /db_xref="HOGENOM:HBG398256"
FT                   /db_xref="UniParc:UPI00003B5EDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY98"
FT                   /transl_table=1
FT                   /translation="MIRTRTRAVQNTGKFYACVSKRQLMGFVRNALGLDPPPSPDEPTE
FT                   QNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQYTCPISGIPTHHSREAWEQDKEY
FT                   HASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRSFYSMDT
FT                   EFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYPLQNRAVT
FT                   TTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFEIHFIGPESLYDRERNEYIRS
FT                   ATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHP
FT                   GLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQILQDTYGKEMDMLMNPVK
FT                   NVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV"
FT   CDS_pept        399220..400026
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503088"
FT                   /locus_tag="CAGL0A03949g"
FT                   /product="Similar to uniprot|Q05779 Saccharomyces
FT                   cerevisiae YLR201c"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAG57831.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="HOGENOM:HBG202493"
FT                   /db_xref="HOGENOM:HBG434378"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniParc:UPI00003B5EDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY97"
FT                   /transl_table=1
FT                   /translation="MSLYNNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYT
FT                   PESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSPAV
FT                   MELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLKRLKMDVPIASHLTQMTAQLMVP
FT                   SSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNF
FT                   METMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKSQMARV"
FT   CDS_pept        complement(400291..400611)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196242" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350865"
FT                   /locus_tag="CAGL0A03971g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAG57832.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="HOGENOM:HBG559219"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI00003B5EE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY96"
FT                   /transl_table=1
FT                   /translation="MSAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKE
FT                   DTVVYKLTGNVLLPVEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLISQ
FT                   QK"
FT   CDS_pept        join(400841..400846,400992..401804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445468"
FT                   /locus_tag="CAGL0A03993g"
FT                   /product="Similar to uniprot|Q05778 Saccharomyces
FT                   cerevisiae YLR199c"
FT                   /protein_id="CAG57833.2"
FT                   /db_xref="HOGENOM:HBG124208"
FT                   /db_xref="HOGENOM:HBG398773"
FT                   /db_xref="InterPro:IPR018855"
FT                   /db_xref="UniParc:UPI00017BD7F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY95"
FT                   /transl_table=1
FT                   /translation="MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEG
FT                   GNVKRVILTTKTMDTFFLLDKTMKVKKLADITCSLEIPKNLQTHEATHTWDFGENFPNE
FT                   VEPLQDEEQRTFSLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRGHEI
FT                   VILGCSDRIEDTKICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQG
FT                   FEKLSSTTVDSIIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL"
FT   CDS_pept        complement(402070..403596)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350866"
FT                   /locus_tag="CAGL0A04015g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57834.1"
FT                   /db_xref="HOGENOM:HBG335724"
FT                   /db_xref="HOGENOM:HBG611715"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniParc:UPI00003B5EE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY94"
FT                   /transl_table=1
FT                   /translation="MAIEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTK
FT                   LVELVSFAPFKGAAEALENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKNLG
FT                   PSIKEAFPYVDCIANELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKF
FT                   SVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIK
FT                   DKASLNEESLHDLAAVVNEDAGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVD
FT                   YRKQLYDYLCEKMHTVAPNLSGLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKAL
FT                   FRALKTKGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFG
FT                   SVLKKQVEQRLEFYATGKPTLKNELAIHEAMELFNKDKPVSEEPKADSKKRKLEESESE
FT                   SEEEEEKKEKKEKKAKKEKKEKKEKKEKKEKKEKKEKKDKKEKKEKKSKK"
FT   CDS_pept        complement(404063..405814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445469"
FT                   /locus_tag="CAGL0A04037g"
FT                   /product="Similar to uniprot|P21304 Saccharomyces
FT                   cerevisiae YLR196w PWP1"
FT                   /protein_id="CAG57835.1"
FT                   /db_xref="HOGENOM:HBG266723"
FT                   /db_xref="HOGENOM:HBG748186"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B5EE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY93"
FT                   /transl_table=1
FT                   /translation="MISATAWVPRGFPSQFPEKYVLDDEEMERINQMAQLNLEDAKEDL
FT                   ADAQDAQAGAESEEAGEEAGDVAQPNTDRLKDQAEVDDDLKEFDMEHYDDEDGAEGAEM
FT                   SMFPGLSDEVKFHAGEGDEDAYISMPHEKETEEDKEELQVYPTDNMILATRTEDDISYL
FT                   DVYVYDDGAGFHSDEIPVEEGDEYDPDVARGMVRDSALYVHHDLMLPAFPLCVEWIDYK
FT                   VGSSSEEPGNFAAIGTFDPQIEIWNLDSVDKAFPDLILDEPEENSAASLGKSKKKKGKK
FT                   KGHVTTHHTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNATAARSMANIHSNKNVSS
FT                   SQWHMQNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEEIETATFASENIILCG
FT                   TDAGNVYSFDIRNNEGSKPVWTLKAHDAGISSLSCNRFISGMMATGAMGEKQVKLWKFP
FT                   TEATAGSSGPGMVLSRDFDVGNVLTSSFAPDIEVAGNIVIGGVSKGLKLWDVFSNRSVR
FT                   RVFQDELQQVQEAAKAEAKSLGRSSRIARKYIKNDNPDTVLTIEDKNEDEDEDDEGEED
FT                   WEDEDEE"
FT   CDS_pept        406133..407488
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350867"
FT                   /gene_name="NMT1"
FT                   /locus_tag="CAGL0A04059g"
FT                   /product="Glycylpeptide N-tetradecanoyltransferase "
FT                   /EC_number="2.3.1.97"
FT                   /function="glycylpeptide N-tetradecanoyltransferase
FT                   activity"
FT                   /biological_process="N-terminal protein myristoylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57836.1"
FT                   /db_xref="EMBL:AAC26048.1"
FT                   /db_xref="GO:0004379"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006499"
FT                   /db_xref="HOGENOM:HBG011427"
FT                   /db_xref="HOGENOM:HBG314670"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniParc:UPI00003B5EE4"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74234"
FT                   /transl_table=1
FT                   /translation="MSEKKIEELLKLLSMNNGDMSKLTANQRKEMKEYKFWKTQPVTKF
FT                   DEEVKEEGPIHEEKTPADIPDEPLPLLPDFEWCAIDVDDEKQLEDVFVLLNENYVEDRD
FT                   ASFRFNYTREFFNWALKSPGWTPDWHIGVRVKASKKLIAFISAIPVRLRVRAKVIDSVE
FT                   INFLCVHKQLRSKRLTPVLIKEITRRVNKRNIWHALYTAGVVLPAPVSTCRYAHRPLNW
FT                   DKLYEVQFTDLPPNATKAEMVAKYTLPKATKTAGLRELRLEDVDQALALFNRYQSRFDI
FT                   VQEFTKEEFIHWFINDKNVVEQDKRVVFSYVVESEGKVTDFFSFYSLPFTILNNSRYKD
FT                   LGIGYLYYYASDADFKFEDRFDKEGTSLLKQRLSTLVQDACIIAAQNKMDVFNALSSQD
FT                   NTLFLEDLKFGPGDGFLNFYLFNYRTFPITGGLTEDQHFDTEHRSNVGVVML"
FT   CDS_pept        408064..409188
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197686"
FT                   /locus_tag="CAGL0A04081g"
FT                   /product="Similar to uniprot|Q05777 Saccharomyces
FT                   cerevisiae YLR194c"
FT                   /protein_id="CAG57837.1"
FT                   /db_xref="HOGENOM:HBG124209"
FT                   /db_xref="UniParc:UPI00003B5EE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY91"
FT                   /transl_table=1
FT                   /translation="MKLTQVALICSIASVNASTGGLDDNFGGKADSSKESPSGSQAADS
FT                   DSPSSQVEAQVPSANAAAQLPSSKAVSQVPTQSVVQNSNVVSSAKGKDGFAVEPSTTIT
FT                   TTDANGNPTTKYLWWIPEATPSVSAKSAPTSVEDSESSSSSAVVSSTVSPSAVSSASVV
FT                   SSSHKSIVSDSALLQNSDFSSVVSSSVSSSASSSASSSASKGKKGKDSDASSSVSSHSR
FT                   RPDEPITVLTYLDSEGHTVTSKVWWTPTGVTSSNTASVSVSSSIESKENKAVSSVHGKK
FT                   DKKSKHQKSHSSTTVETTTASSSKEHTSKHKGKGKSKSTVETVHTSVSHSASHSTSQSV
FT                   SEVAKRAVHFENAGVVDKYPLVLAAGSLAIALLL"
FT   CDS_pept        409523..410077
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445470"
FT                   /locus_tag="CAGL0A04103g"
FT                   /product="Similar to uniprot|Q05776 Saccharomyces
FT                   cerevisiae YLR193c MSF1"
FT                   /protein_id="CAG57838.1"
FT                   /db_xref="HOGENOM:HBG398237"
FT                   /db_xref="HOGENOM:HBG494750"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI00003B5EE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY90"
FT                   /transl_table=1
FT                   /translation="MVLVHRSVHVFENDFASVSCAFFNRYPNPYSRTVKSIDTLNQQVL
FT                   DGKLHTTRLLRKTGNMPVWARPFLGRISESWVIEVSVVDPQRGRMETFTKNLDHTRIMQ
FT                   VEEYSTYDYNFETRKTSVVSRVKFSSGFTTGLRERLENWSRSIFDENVKYSRQGMLFVM
FT                   KKIEEKRNKRSLLQQIQNIEP"
FT   CDS_pept        410626..411423
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445471"
FT                   /gene_name="HCR1"
FT                   /locus_tag="CAGL0A04125g"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit J"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57839.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG392163"
FT                   /db_xref="HOGENOM:HBG398276"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniParc:UPI00003B5EE7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FY89"
FT                   /transl_table=1
FT                   /translation="MSWDDAGNDDAVLMDSWDAEVDFAGDEPILDSWDEEPKAKKEAAK
FT                   PKPKPKAGGKKNAKGEEKKEQVLAIDELDPQTRKELMKKAELESDLNNAADLLGDLEMA
FT                   EEHPRARAMQKEQELAAQAALLRPAMTKDTPIEDHPLFKAETKKEYQDLRKALATAIVT
FT                   MHEKSSLNYSSSLAIDLIRDVSKPMSIENIRQTVATLNILIKDKEKAERQARLARVKGG
FT                   TATGGAGKKKAKAKTNLGGAFKKDQDFDVDDINYDDFGADDFM"
FT   CDS_pept        complement(411674..412849)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445472"
FT                   /locus_tag="CAGL0A04147g"
FT                   /product="Similar to uniprot|P80667 Saccharomyces
FT                   cerevisiae YLR191w PAS20"
FT                   /biological_process="protein import into peroxisome matrix,
FT                   docking"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAG57840.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016560"
FT                   /db_xref="HOGENOM:HBG124210"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="UniParc:UPI00003B5EE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY88"
FT                   /transl_table=1
FT                   /translation="MTYTETRPKPWETNGGTTAAVDRAFDIENEANNSLMSTRDTTTQE
FT                   SHEQGTREGSEPPEVVPRPPGLTNTMNGGVGTGMYNSGGYGYDSGIYGGGMYGNNGGMF
FT                   GSMYSGAMNRYGGMYGGGYGNYGSFYNNGYNYGGAYGDMGGNGLEQIGESTRATFQLIE
FT                   SLIGAVTGFAQMLESTYMATHNSFFTMISVAEQFNYLKEVLGSAFGIFAIMKFLKRLLY
FT                   FVTNGRLGSAPKRIQGGGNSGNSRLLEEFSRFGLNNDKAPARKITLKPLLFFLSAVFGF
FT                   PYLLNKFIQKLQEVQQRNSIAMGKDGDGTIDPSKLEFARALYDFTPENPQIEITLKKGD
FT                   LVAIISKADPLGRSSDWWKVRNRAGQNGYAPYNYLEIIKRVKKQESKTPPA"
FT   CDS_pept        complement(413588..415297)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000067723" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445473"
FT                   /locus_tag="CAGL0A04169g"
FT                   /product="Similar to uniprot|Q06324 Saccharomyces
FT                   cerevisiae YLR190w"
FT                   /protein_id="CAG57841.1"
FT                   /db_xref="HOGENOM:HBG124211"
FT                   /db_xref="HOGENOM:HBG202490"
FT                   /db_xref="InterPro:IPR013712"
FT                   /db_xref="UniParc:UPI00003B5EE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY87"
FT                   /transl_table=1
FT                   /translation="MNSPHFNELSPSMSPIAFGFDDKTLLSPTKLKLDQHAPMNSLLYP
FT                   TSLSKLSELSRTGRSQQRSRRDSDTLRSLSPLRLQFQNTGGANPGPNFSMGAPKMLKPE
FT                   FLQKSSTSTSTLPLLSALLMKTGNGKAGSQQQGSASNENNSQTTSMSGFEQVSMIKESL
FT                   DQLRQEVIVPKRNKNRDSTSTRRDRATTTKDETLAVSDDKDARKVSDANSEKTLYEEQH
FT                   LRKQVPASHSKEVGSSRIFSTETATSAKDVDSQQLRDGLDVEALPTDRNGFVQIDHKNI
FT                   NTNRYSFISATSTDYDMEWYESQNNIAKHANSHRHGHLSSNRMMSVIQDDLRNQVNLES
FT                   QSSQSSTSYEAQKLDLKIKQLELEISELKLQNEKLIHSITTNRIVEDRLLMDFIGNNEN
FT                   APIAKPTQQRDMEKKVKQLEKRFDSYQKVLKQLKVISNSPPPKKSNSKHGHRHSHGHRK
FT                   SCDNIQLTDNRGRILRISSTELRKLDEQQDSSSSSPSSFSDSPSSTSVIAEDEIEQIDL
FT                   EDPTEEKIIVKKRQNAASSVASATSSKKGFQLNFQVQLDDMEKIPKTPSPEL"
FT   CDS_pept        complement(415933..416202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445474"
FT                   /locus_tag="CAGL0A04191g"
FT                   /product="Similar to uniprot|P52871 Saccharomyces
FT                   cerevisiae YER019ca SEB2"
FT                   /protein_id="CAG57842.1"
FT                   /db_xref="HOGENOM:HBG178092"
FT                   /db_xref="HOGENOM:HBG749385"
FT                   /db_xref="InterPro:IPR005609"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="UniParc:UPI00003B5EEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY86"
FT                   /transl_table=1
FT                   /translation="MSTPPPPGGHRTLQRRRQAQAVKEKQQTQTPTSARAAGFGGSSSS
FT                   ILKIFTDEADGLRVDPLVVLFLAAGFIFTVMSMHFVAKMTGQVF"
FT   CDS_pept        416929..418848
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115549" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445475"
FT                   /locus_tag="CAGL0A04213g"
FT                   /product="Similar to uniprot|P34217 Saccharomyces
FT                   cerevisiae YBL051c"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG57843.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058477"
FT                   /db_xref="HOGENOM:HBG204250"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B5EEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY85"
FT                   /transl_table=1
FT                   /translation="MDTDSNPEAGVNNGAANGAANAASLTNDTATPPTTTTTTATTNND
FT                   YEANDEDVIPNAIVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANF
FT                   STPEDTSRVISDLNGKEINGRKLKVEYKKMLPQAERERIEREKREKRGQLEEQHRSMSN
FT                   LSLSSMNRNSNNTNNSNVTPAANTTNLLSQQLFSPNLGSLSTMQNSNIVQPMANQSTSG
FT                   SMYSARNSAYQNDPNTSANMVQQQSAVTERYYAPLPAAYSLPLPPQQLDLNDPDTLEIY
FT                   SQLLLFKDREKTYYELAYPVGVSANHKRIINVLCSYLNLVEVYDPRFIIIRRKVLNQND
FT                   LQSHILQNQQSPQVGTTENNAMMHPLQASSTGGSMNRSHSYTNLLQTHAAAAAVGTTTA
FT                   SYGLGVTAASSTGTPKITQLAQQMVANQQSQQQNASAQGHVASTSSPVISVQSNPLFSG
FT                   EQQQSLLRQTSGLTASSRIPSGYSSNQMYNNVNPLLRNNGISPPAGQTALNMTSIHNNQ
FT                   RIPQGFPASASQLQQQQQQQQQTYGQNSNPLIPQHTNESAHSNYSLQSLHDDLMNQQSN
FT                   TSVLGNSISATNTANASDMIYRTLSQSRYEDGLEQGLNRSLSALDLTGKDQENSSNDKN
FT                   AGWP"
FT   CDS_pept        419951..422110
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445476"
FT                   /locus_tag="CAGL0A04235g"
FT                   /product="Similar to uniprot|P34218 Saccharomyces
FT                   cerevisiae YBL052c SAS3 silencing protein "
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57844.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG104229"
FT                   /db_xref="HOGENOM:HBG124212"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B5EEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY84"
FT                   /transl_table=1
FT                   /translation="MNRATRSRKPDQLPSQPQRYDYNTINDLGATHMTNGGTNVASITT
FT                   NLSTNPNVEIHEEVFENNARKLGPLKIRYDSKKLLNFKRLLEVRSENAIKDSEASIREF
FT                   DPNGDSDALQIPEVDDDIPYRGVVVGKKNYSTHRTIPSSTDREFFRRLFLESSTAAFYN
FT                   GNVLLGNHDINDNDTSQPPNKKLKNVKAVKENPKTIEYVYIRDSEVKTWYTAPYPEEFN
FT                   KNKILYVCEYCLKYMNSRFVYYRHTLKCKDHRPPGNEIYRDENVSVWEIDGRENVVYCQ
FT                   NLCLLAKLFLNSKTLYYDVEPFVFYVLTEREVSEDGRTVKNHFVGYFSKEKLNSSGYNL
FT                   SCIITLPLYQRRGYGHFLMDFSYLLSKREFSQGTPEKPLSDLGLITYRNFWKLKCAETL
FT                   LYLKNELNLEDSESDDKFPLVSIEDLANLTGMLPTDVILGLEELGVFYRCPDPNQNTTS
FT                   YCIKIDSWNRIKAIRENWLRKGYQSLKPENLIWKPLIYGPSGGVNALGMVEPPSLPEDR
FT                   KTSISSEPNFQNNPVDFFGSHITMVKKFMTDDIEDPRDLEILTIDNIKKRKLSVGKNNM
FT                   LQQSWEIAYQDPRPVDKKDTTARKAPSLLSSKTTRKESLMSAETEDVLPYENQEMDDTS
FT                   VVLETEESDPDDNDYDEEDINEKVISSDSSSLVVSSEEENTDETIPVRRFPRRHASGLD
FT                   DALDDDRDELIDLTTSRQKRQLRRM"
FT   CDS_pept        complement(422355..424289)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445477"
FT                   /locus_tag="CAGL0A04257g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57845.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124213"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00003B5EED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FY83"
FT                   /transl_table=1
FT                   /translation="MISALMMDVGEKHGESESESDGVAAIRDKSAAAASISTPLSSNNN
FT                   SDVGSPELDKVGSDGVPEPNSVSNSVSNSVSNSVSDSVSNSVSNSVSNSSNSASASQDN
FT                   ANAKNPSSWDPEDDILLRHLKEIKNLGWKEIALYFENRTPNACQFRWRRLKSGNLKSNK
FT                   TATVDISEYNVVVKRLSEIENAQLSRSASEQPFRPPVDNNDKLANNIPVSYPGSANGNG
FT                   TPLGSEMDTKLNKVVSGASPAPVAATAMLTSSSHGSVTPNGTNGTQKGKRASLHFPIIP
FT                   LSRRTSVATIPSNAISGSTQSITGSVTPGSTQRSHTSLAKNKFPKARSYSHTLGPSPQL
FT                   HSLKGIKFKETKTRESHGSAINDDIENENFGFIPKIIVKSRRNSFTHPPMPVGNSTNSS
FT                   ANTKYNPGPSGLSISPPSTFNGGSGGQYLQNASFSSNLANALNTTLITSKSRKNSFSVN
FT                   SRRSSFNISSTSNSRRPSIISAPNSITNNFVINHSNSASNLHAAPKMQRKNSNVKREAT
FT                   SSQSLNTISSPNGKTSTENGTYENSYNTFKVQYMDNPVGHSSAFQKKAMDYASHSLDGM
FT                   EPKDEGVTSCSNNSGNNSRFMPWSLEEDQLLTENKLRNLSLMELSILLPNRSENEIKWR
FT                   LDTFSRNYL"
FT   CDS_pept        425058..426212
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197687"
FT                   /locus_tag="CAGL0A04279g"
FT                   /product="Similar to uniprot|P34220 Saccharomyces
FT                   cerevisiae YBL055c"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="CAG57846.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG305823"
FT                   /db_xref="HOGENOM:HBG629833"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI00003B5EEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT6"
FT                   /transl_table=1
FT                   /translation="MSIARRMRFYDIALNLTDPMFFGVYRGKQKHEPDTYELLHRAYDA
FT                   GVHASMVTGSSIEGSIDAISLVKRLSHKDHIQMKLFYTVGVHPCTVNEFMAHTMDGAFN
FT                   IHEASNDSDHNDRLYRQVIENPQLAVPKLRELHLLQEKAMHDPHFRAVGEIGLDYDRLN
FT                   YSSKEMQMLFFEEQLKIACMAAPSKPLFLHMRNCAADFISILRKFINGFTDTEDTFNWI
FT                   QIAPHRNIKHGSTYYKLDPTVKFVVHSFTDSLEDMKELLALSPNCYIGINGCSLRDQTN
FT                   IESVRQLPLERLLLETDAPWCEIRPSHASSAYLQGYDGSRYKHVKKEKLDECLRKDETN
FT                   VLVKSRNEPCNMEQVAVVIANIKELPVEEVAERAWENSCDIYGL"
FT   CDS_pept        complement(426571..427929)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445478"
FT                   /locus_tag="CAGL0A04301g"
FT                   /product="Similar to uniprot|P34221 Saccharomyces
FT                   cerevisiae YBL056w PTC3"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="CAG57847.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI00003B5EEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT5"
FT                   /transl_table=1
FT                   /translation="MGQILSNPVIDKETESGSDKWTAYAVCAMQGWRMSMEDTHIAQLN
FT                   LNADESSGHVALYSVFDGHGGSYVANFCGERMEKIVKSQKSYETGDLAQVLTDAYLAAD
FT                   EQLATQSSISDDHSGCTATSVLISKEKGVIICGNAGDSRTVLSSGGLAKALSFDHKPTL
FT                   PGETARITAANGFVQMSRVNGNLALSRAIGDFEYKSNPKLLPHEQMVTCVPDVIEHKLD
FT                   FENDEFVILACDGIWDCLSSQECVDMVHYGIQKTELSLLEITSRIVDICCAPSTEGSGI
FT                   GCDNMSIIVVALLKDSETLEQWFERMRAKNYSYSTTFEQKRKEVFSFYNFAKNQETGDE
FT                   DVFAITAPRSAPGSKLNGNQERGVTAKGPVDTSKNGKSPGVIDFTSLESLLEAGIKISQ
FT                   SPNNVQHFQGSALADMLASLSEAAAGETSPSEKNDDIEFTESTHANPEESIGH"
FT   CDS_pept        429121..429771
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227349" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445479"
FT                   /locus_tag="CAGL0A04323g"
FT                   /product="Similar to uniprot|P34222 Saccharomyces
FT                   cerevisiae YBL057c"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAG57848.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG496327"
FT                   /db_xref="HOGENOM:HBG526257"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="UniParc:UPI00003B5EF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT4"
FT                   /transl_table=1
FT                   /translation="MGSNIIPSFFGIAVASLATGYYLGTLSNGDLLSRKKKENRKPTKD
FT                   EILKKCKETAEATANAESEDEEETDDEDYDEGELSDEEIESLSLNDIPGEVRMALVIRQ
FT                   DLGMQKGKVAAQCAHAALSCFRLIATDPNKMSYNPELTKRWLRHGQAKITLKCPDKEKM
FT                   DELYAMAISLGVNAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGELKLY"
FT   CDS_pept        complement(429936..431114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503089"
FT                   /locus_tag="CAGL0A04345g"
FT                   /product="Similar to uniprot|P34223 Saccharomyces
FT                   cerevisiae YBL058w SHP1"
FT                   /protein_id="CAG57849.1"
FT                   /db_xref="HOGENOM:HBG055918"
FT                   /db_xref="HOGENOM:HBG717153"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="UniParc:UPI00003B5EF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT3"
FT                   /transl_table=1
FT                   /translation="MSDSDKVIQQFMTLTDRSIDVAREYLEQYDNDLGGALNAYYASQM
FT                   ESEEEQRENDERWGPTRESPRPSSAEGTSSRALSQSSEPVKYDSKKNSKFMSFSQMVKS
FT                   NGGSGDDDDDDDKRNTFAGGEVSGLEVTDPNDSNNIIKDLLEKAKRGGESLSQEESENK
FT                   RSAQHFIGKGYRLGSSVGETNQVVEDNTESGRRTPERVTRDITFWKEGFQVGEGELYRY
FT                   DDPANSFYLNELNQGRAPLKLLNVEFGQEVDVNVHKKLDESYKPPKRKIEGFHGRGQRL
FT                   GSPVPGDAPEPAVATATQAVPKTETKAEKTEEVPKGDSSIQIRYASGKREIFRCNATDS
FT                   VRSLYEYVSSNTTDKSRQFTLNHAFPVKPIENSDISVEEAGLVNAVVVQRWK"
FT   CDS_pept        complement(431519..431881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445480"
FT                   /locus_tag="CAGL0A04367g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /protein_id="CAG57850.1"
FT                   /db_xref="HOGENOM:HBG124214"
FT                   /db_xref="UniParc:UPI00003B5EF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT2"
FT                   /transl_table=1
FT                   /translation="MVEQQVPLRYQDRRKTEMLRFFGATMVTLVSCRLLMGKVAPKKVD
FT                   SSLLRRTNFMSNHKPFTGTTSEKTGKDISMGLLYTTGMITGLISMGITGSCWNNDITTV
FT                   DEFRERFRLDKEYLND"
FT   CDS_pept        join(432158..432191,432354..432625)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445481"
FT                   /locus_tag="CAGL0A04389g"
FT                   /product="Similar to uniprot|Q3E7A4 Saccharomyces
FT                   cerevisiae YBL059C-A"
FT                   /protein_id="CAG57851.2"
FT                   /db_xref="HOGENOM:HBG124215"
FT                   /db_xref="HOGENOM:HBG397763"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI00017BD86C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT1"
FT                   /transl_table=1
FT                   /translation="MHPQLEAQRFHSCLDYIEALDKCHQKEYYKRMLGLCNNEKDALTQ
FT                   CLKQASAETKKKAIQENKLKRDKLESKWRKIEEEEYGEDAILKMILDRELKKREGK"
FT   CDS_pept        433577..435544
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445482"
FT                   /locus_tag="CAGL0A04411g"
FT                   /product="Similarities with uniprot|P34226 Saccharomyces
FT                   cerevisiae YBL061c SKT5"
FT                   /function="binding"
FT                   /protein_id="CAG57852.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124216"
FT                   /db_xref="HOGENOM:HBG204244"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B5EF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT0"
FT                   /transl_table=1
FT                   /translation="MSHPYRQQLGEYGSRTSFDNSGQSLGIDISKIKDDIISTSSSLPR
FT                   RPELFDDDEEYSSSNNVAAEDNNFDQSFNSTISSGARNMSSTSLSGNNVRKIRSKSVDL
FT                   SHMYLLNGSHDTQLTFTNESVADLSHKVVSQYLSSGNNDPDTNPLVPRLKTIEMYRENV
FT                   KKSKDPNVLFQYAQYMLQTALTMDPECMNSTGKDEDAAELKKKFLKDAHHYLKKLSTKG
FT                   YVDAQYLLGDALASGAFGKKDNKEAYTLFQAAAKHGHVESAYRTAHCLEEGLGTTRDAR
FT                   KALNFLKFAASRNHPSAMYKLGVYSFYGRMGLPSDVNTKQNGIKWLSRAAARANELTCA
FT                   APYELAKIYEVGFLDILIPDNKYALELYVQAATLGHVPSCTLLGQRYETGDEFLPQDTS
FT                   LSVHYYTQAALKGDPVAMLGLCAWYLVGAEPAFDKDENEAFEWALRAANLKYPKAQYTL
FT                   GYFYEHGKGCEKNAEIAWKWYARAAANNDKRAINKMNSKSKDDVTSTFKKGHQKSRSVN
FT                   TLNLFAKMDDEPEYKPQESTFNNEFNTNSRDDLDGGRHNLSKSNDNYGSLPTPQINYFS
FT                   APNSAEQSPAISKQSANGKASNNTGRLHRSTPQNDIRVIQNTQFKSEEDHLNKELPSHS
FT                   QEQNSKEKKKKKNKKDCIIM"
FT   CDS_pept        436143..436925
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503090"
FT                   /locus_tag="CAGL0A04433g"
FT                   /product="Similar to uniprot|P34227 Saccharomyces
FT                   cerevisiae YBL064c"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG57853.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="UniParc:UPI00003B5EF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS9"
FT                   /transl_table=1
FT                   /translation="MSTFMRQYARNMARVPVSTRLNAQRFACANYRFYSEKTNYKQADQ
FT                   PRLRINSSAPNFDADTSHGKINLYDYLGDSWGILFSHPADFTPVCTTEMGAFAKMKPQF
FT                   DKRGVKLLGLSVEDAESHRKWIKDIEEINGIDKFGFPIIADTKRHVAFLYDMCDEEGFG
FT                   NINDGSLTTVRSVYVIDPAKKIRVIFTYPSQVGRNTAEVLRVIDALQTADKHGVVTPGN
FT                   WSPNDDVIIPPKVSDAEASEKFGDFKTVKSYLRYTKLK"
FT   CDS_pept        437546..440842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445483"
FT                   /locus_tag="CAGL0A04455g"
FT                   /product="Similar to uniprot|P34228 Saccharomyces
FT                   cerevisiae YBL066c SEF1"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57854.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060087"
FT                   /db_xref="HOGENOM:HBG397880"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B5EF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS8"
FT                   /transl_table=1
FT                   /translation="MSTAASNDHPDGGGKQSTTKKATKRASKSEESGQKKKVKKESTSK
FT                   ISSPDDNHSVTSTSTVLSQHMNGSMSSNGANLGTTHRPVTSCTHCRQHKIKCDASQNFP
FT                   APCTRCAKNGFHCEINPQFRPKKGSMMQMLAHEVDELKYKVSYLIRNDGLIAKALANHK
FT                   EGQDILRVLNTNPPGYYQEGKSEINTNSPSVNHALTPNHETNSNSSPNTKISVQTYLAG
FT                   DHPLVSQDTKSPTASGNAVPTQAMNMNRNDIIGTKYTTSVNKPILPPILNDSTPTNNSS
FT                   KAQINSGLLQMAFHRNSSTTGSPSTSRPLSPLVPNGATSHGMINNDIGLQQAGQVGAKK
FT                   SPIIATTTTMDPLPSPQANIDEFVLGDIRLSINKADELHSTFLTKYLPYFPIMSSNSAT
FT                   ELFGQSQLLFWTVMLTASMSEPEPTLYMKLSTLIKQLAIETCWIRTPRSTHISQALLIL
FT                   CNWPLPNQKVLDDCSYRFVGLAKSLSYQLGLHRGEFIYEFTRTQTSMPDAEKWRTRTWL
FT                   GIFFSENCWSSILGLPPNSKPDYLTEKAKKAEIYEDNVDKTSEITSKESNKGKAKETNG
FT                   HANEISDNKMTLPKRFKQMLILADFQGKLCNIMGTSVTSPDGLMEPSYRSDALSVLDKE
FT                   LEELNTTYKFDTDDVVNIYYLYIRLMIYCFAFLPGTPAQDQLVYVNPAYTAATKIVTLL
FT                   TQLLKDQQLIELPIYIRQSASYASLILFKLQLSPALSDKCFESARQSIVTIHRCYRNQL
FT                   SAWATVVENDISRTASMLEKLNFVLITHPEVLVEEAGIISRMRSHMTGSLFYDLVWCVH
FT                   EARRREVDPEYNRQVLEDVKKSHEKDGSKQSYHIPASKLYPLPLYNQISKEDFKTVTKT
FT                   TPNGTTVTTLVPTRSALRQAESNSNNDGGAVAINGIPLAMLDENGSLDMDNLFSLQNIA
FT                   PVNGDGAIYPRMIDSIIRPEDIPDRPNSAMATIAPSDRQDFGNKGDVNSSTQQGVNPPN
FT                   DFMMERQASFPPTQNPRTTGSSLASLPEIPKNGKSFKDFANIAQWGNFASNPTSGPNKN
FT                   NKNDIPSANSRLQLNQLSDFFQQQSAGWIEGNLGNDDFFGWLDMNMEPKF"
FT   CDS_pept        442089..444401
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000141813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445484"
FT                   /locus_tag="CAGL0A04477g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG57855.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG124217"
FT                   /db_xref="HOGENOM:HBG204242"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00003B5EF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS7"
FT                   /transl_table=1
FT                   /translation="MLKKWLPSSKKKQSSKGSAGGSSAPVTPLKGNNHLNVGNKKGSTP
FT                   TITRSAPNNAMRSSPSLPESNNDRLRVNNNNDARKDSFGNAQGPNLKLNIVEPQDVGTQ
FT                   LQKLNGGFNTTNSSNESLPSEHLHNPILNTERTELTPYGDGSNKIFGYENFGNTCYCNS
FT                   VLQCLYNLPEFRNDMLRYPLGQPKSGKSRKLEMPGLKPRMFLPEHFEPRPTQEVPKKSS
FT                   SFIKSTFSAVTSSQSNLLEDKASQQTERPLPINLSTKSSTNSLNHDAVKMRSNSEINVG
FT                   TTNASISNDIPNTEINDNGDSHRRESWVPRKHSTDHPDLTVEGQPNIDKHHSKRVIVGR
FT                   NYPKLYSAENSDQILQNNIHLKSEHLTNEQRKKSALINGPIVNVDHQIDSSAESNLYNG
FT                   LKDIFECITEHSYLTGVVTPSAFIEMLKRENVLFSSMMHQDAHEFLIFLLNEISDFLDK
FT                   QNKNALNSKIYDSSQGRRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARDEPFLDFPI
FT                   EVQENVDIDIQEILESFHQKEMLHGPNKFYCDECCGLQEAERVVGLKQLPKTLALHLKR
FT                   FKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLC
FT                   KNEKFGWLLFDDETVEAISEQAVLQYTGDKDTMTTAYVLFYQESQKEGISVDHDTNINK
FT                   LIEYDDWLRTRPPTIIKEEEEEDTPSSGEVIETGRSVTNEDTKKNKTDVIIDKENDKEK
FT                   KNKSSRRKSKLFGFMKG"
FT   CDS_pept        complement(445085..445333)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445485"
FT                   /gene_name="DPH3"
FT                   /locus_tag="CAGL0A04499g"
FT                   /product="Diphthamide biosynthesis protein 3 "
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57856.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG210658"
FT                   /db_xref="HOGENOM:HBG523051"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="UniParc:UPI00003B5EF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXS6"
FT                   /transl_table=1
FT                   /translation="MSTYDQIEIEDMTFHPDSQMFTYPCPCGDRFQILLDDMFDGEAIA
FT                   VCPSCSLMIDVIFEKEDLDEYYEEAGIAPPQPIAAAA"
FT   CDS_pept        447271..447876
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197688"
FT                   /locus_tag="CAGL0A04521g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57857.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG245558"
FT                   /db_xref="HOGENOM:HBG745393"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI00003B5EF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS5"
FT                   /transl_table=1
FT                   /translation="MGISRDSRHKRAATGAKRAQFRKKRKFELGRQPANTKIGGKRIHA
FT                   VRTRGGNQKFRALRIETGNFSWASEGVAKKTRIVGVVYHPSNNELVRTNTLTKAAIVQI
FT                   DATPFRQWYEAHYGQTLGKKKNAKTEEEVAKPSKSAERKWAARAASAKVESAVDSQFSA
FT                   GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
FT   ncRNA           complement(448251..448325)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR56"
FT                   /db_xref="Rfam:RF01188"
FT   CDS_pept        448806..449897
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046514"
FT                   /locus_tag="CAGL0A04543g"
FT                   /product="Similar to uniprot|P32357 Saccharomyces
FT                   cerevisiae YBL074c AAR2"
FT                   /protein_id="CAG57858.1"
FT                   /db_xref="HOGENOM:HBG060090"
FT                   /db_xref="HOGENOM:HBG204223"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="UniParc:UPI00003B5EFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS4"
FT                   /transl_table=1
FT                   /translation="MYNVLFSSIERDVDVGINHFSFHLQKGQPFGGIKGIVSGSREVDL
FT                   IHFISEGSLRYGYWITPGLKYYCVYNSDAELYEIHIDSNGAGYEEKLRRYESQSMLVQY
FT                   PRLDENDTWYSLTSEIRWYNVSKLFSLTTDDKIAYMDSSMTTIEEAKILQDRLQQTVGH
FT                   SGHDNKALRYAYINFKSREAIRDTHKMEDFYDKSHYLFDVVLPQQFRDSMSAYMGELQM
FT                   SFINAMFFASYGSSMQWHNLLQLLCDSNRFEQYKRLDEVVSVQINNIPEEYFDTLINRE
FT                   CWTKLLKAHHSQLPNTYNSMQTRFPELIPATAGHNDYDCDSDPGTGPVPDPMLGSDSEI
FT                   EMNATSDEEDTPTVVSQVHHRHI"
FT   CDS_pept        450575..453700
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046515"
FT                   /locus_tag="CAGL0A04565g"
FT                   /product="Similar to uniprot|P25302 Saccharomyces
FT                   cerevisiae YER111c SWI4"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG57859.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG060088"
FT                   /db_xref="HOGENOM:HBG203685"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B5EFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS3"
FT                   /transl_table=1
FT                   /translation="MNRDTADPNYLMIGTHPMSNVPSSLAAAVDTSSGMAPIIEIATYA
FT                   DTDVYECYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEKVQ
FT                   GGYGRFQGTWVPLEAAKFMTTKYNIDNPVVNTILSFILNPNNPPPKRHKNSVLRKTSPG
FT                   TKITSPSSYKKTPKKPNANSASKLSTSYTKRKKNSTQPNPSPLQNMVFRTPQQSHLASI
FT                   PTSELNMNQHGDTDATINAAYSAMSHSKTNETPLSQGYLATQKPLQFYPVPTNVGQQQE
FT                   KSRRGFTSFVPFVPEGQDNSHVNNKSDIPAITVDDMSKSQKNVKKRIKKSKFKESNEVE
FT                   YMENIPEEGRDQQYGNGNYQSEPVKRQYRKRKVKEQDAYGMYKNKDQYEQDQAKNYNLH
FT                   TDAFSYPNGAVADPYNFNDGNALQYNMTIQNDGDEAIKIESYKETLLKVLSSEEDTTRP
FT                   DYALPAELYHPPANLNINFQIDDQGHTPLHWTAAMANIPLVKLLIGLNANALHCNSQGF
FT                   NCITKAVFYNNCHKNGAFPELISLLKICLITPDKNGRLPLHYLVELSVNKTKDPNVIMT
FT                   YLDDIVKNLGQGDESLLRMCLNYQDNVGNTPLHLAALNLNLQLCNKLCQLGASMTVSNF
FT                   NNETPALILTRFNLVPPTNPSMSLPTAPTSSSSNDKNRYYRGESMQEQVYGVNNSLGNP
FT                   VSVPKSNMMKNSSKTKKVNTRKQQNSQSEDTKFTTMDAGTPNSIIRNVNDKNEEFSTPK
FT                   INHIHDSNLLDTQDTTGLHTIMDDLSHMESLVTSSVIKDTKMTPSKVLGGSPISPKKHQ
FT                   MHPVGGSYISSNLKNPVPLMDIMASPSGTLMNEDGASEKDGHILENIEKFGSASSTLFE
FT                   GLKSQFQSLQTDVEVSESALSEIASHLESISHQRQALLHSMKETEGLQSESELHHSTEQ
FT                   LREVVNQTNEMFTQGMENSQALRLAMLIQREESKVETERNNGVSIQESLDYAVELSVLQ
FT                   FKRRLIMHKIREQRCKSTSSTKINKYKRLIGLNVTDINAKLDEIERELTTKA"
FT   CDS_pept        454151..455479
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000237555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350868"
FT                   /gene_name="ALG3"
FT                   /locus_tag="CAGL0A04587g"
FT                   /product="Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.130"
FT                   /function="dolichyl-phosphate-mannose-glycolipid alpha-
FT                   mannosyltransferase activity"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57860.1"
FT                   /db_xref="GO:0004584"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG034282"
FT                   /db_xref="HOGENOM:HBG525447"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniParc:UPI00003B5EFC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXS2"
FT                   /transl_table=1
FT                   /translation="MQTVRSEDNPPKKEEFKRPPIDLLQDLKDGINHVVYNPLGNKIVM
FT                   PLMFLLESVLLKYVIAAIPYTEIDYKAYMEQVEMIYEEGNYNYLEITGGTGPLVYPAGH
FT                   VLIFRVLNYFTEGMNHIEVGQKIFRYLYLITLLMQYTCYYQLRLPPWCVVLASLSKRLH
FT                   SIYVLRLFNDCFTTFFMVLFVLLYTLRSNNSTKMSMVISTFGSLVYSMAISVKMNALLY
FT                   LPGYLVSTYLINEGKLINCLISASVILFWQVIVSLRFLRSYPVEYLAGAFDFSRQFMFK
FT                   WSVNWQFLDEDAFQDRVFHTTLLGSQFVAVVAMTLCLYPRLPLDAWKSLKAPFTQVVIA
FT                   DLRFIVPFLLMTSNFIGVLFSRSLHYQFLSWYHWTLPCLIYWSKLPMPLGFIWYICHEY
FT                   CWNSYPPNEKASILLFTLNASLLCLLAINCMRPVIVNIKRKQQ"
FT   CDS_pept        456156..457241
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046516"
FT                   /locus_tag="CAGL0A04631g"
FT                   /product="Similar to uniprot|P38180 Saccharomyces
FT                   cerevisiae YBL081w"
FT                   /protein_id="CAG57862.1"
FT                   /db_xref="HOGENOM:HBG124219"
FT                   /db_xref="UniParc:UPI00003B5EFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXS0"
FT                   /transl_table=1
FT                   /translation="MPGKIISIPFLAQNEDMDRYLVKYNENRKTNENSNASNAANNSRS
FT                   RHNGYNNFHRFHYAKNGPGNSMVDSLSYFNNRNFNAPVSSSTNNEMGNKIRLNGNSMKY
FT                   NQYKVNDPGQQSNLLMATTQLKQAYSQLYYNVANKGGNEANVASGRAFLPNNQDTFFQS
FT                   GSFQGNAEFSDKAPIDSLFSSSDARVTGGSAMFSNPTSSPTLDNGFETLSRSNGSLNTN
FT                   YSRNEALMPNFLDDLLSNSNKSPYPFGKTDLDMDITKGMKNLNIEHGNTSLPPFPFTSN
FT                   QLPLSSSLAFDLEDKSIPASNEGQQSSLFGIESFKGPLTDNGSLLMSGASSLNWDNNNI
FT                   PSSSTSSNHLGIWNNDMSVWS"
FT   CDS_pept        complement(457590..459218)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046517"
FT                   /locus_tag="CAGL0A04653g"
FT                   /product="Similar to uniprot|P33893 Saccharomyces
FT                   cerevisiae YBL080c PET112"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /protein_id="CAG57863.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG000745"
FT                   /db_xref="HOGENOM:HBG395951"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniParc:UPI00003B5EFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR9"
FT                   /transl_table=1
FT                   /translation="MYKNSIRTRPLKRFISNHAKGKFALDPAYKLKCGLEIHTQLNTRY
FT                   KLFSYTSNEAENLTISPNTSTSHYDISLPGTQPRLNYEAVLYATKLALSLDSDINLISQ
FT                   FDRKHYFYGDQPQGYQVTQHYKPFAKNGKLTLYGAYEDINENEKTIRIEQLQIEQDTGK
FT                   SLYASGADMTTMIDLNRSNVPLIELVTKPDFEDLKQVRAFIKKYQDLVRRLNICTGNLE
FT                   TGSMRIDVNLSVNDFARVELKNLPNTSSIMNAIKFEYERQLHIIKNGEGERLLRDTETR
FT                   GWTGSETVKLRSKETSIDYRYMPDPEIPFITIADDVVHKVKSTLPVSADALLREFMNKP
FT                   YNLPIKHAKILCISGNQNEMYDHEQLRKYYKDVCVHYQKEYPDDNLKIPSNWILNEFIG
FT                   NLNKLETKLNEIYEILTPSTFFELIRLMKQGVITGNSSKLLLFHIVNNVKTGVFTKSSQ
FT                   INLKQLINEYELQAADQINEHELEEICRSIIDDIKDEKLLQNLISGKKKTSLKFLVGQG
FT                   MRLSQGRLNPNELEKMFRQVLDIKW"
FT   CDS_pept        complement(460159..460515)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000232034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197689"
FT                   /gene_name="ATG8"
FT                   /gene_synonym="AUT7"
FT                   /locus_tag="CAGL0A04675g"
FT                   /product="Autophagy-related protein 8 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="CVT vesicle membrane"
FT                   /cellular_component="autophagic vacuole membrane "
FT                   /protein_id="CAG57864.1"
FT                   /db_xref="GO:0000421"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0033110"
FT                   /db_xref="HOGENOM:HBG353149"
FT                   /db_xref="HOGENOM:HBG592694"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="UniParc:UPI00003B5F00"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXR8"
FT                   /transl_table=1
FT                   /translation="MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVD
FT                   KRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGF
FT                   LYVTYSGENTFGYQ"
FT   pro_peptide     complement(460162..460167)
FT                   /gene_name="ATG8"
FT                   /locus_tag="CAGL0A04675g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXR8 "
FT   mat_peptide     complement(460168..460515)
FT                   /gene_name="ATG8"
FT                   /locus_tag="CAGL0A04675g"
FT                   /product="Autophagy-related protein 8 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXR8 "
FT   CDS_pept        461930..462304
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350869"
FT                   /locus_tag="CAGL0A04697g"
FT                   /product="Similar to uniprot|P19955 Saccharomyces
FT                   cerevisiae YFR049w YMR31"
FT                   /protein_id="CAG57865.1"
FT                   /db_xref="HOGENOM:HBG059473"
FT                   /db_xref="HOGENOM:HBG398542"
FT                   /db_xref="InterPro:IPR020373"
FT                   /db_xref="UniParc:UPI00003B5F01"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR7"
FT                   /transl_table=1
FT                   /translation="MNPTAAKLAKAYEPMIKFVGTKHPILKHNTDKILPHPCTVNGLIP
FT                   GGAETVQVADFMKNYTPFQVVPYKNSKANSSTAGSSKYQFTDRALKADEVSSINDLPLR
FT                   FHYKPIDEAELEVINGGGAY"
FT   CDS_pept        complement(462716..463513)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445486"
FT                   /locus_tag="CAGL0A04719g"
FT                   /product="Similar to uniprot|P30657 Saccharomyces
FT                   cerevisiae YFR050c PRE4"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAG57866.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG028814"
FT                   /db_xref="HOGENOM:HBG629728"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="UniParc:UPI00003B5F02"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR6"
FT                   /transl_table=1
FT                   /translation="MNHDPFSWGRPSEQTYGQYDHSIAQASIPKMNTQDPIVTGTSVIS
FT                   MKYNNGVVIAADNLAAYGSLLRFNGVERLIPVGENTIVGVSGDVSDMQHIEYLLDEMKI
FT                   ENNYDNSSPDDEEALQPSYVFEYLAAVMYQRRSKMDPLWNAVIVAGIEKDGSPFLRYVN
FT                   LLGVTYSSPTLATGFGAHLAIPLLRRVIDKETDIEKTDLALAEQTIRESMKVLFYRDAR
FT                   SSKKYSLAIIDKDKGLMFKQNQEVENMSWKFAKDIKGYGTQKI"
FT   CDS_pept        complement(464302..465912)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046518"
FT                   /locus_tag="CAGL0A04741g"
FT                   /product="Similar to uniprot|P43621 Saccharomyces
FT                   cerevisiae YFR051c RET2"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAG57867.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG028031"
FT                   /db_xref="HOGENOM:HBG521204"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00003B5F03"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR5"
FT                   /transl_table=1
FT                   /translation="MVVLAASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISS
FT                   DHTFLEDEHVRYVYRPFDNYYIILITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIF
FT                   DNSFEILSSFDEIVTMGYKENLSISQVETYLAMESHEERIQEIIERNKEIEATEERKRR
FT                   AKEIARKEQERKLGIYGGEFETANLVANSQNRFMASNDPNVANALNSYYSHASPAAQQS
FT                   YSKQQHPQSFQNLDNDVASTTRGMKGMKLGGGAQPAMSRKISTPSRPSRGQTAEPEEDK
FT                   PQNNGILITIKETINAEITRDGVISSSELKGVMELRINDPELAQAKIKLADSMDVKDHS
FT                   YQFKTHPNIDKNVFTSSKTIGLRDSSKSFPSNDNSLGVLRWRKVGLPDDKALIPLDVST
FT                   WVSPSSDNDGLFEVTIEYESRKDLENILFKVPVYTENVKINEDSDDSNAEIIAIDDEEG
FT                   ITIKVDSCPNGSSGVVSLLVEAEFEDALFPLSIGFTGKAQGSASMVGVDISAVVGSETA
FT                   EELPFDKITVIKPEQYVVV"
FT   CDS_pept        467238..469040
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215243" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350870"
FT                   /locus_tag="CAGL0A04785g"
FT                   /product="Similar to uniprot|P32608 Saccharomyces
FT                   cerevisiae YGL252c RTG2"
FT                   /protein_id="CAG57869.1"
FT                   /db_xref="HOGENOM:HBG059486"
FT                   /db_xref="HOGENOM:HBG325605"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniParc:UPI00003B5F05"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXU0"
FT                   /transl_table=1
FT                   /translation="MSVLSDSDTEAEVVSRNLCGVVDIGSNGIRFSISSKAQHHARIMP
FT                   CVFKDRLGISLYEIQYESDTGKQIPIPDDIIDEIVSAMKRFKLICEDFGVPQSGVRVIA
FT                   TEATRLALNCDQFIDAIESSTGWDVELLSREEEEKIDVYGVVSSFYFVNGLYLDLGGGT
FT                   VNLSWLQTVDGEIKRSSTSVALPYGASALTRRSNTEDRRALFLEIKEAFRKAVDEIQIP
FT                   NDMIQEAKRTGGFTLMARGGGLRGMGHLLISQNPDYPVQTIINGYSCSYDEFDALTDYL
FT                   FLKKRLPSNNKIFKVSEKRRSQLPAVALLMSAVFDVLPRITTIYFSEGGVREGTLYSIL
FT                   PREIRAQDPLLISTRPYAPLLADKYLQLLQTALPEHQIPEIVYQRVAPALCNLAFIHAS
FT                   YPKELQPTAALHVATRGIIAGCHGLSHRIRALIGIALCNRWGGNIPEPEEKYMKALEDV
FT                   VLNDHNKIEARRAVWWTKYVGTIMYVICGVHPGGNIRDNVFNFAVLKKRPQQGQTTEQS
FT                   SSHLKRSNSRTIDETLENQMESLSIQSGGNANREFEVVVRISKDDLKTSASVRSRIITL
FT                   QKKIRKLSRGSPEKVRISVQFSDN"
FT   CDS_pept        469655..470452
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445487"
FT                   /locus_tag="CAGL0A04807g"
FT                   /product="Similar to uniprot|P32496 Saccharomyces
FT                   cerevisiae YFR052w NIN1"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="proteasome regulatory particle "
FT                   /protein_id="CAG57870.1"
FT                   /db_xref="GO:0005838"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG175668"
FT                   /db_xref="HOGENOM:HBG677040"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR006746"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B5F06"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT9"
FT                   /transl_table=1
FT                   /translation="MAPTLTDLVAKINQSYNSKDFSTCKKLLPAVKIELIKNNILIPDV
FT                   NNTNEQYLQDILFTRKIFEIGALVSIYTLDFEQFYSYFAQLRTFYFSKNEKLSQSEDKS
FT                   KIISLYLLTLLSEGDVTKFHSELEYFDKHIQNIEEDQLLSYPIKVDRWLMEGSYQKAWG
FT                   LLEAGSKVPEFDVFTKTLMNAIRDEIARNTELAYKNLPLTSIKALLFINNEKETELFAK
FT                   ERGWKISRGTIYFHEENANELDEEKLDIVDKALDYAINIESIV"
FT   CDS_pept        complement(470791..472251)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445488"
FT                   /locus_tag="CAGL0A04829g"
FT                   /product="Strain CBS138 chromosome A complete sequence "
FT                   /function="ATP binding"
FT                   /function="hexokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG57871.1"
FT                   /db_xref="GO:0004396"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG130961"
FT                   /db_xref="HOGENOM:HBG522186"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI00003B5F07"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXT8"
FT                   /transl_table=1
FT                   /translation="MVHLGPKKPPTRKGSMVDMPQQLLDQIKVFEEMYTVDGETLRKVT
FT                   KHFITELDKGLSKKGGNIPMIPGWVMEYPSGKEKGDYLAIDLGGTNLRVVLVKLGGDRT
FT                   FDTTQSKYKLPEAMRTTKNHEELWSFIADSLQAFLEDQFPEGVKGKLPLGFTFSYPASQ
FT                   DRINQGVLQRWTKGFDIPNVEGHDVVPMLQKQIEKRNLPIDIVALINDTTGTLVASLYT
FT                   DGETKMGVIFGTGVNGAYYDVVSDIPKLEGKLADDIPNDSPMAINCEYGSFDNEHVVLP
FT                   RNKYDLIIDEESPRPGQQAFEKMSSGYYLGEMLRLALLDLYDQGLILKGQDISKLKKPY
FT                   VMDTSYPSKIEDDPFENLEDTDELLQKNLGIQTTVQERKLIRRLCELIGTRSARLSVCG
FT                   IAAICQKRGYETAHIAADGSVFKMYPGFKEKAAQGLADIYGWEHKDPKDCPIVIVDAED
FT                   GSGAGAAIIAALAEKRIAEGKSLGVLGA"
XX
SQ   Sequence 491328 BP; 148835 A; 99097 C; 97973 G; 145423 T; 0 other;
     tcaaaggtat ccactcaaca agattacagt aatacagtac tatcctaata tatacatagt        60
     tttttaccat ctcacaatgt aaactatgta tgtctaactc ccaccatcaa tcccatcaat       120
     gaaccttggt aagagttcag attcaatcag atgaaaaaca acacttcagg gagaacaatt       180
     gttctagagc agagtggtta ttgtactaca acaacgcatc gttgaacaca acatctcgcg       240
     tttttcgcaa ctctcaacca ggctgggtaa atcaaattgc tttgtcgact gtctcgtaga       300
     acgcaaggtc tcgcgttttt cgcaacttga tatctggact tacaggagga ctcagcttgg       360
     cccactacca gaacaatagc atttcagaac agagacatgc tactgtgatt ccaccacctc       420
     agacagggct gtttttgtag gagaaaaatg taaaaagaaa gaatagctgc atgtatgagg       480
     cgcttattag ttatatatat gattaatgtt gcttgtaaat aaaaataaac aaccccttct       540
     gtttatcttt tagcaggtgc tgtacattct gtgttcatgt gtaaatttcg tcaattcagt       600
     aacgtaatct tgaaatgtac aacactatac tctctcaagt attgataaca aagtcttaaa       660
     tcatttcaga ttaatttacg caacagctcc aaatatggat tcacaataca agctataaga       720
     agcaatacct tcagtataat aaaaactcac caataagttt tgactggtaa aaccatgcac       780
     tgtaactaat atttactatt tctattctgg cactcatata tgtttgaaca attgaagatc       840
     acaaaatttg aaattcatgt ttgggtgctg aagtgcgcac tctaacaaaa ctttaccacc       900
     acctcccttc aaccaaattg ccaaccctgt gaaaccttcc ctagatgtta gtgaaaaagt       960
     aagtactcgt tcatcgatat atccatggtc atctgaacat atatcgtatg atgtactgtt      1020
     gtgaaaatga gggcagggta actacaatcg gccttgtatt tttcatcaaa caactaaagc      1080
     agattgttga acagggtaac ttagcttatc agatgactac caccgtgcat tatcacatct      1140
     cgcgtttttc gcagcatttg aagttcaatc tcagacccac aggttcgaaa ccatggctga      1200
     ccaagatatt ataagaaaca tcgacaacag gaagacgcac acaatacaat aataaagaca      1260
     taaaacaaca taaaactttt agaagagaaa aataattata gtgttaacta ataataaata      1320
     atatatacaa aaactcttca gaataatact gctcacatta ttaatatgag atatagaaaa      1380
     cagtacgtga aacaaaaata atagccccaa attacgaaca ataaatatat attggggagc      1440
     tttaggtttt ttactttagt gttttttcag tttttttttg ttttgttgga ctataatcaa      1500
     tccattttat cattatcgat aataaaagaa acagcctatc taaaaatcat ggctggacga      1560
     acgtttgtaa tattgtacat gttgatcagt cacagaacta gtacacttta gatcataccg      1620
     acaactatta ctgcaatcat tgagaatata atactgagag aagcaactct aatcgaagca      1680
     cccttaccct gtaggacaga tgctgtttgt gtgctgttga atccactgcc gtagttgtta      1740
     acagaggaac cagaaggtga tagaacagtc gtggcagcct gttgacgtga tgatggtgct      1800
     tgtccttgtc cttgttgttg ggcttgggaa ggtacagagt gtggtgtttg gctactatga      1860
     ataccactga ctggagacgc agtacccttt gcactctgaa cagatgggga tccagatggt      1920
     acattactgc ctgccgattg gtgaactgac ccagagccag aaccagagcc actaccaccg      1980
     gctgtgccag cagcttctgt tggcttttcg ttgccagacc cttggccagc cacattttgt      2040
     gactgaggtt tctgagagtt gacaatacca cctacacctg ctgttccagg agcattaaaa      2100
     ctagcaccgg atacagttga gactggtgct gcacttgaaa cagtgtttcc atgactctgg      2160
     ccacctacgg tttgcgttac tgtagaaaca attgtgtgac cgtgctcatc agcacctgtg      2220
     ctatggcata caacctcggt gaacgtgtga ccgttagaaa ccacggtggt ggtgtaatca      2280
     gacccaatgt ctgctttaga aatcgaaggt gcaggtgcat tggtgattgt ggtggttatt      2340
     gttgtaggat taccattgga gtcggtagtg gtgatatggg aaatgacatc agtttcgata      2400
     ctgccattgc ccctgtcgac tgatgtagtg tagccagttt cacctccaac agataccatg      2460
     gagagagtag ttgtgcctgt cctggtgact ccatcgacgc caatagatgg gaagtgcgaa      2520
     attactacag tggcagtagc agtgtctgca ctcacagtgg ttgtcacaac tggtggctgt      2580
     gagtaaggtg gagcagacgt gtacacgccg tcgcctacct gatcgaagga ggccatcgtg      2640
     gtggtgtatg taacagtgtt accgtctgaa tcagtggtgg tgatgtggga gactacttct      2700
     gtgatggtgt gaccgtcgga agtaatggtg gtggtgtagt cggccctcgc cggcatcact      2760
     tggcttcaat gggatggtgg tgacgatggt ggtagggttg ccgttggagt ccttggtggt      2820
     gatgtgggag acgaggtctg tctcgaagtc accgttgccc ttgtcgatcg tcgtggtgta      2880
     gtcggcctcg ccgctcggag tgatggtgga gatagtggtg gtacctgtac gggtgacccc      2940
     atcctcgccc tcagaaggcg agtaagagat cacaaccgtc ttgctactac cgtcgtcctc      3000
     cgtcacagtg gttgtcacaa ctggtggctg tgagtaaggt ggagcagacg tgtacacgcc      3060
     gtcgcctacc tgatcgaagg aggccatcgt ggtggtgtat gtaacagtgt taccgtctga      3120
     atcagtggtg gtgatgtggg agactacttc tgtgatggtg tgaccgtcgg aagtaatggt      3180
     ggtggtgtag tcggcctcgc cggcatcact tggcttcaat gggatggtgg tgacgatggt      3240
     ggtagggttg ccgttggagt ccttggtggt gatgtgggag acgaggtctg tctcgaagtc      3300
     accgttgccc ttgtcgatcg tcgtggtgta gtcgggctcg ccgctcggag tgatggtgga      3360
     gatagtggtg gtacctgtac gggtgacccc atcctcgccc tcagaaggcg agtaagagat      3420
     cacaaccgtc ttgctactac cgtcgtcctc cgtcacagtg gttgtcacaa ctggtggctg      3480
     tgagtaaggt ggagcagacg tgtacacgcc gtcgcctacc tgatcgaagg aggccatcgt      3540
     ggtggtgtat gtaacagtgt taccgtctga atcagtggtg gtgatgtggg agactacttc      3600
     tgtgatggtg tgaccgtcgg aagtaatggt ggtggtgtag tcggcctcac cgctaggctt      3660
     ggtcaatgtt atcgtaatgt ctccagttct agtgtggccc ttggagtctg tggatgggaa      3720
     gaatgagatg atgtctgttt ctgtggtggt gctcttggaa acggttgtgg tgtatggtgg      3780
     aggcagtgag aatgagtcgg aggatgagga gccagatgaa ttaatatctt gacttggcgt      3840
     tggaagaggt tcacatgcat ctctaatagg attatagaat tcacctggac atttttgtgt      3900
     tggctgttct ggatcacatg ggacaccaat ttcgtaaatt gtttttgtaa ttgggacaat      3960
     atttccttct tgtttatcaa cagttgtact agaggttaaa atagttgatg atttcacatc      4020
     agcacagtta taattataat taacacttcc tggacattgt tctccatcag aagcagaaaa      4080
     gaagtaacta gtaaagtcat gaactttctc tttgtcaaat tctgtagtga aagaaaaatc      4140
     tataacagca ttgttatccc tattcacata gaacaatctg ataggataat atacaccaga      4200
     aactagaaat acagtaatgt tagcttttgc ataatctgat ccccaaagcg aatatgattg      4260
     ataattacca aaattgtcta aagttgattc ggctttacaa caatcaaatg catttccagc      4320
     accaagattc ataaataaca aatcgtcggc ttcaaggtta aatgtgtggt agccggtcac      4380
     ctttggctga aaatagccgt ataatatcat tgtaaagttt gtgtaggtta atgtgtctgg      4440
     atagttgtag ttgcttggta gatgaccagt taacacacga caaggatcgt tgggcttcaa      4500
     gtcaatatca atttttccat ttactcctgt aatatcagcg agtttacgct cttttttgta      4560
     gcctgacctg gggaaatctg gatattggta ggtaatatat gaacaaccgg gtacgggatg      4620
     tccataagag tacagcttta cagccaaacc cggctgtgtt tttagtactt ggggtgaaca      4680
     acctattgga aatcttgttg gatccttaga gttaggaaag tatttctcac tttgtattgc      4740
     acctaagttt tgggcgttca gtgcttgcag aaagaacgtc caacaaaaca ataatatttt      4800
     ccagttcata tttggttcaa ataatatgtt tctgtaggta tggttttttt ttgtaaatgg      4860
     cagagaaaaa ttaaagatgt caaatggatt gttaaacttt caaaatttca ctcctatata      4920
     tactgtgttt tgtattagtt ggaaagaaat tacttgtcca ttttcaatct cgaattccca      4980
     ttgccttact gactctgtca caaataatat aatatcataa tagaattatc tttaccttga      5040
     aattttttga agctaattaa tctcaaaatt ctaacctcaa tgaacttctt gaagtttttg      5100
     attatcttct gtcattttag aattggaaat cccataataa cgaaatattg acatgctact      5160
     ggtcttatca taataataaa gcaacaatat taataactta tgaaagtatg agtataccta      5220
     aacatttcta tttgttagat ggacgaggat agaaattggc ctgtccccct ctgttcataa      5280
     tcgccatcta atttaagaac cgagccttct tgaccaattt cattcttttt ctatgtacaa      5340
     agattaatat aataagggca ttaacggatt taccaaataa ataaaagtat attcaattta      5400
     atcggtaaaa taattgtttt gtgtattaat ttaattgaca agttacaaaa ataacaatca      5460
     atcaaaattt agtaaataaa cctgataaag ccttattccc atttctacaa attaatggat      5520
     gatgacaata tgtaaattaa taatagatta gtgagaatat ttaatattat tggatgattg      5580
     gcctagattc tagtgtaata atccaaatat tcttattgaa cctattatgt cgagatttta      5640
     tgccattagt tttctaaata aggattaata ttatcgtctt gataatcctt gtaattcaac      5700
     ttaaatgagc atgaagaagt ctggaattaa ataaacgacc aaagctgagt tatcaatcaa      5760
     gatttctaat ttcaacatcg gtttcgcttt tggctatcgg aacatatttc tttttgtaat      5820
     aatatatttc ttggaacatg ttattagata acgccattca gataagaaaa aacccttact      5880
     ttatttctaa gaccttttca ttaacgtaaa ggaaggcctt atcacgacct gcaattctgt      5940
     acatatgtgt ctatcttgat tacacattga tttgaatcaa tttctgtctt accaaatagt      6000
     ggtaaattaa tttgaatata atacaatgaa aaagatggca gccctagccc gataagcaca      6060
     ctatcagata tatctcccaa actggtacat ccttataaag agtcatacaa cagttgtctg      6120
     gacattatac tataaccaca gtgtcacaat aaattgattg attaaaattt atggcacaga      6180
     ttatcctcta gttactaatt ttacaagatc atgatgctat cttcccatga tgatttgcca      6240
     tatgtaattc agacaataag gatttaccgg caacatcata gtgtacgtaa aggatttacc      6300
     gtgcatgtat tgtgaggtcg ataagacaaa aatatgatta gaaagtctcc aatattcaat      6360
     aaaaccaagc ctatgttcat tatgtagatt ttaattttct atatactata aaaaataatt      6420
     ttctatatta attcaaagtg aattattagc atgaaactac gagaaatatt attaactaga      6480
     cgcttcagtt tcattaaaag tggagatata agttcattaa ttccatatcc aaatctagga      6540
     tgaatttgat aatgaagaaa attcatttaa gaatatttag aaatctcggg aaaagcactc      6600
     ttcctacccc cttctatctc cactaataat gcttgcctct taatctgaaa taccagccaa      6660
     atattatata ctaaaattaa ctatatacga ttctatctcg ttcgagcacc cattggatac      6720
     acataaagag gatctgaccc taaattggtg aatttatctg ctcaaaatta aaagaaattg      6780
     ttatttattg gccatacttt tatgtgtttc attaatgtat atattctaga atcaattatt      6840
     gtagtgacag tacaggttct aactgtaaca ctaactagaa ctataggatg tattttccaa      6900
     tgatttatct ttctatattg agcaatatac aaagacttat cgtggatggg ttgtataaaa      6960
     gatattaccc gaaattaact atgtatgatt tgaaaaggat atgaaacaac tgaaacttca      7020
     aaatagtcac caaagaataa agaatagatc aaatgagtag tttgtaaaat ttataatatt      7080
     agtgttcatc tagatatggt atcattccgc acaccttaca gaggtaaggc acttggacca      7140
     tttcgattca ttaattcact ttagaaagag atctggtaat aagagagtcc attagcttta      7200
     tttgagctat tagggctcta accaaaatgc tattacacaa taagcaatta aacgtaataa      7260
     gaaggatcaa aaaaattact tcaataaaat agattaaact tggaaaatct tacgcaaccg      7320
     agttgtgtca catctacttt gataacacat gaactttact ctataatctg ttgagatgaa      7380
     gttgttagac acattagaca tattgaaact acgagttgga gaagttgaga agttggataa      7440
     tttttcgtct atatttcgtt catttttcat ttcataatgg ggaaataggc acattatgca      7500
     gcatcgttac cataggttaa tgctggagtg acagagctat gttattcatc tttccaaaac      7560
     cgatgggtct tgcattcgat aagcacaaga cactttttta acataactgg aacttggttg      7620
     tacctattct gcgatatcac cggtctcaaa aaagaaatta aatgatgaaa atgtacttga      7680
     acaaatattt gtatcgttta gtaattttgt taaattattc ataccgaacc gactagtaag      7740
     aagtagttaa cagcataatt gcaatttgtt atttaatgga aataaacaat cgaactcgct      7800
     ctaattgttt ccgtccccca cacttactgt cactaaggta aatcatttag aagacaataa      7860
     caaataatgg tggatctcaa aattagtcaa catatgttga ggataaagca tccatgataa      7920
     gacgaaaaat gtagtagcac agcaagtaat tatttccgtg cggatcaatt caattccagt      7980
     atgttctact tcttctgtgc acttcttctt tgcaaagcca attgtctcat cttgttgttg      8040
     ttacaacggg tttgtgtggt agcaagaacc attttgtctg ataaggaaca atataggctg      8100
     cagaatatgc aggtaaatca tcgacaatac accttgtacc ccccccccct aatttttgtt      8160
     agttagtcct gagagaagaa aaaagttact atcactaact aatgcatgta gagaaatgcc      8220
     tggataagga atagacccag caagaagagt caagcagaac aaccccttta tatcactttc      8280
     aacgttatgt tggtgctttg actgtacctt tgttgagact ctgctttcct ctcaagaggg      8340
     ggtagagctt tattccgttt cttttttctt tttctgtttt tttgctgccc ttctaaagaa      8400
     caatttctcg ccacagggaa gaaatctaaa aagataacgg cagcattaca aatgtaagcc      8460
     aagactgtat caagaagggt tattgaacaa tctctcggta gaaagaagaa aagaagccat      8520
     ttcatgtcct caactcttgt aacgaatatt ggttggtgtt ttgcctcaga aatagaaggg      8580
     ttgaaagtac ccttgaccca ttgttgttac agtatagttg tgttagaaaa actacagtat      8640
     tttaattatt catgacagaa tccagtaata attgtcatgt gttatcagtt acaacataaa      8700
     gtgttaatat tttggtatta atcttgtact tcacttcaaa tattttttgg tacgtacatt      8760
     attaactacc agaaggctat gaattagcac acgtaaaaca cctaacaatt cttttaccgt      8820
     atatgttatc atgtagagga cagccttgtc aaccgatctc caataatttt ttagaacagc      8880
     taggttctag acccaaagat acacagtatt agcccattaa ttaattgtaa taacatgttt      8940
     catttcaaaa ttaaatctaa gtgaaattat tgcgtacaaa caggaatata cgtgactcct      9000
     acattttcaa agtatatttc gatatatctg tacgaccttt tcaagtaaaa tacacgacaa      9060
     atacaaaacc gaaaagtaat tttaaagcta atgaaaactt gttgaatata atatatttta      9120
     ctaattggtg gtgggtatta tttacagcgg gatccacaca ttgtaagtcc attatttgtg      9180
     gtaatcagaa cctctagata gttataatta ccatgaaata ttttaaaggc ttaattacaa      9240
     taatattgga atacactttg aaaagtagtg agaaaatata tcaatttgta tcattgtaca      9300
     aaataataat gttttagaat atgataaatg ttttgggcta taaaattaat ttcatgaaaa      9360
     aaggactctt gtgaacacta aatattggat ctaatatttc cattgtcaca atgtttagac      9420
     accacaaggt tatcaagtag tatcatctca gaataaagtc atcaaagaga acaatagttt      9480
     atctgtttta ctataggtca ggtttaacta aaagtgtgag aaaaaaagta ataagtaggc      9540
     agagattgaa aataaaagga ctgcaatcaa tcttggagaa aggtttcaaa aactttttgc      9600
     ggaagttaaa taatttttct tgcttttagt taatagtgta tatttgagga tcctttgaag      9660
     ctagagagta tgacaacttc tcaaccataa aaataaaaac ctattatctg aacatttttt      9720
     attgctaaca aattgcatta acatttatca acttagattt tttatcctca gcttacattt      9780
     attaaactgc aaaaatgttt aattatcagt tttatttttc atagaacata aagatgacga      9840
     cgaattagat gtacttgctg atatgggcta tcttaaaatt ttttgctgtt ctttgccttc      9900
     atgtcaagtg acaaaatgta ggtttataaa tgacggtgat gaatattgat ctattttacg      9960
     taaacttctc ttttttctga gaatgataga agccgtgagt aatattgcat catttagata     10020
     ttttctacta gtttattgtt gcatataatt agcttgcttt tcttccaaaa cacgatacgt     10080
     tagccctcag ttttttaccc aaagtggaag ataattagtg aactttcgaa agttaaatat     10140
     caatgtttta aggaatatta tccaaataaa tcttttcaca aatatatctc catatatcca     10200
     aaaagcatgc tatagtttca actgaaaaat aagcactaag aaacattagt gcgaataatc     10260
     attacctcat tagagtaagt aactaaagct ttgaaaataa aataaccatg catttcaatt     10320
     ctatccatat tacctgtaat acctaaagga ttagatgaac catgtacatg taaagccata     10380
     aaatgcgtta ctactaaagc agcaataata attttattga tctcatattt aattttttta     10440
     ttttatttta tccaattatt aattatatca atagagaaat tattgaaaat cgaaaatttt     10500
     gcgtgcaaat aattatatca taacaacata gaataggaac aaccaattaa tttttataat     10560
     ttgctagacc acgtcccatt attatttctt tttgtgtttc acattatttg catttgttca     10620
     taaacccccg aaatatattc agttaaaaaa ttacaatctt ttaaatgtaa aattagtatt     10680
     ttgttttgct ttgttatctc ttagaaattt ttcatatcaa cctgtggatt tagtctatga     10740
     cgatcttatg cagtaatgag ttcttgggtc taggtacaca tgaaaggcat gatattaaga     10800
     tattagttca aactatagcg gtgtaggtag atattatatt ggttactttc ttttatttta     10860
     cagtataaga tactagaact tagatttaat ttcatagact atgataagtg aaggctcttc     10920
     atttatccta ttattcaatc acaacaagtt gctctataac attgatgtgt atttagaatg     10980
     agaaccaaaa tatttgaaac aaaacaaaaa aaagcaattt taaattgagt tataactttt     11040
     ttgctagaca aaagagaata ctctttatga aaactgatgt agaagagact ttcaagatgt     11100
     ttggttttga actagaagtt ttattagagt atgacttact ggccagatgt actaattgtt     11160
     ttttctgtaa ttttatcttc actgtaatga atttctgggt tcaagtaagt ttattgcttt     11220
     tttttctcgt gtaaatatat acactgctgg ataacgagtt tatacacgat atagttatat     11280
     tgtgaataag ttttctacca ttgcttataa gcacatgcaa cagtaaaggt atcggtctcg     11340
     caagtgttac agcctttaga gcaacaaatt aatatatcag caaattaaaa aatatatcaa     11400
     ttttagtatt gatattgaat ttcaagtaat gagctttgta aaaacctttg aatgattttt     11460
     aatgcctttt tctacccaat agttattgtt attgcaaaaa cattgaaatt aagcaatggc     11520
     caaaacaata tgcatagtat atctgataga aacggtaaca gatagctata tgtagaaatt     11580
     ttgtaattta agtaagttat atttagtaga ttatatgtta gggaaatatc agtaaaatta     11640
     gagatgattt taccactgaa acaaaagaaa aggggacaaa aagaaattta aaagagatta     11700
     ggaaaaattg aatgtgaaac aatacgcaag ttaataacat gcgtatgaca ctatttggta     11760
     ggtatatcaa agtaatattt tcagttttca tcttcttttt tttgcctaca gaatctacct     11820
     aaacaaattt aatgttctat catttgttac tgtttataat ctatcattaa aaattcagac     11880
     cagtttttgg tctagtcttt aatttgcaaa aagatagtaa ttacagccat cccatcagaa     11940
     aaagtttcat acatttcatt aattaagaaa atacctaata aaaattggga cttccgattg     12000
     taatcatatt cgttagtcta tcattatgaa ttactatctt ttctgtctag tgcacacaaa     12060
     gacttgaagg cttctttgaa gctcaatgtt ttggcatttg taattcaata gatgttccag     12120
     ttatcacgat agaacagttg agtaagatta atgatgtatt gatgagcaat atatttctgg     12180
     agggtttgct acaatttcaa ataattcgat atctaaaaca ggtttcataa gcgacgatta     12240
     tttgggaaaa attgttctct gtgaaaagaa cattctagaa tatatttgct acaacatgag     12300
     acaaataacc atcaactatt gtatttatac ggaacttagt tccttattgt tgcaattaac     12360
     cagaatagac gctatacaat gctcagtcaa acttaaatat atttttctta tggttttttt     12420
     tttccgtccc gctagtcctt gtcaaggtaa tgatatcact taaatttttt ttcataatag     12480
     gtaaaataaa aaggctagaa tctttctcac aaatttttgg gagattgatc aatttgattt     12540
     taactaaaga gcattcaact aaactgcatt ggaatataac aacctatatg gataactatc     12600
     tgatcaagaa agaatacaac aataaagaaa atatgaaacc caacttcatt tgtttcaaaa     12660
     tcgtattctt actttccaaa aatctttaaa aaaatgcgtc atgtctcttg aatatacact     12720
     aaatggcagg tctacctatt ttcctattat tgcagttttc tttttacgtt attggttctt     12780
     aaataattac tatagttgtg tgggtgatgt gatgcattcg aacacaatta aattgatcct     12840
     agaaataaga tgattcgact tgttattatt ctttagtatt ccctctcaaa agttcttaag     12900
     ccttgtgcac taaaattcgt ccctactgaa tgataattga tttttctctt ttaggcattt     12960
     tgtaactaac tttacagaat agaattatca cccttctggt tttgcccacg tagatggcca     13020
     aataatcaaa tatccaatta tatatccttt gtatgttcat atataaaatt ttatagcagc     13080
     aatatattat aaacctcata aaaactagta tttgatttat acatatatat ctttatatcc     13140
     gatgtttttg atcatttatt cagtagcata atctatttgg ttcattgaca aaatcgaatt     13200
     aatagatgta ttattctacc taccgaagtt ctttctatgt aaatggtatt gcattaccta     13260
     ccttaaaatt actaggaaat atatttaata tcaaagaaat ttaacatagt ttttccaaat     13320
     tgattttgtt actttataat ttattctttg tataggaatc tgctgcatgt cagttttttg     13380
     ttgagtatta atattgtcct tggaatgcca gatctcaatt ctatagaaaa tcgatgtctt     13440
     gatacattaa ttgttaaaac gctttttctc caagcattca caagcaattg tagaagtttt     13500
     taacaaaagc taaatggtta atttcctttt gtattaatgt aactaaaaat cttgcatgct     13560
     tcgaactact taaccacata tcagcagtaa ttctttgagt aatgtgtgga tcccttcaat     13620
     taccactata tgatggaaat gggaaatacc tcataattta aagctcctcg atcttttcct     13680
     acacattatc aaattatttg taatgataaa gtattacatt tatatttgag attgttattt     13740
     ttaacatctt tcatgtatgg tactcatctg atctgtctac ctattgattc tctaaaatag     13800
     cattatttta ttaacgggct ttcttctgta ctatatagcc gatcgatcag ggcatccgag     13860
     tcatataact aatcatatgt gatacgtaca gtactatgca ttcggaagtg cttagatata     13920
     tgaagtgaga caatttcaaa ggaagtaatg gaaatttttg aacagttctt taggccagtt     13980
     ctggaaaata gtttctaaca tatttaaaac gacaaaattt taacattcgt agatcgcata     14040
     atcacagtga taacttaaat tagcttatca agattaacac cttaaagttt atactagcta     14100
     tctaaagaga ttacaagctt gggcacaacc aatcatttga gacaaccatg acatttatag     14160
     aagcatatta aaatacttgt ttattttttt gggcgataag ttctgtgtga gttatgaggt     14220
     ggttttcaag gttaattttg aagtcattgc agtgatagta gaattcaagg tagcaaaaga     14280
     tatagtcaaa aaaacagttt ggccaaagga ctatatatta ttaatgtgct aaaagcacac     14340
     gtatgaaact tcacctctag tgaagagtaa ttgttgaaga tgaggagtac atatgataac     14400
     taatggcgtt atctttgagt gactttaaca aattaacttt gggacaaaaa caacttatca     14460
     tctccaagac tttctttatt ctccctttca aaatggaaat gaactgtctt attgtaatca     14520
     gccttctaaa attatatttg tattgctcta aatctcagca agacattggt gatagcaatg     14580
     atacttgcaa agctttttta tgtcatttat tataagtttc ttatcgacac tttaaattat     14640
     tttttcaaaa accccatttc attggtctat aaggatagct aaacttaaag ttttcaccat     14700
     ggcgtaatat catattattt tagcagaaat acaaaacaat aagatagcaa ttacttgaca     14760
     atatgattag tgcgaatact gttagttttg atgacattat gatcatacac gttttgtgat     14820
     cggaggatgt tatcttttga tgtattccat tcaaaattgt tgatcaaacg gtttacttgg     14880
     ggtgcatggt gatattaacg gtcttacagt gaatcctaaa tattggtatg tatgtcttgt     14940
     ttggcatatt gtatgcataa ttaaagtatt acttacagtt agaacggtaa cagtacgaat     15000
     agtaagtaca aatgaataca tatgtcagca gtaggcacca gttgcagacc gtttgcagca     15060
     cgttaactta tctatattta gatagagagg atcctttaag aacagttttt caaattttat     15120
     gtgactctta ctgtctaagg ttcgatagtc gtttactgaa tatccatatt tatccctttt     15180
     tctgggaaaa gaatgggaaa agaaaagaca agatattaaa gtatagaaga taagatcaaa     15240
     cttcattgaa atatttcaag tttaaaaggc caatagtaaa cacaatcact gattgatgat     15300
     tttttaggga aaaataatgg acggtttctc caaaacctta tattatatta gtatctttag     15360
     tttcggtgaa atgtcatcta taaaattcag tagtatatca aatcgtattc ctatggcctt     15420
     tgctttttaa attactttag atggtcttca tttgatgtat ttttctttct gaatgcatag     15480
     ttatccagct ccgtcaaagg acactctgat agcaaagaat gataacttaa ctttaagaaa     15540
     atggtgtcaa ctaattactt tcaaatttag cttttgtgaa cttctgaaat tattgtatat     15600
     ctgttgatgt tactgtttta tgaagttgag aaatttcttt attttagtga atgttcttac     15660
     tataaattgc attttttgaa aacaaaacta agatatagga ttaaaaatta acacatggga     15720
     ctgcgctaaa ataatacaac gctctttttc attgttataa acaaaacact ggcctatgag     15780
     aataacagat gatgaaagcg tgctaaattt tgtacaaata ttaccttgga attatttaat     15840
     tagtttctat aaatagacca gcaagtacat aaacgataac tagtatgaaa gacaatgtta     15900
     ctactcaagt gagatggtgc actaattatt tgtataatat catttgtttg cgaacatgat     15960
     aaggaactcg attggaataa gaaattaatt tcagtctaat atgcgatgag cacaattatc     16020
     cctgtgtcgc attggttttg ctgcacagat ttgatttgaa ctgtaaccac tattgataaa     16080
     ccaagtataa gcatttgagt ggttacacta gagttgtatc agatcaaagt aatgttttgc     16140
     gttgatttaa catattcaga catctttaaa ctacttcttg tatcccattt agggacaatg     16200
     tgtatagaac agtaacattt tatacttgaa taagtgatat tattgacttt cactagattt     16260
     tttaacacac ttcatggcag gcacattagt cctcatgctc attatttttt acttaaaaat     16320
     tatactgtag acataattta ataaagatga agactttaca gttattcggt tgaattttga     16380
     atgatttttt gttcttcttt tattatttct atgtttggta ttttattagt tatatataga     16440
     taataacaca atcatcaaca tgtttagttc aatttatttt ggttactggt tcattatacg     16500
     attactcggg attttcagtt ttgattataa gagagaaaga gatatattta ataagaacaa     16560
     cggattaata caggtgttta taggactgtt tgatgcactt ctaactacct tccggtgctg     16620
     aaacgtagca aagaggaatg tgatttgaca tgtgagtgca cctcataagt gcaagcgcta     16680
     tatacatccc ctgtgcttac tacagtgagt ctgctgtcct tttgcggagt tcatctttca     16740
     cttgcggtaa tggaggcaga agctatcccg gaaagaagtg ggctaacatc aatggaaaag     16800
     agcaattaca cagaatggcc tggagagctc ttttctgagt agaatacaac actccagata     16860
     tcagctctgc gttacagttg acttctgata attatatgaa atagctagtg taatgttggg     16920
     ctactcttag tcaaacaata gtcctttaag aactttccca tgcgatatat tcaacaattc     16980
     atatcaacta tcttgtttga atgtagtcat tgttggtttt gtgtgattgt atttcaaaag     17040
     gtgtgaatta agtaaaagga aaatcatgac tcagagacca atgaacccca acatgagcta     17100
     tcgaagagta ggttggttgc cagtctatcc catattgacc tacattacac gaataattga     17160
     gttcttagct gataatgaga tgatattaat tgcttttcaa gagagccttt ttaagttttg     17220
     gttattcttc atgtaaacaa aactagaagc tgtcaattca aataataaat tttcgtgacg     17280
     tataactata gtttttagac atacaagtcc agccgtcctc atattgtgga tatattggat     17340
     gaagacaatt ctctgtttac tttctagaat tagtctacta tattaagtga aaataaaatt     17400
     ctagaatatc aacatgtgag aagttaaata gtagctcatc cagacaaggt ctctcccttt     17460
     agaatagcaa tattttacac agtagaatgg gtaattcatg gttatcaagt gatggtgtaa     17520
     aacttttaat tgcactttat cgtcatatta cagtgtcata atgtggaatg ttcagacgct     17580
     gctctggtgg cactatcgtg gtgtagtgta tttgagaagt ataagatgta tgtgatactt     17640
     ttagcgatat ttcctgaaag ttttacaaaa gcaatttgaa tatactagaa cgcaaatatg     17700
     tattgatttg agaaaccttt taattactct tgcttgcatt cattgttagt tttattctaa     17760
     tactatacac gagaattgta atcgaggtct aattatgagg ccgaaactaa ccaaaaagca     17820
     aatagaccgc aaagagcatt gctctttttt gccaaataga gattttttaa ctgtttatca     17880
     cttcgagttt ttgttattga tctctgtagc gaaaatttaa attttattat tttgtcttaa     17940
     taacggtggt ctacgttaac tattaagcac cttttcacat ttcttcggat cttaaggacg     18000
     atataatttg tcagcactgg tttcatttat aatgtctcaa cctttaattt gtcttttttt     18060
     gaataatatt atatcagttc ctgctctcat atcgtattta tcctttattc ttgtttccaa     18120
     gttggaagta aagtgatctc caaaccataa ctgctgcgca accttaacag atagttgatt     18180
     atagcatagt tgtaataaat tgtcagttct attaatcatt acttgcatca ctgatgaaag     18240
     ttccaaaaaa ttcaactcgt catctttgag gtttttacaa tagtgaaacc atatacgcgg     18300
     cgattcggac ttcagaacat atatattagc catattgatg atatctaaag actcagattg     18360
     agatacagag gaatactgca aaaagtctac acatttgggc acatccttct cgatatgact     18420
     caagtagagt gcatatattt ttgcatatgg ttttctgtat tgcaagggaa accactcatg     18480
     aatggcattc aacactagtc cacctagctt attatattgg ccatgcctta acaggaaatc     18540
     atatgagagc ttatagactt cacttgcctg tttccaaaaa ctttcatctt cgtctctatg     18600
     atcctgtcgt atactcataa atacttctct aagctttctt agtccatgtt caacggtagt     18660
     taattgcttc tcatcataaa ataacagctt caacatgcta accatctcac ttcttttatc     18720
     atgattaatt tttaagtcta ttattgtatt cgattcgccg gaccggctaa gtagagctac     18780
     atctctcaaa ggatcattaa taatggcctc cttgccaaat tttgagaacc tttctttcct     18840
     ctttcttaag acttcttcat tattcaattc atacatccta ttcgtcaatt ctgtaaagag     18900
     acattcagtc gagttctatc gacttagtta agaactctat atgctctctg cgctttgcaa     18960
     ctgcagctat tgcttcaaca agtcatgttt tttctcttgt taaaagaagg cggacatcat     19020
     cagttgcatg ggccaataat agctgaaaaa atagtggcta aaatatagga agatttcgat     19080
     cagataagaa tcaatcatta ctgaataggt atatgtaaac ataaaattaa actatattaa     19140
     atacataata gacatgatca aaaatgattt ttattaacct aaaggcattg ctcatgtagt     19200
     gcttttgccg ttctacgtgt acatgagtaa ttagactact gccaactatc tttcttcgat     19260
     gtagtatcat atatgtgata cagacttgat gataaaatct ctctgtgtaa tgacattttg     19320
     aatattcatg agagttacct aaaaagctaa aacgaaaaga tcaaaacgaa actctaatat     19380
     gaggagaaaa ttaaatgaga tcatcgtaca aattgtgtgc tcgaaatctg cagcactcaa     19440
     acgtcttcca ggcgtttcaa atctaacata gattataaac aaaagcttaa aaactgctcc     19500
     aattccaatc tgcaggtatt gaacctacaa cgctattcac agtcggctcg tctttcttat     19560
     tctgcttgtc ttctgactct gatcctgcaa cttcaattgg ttttgcttta gaatgctccc     19620
     cactcgataa agcagaatct agactcatct ctacgtttaa attgctcttt gtcacaatgc     19680
     cattggaaaa tggcccgtat tttttatttg ggacaacgac gcttggtgtc aagctagttc     19740
     ttgctaaatc ctcatactct atgtggcaag catcacaaac cttggatagt gtaccaacac     19800
     cgccacctcc tacaacaaat ttagcgtccg aatctaggta taaccaatgc cgtagatgct     19860
     tttgacaata tatgtctcca caatgacggc aatggtgttt tctatcaaaa aaggtgaaga     19920
     gtttatggca ctgatgacat gccgatcttt ttgagtcagg aatccaatgt gttcgagtcg     19980
     gaagttgagg cgatctactt gtagcagaaa caattgaaga tgaataagat cctattgtcg     20040
     atggagtaat atttctcttg tgtaatatcg agcttatagc atcatctgtt acctgctgtt     20100
     gcctgttcgg aaatagaaac gatgaaatgt atcttttata agtttctaca acagaggaag     20160
     tatttgaggt accacttttt tgcgaacccg cataattaat gtctgttcta taaccgggag     20220
     actttttgtt agccgctggg gtagtacgtc cacttaatct aggggagatc tcttgcagat     20280
     catcattagt tatattagtt tcaaccacat ttcttaatac cactggcata taaagtggct     20340
     tttttggatc attgatctgt ttggcatgcc ttctgtttac tccctgtttc tgtaatgtgg     20400
     ggttattgga attggacctg tatcttactg gcttttgtaa catatccaaa gaatgcattt     20460
     tagttatcgt tctcacctgt ggctgcttgg catctgcaat aaagttttgg gcatgtgtgt     20520
     tggttgtcat ttctggatta ttttcaactg ttatgtttct atcaccaaat ttcatattca     20580
     tcatggagtg tgagtttgtc gtgaagttta gtatattgga actagatgtt cggctcaaat     20640
     cagtatcagt actactctga tcatttagtt ttacagtttt cttgggcgct tccgatgaag     20700
     ctttcatagg agatggagag cttttatctg caactaagaa gttactcgac tctctcataa     20760
     tttttccttt ctcattctca gatacatttg ttgttggagt accggtgctc gtcgtatgct     20820
     cactgaatgc ctcattcaaa tttgaccctt taaagttgga cagcttcctt aatgcttgtg     20880
     tagttaaatc tttttgagaa atttcatctt cgtcttctgg tttcaaatct gatataactt     20940
     ccggtaactc acgtagagca gtaggtgtag cattatccac tatttcattt cttattctcg     21000
     gcaccgttgg agattctttc ttacttccta tctgtatcct ttcgtcattt gtgaatggta     21060
     gttttttacc tatttcattt gaatccagac tatttgaatc atatatcgtt tcctgttttc     21120
     caaaattact agctgtccta ctagcggaat gcatcagcga ccctgttctt ttgatggaga     21180
     acattgccgg tgatcttatc tgctgactca tgtttagtaa actatggctg attaaattct     21240
     gatcattatt agtgttatta gaacccatac tgtttctatg cattgattgc tgctgttgtt     21300
     gctgttgatt atttacatgc tgttgctctt gtatcataga cctgagtgaa atactggaca     21360
     gcatactctg ctgagactgg gttctccgtt gtggaatgac tttgcgcttt tcaaagacta     21420
     gtccttcact ttgtagtgag ccattcatcc tattttggct agtgtcatcc ctgtctgtga     21480
     actcccctga cgtgtccccg ttctgagtca tcccgccatc tcccaaaatc gtgtcctgac     21540
     tagtctctct ctcatcaccg acttcaaatg caacagattt cccttccgat ctagtttgat     21600
     ctttattaat accattgctg gtaaatcctt gttgtttacc tcggccacta ccgtggccat     21660
     cacttggccc atcgccatcg ggcttttctc ccgttggtgc cgggttctcg gtagaaccag     21720
     agctaccgtt tccgtgctcc cgctctagca cactcattct cgcagtattc cgctatatcg     21780
     ggatatatcc tagtacaggt ctgtgtgaca agttactggc tcccttatat atccaaagtt     21840
     gcgctcatcg catttgtaga cctcctctcg tcagcccatc ccaaagggcc caaccttagg     21900
     gaaacccgtg ccgcacgact ttcctgcgct cttttggcga aaggccccag agcagccaac     21960
     gaattttggc aaaatgccag cgattgcttc aaataagaga gggtcgggac tgaaatagtg     22020
     ttgttcagtg tcagttatcc actggacgta ccccaacaag cgtcaattgg aaccagatta     22080
     gctgagtaaa caagctgctt cctagaattt tgtgtgagcg ttcgttcttt cttatctgat     22140
     attgcattct gccaacggga tttgcgtttc gatcgacgtc aattggatat tgcgaggaaa     22200
     gagaagatat caggatacaa aactggaaat aactacaaaa tagagagaaa tagagagtca     22260
     tgtcgtctgc tgtatcggat aggcagactg tgcaatgggt actcgtggtg ctgaaggcac     22320
     tcgttttcat ggcgatcttt ggtgccgcta tctcctcccg tttatttgct gtgatcaact     22380
     tcgagtcgat tattcatgaa tatgaccctt ggttcaactt cagggctaca aaatacctgg     22440
     tttcacattc gttccacgag ttcttgaact ggttcgacga tagaacatgg tatccattgg     22500
     gtagagtcac tggtggtact ttgtaccctg gtttgatgac cacaagtgct tttgtatggc     22560
     acatgctgcg caagatcggt ctacctgttg acattagaaa catctgtgtg ctttttgctc     22620
     ctgctttcgc cggtattacc gctatcgcaa cttaccaatt cacaaaggaa ttgaaggatt     22680
     cctccgccgg tctactggct gctgtgttca tggctattgt cccaggttac atttccagat     22740
     ctgttgctgg ttcttacgat aacgaagcca tctcaattac tctattgatg ataaccttca     22800
     tgttctggat caaagcacaa aagactgggt ccatcatgca cgccactttc gctgctttgt     22860
     tctactttta catggtctca gcttggggtg gttacgtctt cattactaac ttaattccat     22920
     tacacgtttt tatccttatc ctaatgggcc gttataactc tagattatac actgcttact     22980
     ccacttggta cgcaattggt acattggctt ctatgcaaat tccttttgtg ggtttcttgc     23040
     caatcagatc taatgaccat atggctgcct tgggtgtttt cggcttcatt caaattgttg     23100
     cctttggtga cttcgtcaag gccagagtcc ccgcacaaaa gttcaaggtc atctccttgg     23160
     tttctttatt ggtgttgatg gctgtaggta ttttgggttt gttcggtttg acttacttcg     23220
     gtttgattgc cccatggact ggtagatttt actctctttg ggatactggc tacgctaagg     23280
     ttcacattcc tatcattgct tctgtctccg aacatcaacc agtagcttgg ccatctttct     23340
     tttttgacca acactttttg atctggttgt tcccagcggg tgttttcttg ttgttcatgg     23400
     acttgaagga tgagcacgtc tttgttatct gttattccgt actctgttca tacttcactg     23460
     gtgttatgat tagattgatg ttgactttaa ctccaattgt ttgtgtctct gctgctattg     23520
     ctttatcaaa aatatttgat atctacttag atttctcaaa gagagatgct gatggtaaag     23580
     ccgttccaag tttggacaag ccagcatcca ttttggccaa gttggttatc tctggttcct     23640
     ttatcttcta tctatacctg tacgtcctac actgtacctg ggtcactaag acagcttact     23700
     cttctccttc tgttgtcttg caaaccagag accaagttgg taacaatatt attatcgatg     23760
     actttagaga agcctattac tggctaagaa tgaacactgc tgaagacgct aagattgcct     23820
     cctggtggga ttacggttac caaatcggtg gtcttgcaga cagaaccact ttggttgaca     23880
     acaatacctg gaacaataca catatcgcca ttgtcggtaa agcaatggct gctccagaag     23940
     aagtttctta taagttattg aaagaacatg atgttgacta cgtccttgtc atctttggtg     24000
     gtgttttagg tttcggtggt gacgatatca ataagttcct atggatgatt agaatctcta     24060
     gtggtatctg gccagatgag atccaagaaa agaactattt cagtgactca ggtgagtaca     24120
     gagttgacgc catggcctct agagccatga ggcaatctgt gatgtacaag atgtgctacc     24180
     aaggctttgc agacttgttc cctaacgggc aggccgtcga tagggttcgt aaccaacaga     24240
     tcgacaactc tcacgtcgag ccattagatt atttcgatga agtcttcact tccgagaact     24300
     ggttagtcag agtatacaag ctaaaggatg aagatccaga aggtagagaa ctaggcgacg     24360
     tcggattgat caacagacat ccagctacat tcagaaagaa ctctctgaag aaaccagaac     24420
     tcaacatgag aatattatag ctgtaacata aattcgggct tattacagtg tatatataaa     24480
     tccatcaaaa attatcctat agtacatata tttcttagat agaaatcaat tagtaaaaac     24540
     aagcagtata ataaatcagt ttggggctag ttgtcaaact ccatacactt cggatgactc     24600
     gctatggtag ggattgccat tatacatcac ggtacagctt gtgataccga cgtcctttgt     24660
     acctcgctac tatttggtga tgagcccttt ttcctaattc ggtagatttg taaacaaaaa     24720
     atcaaaattt caaaaatttt attctccata acaaacaaac aaacaataga gggccttgat     24780
     tgcggtatta gttattgcat ttgaaaggta attgagagtg tcaatagtgc gctcctcgtt     24840
     actggcgtat atttcgagtt tctttctttt tgaaccgttc tttttgtgta aataacagat     24900
     cagaggttgt tcttctaatc tcctgtggaa aatttaacac atagctgatc caccactgtc     24960
     aaagcaacgg cttggcctca gaaacccaaa taggatatca tattgttatc tttctttcag     25020
     ttttggtagt gtttgcattt agttttggag attgagtttt gttttcgata tctttataaa     25080
     agatttgagc ttgaaattat ccttcctcgt ttcgataaaa gcatcaccgt gaccaataag     25140
     ccaatatcaa cacttttatt gagcatatac tgcactataa tctgatccat atcgacaagc     25200
     ttatagaatt caaaaggaca ttagcaatct ctcgcctaat atggacactt ctttcgagga     25260
     gtacgttaac ggaaacagaa atgttcttgc gctagttgtt tcagataatg aggacgacta     25320
     tgacagttcc atggactctg tgtcaatatc tactgaatta aatggcagta gcaccaattt     25380
     ggataggcaa gacacgatac aagatcagag ctcgccggtg ccgaaacaag aactagtggt     25440
     acctagacaa cgtgccaatg agaaaggtga gaaaggtaca aaaagtggtg gcagcaagag     25500
     gtggtctttt atatcaaacc attcttcttc atcaaagaaa agatggtcca cactatcctc     25560
     aatccctagt gaaagtgcta gcagagtgct ctcgggcaca aaagatccaa taaaaagatt     25620
     atcatccgct agcaatttta gtgttgactc tatgggcttt gatgcggtat ccaggaggca     25680
     gacatcatcc gataagaact cggttccttc attgaagaga tcttctactg gtctatcgct     25740
     aagacaacta ttcaataaaa tagttgtagc cgaggatgat actctgtctc aaggaggtga     25800
     taaggagaac actggtaaca aaaaagaaac tgcatcctta cgtaactctg catcaagccg     25860
     ctatccactc agaacattaa ccaatgagaa cgcatcaggt ctataccaag cacaatcacg     25920
     tacaacatat tctaatacag cacgccattc ggttcatttt aaccctacag gacctgagac     25980
     aagtaatacg tccagactct ccaaatcatc ttccattacc tcactgtcat ccaagttgaa     26040
     gttctggaag cgcgctcctg gtgtacctaa gtctgaatct aagagaaatt tgaatatttc     26100
     agaacctttg gaacttggaa attcagactc aaatatcaga acaaagactt cgtattcaga     26160
     tttacacaag tcaatctatt ccagctatca ttattcaaaa acctttttaa gcgagccatt     26220
     agagtctggt atgccaatga gagaattaca acagaaaaaa tcaagaactt ccatcttaaa     26280
     caaaaagaaa tccggttcta gtttatctgt taatacagga ttaaagcact tttcttctac     26340
     atcaagtctt tcattgggag ggttaaaaaa taagtcatct cactccagta ttaatatgaa     26400
     tgtgagtatg aaacacaaga gctctcactc ttcgctacat aagctggcaa aacatagacg     26460
     taaatcgaat aatggtgatg atagatctag tatatcatcc actacagcat caaccattag     26520
     tgcaaactat caaatatccc taccagtacc agatcaagtg tctcgggaga agatcagaaa     26580
     taaactaaag aactctacat ctttgttgtc tttaaattct tccatacctg tattcaaaaa     26640
     agaatttgat gagtcacttt tacaggaatt gcttgactac tgcaactgta aatatgtaat     26700
     caagaggtta aattctttag atgatgatga tgttcctatc tttcatacct ttaataacgc     26760
     taatcaaatc tccaagaata tttggagaat aagtgggcct tttaattgga caaaagaaaa     26820
     aagcattata ttcaggcgta tagagttggg ctctgttgac gatatcacat actccaagaa     26880
     ggcaattgcc ctgcatgaat taaaagcaca taactatacc tcacaaatgg ctgggattac     26940
     aaaagtttta cgatcttatg ttgttacttc tgacatagct tctccaggtg acaatattga     27000
     cactgatgat cttaagaatt tgtacttaat aatggtaatg aaagaccatg gctcttcttt     27060
     ggcaaaacta acacccataa atgactggaa aacatcggtt aatatattct ggaatactgt     27120
     ttcaatctta gcgggcttag aacaaaggtt gcagtttgaa catagaaact tgttgctaga     27180
     tcacatttta gtagatgaaa gaaatggatc gattactata agtaatctaa acagctcacg     27240
     gtttcaacaa gatgacatga atactatagc gtttactaga ttggacgatc cattattttt     27300
     tcaacgtaat gcaagagatg atcagtatga agtttatagt actatgagga tgtttttaag     27360
     tgagaacttc aacaaccagg ccaatggatg tcccgtatgg gccaggtttg agccgaggac     27420
     aaatttacta tgggcgcata atttgtgcaa aagactaatt caagaaacta cagattccaa     27480
     gcatcagtcg gaaagagacc atctaacaag gatatgttca gccattgatc ccgtaatgct     27540
     atcaaggcgt agcatgctaa agcgcaatga tggcgatata aagtcattaa tggatatatt     27600
     gaaatggaag aaaacttttt gaaactataa cgaatttcca ttaatttttt ttttttacat     27660
     tatattttta tactatttag tgtttttcta ttcatttggg aggttaataa taatattttt     27720
     ttatcgatac tacttaagaa gcattgcttt aaatacaatt tcaaatcagc ataaagtaaa     27780
     tataagatat atttcgttat gttattgcta ttcaattgca taaatagaat tatgaataca     27840
     ggtgtatacg atttgtttgt tacaggtagc aacagatcac aatcaagcta tgtttgatgg     27900
     atataagtaa tttatcaatc aacttttatt tcatcagtaa ctatttccaa ttttttggaa     27960
     ggcttactaa caggcttggc ccacaattgc atagtcatga attctatgtt actaatgaca     28020
     ctattcaaag cccaaagcca tattcctaat gagacaccca tgtgtgggaa gctagcggtc     28080
     tcgatggcaa aggaagatcc tgtgacaatt gatttagcta actgcaatgg cagaattgcc     28140
     aaatacagcc atccttgact ccaaacacca gcgactaatt gagggaacat ttgatggtga     28200
     ggtaggttgt aaactatatg cttacccttc cacaatttga aacataggaa tggcactgtg     28260
     agcaaaagca gcttgacctt tttcaggtgg ccctttattt gttcattatg agctttcagt     28320
     tgagcaccta gttccgttat ctctttgtcc agtttatcca atttcctgtt gttcttagtc     28380
     cactttgcgt agttatcctg cgcagaaatg gacttgttct cctcctgtat ggagcgacgc     28440
     tcctttacca gcgtctcaaa cttcacagag atagggctgt tcttgaagaa cagcgactgc     28500
     aacactagat catggtacga agtcgagtac tccaacactt tcaaaacaac cacgaacacc     28560
     accgcaatgg caactaccca actcattttc ttccttgttg tactcgctct atcttaactc     28620
     tcctcggtga caaaatgaat ccaactcaag acacacaact ctgttcttca agatatcctt     28680
     atccatgtag accctctccc cagacttgta gcttgctcga tgcccaacgc ccactggaca     28740
     aatccttggc aacttcctct cagtatatca cgtgatttgt tgatgttctg aaatttgaca     28800
     aaaaaaattt gaagtttggc caactttcac ccttctaaag gctcttaatg ggcagtgctt     28860
     gtgctgtgga agccttctta tcggagtggg tacccagtgg tttgctgatt tggaggtagt     28920
     attgatcaac ttttctttga aggagtcttt tttttaggtg ctattggctt agtgttttga     28980
     atctagggaa taaaagcggt tgcgaaaagt tctagattta gtttggtggg ggcaattgaa     29040
     cgttctaata tccctatctt agagaaaaat gagtgagtat atggaggata attcgcactc     29100
     tgacgatagt gggacctacg acgagtggat tccttcattt tgttcgcggt tcggtcatga     29160
     gtacttctgt caggttccca ctgattttat agaggatgat ttcaacatga catctttggc     29220
     gcaggaagtg ccacactaca gaaaggcgct tgatcttatc cttgatctgg agatggtgag     29280
     cgatgaggag gacatggatg agaaggagag cggtgcggag agtagtagcg gtgcaaacaa     29340
     taacggtgga gttaattcca aggccctagt aaatagaaac attattggcc acgcagcaga     29400
     acaactatac ggtctgatac acgcacgtta catactgact aagccaggtt tgcaggccat     29460
     ggctgagaaa ttcgatcaca aggatttcgg tacttgtccg agatacttct gccatggtat     29520
     gcagttattg ccatgcggtc tgagtgatac gataggtaaa caagcagtaa ggctctattg     29580
     tcccagctgc caggacttat acttaccaca gagttcgcgt catctatgtc tagaaggtgc     29640
     ctactggggt acaagtttcc caggtgtctt tttaaagcat ttcaaggagt tggaagaata     29700
     cgtagagaga aaaaacaaag aatcatatga actgaaagtg tttggtttca ggataaacga     29760
     tcaggctgtt tcaggcccta gaatgaagtg gttaaggcaa tacccagtca cggaagaaga     29820
     ctgggaagag ttcaataaat gcgaattcga aatgccaata gtagaatgat agtagatggt     29880
     atgacaacta ggcatgatgg tttgtgactt ttcaaaatac tcaacagcaa catcaaaaac     29940
     tttcaaacca attttatata tataaattac gtaactgtag attttaaata tttacacagc     30000
     aattctcgtc ataactaaaa gtatgtatat cggttgtcca tcgaacttta gcaatgcgtg     30060
     ctgtgtttta gtgccttact tgtgtttatc attgtattta catgccttga ccatttgttc     30120
     tcgtagtcta tctaaataac aatcaatagt ctatgtggga ttaaaccaat cactgaaatc     30180
     aatgcttcaa atcaataggt ttccctggcg cccaatcctt aactgctgat gctacattct     30240
     tccagtattt gagtcgtgct gtgagattga ttgctctttc atactccttg ttatcgtagc     30300
     attcctttaa ttctgcttct attttttcta tgcgctgctt gttgaccttc tctatctctc     30360
     ttacttcatc ccggctatta gcatcaagca attgctcatg aacgtccatg acatccatca     30420
     gcaattcagg gtccatttgt gtatattccc tggcgacact atcaacagtc agatccacgt     30480
     cctttaggat ctgaatcata tgttgagacc tagttaaggg atcctttaag gcatgataag     30540
     ctttatttag taaagaagat tgctctgagt cggcttcttg ctctttttgt atcttatcag     30600
     ggtgcacctc agcttgtaat ttcctgtatt ctttccttag cttgccaaga tccacatccc     30660
     agcgaggttg gctatctggg aacgtccctg gaaatagctc ataatagctc actatccacc     30720
     gtctttgcaa aacttgtcta atcccactgg tcggtaacct ggcacatctc agcattgttc     30780
     tgataatttg gtttggagtt tagagaatcc atatcaaacg acttgactaa cctctatcag     30840
     cattctagta acttttaccg tatttataag ccaaatttca gctaaggcga tgcgatgcga     30900
     tagtttcaac agaaaagatg actaagccag cactgggtgc catagagagc ctaattcgca     30960
     gggaacaagc actataaatg gagaataagt tgataattca taggccgctg tacttttctg     31020
     ataagagtga ctgtggctat tgccatggga agaaggctaa aggcagcgac ttttactcgt     31080
     tggaatcctg gtatgaaaga ataaaagaga atgctgattc tgaagtagag gagctacccg     31140
     tgaggagctg cactgtcggt ttccaatgtg agaatatgac cgtagccatg tatgatcaaa     31200
     tgtgtaatat gggttttcgt aggtcagggt tgtttgtgta caagatggat gcgttgcgaa     31260
     gctgctgtcg gctctacact atcagaacta gaccggattg gtttaagctg actaaggaca     31320
     tgcgaaagtg tattaaccgg tttcgaaagc atgtgctggg cgagcctgtg gctaacgcaa     31380
     aaacgcaggg ctatgttgag gatattgtgg acattgaagg tcagagcgac agtataaact     31440
     tctacaccag atttgggcca gcagtatata ctgatgagaa gtatgaattg ttttcaattt     31500
     atcaagaacg tgtccatcaa gattttgatc acagtaagaa gggctttaag aggtttcttt     31560
     gcgatgctcc atttacgcaa ggagtaatca tgggaaccga ggaagaatgg gaacaattaa     31620
     acaactggaa gtcaatgaaa cctggggaga ggcttttaag aacaggtccc gttcatgaaa     31680
     gttattatta taaaggtaaa ctgattgccc ttgctgttac agactttcta ccgagcggaa     31740
     tttcgtcggt ttattttatt tggcatcctg actatcacaa atggtcatta ggtaaactga     31800
     gtgcattgag agaactctcc cttgtatcca agactaactt gaagtactat tatctgggtt     31860
     attacataga tgattgtaaa aaaatgaact ataaggccaa ttacggggga gaattgcttg     31920
     attcatgcac cgaaagatac tttaaattgt cccaggttaa ggacatgatc agaggtggga     31980
     agttattcat ggtgggaaca caaggtcacg atattagcag ggaagttgct ttatccgatg     32040
     ctatcagaga ttgcatttat cagacagacg cgtttgatat agccagcgat gataatgtgg     32100
     cagaaaaggt ttacggtacg tcatctaata tttatcgacc acaatacctt aaagaggtga     32160
     tatctttttt gaaaacttca ggtcttgagt atgactttcc tatctataat gatggagtat     32220
     ttaatcaata tgctaaaaga atagccaaag acggagaaga tcctgatttt actataccca     32280
     gcatatgtcc ggggttaata ccactctggg aattgaagga tctgctcatg tctggtaaat     32340
     tgcaaaaaga attgacaggt aggacattgg tatttgatac ctcatttggg tttattagaa     32400
     aacttgaacc gtgggaagat gaggactcta caaccaagac ggctatatgt gacgtagtaa     32460
     ggttgttggg ccttgaaatg gcatccaact ctatagtggt ggtataatta gggttaagta     32520
     gcatatatta attataagca ttggaaatta ttttaacgtg agtctataaa gtgagctctt     32580
     tatacaagaa tccgttacca tatagaaatt cggagttaat tacatttaat aaatgatgcc     32640
     aagtcttcaa tttttgagtt ataattgaag catgaatagt aagggcaaac ttgttggaga     32700
     ggattctcca acaaccccat gaaaatggaa atgtcaacaa tgctcaagtt catcaagaat     32760
     agaacataag ttcacctatg gttcaaagtt tctccaatcc gacacaacaa tggacgcatc     32820
     tgccaatgat tcaatacgga ctggtgactc cccataaatg ggatggcatc aagtaacaat     32880
     gggtctttag agaatgtata taaagagtag cttatataca agtagtttgt gacttttaat     32940
     acataaattg tttttttttc cttgttgcaa gctttcataa gttagaacaa ctgtttaaac     33000
     tcacatcaat ttgctttctg gaacttttag gtatttgggc tagtgaataa taataatggt     33060
     tacatctgca gctgctactg ttacaggtac aaatacagag gttggtggcc tacgtaagga     33120
     gcttggcttt tacaagtttt accatcataa tactgtgaat gtgcttattc attcagtatg     33180
     tgttcctact attctattca cgacgatatg tatccttcat agggtcagct taccattcca     33240
     aattatggga gtatacctaa cacttggaca cctgttggct ttgcggtttg ctactactta     33300
     ttgcagatta catattcctg taggcatatg tgcaactgca attctagtct gtaccttgta     33360
     tgccttagat gccggactgg taggcttgac gttgaagcaa gaatcagaaa tatttgttgc     33420
     agcttggata atgcagttca ttggacatgg tgtattcgag aagaagaagc cagcgttact     33480
     agacagtttg gaacaaagtt tggtgctggc accttatttt atcctttttg agtttttgtt     33540
     tttgttagga ttctttccaa aattaagagc tgaattggaa tcggatgtta ccaagttaaa     33600
     attgcaagag aaaaggcaaa gctaaatata ttgtcacaac tcaagagttg tatggtaatg     33660
     actgttatga tactatgaaa cttacatatc tattagctat tcttgaatat tatttatgat     33720
     tgtattaccg atccaaacgc ttagcgtaag aacagtatgt attatgtggt accttgagca     33780
     gaatgcttta aagcggaact tagagcaatt cttccaacta gcaatgctcc ctctaatgct     33840
     ataaataact tattatttaa aactttgaga gaattgaaca ttaatattat aaaattttga     33900
     tataaatatg tgatagaaag aatactttca ataaatagag atgctaaatt tggaaaggtt     33960
     aacaaaaaaa gacagatata tatatatgaa aagtttacca atcttgatga acagtgtcat     34020
     aagtcgttaa tggagttctc ttttttggga actgcttggc tgggaagtgt agcaacttag     34080
     aaccaccttc ataaaatgag tacttttctc ttctaatctt ttcgtattgg tcgatgtatt     34140
     gttctttctg caatgtgatg ccaatgtcat ctagaccatt tactagacaa tgctttctga     34200
     atgcttcaac ttcaaaatgt tcaaccaaaa cattgccatc cgaatcagag atggtttgat     34260
     ctggtaagtt aataacgaga ttcttaccag cctttgcaac aggaactagc ttgtttacga     34320
     tggtatcttg atcaattcta attggtaaca aaccattctt gaaactgtta ttgtagaaaa     34380
     tatcaccgaa agatggagca ataattgact tgataccaaa atctttcaaa gcccatgggg     34440
     cgtgttctct agaggaacca caaccaaagt tgtcaccagt aacaacgagg acctcagctt     34500
     tcctccatgg gttgacattc aacacaaaat ctgtttcttt atcttttcca ctgtcatcct     34560
     tgacaaatct ccattcgtaa aatagacctg atctcaaacc ggttctctta attgttttca     34620
     agaattgttt tggaataata gcatcagtat caacgttagc cttttcaagt ggagcagcca     34680
     aaccattcaa aacgacaaat gggtccatac caccagcaac tggcttagta tcgtccgtct     34740
     ttaatctttt tgtttcggat tcgactggga tgtccttcaa ctgatcattc tcaacatcag     34800
     ttggggcatc accgggctgt tgtggttcag tgtgctcata cgcagcttct tcaagttctt     34860
     cgtcttcatc agaagatata gtaactttag catcgtcagc gttattatat ttaaattctc     34920
     tgatgtctac aaagtgacct gcaacagctg tagcagcagc catggctgga gacattaaat     34980
     gtgtacgaga taaggcacct tgacgacctt caaagtttct gttggaagtg gaagcacaac     35040
     gttcgtactt gtccaaaata tctgggttca tacctagaca catagaacag ccagcttctc     35100
     tccattcaaa gccagctgca atgaaaactt tatcaagccc ttcttcttcg gcttgtacct     35160
     tgactaaacc ggatcctggg acaaccatag ctctcttgat atttggggca atcttatgac     35220
     catttaagac cttagcggca tttctcaaat cttcaatacg gccattagta catgaaccaa     35280
     tgaagacctt gtcgacatag atactcttca atggagtgtt tggtttcaag cccatgtatt     35340
     cgagagctct ctccataccg gacttcttga ttggatcatc tacattagct ggatctggaa     35400
     ctgatgcact gattggtagc gcatcttgtg gagaagtacc ccaggtaata gttggaataa     35460
     tttctgaacc tttgatgacg atttcgtgat cgaatttggc gccctcatca gaatgcaaag     35520
     tcttccagta agcaacagcc ttgtcccatt cggcaccagt tggggccaat ggtcttcctt     35580
     tgaaatattc gaaagtgaca ttgtctggtt tgatcatacc agctcttgca ccggcctcaa     35640
     tggacatatt acacatagac atacgagctt ccatagataa gttctctata gcttcaccag     35700
     caaattcaat gacggaacca gtaccaccag cagtaccgat cacaccaatg atatgaagaa     35760
     tcaaatcctt agatgtaata cctgggctta acttaccgtc gactctaatt ctcatattct     35820
     tggatttact ttgaatgata gtttgggtag ccaagacgtg ttcgacttcg gaggtaccga     35880
     taccgaatgc caatgcaccg aatgcaccgt gagtagaagt gtgggagtca ccacacacca     35940
     cagtggtacc aggtaaggtg aaaccttgct caggaccaat agtatggacg ataccttgtc     36000
     tcttctcggt tagaccaaag tatggtacgc caaattgctt gacgttctgt tccaaagtct     36060
     tcacttgtaa gcgggagtcg gtttgtgtaa tgaaagagtc caagttcttg aaactctttc     36120
     tggactcggt tgggatgttg tggtcaactg tggccaaagt acaatccacc cttcttactg     36180
     gtctgttcgc attagtcaaa ccttcaaagg cctgtggaga agtaacctcg tgcactagat     36240
     gtctgtcaat gtacaacaag taagagccat tctcatcctt gtgcaccaca tgcgcatcaa     36300
     atactttatc atatagggtc ctaggacctt tagtctctgt agtaaccatc ggttaatatt     36360
     ctttataagt cttgcttgtt cttgtacatt ccaattcttc ggagacaagg caaagaccaa     36420
     ttccaatagc ctccactcaa cttatatact tttttttttt ttttgtttgg gctcccaaca     36480
     ttgatccaga agatgtgact cgattgtcca aggttccact tccaaccacc ttgggtccaa     36540
     ctccaccggc gtccaaccca agctcgactc atttactcct gcatcgctca cttgtgttgg     36600
     cagtggtaag aaccaaatcc aacatcccaa ctgcagctcc gtctaagaaa cgcttgcgat     36660
     gagtatcaaa tttcaacttt tttttcttca aatcctgcaa caagagtttg aaatttttca     36720
     gttatttttt gggatttttt ttttttcaca gcgatttagc tcccctaacc tcagagatca     36780
     gcgtacaacg caagctagct ttttcctagt tcttaggggg gctgccctgc tttagtaatg     36840
     atccgctcgc atctttgaac tgggccggtc tcgtcaaaga ctcataactt tccacatcca     36900
     ttctgggctc tatagagtgg gtggtaaggg acgggatgcc gggaccggca taccgggcgt     36960
     ggtgttgccg gtaccgggtt gttttgacga aggttagagt cattttcggg ttgatgtatt     37020
     cgttagttgc gatgcaagtc atatgacaaa gtccgctcca aaagccctct gccgatgccc     37080
     attgccgatg ctcatggagt agctcatggg gggtgggaag gtgcccacac tgcttatcag     37140
     tgggaatcct tagtaatagg tctagtagcc tggcagaccg ctgcactcta gccaccaggt     37200
     caggatgacg tttcccgctg ccctgctgcc gcgtgtgatg aagagcttgt tgatgaactt     37260
     ctcgtgcgcc tggggcttgt ctacgagctg tgggaggaca gcgactagcc agctcttgaa     37320
     ctctatcggg aacttggcca ccagcgtacg gataagctcg gtgtatgcgt tgagatctga     37380
     cctctgggtg tggtacagac cagccatgac atgcgcggtg agttgcgcac caacagcggc     37440
     cacttgctgc cgggtgatct cgagctcttc cctcgtgtac ttcttgttgt tcaccacttt     37500
     agtccagaat tttgtcaccg caacaatcgt gaacttctcc ttgtgagtca gtagttgtaa     37560
     aaactctttc aggataaagc tggaccagta ttgtgagtac accgctatgc cgggcttggt     37620
     gtccaggata ctgttgacaa aattgacaca tgtttgcaat gagtcagggt cctggactat     37680
     aacttggtgg taattactga tcatgactcg ctcgaagatg acgtcgaact cggcagaggt     37740
     cattgtcgct ttataacaac tgaacaagtt ctccaacaag tacacaaaga agggaagcgc     37800
     cggagctatg tcacaggtct gtagatgtgt aaacacaaaa ttgatgatct cgttcatgct     37860
     ataacgcaag aaatatggct cttcttcggg tagcgtcaac gatttcccaa ggatcagaca     37920
     gctggcctca atcaaagatg acgatttctg gaaatacgga ttctgtaaaa ccttctcgat     37980
     tatctgcatg atcttggccc tgatacctaa cggatcggtg ttccaatact cacggtacgg     38040
     aggcagcaat tggattacct tgggatcgtc catttcttgt ggatatacaa gaccgttacc     38100
     tagttcggag atacagtcaa ggacacactg gatatagttc tgtttttctt gaatagatag     38160
     gcccgatccc aaagcttgct ctattagatt attgaacatc atgactaatt tgtcaatatt     38220
     gccgccttga gcatccggcc cgttctcaaa ctgaccttga atgatatacc cgattgaccg     38280
     tgtaagactg cggcgtgtaa aatcggagct ttgcttgtca ggagacatga tactatgcaa     38340
     aaatgaggtg aagttgtcca aatagggata cagttctttt ctacaaactg agcaaagtgt     38400
     cgaaatggtc ttaactagca tgctctcgac tttagtaaag gcgtttgctc ccccagtaga     38460
     aaatgcacat ttttcaagac cttggactaa aatctcaata gtaccaccaa tttgctcggg     38520
     attctcctta taaaagccgg acaaagagct catcaaagtt gtactcgacc tcacaaagtc     38580
     aattgacaga ggtccactat tatccaaacc tgtccttaat agggtttgga catttgcaac     38640
     taagaactta gctgcttcta agacgtctag gacccagaga ctctctggaa tattgatgtc     38700
     ctttaataac ttttccaaca gatatgacat tgtttcaata ttgaaaagct cagtttcact     38760
     tgcgatttca gtagatccga caccagcaat aagcacatta gttaagtttt cattgccaag     38820
     tactaaccat agggattgag ttaaatcagc aaccgcatta cgaaaatctt cgaactcatt     38880
     gagtacagtt ttatcttctc ccatttcaag gaataacttc ttgttagaaa gagatatctt     38940
     aggaacataa atattaatca cttgttgaaa aatctcaatt gacaactgtt gagagttcgg     39000
     tttcaatgat tcaagggcca aattagagta accttcagct aggtccaacc aaaaatcaac     39060
     catttttagt gaaaaggatt cctgagaaac agggtgcaaa ggaaagtttg tcaattgtaa     39120
     caaaaccttt atgtattctt gtgtattatc agatgcagcc tgatcttgtg tttgaattgt     39180
     tgtaaataat ttgttgcata ggtccaaagt attgatttgc aagaaatcgc atacacaaat     39240
     ggataaatcc ttcaattctg agtacatctc atttgttacc aaatagttca tatatgccaa     39300
     catccattga tattgggact tgtcagcgtt agtgtctcca tgagaaacac ctaaaaaaat     39360
     tgtttccaat ctgctacgta gttcgaaatt cataagtaga gggtcattcg agaaaatatg     39420
     cgaaaagatt gatattactt tttcagcact accatattgt tcattttcat tagattgaag     39480
     catgactttt agtaatgatt caagcagttc gctcaaatcc atcctgccct ggggtgaaac     39540
     ttgcctgcta atagaaatat agtttatcca agcattgata cagttaaata ggttgtcatg     39600
     caattgtgta gcgtctaagt ttgataggtt aaagataatt aaagccatgg ttgagatgta     39660
     taagtgttca tgaacgacac catggataga attcattgca tgtttttgag tttggaattt     39720
     agtcaagtcc tcgaccagaa tttcagtaaa tagcaaggac aattggttcc tcactggaga     39780
     tgagctaata aattcaatta gctgattata tggtacttca gagttgatag tgtctaaaat     39840
     aatcttgtcg gattcagagt tgttatttgt gccataccag tgagatttct gatcggtgct     39900
     catctgactg ctagcaattg acaaattaat cagtgtgttt agtgggttat tccaactagc     39960
     aataaaatcg ttctctgatg ggttattatt attgatactc acaaatagta ttgaaagatt     40020
     ggacattagt ttcttaatta caatagaata tgatgataat gctgagggat cattgactac     40080
     attttcaaag tattgaacta agaaagctaa attcaaccta aataaagtga acccaaactc     40140
     ttctttcttt agatcatcat gatgcatgtt aatctgtaca gctaacgtga gcgcaccaaa     40200
     gtacttgaca ttggtggaat atggccctga caataaggca ctacccagga tcaacccatc     40260
     acctgatttc tgtattcctt gcaacacttg ttggatctcg ttaagatctc tattgggttt     40320
     tggagaatac aactcctcaa tgagattgac tacttcttcc acagaactca tcgagcctct     40380
     atatttccag atatattgta taatagcctt tttgtattaa tgacacccag caaaatatga     40440
     ttataagata ttcagaagtg gctgtgataa ataacgctaa cgaaagagca atgacagtat     40500
     tgtcaaatga gaattcaatc aacacaatat taatcggaat aatgtctaca gaacaacaat     40560
     cataagcaat ttaattgggt gcgttttgac acatttctca ccaatttctc gatggccatc     40620
     gcaaagagca tctcaaggtg caaaatctcg cgctactttt atgttttttc agacataaat     40680
     tacgaaatgt cacatgacta aaatagtcac tgcaacattt cttaaagaag gctcttgttg     40740
     tttgatacag tatgttgtgg gtctacgtgc taaatagaat aattgctaca cacatttgtt     40800
     accgctgtgc aaatacgtct tgtattaaag tttattcttt gatcattatg ggaaaatttt     40860
     tggtattctt ctgtaagttt tgaataaagt taccaaacat taaatttcga gtacttcata     40920
     attgggtgga gtgggcgtaa aaagcaatgt gtaatgcatt tcatattcaa agaaaagcca     40980
     cttccaaatc caataaaaat atactatatc gtttttctgg ccaacggaat actgcaagac     41040
     aatgaaaatt aataaggact aaaaaaattg ctatgccttt gcctggtaac caaccaacag     41100
     aaagattgct tgttgtaaga acaagcgctt ggtttgatgg tattgtattt cttaaaataa     41160
     tgaaataaat acattacaga tcagataact tctaatcatg tgatcgctat gtttgccata     41220
     tttgatacga aatggtactc ctgtttcatg cctatgaacg acaaagtaaa atcggcactt     41280
     cttgccactt cgaaacgtat aatggccaac aagagtaata gcccatttac attgaagggc     41340
     attgtaattg tgctccatcg aaaagtttaa ttacttgaat atattgtgca agaatttatt     41400
     taattgtgtg tcacttataa cagtaattag caattgagtg aggatcagtt ataagttagg     41460
     tgataacgaa aagaaacttt tgataatata aagggtttgt gttttcgtat ttctccactt     41520
     ttgtcaaaaa caacatttaa atagtttatt acacaatgtc tggaggtgct gctgctgctt     41580
     ctgctgctgg ttatgataga catattacaa ttttctcacc ggaaggtcgt ctataccaag     41640
     ttgaatatgc tttcaaggct acaaatcaga caaacttgaa ctcgctagca gttagaggaa     41700
     aaaactgcag tgttataatc aatcaaaaga aagtaccgga caaattgcta gacccttcca     41760
     cagtgtcata cattttcaag atatcgaaaa caattggtat ggtcgccaac ggccctattc     41820
     cagatgctag aaacgcagcc gcaagggcca agggtgaagc agctgagttt cgttacaaat     41880
     atggttacga catgccttgc gatgttttag ctaagagaat ggctaacctt tcacagatat     41940
     acacacaaag agcatatatg agacccctag gagtcatatt aacttttatc tctgttgacg     42000
     aagaattagg cccttccatc tacaagtgtg atccagctgg ttattatgtt ggttacaaag     42060
     ctactgctac tggtccaaaa caacaggagc taactacaag tctagagaac tactacaaga     42120
     aaaaaaatgt tggctctcac ttggatatgg aagaatggga gaaagtcgtt gaattcggaa     42180
     ttacacagat gattgattcc ctaggaaccg aattttccaa aaaggaccta gagattggtg     42240
     ttgctaccga gaacaaattc atcatattga ctccagatga gatcgaagaa agattagtcg     42300
     ccattgcaga acaagattga gaattgcaat actagaatat atagtttata gtcaccttca     42360
     taataagatg ttatgtatta cgcaatccca agtttcatta gcaacgtaac tctcaaaata     42420
     gcaaaattct gtatagttcc catgaaccgt ttttccttat cgcttttctt tcttcggttg     42480
     cagtgagatt tgaatattga ttgatcgtta atctttaaca acaataatat ataaatatac     42540
     tttatatagt ttataaacat gattatttca tgacgtgcat atttttcatt taaccattat     42600
     ggaaagggtt ataatgcatc ttttctttat ggcatctaga aaacgtatgg aatgaacaaa     42660
     tatggacaat gcttgcagta ttcaacccag tccttgccgt acttcttctc acacttagct     42720
     tgatctctta gagctctgtg aatcaataca acaaagaaga aaattgggaa gaaccatggg     42780
     aagaaagagt taaaaccaca agacatagcc cagatcaaag attgggtcca gtcagcagta     42840
     taatgaatct ttctggcata tctgtaccaa ccgtcaatta gcaaatatga tccattggaa     42900
     gtgaccatgt actttggatc ctttaacact tggtatggca aaaatgggaa ggtctttctg     42960
     acagtcttat cgccagacat ttgttttctg aaggagttct tttgaccatt ggtggtgtca     43020
     aagaaatagt aagctgttag aaggaccacg tataaagata ggttgtattg ccatgaccag     43080
     ttatattcag atggattatg gtagtataag tacaaagtac agtggcagta tgtgtatgga     43140
     acacctgcga tattccagaa aattaacata aacccgaatt tttcgtaagc catatcccaa     43200
     gttggcacga ttaattcttc acccttagca caagcgttag cgtacagcca gtgggctaac     43260
     atgacgacac ctaattgagg ggtgacatag ccatatgttt catattgctt gaaacaagca     43320
     cctaaagtga taaaatatag agtaaaccat ggtagtctaa cttcgaagaa catcttcaag     43380
     tcaaggatac cccatctagg gttcaatgga gctcccataa agaaatcata aagatggtta     43440
     ccagtcattc tatggtagtc atgggtaaca aatagagtcc agatgtaaag accaatggaa     43500
     aaggcaaagc cagatgcaat ggcacaagtc attattcttc caaatctgtc gataatggtg     43560
     tataacttaa atacaccagt aacatgtagc aaaacaacta atgcagtaga ggtatataat     43620
     gtccacatag cattacagta gtaaggtagt tgcttgttct tcaagtgggt caatggttga     43680
     cctttggtcc aaacacctgg cagagtgtaa tagaagaaga tttggaaagc ccaaaaagta     43740
     aagaagataa cgagatcata cttttctggg atagcattgt cacagaatat atggtaaagt     43800
     ttgccgatga attgggccca agtttcgttc tgagctggta acgcaattct accaccataa     43860
     aattcagcac atatccacat gtaatacatt aacaatggga agccaattag catacccagc     43920
     acacctgctg tgccaccaaa ttcatattcg atttcctcag gtttcaagta cttaccttgt     43980
     ggaagaaatc cggtcgattg agtcttcttc tcttctttcg atccgctcat tgttgatctc     44040
     aaaaaaagtg tctgtcttgg tacaagtccg cttttgatga attgacccaa taataaatac     44100
     aaggatgtta caataatgca aattaagttc aatagtgggg tttatataag tattaaacct     44160
     atcacattgt caagacaaac tacattgtat atacgtttat gtttatcact ggagaagaaa     44220
     aaaattgcta aacgagcgac cttcctcgga tacaaaaaaa ttccttgaac taatgaaaaa     44280
     tgtaaacact ttcccacgtc attttcatca atttgtcaac atgaattcaa ttgattgtta     44340
     cctttactcc aagtattaat aacctctcaa tcttaatgct aggatttcct ccgtggggag     44400
     aacaagggac ctcctattgt cactttctcg tgacacatag taatacttta caaatctagc     44460
     tttcaatctt cggatatatc gattgatcac gatgatatat atatagttat actacgggat     44520
     tacattcaac gcatacgccg aaatttaatt gtaatgacta gtgtaattct tgacttacag     44580
     aacaacaaaa tctatacccc accgattatt gtgttggtaa tgtcttcatt gtgtagttat     44640
     cttactcgat cgcaaactct tctatcattt aattacatca tgtggtcata atagattttt     44700
     ttttattctt ttagtctgat atgtttgtca taatatatta ttatagattg cttttatccc     44760
     cataaacttt tagttatcaa gttgaatatg gtaagtcact ctggtgcgtt gacttttgaa     44820
     tcacctacta agtaaaacat tataagcccg tagattccta ggtttatttt ttgaccgaga     44880
     atagttcttc aaaagcttta gcgataattc gggtgagttg acttaagtta tggatcaacc     44940
     gcttggaaaa gctcaactgc tatctaaggt agcgaagagg atacaggcac acaggcacct     45000
     tggggagtct taactaagcc aacactagaa tctaattcgt tggggtacct ggtctaatgc     45060
     ttggaagtat cgatcgccaa gaagagaata atactcagac tcgccagcat cccttcaaat     45120
     acctcaaaaa tctctctgtg tgttttcact tcggccctag tcgtcctagg ggaacagtgt     45180
     tttagcagca ggcgctaaag ttaccaagtt agggaaatgg ggtgtctgtg cgggaatttt     45240
     tctggacccg cattctcctt ctcggctatc acactatctt gttgtactcc tttgctgtct     45300
     gttgctcagt tagcggagtt tgagcggaga taaccggggc gatatgctgt atgtctctat     45360
     gtactgaaaa gagaaggaag gggaagtgag cagagactaa gcatgtaatg atgcgcggtt     45420
     ttcctctctg tactatattt aggctcttga gtaattacag gcgggggtga tcttttgttg     45480
     attgctaggt tgcacatctg ttggccctgc tagatctcta ggcgctacca cggtgaccca     45540
     tgaacaggtg aacatgaata tacatcgaga aagaaagggc gtagtgagtg aacggcggca     45600
     atttatttcc gttccacccg cccccccttt tttttgtctc taaattgttt gtttttgtgt     45660
     cagggggagt ttggcggcta aactaaaatg tataaatagc gcatggaaaa actggtttct     45720
     gggttgatat ttgttctttc tttcccgtgt ctcccaaaat caggactctt gcagtggtgt     45780
     gcctaccttc gttatttctt tggttttttt gtcgttgctt tttctgtttg cgtttaaagt     45840
     gcaatagtga ttggttttta tctttagatt ttatttttta tgtccttatc actaggtctc     45900
     attttcatat agcaatattt ttgctgtttt tttttactcc aggcttttta ctagtgctat     45960
     tagatttact actcatactg ttgggaatac taatgctagt ataaggtcat accagaactt     46020
     ggtctccgct acaggttata ggatctacaa aaaaaattgt aaaagaaaca gatcaattac     46080
     aacttcaaag aaagcaggtc tgtttgctgt ttttctgtga tttttttttt tctattttat     46140
     actgttttta ttgtcaattg gaagatgcaa cagaatttta actatcatcg ggtatgataa     46200
     aatcaatttg aaaaatatat atatatggtg aaactatgat aaaaataatg ccacaagcat     46260
     tatctaggtg gctgggtgcc ggtaatctga gtttggatat atatatgcgt ttgatgaagg     46320
     cacaatggtg ggggtccgat tttaaagata ttttcctttt ttagttttgt tattattttt     46380
     tgatataagc cgaataatca tctgaatcta aaattgaaat gaaagacttc gttagttctt     46440
     ttcctttttc aagtgggtat ctttacacta ctgagatgaa agcaataatt gttgattgta     46500
     cccatacaga agaaaactta gaaaaaatga aatactagta cattaagaaa aaaacagcag     46560
     aaaaaaaaaa agaaaagctg aagcattatt atacatcgta acaaacattt cctcatagat     46620
     ctaatctttt acttcagcaa tttctagtct ctgcaacaaa ttacactaaa aaaattacaa     46680
     atcttgcacg agtatcataa cgatgcagtg tcaaggtctg agcatactga ggttattttg     46740
     ttggcttgta ttatcagttt cttttctttc ttcctttttt gttttttttt tgtatttctt     46800
     ttggagttgt ccgtttcccg caaccagaca aagaccccag tatttgtaga ctcattccac     46860
     ggagcaaaat gtgctataag gattatttct ctgtgcttca ttttctacct cgtagattag     46920
     gttacgttca aattttaagt ggcaaaacca tatcctgatc gtcagtacta cacctgagtt     46980
     gtcccgatga gcctcctatt ccgtggaaag atggcttttc ctattgatct aagtggataa     47040
     gcaggtattg cgttgatcat tataattgtg ggtaaaacta ggtattaggt ccttctaata     47100
     gtcatcttta ttgttgtaaa aattatttcg atggcgtatt catagaatcc gaacatatat     47160
     accaaccaaa tggattttaa aggaaaaagc aaatacatta aggtctgttg taggaaaaga     47220
     ccatattgat ttatctattt agttgagtaa cagaaatcac atatagtttt aaatttttgg     47280
     taatcaaaga cacttgaaac tataaaacat ttggttgaag aagaagtatt aactttgctt     47340
     ggagaaaagc gtgcccacac ttgcttggtt ttcaggataa taacaagcat agaggcgctg     47400
     ttattactta aacaattttt aagtaacaca ttcaaacttc cattacttcg taccccatat     47460
     cgtattgcca ttgtgatatg gaattagtgt tttattctgc cttttttttt agaatatatt     47520
     ggtaaagtca ttctttagct acgttattga gagaatatgc aaacattaga aactacatca     47580
     aaatcaaatc caggggaagt caaagcacag aagcctagta caagaagaac aaaagttgga     47640
     aaagcttgtg atagctgtag aaggaggaaa ataaaatgta atgggctaaa accttgtcca     47700
     tcttgtacaa tctatggctg tgaatgtaca tatactgatg caaaatcgac aaaaaatctc     47760
     aaatcaaatg atgcaggtaa atcaaaacca acagggagag tatcaaagaa taaagaaact     47820
     actagagtcg acaaagatat taggaaatta gagcagcagt atgtccctat taatgctaat     47880
     attcatgttg gtcccaggtt cccctccgag aatatattga atggatatcc acaatgtgga     47940
     gcaccacaga acaatgttgt gggtaatcca ctagcggtta atactcaatg ccatagaggt     48000
     ctttctgaaa ctcctatgtc ctcaacattc aaagaatcta acttaagaga tgatcggcta     48060
     ctacagtcat cagatacaga tgatatgagg aatggtgact cggaagaaag ggacttgaaa     48120
     gggagtgaca gcgagaatgt caaaagtaaa gacaataaaa gtgatccttt gattatatac     48180
     aaagatgata cacatattga aagcacggtt aataaactaa cacaggcagt taatgaactc     48240
     aaatcacttc aaaatgcacc cagttcgata aaatcatcca ttgacgccat tgagttacaa     48300
     cttagaaaca ttttagacaa ctggaaacca gaggtagatt tcgagaaagc aaagattaat     48360
     gaaagtgcca ccactaagtc acttgaaaca aacttgctga ggaataaata cactaatcac     48420
     gttcatttaa caagatttag gatatggata gattataaaa atgcgaacaa aaacaatcat     48480
     tttatgggag agtgtggatt tagtcttgca gaatcttttt ttgcttctaa tcagccattg     48540
     gtcgatgaat tgtttgggtt gtattcccag gtagaggcct tttctttgca aggtcttggt     48600
     tactgtgttc acctttatga gccatatatg aaaactgagg aagcgataaa actgatgaaa     48660
     gagaccttat atattatact acggtttatt gatatatgtg ttcaccatat caatgaagag     48720
     tcgatatcga ttgccaaccc gttagaaaca tatttacgaa aaaaacatct aatgcctatg     48780
     actcctacac caaggtcgtc ctatggaagt ccacaaagtg ctagtacaaa gagcttggta     48840
     agtaagataa tagagagaat accgcaaccg tttattgaga gtgtaactaa tgtgtcgagt     48900
     cttcaactat tagatcttcg agatgacgag tcaaaaatgt ttggaacatt gctgaacatg     48960
     tgtaagtcta taaggcgaaa atttgactct gttatgagcg attacgattc cattgtcaca     49020
     gaaaaatccg aaggcgaaca aaatgatggt aaagtaactg tagctgagtt cacatctttg     49080
     tgtgaagcgg aagaaatgct cttagcatta tgctataact attataatct gacgttatac     49140
     agtttctttg aatttgggac taatattgaa tacatggaac atctgttgct tcttcttgaa     49200
     gaacagcttg ctctcgacga atactatggt tttgaaaagg tcttgaatgt agctgttgca     49260
     aatgctaaaa aaatgggttt ccaccgttgg gagttttacg tcggctatga agagtcgact     49320
     gctgaaaaga ggcggctact atggtggaag ttatacaatt atgaaaaagc cagtactatg     49380
     aagaagggtt ttttttctgt gattgatgat gctactgtca actgtttatt acctaagatt     49440
     tttagaaact ttggctatct ggatagggtg gagtttctag aaaatattca aaagccaatg     49500
     gatcttagtg tgttttccga tgttccaatt tctgtccttt gtaaatacgg tgagttggcc     49560
     cttacaatag ttaccagtga gtttcatgaa aaatttttat atgctgatag atacacttct     49620
     attcgaaatt ccgcgaaacc gccgacatta aaaaaccaat taattaagga aattgtggat     49680
     ggtatagctt atacagagac atcatatgag gcaatcagaa agcaaactgc aaaactatgg     49740
     gatattgcat taggtaaggt gaccaaagat aaaatcaata aagaagatac agcagcagct     49800
     agcaaattta ctttgagtta tgaatatcac agattcaggc taatcaatat ggcagacaat     49860
     ttaattgcta gactaatggt gaaaccaaaa tcagattggc taatatcagt catgaagggg     49920
     catcttaaca gactatatga gcactggaaa gtaatgaatg aaattatcct aagtatggac     49980
     aacgattatt caattgcaac aacgttcgaa tattatgcac catcatgtct gtgtttagct     50040
     acgcagactt tccttattgt gaggaatatg gaaatggatg atgtcaagat gatggttgca     50100
     gtatataaaa gatttcttaa cctaggaatg tttttgcaga gtgccaaagt atgcagcctt     50160
     gccgatagtc atacattcag agatttttct agatcttttt cctttattac gataatttca     50220
     agattgatga taatcgaatt tatgcaaatt aaagaattga cgaaggtaga gtttattgag     50280
     aagttttctg aagtatgccc tgaccttgca gatctacctc cgatgcttct agatccaaac     50340
     tcttgcttat atttttcatt gttacagcag attaagaaat ctggttttac gttgtcattc     50400
     aaaaaaattc ttgaagacgc tagaatgatg gacttcaatt acgaccgcaa tttggactca     50460
     gaggccatta aaaagtgcaa tggtgaattt agcaagtcaa tgccttcctg taccaatgtc     50520
     tcagatacca ccaccgctgt ttctgacaat agtgctaaga agaaagcttc aatggggtcg     50580
     gcgagggtaa attcaactga tacactaact gcatctccct tatcgggctt aaggaatcaa     50640
     acgcagttgg attctaaaga cagtgttcca tctctcgagg cttatacacc aattgattct     50700
     gtctctgacg tgcccactgg ggagatcaac gttccattcc ctcctgttta taatcaaaat     50760
     ggattggatc agcaaaccac ttataatttg ggaactttag atgagtttgt taacaaggga     50820
     gatttgaatg aactctataa tagcctatgg ggtgacctat tttctgatgt ttacttgtga     50880
     tgctattaat ttagacagtg tgcatagcct gtataatttt atatttaatc tgaaaaatca     50940
     ttttttagtg gttatgttgc ataattttac atgagactta gactacctca aattagcgat     51000
     aacactacaa tatctctcat taaaaaattg tagtttaata tatgatgatt attaaaacgt     51060
     attgtacaaa ttataactta taaaagaaaa acccttcgat tctgaatgaa gattctaaca     51120
     gcaaaactgt ttgggtttat tcaatattaa ggatacccat tatccttttt ccgtgaggag     51180
     tgtttctaat attaccaact agtagtggtg taaccaagtc aaccaatttc ttatacatat     51240
     aaggatttgt gtcgcgacta atatccaatg cagtctgtag cacatagtta ccgaagctat     51300
     cgtttaacag agcttgaacc tcagcactac cttcgttgat cagttcattt attatagttt     51360
     ctgatactac aggagttctt aataccttct caacaacgtt ggatccaaac ttatgtaccg     51420
     aaagttcggt aaatctaggt ttcaattgat tgactatctt gtaagtgtag tcataatcat     51480
     ttctctccgt ttctttggag ataatatatt gaaccacata attaccaaaa ggatcaaagg     51540
     ttagcatgtc gatatatttc agtagctttt cacagaggtc tttaaattga gtcttggttc     51600
     cgtgatccaa acaacgctgt aatacacagc acccatgtct atgagtggct atttcaccac     51660
     attcattgcc agcagcgtcg aagataaact gtgaatcttc tggattcaac ttctgcaaac     51720
     atttttgaat tacatgatta ccatttaagt ccttacttaa aataacagta tcgggttgca     51780
     aggatttaac gacaatttcg gcttcctctt tggtgcttat acattcgatg agcttttgaa     51840
     gtgctctagt accatgtgga tccttcgaaa tttcaaccat ttttggagca gctattttgg     51900
     caagttcgac acgttggtcg tctgtaactc tttcaagaag cttctgaatc aaataattac     51960
     caaaagaatc agtcattaat tccacagtgt attctttggt ctcttcgaaa atagcatccg     52020
     atgctttttt accaaggaca tcaagttgtt tttgcaaaaa cctgcagcca tgttggtcct     52080
     tgcataacga ataaatgttt ccaataaatt ggtctaatgt cgcatcagcg tattgagagt     52140
     tatccatttt tctttgtctg tcttcatggt tgtaataatt gttgtttctt ctacctctat     52200
     gtctgttatt gtaatggcct ttgtcgtgct tgtcgtgcat gccatccttt gatcttggat     52260
     attgagattg agggccctga ttcatccctg ctgagtgagg catcatgcca ttaaatgctg     52320
     ggttaccata catccatggt gggggagttc cattttgctg gtgttgcatg acaggaaacc     52380
     cttgtggaat catggcaaca ttctcatcct tttttccttc tcccgattca ggacgcatac     52440
     ctttcataaa ctcaggcatt gggcctattt gaataggtga gtgggtcata ggaattgggg     52500
     aatgtggatg cataggagga gctgggcctc ctaaagttgg tgaaaatgac tggaatggag     52560
     cgccgaaatc gccaaatgca cctgggaacg gcgatcttac accatagcct gaatgaggta     52620
     tctggtgtgg accaacccct ggaacgggac tgccttgaaa tggaggtcct ccatatggat     52680
     atgcggctgt gtagttcact gggacgtttt gaatatctgc agtggcattg gtaccctttt     52740
     cggtgtcttt cgtgtctttt ccttcagata gcgttgaatc agctttatcg aaagaaatag     52800
     attgtgttct attcttggca gtttcaaaat tcttttctgg taggtcgttt acagacgttg     52860
     gaataccgtc agatattgct gagtcactaa tagtactagt agaaattgca tgaaatgtct     52920
     gtcttctaaa tgcgccagca gttggtgctg catctttttc agttagtttt gatccattat     52980
     cttctggaac agcacctgtg ttgcctgcga catcaatagc agctgaggct tgtaggtttg     53040
     atgagttcca caactgatca ttacttggaa caaatggatc atttatacca gtgctgtttt     53100
     ctccatctgg gaccactcca agaggtggga atgaagcacc gagaggcgga aacattgaag     53160
     catcattgga gttattgaac acagttggaa ttcttccatt gccactggga ttgggcatat     53220
     tttcttggaa ttctggtgga tggaaaaacc cctgtggatg tggcatgtgc atcatttgcg     53280
     aatagggcat aaaaccgtac atttgtggtg gtgggaacat gtgtgatgga gaggtagatt     53340
     gcatggccgt tggtgcatgc tgagttggtt gatcacccgt agctggtggt tctggtgatt     53400
     caacatcatc catatgtagt tgctctagag ctgagtttac agtttctgca acaactttgt     53460
     catcaatttt ttcttgattc tgagtcttat ctgtcatgat ttaaaataca aggataggtg     53520
     caaattaggt aaattgatta taatgttatg ttggtaatga aatgcaatta atatgagttt     53580
     ggatcagtaa cactttctaa tctttctgta ttctaatgta caatgaatat gtttttccaa     53640
     ggagagtgtt gattcgataa aacaagtagc cttagaactt gaaatgaaaa taataaaaac     53700
     ggaatggttc ttgaaaagta gatctggctt caaaaataaa agtacaactt agaatagttc     53760
     aactgttaat caataattta caataatgga actgaaaaca aataatgtac aaaaaaaagt     53820
     ttaacgggag cagcagttta atgaaaaaag ctttcttaga acactaacta gttgttttgt     53880
     gtatgattac gtcagagtgt ttaaattatg cttcttacct cctaatatct cttctcgaag     53940
     tcaatttata gttgaaggat aataatattt ccctaaagtc ctggtcgttc ttctttactt     54000
     actgtttgat ctctatgtct ccagaacaga aatagtatgg taaatcaagt agctgaccgc     54060
     tgccagtgct ttacattgta accacagcgg cattattcag gaagagcggc cactaagctg     54120
     ggggggtcct ggattctgat cccaagagag gctagcaaga caatagctca tcgactcggt     54180
     ttgggttact ctgatggaac ttccctcgct gcgcgctgta acttctgact tcctgcgaaa     54240
     agaaaaattt gcagctcgta tgatgtgatc tgagacttaa ctagtataat ggagaaccat     54300
     acttgacagg cccttggttg ggtggaattt tgacggatct tatacaggac gatctgatat     54360
     gatggttaat atgtttataa aataaatata ttttttatta ttattaaaag tgtgtgcatg     54420
     tttaaaaaaa taaaataata ttactgtgct tcaaaaatta taatatggta atgataaaaa     54480
     agaataaaat aaatgtgctt gcttctatat taataacgat tctacactga cgttgtcaag     54540
     gtaaacaaaa cgagagatta aggatttccc aaaaaaagga tgatctgctg ctaataacca     54600
     tggttgtgag ttaaacaaaa cctgccaaca ggtgagttgt atcaatcgat tgagatagaa     54660
     aagaatcgcc taattaagaa aaattaataa aaggtattgt gtgtgtgtgt tttaagaatt     54720
     attaatttca attaatgaag tgattttacc catagctcaa aagtttagta cggaaaagaa     54780
     ttggcaaggg agattagctc acacgtcaat tagcaacgaa ctttcaaaaa cgattgaaag     54840
     aaatccatga tttttttgtt tattcagtat taaggacaac gccaaatgcg tataagttcc     54900
     cggaaaaaca aagatagaaa aaaaatcaaa attagaatta gtacaacaga aaaggagaaa     54960
     gaattaaaca gaaatgaaga aaaatctcat tggaaagttt gccactaaca cgattagttt     55020
     tccttttcgt gttgagtgga gactctttgc atagcagcca agaaatcttc gacagatctg     55080
     gtggacttct cttccttcaa tggcttaccg ttcattagtc tgtcgaaaac aacggattca     55140
     gacatgatgt agtagaaacc acccaagaca cagaagacac cgatagacca gatgtagatc     55200
     ttaacaacgg tgacaatgtc ggtccagttt tgagagaacc agccgaatag agtgaacatg     55260
     gtagcaatga tgtcaacggc gaacacagca ccggccaatt gccaggatgg gatggaagac     55320
     cagaatggac caacggctct ggtgacgaaa atcaaccagt tttcagtcaa agagatttgc     55380
     aagaaaagaa caccgtcaat ggaaccgaag ttttggatga taccacctct tggcaagaac     55440
     atggtagtca aacagatcca ggtaccgata gccaacacaa tacccaagat aatggacata     55500
     ccccatagtc ttggtaggtt ccacttaaca ggagtttgag agaatggagc gttgtcgtaa     55560
     gcaatggcca aagtagcgac gtcggcgaaa atggcaatga aaacaatcaa ctcaatgtcc     55620
     aaggagtggt tcaagatgat aatccataga cccaagaaca attccaagtg aagagacaaa     55680
     gcgatacggt agacaacgta agagtacatt ctgtggaaaa tttgtctgga ggtcttcaaa     55740
     gcatcgatga tagcagacaa acctggggcc aagaaaacaa tatcagcagc ggatctagca     55800
     gcatcagaag caccttcgac agcgatacca gtgtcagcct tcttcaaaga tggggcatcg     55860
     ttaacaccgt caccagtcat agcaaccaag taacctctgt tttgcaaaat ttcgacgacc     55920
     ttgtacttgt gttgtgggaa aacttcagcg aaaccatcgg cgttttcaac aaagtcagcc     55980
     aattcagaac ctggcatgtc accaccacca cctagaccta gtctttcagc gttgtaaatg     56040
     ttggtaccta gacccaattg tctacaggtt tccttagcga taccgacggc atcaccagtt     56100
     aacatcttaa ctctcaaacc tagtcttcta gcttcgttaa cagtttcagc agtgtcatct     56160
     cttggtggat ccatacatgg cataacaccc aagatttccc agtgaccttc acctctcttt     56220
     ctggcgacac caagggctct gaaacctctg gaagccaatt cagcgacctt gttttcgtag     56280
     ttttcgtgga catcttctgg gattgggtgg tcttcttcga cagtctttag gacgaacaat     56340
     ggagcaccct taacacagac gattctttca ccttctgggg attcaacaac agcggtaacc     56400
     ttcttggaga cagggtcgaa tgggtggaac tcaatgacct tgtacttggt caaagcgtcc     56460
     ttagcctttg gatagttgat caaggacttc aagaaagcct tgtcgatagc atctagaccc     56520
     ttcttctttc tggaagcagc caaacaagcg gtcaacatca agtcatctgc agagacacct     56580
     tcgacagtgt atggttcgtg caaagaaagc ttgttcttgg tcaaagtacc ggtcttgtcg     56640
     gaacacaaga tttcgacacc agccaaggat tcaatagcgg acaacttttg gacgatggct     56700
     tgcttcttag ccaagtaagc agcaccgaca gccatggtgg tggtaacgac agctggcaaa     56760
     ccgactggga caccgataat ggtaatacct agagtaaatc tcaagatctt aacgatgttg     56820
     tcagttctgt agaaacaagc agcccagaca cccaacaagg tgacaatgac caaaaccaat     56880
     agcaagatac cgataccgtt caagacttca gtgaagtgac cttgaccacc ggaggccttg     56940
     ttgaccaaag cggcggctct accgacgaag gtgttgtcac cggtagcggt aacgaccatg     57000
     aaggcttcac ctctcttgac agtggaggaa gagaaagttt ggtcaccgta acccttgtca     57060
     acagccaggg attcaccagt gatagcggat tgatcgactt gtaggaaaca gttttcagtg     57120
     actagacgac catcggctgg gatgatggta ccgtcttcca attgcaagat atcaccaggg     57180
     acaacctcgt tagctgggac ttcgaccaat tgaccatctc tgatgacaac ggcgacgtta     57240
     gccaaggttt tctttagttc gtcgacgatg gaaccggctt ggaattcttg gatgaaaccg     57300
     acacaggcgt tcaacattag cagaccacag ataacaccga aatcgaccca gtcagacaga     57360
     ccggcggcca agatagcggc ggcttccata acgaattgga taggaccaac gaagaacatg     57420
     acgaacttga cgatcatgga ctctctttcg tcggccattt ggttcagacc gtacttctta     57480
     cgtctgtgag cgacctcgtc ggaggtcaaa ccgtaggatg ggtcggtttg caagtactcc     57540
     tctgggacga cacgggcgga gccagtgtgg tggccctcgt cctcgctgtc gtcgtcgtcg     57600
     cccataccgt ggtgggattg caactcctcg atcaaggcgt cgatgtcgtc atcctcggac     57660
     atctcctcgt cttcgtagac gtcctgaggt ggcttctcgt tgttggattc aacgtcggac     57720
     atttagtata tagtagttgg tgtgtgtata tccgtttagt tagtgtcttg cgagaaggga     57780
     aaaatattct tgtcccactg ccagcaaggt accctccttt tatagttgaa atttgggtgg     57840
     atgggtagtt ccagtttgca attgcaatta caacagttac aagcttacaa ctacaacaac     57900
     tacagcaact acagctaggg ctatgaaaaa aaattttcag atgacgtatt gttgttcaaa     57960
     atagcgcact tcctaattcg tcaacaaaca aacaattccc aaacgggaag ttccttgttt     58020
     acagcattac agcattacag catattgttg tggaagttga agttgaagct tgttgtagta     58080
     gtagtagtag tagcagcttg tagtttgttg tagtttgttg tgtagcagct tgtagtagta     58140
     gttcgttgta gtttgttgtg tagcttgtag cagcttatcc tctgcgagcg atttttgttt     58200
     gcaaaagccg agcgatttct tatcgtttcc taatcgggtc tcgtatacgt gtgcggagtg     58260
     ttgtgtgttg ggtgctgggg gtgctggggg tgatgggggg tgttgggggg ttgtgtgttg     58320
     gggttctgtc gtctgcggag aggtgggact cggaacggag ccggagcagc gagggattta     58380
     ctcttctgtg cccaggggtc catgtgctgg agcccttgga gttcttgtaa tctggactct     58440
     gtaggagcct gtggactctg tgggactctg tgggctgtgg gctgtgggct gtgggctgtg     58500
     ggctgtgggc tgtggaagct tgtgggattc tgctcccgta ttcccgtatt cccatttccc     58560
     attctcccgg tgtgtgggtg tactcttttt gagcttctta tctttgttgc ttttttttcg     58620
     tgcgtgtgtg gtgatactgg ttggaaatgg actgggcgtt cgcagtgatg tgcgtgtaca     58680
     gtgaggttct gtggtgtgac tctccttgac gtgcaaaagt aggtcactgt cactctcctg     58740
     gtttcgaggg gaggttcggc tataaaggtg gctcatgccg ctgtgcatac aagcagtcgt     58800
     agttgctggg acaacgaaag ggtctaccaa tgccacacaa tatgaacttc cacagcccca     58860
     agtcggtggg tgcgttcgtg gagcaggtgg gcggcagcgc cgaggcgctc gcccgccggc     58920
     tctcgacgga cctcgccaac ggtatagcca cagacaaaga cgcggagctt ccgcccttga     58980
     aaagaaggga cgcatacggc agcaaccggc tgcccgagcg cgcgccgaag agcttctggg     59040
     cgctcgtgcg cgaggcgttc caggacagga ccatgctgct gctgacgggt gccgccgtgg     59100
     tgtccttcac gctcggcatc tacgaggtgc tgacgcagcc ccccgagctc gaccccgagg     59160
     gcaacccgat cacgcaggtg gactggattg agggcctcgc gatcatgatg gcagtgctcg     59220
     tagtcgtgct cgtgtccgcc gccaacgact accagaagga gctccagttc cagcagctca     59280
     acaggaagcg cgaggacagg caggtcgtgg tggtccgcga cgccgccgag tccctcatat     59340
     ccatacacaa cctcctcgtc ggcgacctcc tgaagctcca gaccggcgac gtggtccccg     59400
     ctgactgcgt cctcgtccgc ggcgagtgcg agaccgacga gtccgcgctc acaggcgagt     59460
     caaacaccat caagaagctc cccttggcag acgctctcga gtaccacagc gcccacggcg     59520
     gcagggacat cggcgacacc agtgccagcg gtgccagcgg cgcagccgac gatagccgct     59580
     gcccggactg catgctcatc tcgggctccc gagtgctctc gggcctcgcc agcgccatcg     59640
     tcaccaacgt aggcgtcaac tccgtgcacg gcaagaccat ggcgtccctg aaggaggact     59700
     cggaggacac tcccttgcag atgaggctca gccagctcac agacaacatc tcggtctatg     59760
     gctgcgtcgc cgccatcacc ctcttcgtcg tgctcttcgc ccgctacctc tcctacatcc     59820
     ttccctccgg cggcaagtac cacgacctgc cccccgccga aaagggcagc aagttcatgg     59880
     acatcttcat caccgccatc acagtcatcg tcgtcgccgt ccccgagggc ctgcccctcg     59940
     cagtaaccct cgcgctcgcc ttcgctacaa caagaatgac caaagacggc aacctcgtga     60000
     gagtgctcag gagttgtgag accatggggt ccgcaacagc tgtgtgctcg gacaagacag     60060
     gtaccttgac ggagaacatc atgaccgtgg tcagaggcac cctcggcaga gccgggttcg     60120
     acgacatcgg cgcagaccct tcgaagtcaa acctggtctt caaaaagaag tgctccgact     60180
     tgctcagaac agtgatctac gacaacatcg tactgaactc cacagccttc gagaacaaag     60240
     actacaagga ccccaacaac tacaactcca tcgatgactc acagccaaga cgcctgatca     60300
     gaagaattac ccaaactttg cagaagaaga aaccagacga cgaggaaaac ctgctagccc     60360
     atgcagctga gggcagacag gaaccttaca tcggctcaaa gactgaaaca gcactgctat     60420
     ccttggccag aaagtccttc ggcttgaaat ttggcgcttt gcaatccttc agaggacacc     60480
     ctgaaaaact accgaccgtt gaaacaattg tccagattat cccatttgaa agctccagaa     60540
     aatggtccgc tattgtggta aaactaaata gcaacaagga aaatgaaggt aagaagttcc     60600
     gtctgtacgt gaagggtgcc gctgaaattg ttgctaaggc ttgcaccttg aaaaatgtct     60660
     gcaatgaggg tatctctgag attgaccaga aaagtaaaga cgatatcgaa gaacaaatat     60720
     tcagcttggc aaaggacgcc ctgagggcta tctctttagc acacatggat ttcgatgtta     60780
     acgaatggcc tcctaaagaa cttgctgatc cagagaattc ccatgaagca ttggcagtca     60840
     aactgattga tcctaaaaaa ccacacttgg aaggtctcac tttagatgct atcgtaggta     60900
     tccaagatcc actacgtgaa aacgttaaga attcggtcgc tcaatgtcaa aaagccggtg     60960
     tcactgtacg tatggttacc ggtgataact tgttgactgc taaagccatt gcaagaaact     61020
     gtggcattct ctcaagcaaa agtttgaacg atagtgcatg tgccatggaa ggtcctgcgt     61080
     tcaggaaact aagtgatagt gaacggaagc gcatcttacc aaagttgaga gttttggcaa     61140
     gatcctcccc agaagataag aagattctag tgagagcttt gaaggaaatg ggagaagttg     61200
     ttgctgttac tggtgatggt acaaacgatg ctccggcttt gaaacttgca gatgttggtt     61260
     tctcgatggg tattactggt actgaagttg ccagggaagc ttccgatatc atcttgatga     61320
     ctgacgactt ttcagcgatc gttaatgcaa tcaaatgggg taggtgtgtt gctgcttcca     61380
     tcaaaaaatt cattcagttt caattaattg ttaatgtaac tgcagtattg ctgacttttg     61440
     ttacttcagt aatttcctct gatgtaaaat ctgttcttac tgctgttcaa ttgctttggg     61500
     ttaacctaat catggatact ctagctgcgc tagctctagc cacagataaa cctgatccaa     61560
     atattatgga cagaaagccc aaaggtcgtt ctactccact gattactccg tcaacttgga     61620
     aaatgatcat tggtcaagca atcctacaat tatctgttac ttttacgctt tactcacacg     61680
     gtgcccaata tttctttggc aagccaaagg aagatcttcc tgggcatgag catcaacaaa     61740
     ttaatgcaat gatatttaat actttcgttt ggttgcaatg gtttacactg ctggtgtcaa     61800
     ggaaacttga tgaagcagat ggtataaaag attggaggaa gaggttgacc gcttcaaact     61860
     taaatttctt ccaggatttg tttagaaatt attacttcat tttcattatg tcattaattg     61920
     ctgtattaca agttctaatc atgttttttg gaggggcacc tttttctatt gcccaccaaa     61980
     ctaaaaagat gtggcttgtt tcagtgagta gtggtattct tgccatccct gttggtgcat     62040
     tgatcagaat atgcccagat gaatgggctc aagcggtgtt ccccgctaga ctagccaaag     62100
     caatcaaata ctttgcaggt ttagaatttc taagaaatac agaaagtgaa tccagaagtg     62160
     attcagagga ggaggaaaga ttgttgactc cggcttgatg accataatga catcaactta     62220
     cattgtaatt atttattttg tattacagca tatgactact ttttggagac gatcctctac     62280
     gaaaatgtga cctcactgac ggttattgat gtaatattag ttattttccg attttgatgt     62340
     ggttccttcg tgaatcattg tttgtataat attgcatctc acttttttat ttacattaat     62400
     gtagttatat attgactata aatcattctc aatattcttc gtgttaatat actcgtttgc     62460
     tctctttgta atagattcta taaacttatg gtattcttgg tagaatgggt caatatcttt     62520
     cagaactgtt tccaactcta tgaacatgtc aattttttca aggatatcct catttttctc     62580
     attggcagac tctttctttt cagattcatc caaggtattg acaatagttt cctgcaaagt     62640
     atcgagtgac aatttgaagt cctttatcgt aattggggca atcttttgtt cgctcttctt     62700
     gccagtgata gtagctatag cctccagttg attgaagtat agtaacactt cattgagcct     62760
     tgatttagct ttctcgaagt ctcgaagcct acccaataca gccgcttttt gtgtttgttc     62820
     ttctgattct gtttctgcag tatctatttg ggagttgaga gttttgatat cagactcaag     62880
     actacgtact gcattggcaa gtgtatctaa gtaatattct aacttagacg atcctatgtt     62940
     accatctgct ccataagaat cacttgtatt ccatgtacca ggaagtgtat cagatatctt     63000
     ctctaatgaa gatatagttc cttctaactc cttagttagg tgttctgtat agtagtcaag     63060
     tcttgactgt aagccactcg tcacaaccct tacctcattg agaccagtac cgttagcctt     63120
     cgaaagcaag atatctacaa atgcttgcgg cacaaattgc tcgtcgaaaa acattttcaa     63180
     cacagcatct tcatcctgac ttgccatatc tgtagttccg ctcatctctc tggttctccc     63240
     taatctgaat tgaatcaaac tccaactatc ctggttcttt tttttgtttg ccctattgcc     63300
     tccctttatc aatttcttca atgaattctt attcttattt aggaaacgtt atagacctat     63360
     tcatagagtt ttcccacctt cctgtttgat cacctccctt ctttcacaca gtttagaatg     63420
     tatactcgtc gatcagggat gtcccaaact cgacacaagg agccctcagt tgtttgttta     63480
     tttcctcgat gagcttgcaa ttcaattttg ttgatttttt tccgaatttc cgtaatttga     63540
     agacaaagtg tgattattcc gtgaattgtt ccggttgtac gtccaagtct tcgcaaaaac     63600
     ggatcttgca tttatttgcg ggaattacaa actgacgtaa tctgtaatat caatacagct     63660
     gaaattcttt gctaatattg atgagctatc aattttagga atgggaagct cagatatcgt     63720
     atatgccgca gagaccccat ttccctactg caagtaaacg actgctgggt gccgatggca     63780
     cgattacgaa gttgttgacc tcctctgtgg caagatgtgt cgcggaagtg atatcgattt     63840
     tgccatttcc ggagtccgag gctatttcga aagtgttgtc caggccactc gacaaaaaca     63900
     gcttatcttt ccaattgagg attttgttta ttgcgttacc tgcgaaatcc agcttttgta     63960
     aatactgttg aggttttcgg atatcccaag tagctactgt cccatcttcg taaccagaca     64020
     ctatggcatg ctcacttatt tgtgctatgg tgttacacgg tgccacaaac gagcttggaa     64080
     tttgtaatat ttgctgctta ttaaacagat catgaacagt tatcgtaccg gataagtgac     64140
     cagcaaaaac ttgctttcct tcagtgccaa actccagcct atctcctgtt tccctatcgg     64200
     taacttgagc cgacatgctt gttgattctt ctcctactaa aagcgacatg gatgtcaccc     64260
     catcagtggt attttccttt ctgcagaact tggaaatagt tttacctgag cccaactccc     64320
     ataaccttac actaccgtca agcgaacttg acagaacgtt acggcccctc tcgataataa     64380
     tggtgtctgt gatcccagcc gaatgaccct tgagggtcct gggatttgac ccatcttcaa     64440
     gagaccacac cttaagctgc atgtcagtag accctgatag gagcacagca ttacttggaa     64500
     agatcttgac agttgttacg tcactaacat gagcgccaac tagtgataac ttgctcatcc     64560
     actcatggtc atagacatta atatcacctc cggaatcacc aatgactatc ttgtctgttg     64620
     aagcatcaca tgagataaga tctaggcttt cagaaatgcc taattcctct gtagagacaa     64680
     gcctcttagg tgtcttgaac cagtaaattt tgccattcac ttcaaatttg taacttccat     64740
     tgctctgcct tgtgaaacta ctatcattgc aaattgtacg taaaccattg tcaaccctac     64800
     taacctcagt tgcactgcca gcatctatgt ggactcggta ttcaataaca ctattagggg     64860
     agacatcgac attgatgtag aattcacctc cattctcata atcggtctcg aagtcggatt     64920
     ggatatgagc aattggaacg ttagccattt ttgatacgtg attttgcctg ttgtattaag     64980
     cttataatag acttatgttt tggtcttttc tgttaataag ttactgcaaa ctgacagttc     65040
     tcactcattt tagtaactgt caccttaaaa tttcaaaatt tcaagctcat cgcgaatttt     65100
     aatatgatct acagcaactt gtttaggttc aatttgatca cacaaagctt ttgattaagt     65160
     tcagttgcaa actatcgaat ttcagctgtc gtatcttact gctatagtaa tctttagaac     65220
     ttcggtgtag tactgtgtag caagggataa tggtacctga atgccgcact tgaatttcct     65280
     cacagatgac taccaaagga agaagcaaaa tcataagaag gagagttatc aagtcttgtc     65340
     agtactgtta cgctcacaaa ttgaagtgta atcgcgaaag tccctgtctg acttgtcagc     65400
     agcaaggtac acaagatcaa tgtgtgtaca acttccagga taatgataca ctgacccata     65460
     gaaagtcgtt agagcaattt aaagttctta aagagccgcg atatactcta aggtcatcga     65520
     cacagtacaa gttgttcaaa ccgaagacat tctacccatt ttttagcagt tcattaacag     65580
     ataagttagt cttctcttct atatatgatg atgtggcttt gacaccaaac tttactagaa     65640
     atcctattac tagattaaac aagttggaca aacaaaatct ccctgattct atcgatgatg     65700
     tgatatctat attaccgaaa tctttggaag aagccttatc gcagttggat atatttcaat     65760
     catccattca tgctataata cctgttcttt caatctccga gagccgacaa gcaataacga     65820
     atttctatga agatttgagc tcatcacaga taaatactac agatgcgtta gttttgttag     65880
     ggattctatt ctgctcttca tattcagcca ttgcttctgg tattgtaata gacaccgaca     65940
     tatgtaccaa ttactataat ggctacaggt ttttacttca tcattccgat ttcccgagat     66000
     acccaacaat agaagcattg caagttttca cagtggttaa ttttgttatt gaccctaaca     66060
     tgttagacat gactggccat tcagctatgc taattagagt tgcgcagcag cttggtctgc     66120
     ataaaaatga ccaatataga ggagataaga caaatcaaag gttaaacttt ttgtggaatt     66180
     atttacttta cattgatggt tccacttctg ttgtacatgg attccctttc tcaacaagaa     66240
     catggttgta ccaacaaaca gatattgatc taaaatatag agaccccgat ctggcaattc     66300
     ctgttgaatt ctctcttggt agattttgta ttaataaagt atttcggtct gttatggata     66360
     tgtcaataga tgaggagacg ataggcgaca ggttaagact gcagaaagag attagtgaac     66420
     tctgctctgt cctaataagg ctttctaagg atctggaatc gcgattagga aggatcaaag     66480
     cgcagtattt taattcaact ttgttcattt ttttattccg cctacattcc aggttcattt     66540
     tactaacttc agggcagctt ccgcaagaca aaattctgga atcccaaaat accgataata     66600
     aaaaggtaga gtattctatt aacaatatta cttggatttt agataagcct cagaagtttg     66660
     acgttaaggt tactacttta tctctactta ttctcataca aactctccgc cgcataacac     66720
     aggatagcat agacaaatat ttgtggtata caaagggttc cacagtaatg caatatttat     66780
     ttgtgttgct aaaagatctt tatcagcacc ctagttctga tctgcatatc gaggatgttt     66840
     tccctgagta tggtactgtg gttggtgagg aaatattaaa ttcctattcg aacaatccta     66900
     acgtttttaa aattgttctt ttggatatcc taattggagt tttggagttg aaattggcac     66960
     cgctttggag caattccgat ttatttcaat ttacattagt aaaatcactt aaagaagcag     67020
     ttgaggttaa gttcagcgac ttcattgacg caaatgatgc aaaaatacat cttctcaaag     67080
     aaagtgtcga tctctttagg ttagcagaga aatgtcttgt aaataagagt agcatttgct     67140
     tggaagattg tttaaggatt tgggaaaatg atgatgaatt cctacaatac actaagagtt     67200
     ttgccgagtg gctaacagaa ttgtaaaact cacaattatt agaatattta gagtctatat     67260
     atcgataaca ctgaacgcaa tcatcttatt tggttcagag cgtttagaat agttgaatct     67320
     gcagttgcct tccttttttg cttttcaaaa agcttccaat aacgcaaagt ctcatctcct     67380
     gcaccagata cgattgtggt tccatcagct gataaagtta aatgtaaaac tctgaaactg     67440
     tgacctttta atatagctaa aggttctaga ttgcttgctt cccatattgt tagattatat     67500
     ttcgagtaac catgggaagt gacaatctca tcagtgtttg tcgaccaaac catgttgcat     67560
     acttgtgaac cagtatcaac atcattcagt tttactgatg tattgacatt ccacatcttt     67620
     agagttctat ctgctgtacc accgccggta gctaaaattc cttgtttatg aggtgaccat     67680
     gccatagctt tgacagcagc cttatgttca ttaattgata gaaatggtgt tctggaagtt     67740
     ccatcataca caaaaaccat attgtcattt ccgcctgagg ctaacttatt gtcgttggta     67800
     ttccatttca atccgcaaat ttcttgttca tgtgtttcta tcttttcaaa gaaaggatct     67860
     gccattctta catcacgatg caatatagtc ctatctctac taccagagct taaaatatga     67920
     ttattccaag aaagacaggc cactctatcc agatgccctg ataatgtcct gatgcatttc     67980
     tcctttgtaa catcgtaaat ttcaacaata ccgttcccct gacctatagc taaatgtgag     68040
     cctgctccca tccagcttaa acttgtatat tcatttggag tatcgcataa atgaataact     68100
     tcaccagttt gatgctcgct taaaaaaact gattttccca aggccactgc taatatgtct     68160
     gtagaagacc aatccaccaa gctatagtaa aagtcatctg caagagaggg tgcatctaaa     68220
     accctgtatg gtactttact gatgttctta aattgcttta ctggcgatag caacagtttt     68280
     ttagagtctc ttctaattgg tgaaacatcc aagctttcaa agtgagaatg taatacggag     68340
     gctgttgatg gcctagtaga actttgggtc atgtacttga gtaggctagc tcctcttttt     68400
     gtagatccta cttcttcagt cgatgcacct gcagagaatg ttagcttttt aggtgttaca     68460
     ggaagcgaga cagaggtgcc aatattatta aaaaataaat tcgaatgccg ccttcttgac     68520
     gggctcgtgt atgggttgtt caaaccgcta ctattcgcgc catcggaatc tgtatctgtt     68580
     cctatgtctg aatctgaatc tgactggttt tctctgtaaa attgaatgct tgacgctgat     68640
     ttcaatggcg aagagttagc tgagaaatta actgtatttc ttatctgatc gatgctgcta     68700
     gcctgtaaag actttctagg gctcgtaaat ctgctcgtgc tgctgttata tatagagtct     68760
     ctctctggag aaagatctct atccttcgct aagtagtcac caaataattc gttctttaat     68820
     atagtatcaa acttttccat tgattctctt tctcttcgta cttctaggtg atctgcgcaa     68880
     gaagaattgg gcgaagttgg cgaggttggg accacaggtg tgttattctt cgtggcattg     68940
     ctacttccaa tagatctaat agttcttaga tctaagtctg ttcgggtggg taaatatcta     69000
     tctgcatagc gttgtaacga ggaccgtggt cttctggagt gtttccccgg agaacttaag     69060
     gatgacgagc tagatgttgg ccgcctcgtc acatcctcta ctgaaccgcg cctatggtac     69120
     tcaagttgtt gcttcttata tggtgacgcc tgcggcgtat tgctcacaaa tggattcctt     69180
     aaagagttcg aattttcaga catttcctgg cctctacctt acgatttcac agtgattgtg     69240
     gtgttgtata gcaatttgtt tcctaactct ccctgtattc tttctccaac tatcgtgtag     69300
     tgcttctaaa atgctggtac gcaactgtca acggatcact gagtcaatgt tagaactgtt     69360
     gttacagttt tgtgcagttg cttgatatat tggcgacgtt gatttagtgg ttttcaggtc     69420
     gggagctagg gaagcccgcc tttttgggaa tcacgtgttt tttcaaagaa aattcgccaa     69480
     aacctctttt tgtcaaaaaa cttgattcgc gatgagctct agttggtaat gtgggtcgat     69540
     gagtggtata agtggtataa gtggtagttg ttatgccaag taaatcattg acttgaagat     69600
     cttaattgca tagcagttat acaatcttgt aaagatactt tcttaactac tggttgagtt     69660
     ttttctgggc aattgattct ggtcgttgag tctattaatt tgatcttgag cagaacaaaa     69720
     cttctcggca aattgagacc gtaattaatt gctagggaga gcacctatag ggagtggatt     69780
     tctcggctta atattgtact tatcggttag ctgttgtggg taagatacag catgcaattc     69840
     tttattttcg ttagtatact gtgcttattt ttggagaatg tgggtgcttt ctacatgtac     69900
     tccaactctg gtgacaggaa gtgcttcttt aaagaactac cgcaaggagc tttgctaaga     69960
     agcacctaca aagtgcaagt gcatgactca accaccaacc ggtatgtgcc aattgctgct     70020
     tccaatggca gagatatgac tattgacatc gaagaagtct tcgatgacaa tcacagagtg     70080
     gttcaccagt tcagctcaat tcagtcagga gaagtcacat ttgtagctgt cgagtctgga     70140
     gagcataaaa tctgcttcca accaaaccaa tcagatttgg gtaggaaaaa actgcgaatc     70200
     gatgtggaat tcaccactgg ttctgtggat gatattgatt caaagaaaac cacgaagctc     70260
     aagactttac acagaagagt aattgcattg attgaatctg taagagaaat taaatatgaa     70320
     caagaaatgg taagagaaag agaaactttg tttagagatg catccgagaa ggtcaactct     70380
     agagctattt ggtggatact atcacaaata gtagtcctag tggcaatttg tgttttgcag     70440
     atgtcttatc tcggcaaatt ttttgtaaaa caaaaaataa tttaataata ttcttatcgc     70500
     ctataataat atatgatggg tcattatact tttgaaacac aaaatatata agttgaaata     70560
     atacccctca tagtaaatta aaatgaagct gtgaagaaaa tcatataact attcgaatga     70620
     ggttatccta gcttgtcgtt ctggttaagt cattaggtat actagacacg aattagagat     70680
     acataaatgc tctcgggaac acgatgactg gccacaaaga tgatgaataa acagaaacaa     70740
     taagttgaat tgcaatcact attgataatt cttgtgtatt atgtattatc accttgcaca     70800
     aaaataagta atatgcattt tattagtatt taatcaagaa acttctgctg aatggcacat     70860
     ttatttacag tgtagctatt cttgattctt aaaattgata tcttccaatg aaactatcaa     70920
     tataaaattt gaatagatga aatttattaa atttactatt cgtagtggtg cggttggagt     70980
     atatttcaac gatatacata ttaaaatatc actgcggtca attaactaca ccaaattagt     71040
     ctcctataac aaacccattc cctatcaaga tcgaagtatc gagcttttag aaaactctac     71100
     ttcagaagtt attcaatata aaccatgtgc cccatcgcat caaggtacaa atataaagac     71160
     tactattatt gaaagacaag ccatgagatt tacaaaagaa ctatctcctg aagagattga     71220
     atttgtagat atgagcctgt caggtatgag gccatctgtt tgtgagtatt tgtcacatgt     71280
     cagttataga gaaacaggaa tacttagtgt acgtaactag caaaacatta tgttggagca     71340
     tttattatta acatttactt atttaatttt tgatgtgaat tggaacaata tttctaccca     71400
     gtgaggtgac caaaataata aattttggaa aaaggtaaaa aaaaatacat tgtagaaagc     71460
     aatactttga aagtaaaatg agaaatagca aatcaggagt aattgatttt ggcgtcttat     71520
     tgacaaccaa tcataccaat taacaacaca atattcaatc atgtatatat gtgtaggtta     71580
     tgccataacc attcgtgctc ttctaaccta aaaaagcaaa aaaattgggg cgagctggga     71640
     attgaaccca gggcctctcg catgcttgtg attgttcaca cggattttat ccatgttcgc     71700
     ccaaagcgag aatcatacca ctagaccaca cgccctaacc aatttgttaa taagtcgata     71760
     agtaaactat actaagtaca ttatcattct tttttctttt tgtgaaagaa cagggcttcg     71820
     aagaatgagt ttacatgctc agctataacc tgagtatttt tttgggaagt attagtttca     71880
     ttcaatatcc ttcatttttg aggccctcaa tttagtcagg caagtgaaag tctctttatt     71940
     aaaaagctat tactctaaaa tgaaaaaccg ctttttagaa ctattgttat gaacatagtt     72000
     gagcagtgat aatgcaattc tacatagcaa gcatggttgt cgttgtctga actggaaata     72060
     tcaatgacct atgagctaca ttacatactg agaattgcat aaaagctgtt ttacaaagtt     72120
     gcagtatttc taatttttag taacattaaa atatcaacca tcgaagagcc caacgatctg     72180
     atctgccttc gcagcttgat gttgccaaac ctgattgttt ttctgaaaaa ttatcagtac     72240
     aaagattaat ataagtacaa gctgcataaa aatatggtaa atttatcagt tagcctatca     72300
     taatcgtatt ggaaatattt ttgcagctaa ttttattccc atcttgcgtg ctgaccaaat     72360
     tacgataaga ggatgtcgat atattttata gaaagaataa cagcttaacg agtataggcc     72420
     ctgcaatata ttaaaaaatc aatctaaaaa taacatagat ttcggctttg acggagctca     72480
     gatataaacg aagtaagagt aacagcaagc aattaaattc tttatatttt tttgcagtga     72540
     tcgatagaga agaattgcaa aagctgcgag gatatggagt caaacgatga ctgcttacgt     72600
     taattcagca caaaatacat agagaaacaa aatagtttta gaaaatagga ctactaaaat     72660
     aatacactat tacagcaatc aagatgttgg gtttaatcag tatcgttcca aaatgatgac     72720
     gttcagatac ccatatactc acttttagtt gttaggaaag gggtcaaatg caaagcatta     72780
     tcgtaccggg caaagcctat catactgaat cgtaggtgtc ctgaggagga aatatttaaa     72840
     taatacaacc caacactcta cataatctaa ctttgaaagc gcagataaaa aaacagtggt     72900
     aagttgcaaa aagtattatt tttagttaat tcaagactca acaatggatt caaacaaatt     72960
     ccacattcct tcaatagatt tgttgtgtac tcccccctat tcttgaactg tttatgataa     73020
     atccgtactt atgtaaaata ctgaaattct tgttattgta taacagttaa atgtccgttt     73080
     cctttctcca attgatacac aagtaacatc aaggacattc attgtctaat ctacgttatc     73140
     tacttttgac acaaattttt acgttgtgaa gtaaataaga tgtacgtttg attatcacag     73200
     ggggtcacag aattaatgga aataaaaaag aataagagcc taaatttgag cattacagcc     73260
     gcaaaatctg gacttttcgg agcaattacc aaatgaagct ttcgttcagt tatccaacac     73320
     aatcacccat ctatgtcata cagtgtcgag acaaaaaaac acgtccgggg gatatccgat     73380
     cacatacttt cggagcacaa gatatcaaca acgccagcga ttaccggaat gggacccttt     73440
     accacagccg tccgtgtatc tctttcagca attgatgata cagttcatta cagaagcaag     73500
     gtccctgata gtacaacacc ctgtaaccat ggctgctttg cgggaaatat gaaaggaaca     73560
     tcaatagtag ccgaaagaaa tctccgtgag gtgagaatgg cacacataat ctacgtaatt     73620
     tgataaagca agccgacccc gcatctaatt acttgtctaa ggaagggaga cacagggttc     73680
     cttatgtgcg ggcaattcac agagatattg acagcaagct ttacctcttt tctttttcct     73740
     ccccaaggtt aaaagtaaag caaacgctaa gaaacaatcg tagcacatac tgaaaaaaat     73800
     aaaatctgaa tgaagtgcac aaaatgaaca cccgtcaagg gttgtagatc gctaagacaa     73860
     ggtcgtaccc cacattgcta tgattgctga tatcttgccc ggttccagat ctcccttgcg     73920
     ttactcaaat ctcttggctt tttttatggc gcagaatcca tagacaagtg cgtacatgga     73980
     atatgaagat actttgatct cgaaattaaa tgactttgtg acttcattag atgtgcctaa     74040
     aatctacggt gcggaaaacc agtggcattc gtcattgggt ggtgcagtag tagatataag     74100
     ctttttattg ctgaactttt gcacatcttt cattgtaata tttcgtgtgc tctttttgaa     74160
     gtcactcccc attaagcgct atccctgaag gaccagtgct gattccataa caaaaattaa     74220
     tgaggggaac aggatggggt gattatagaa gtgtacaacc cctctatgag ctgtaaaaat     74280
     atagtctgac cggtttcgtt ttgatgcaac caaaacgaaa gtaatcgtag agtaacagct     74340
     gctctgaact ttctgtgata aactgtaaga catcaaaaca actccttctt ccccactcac     74400
     ttaaggtgtt gaaactacat aatttccctt ctaaaagcag aagaagtata gccgtatctt     74460
     tgagaaaatg ttggttcaac gcaactaatc aacaaaaata acattgaaaa tgaccaaaag     74520
     gacggaacag tgatggaatt gacgtccaag aacaaaaagt taacaaaaaa aacatataaa     74580
     aaccaaacac taataccaac cattttccac aatcaccttc ttgttcctat tacattcaca     74640
     tctatttgcc atcgtttaaa taggaacaac aacttcatca aaaaaataat tcttcaatac     74700
     tttactttct ggatagtatc atcgataata agttgattaa aatacaattg aatttaaatt     74760
     taaacaatgt ctgaagaatc acaatctgca ttctcagctt ccaacagcaa agttgagaga     74820
     gaggaagact tcaaagctta cgctgatgag gatggtcaac ccatggttga gattcccaaa     74880
     aaaccagctt ctgcttatac cctcatcttt atcctctgct tattcatcgc tttcgggggg     74940
     ttcgttttcg gttgggatac tggtactatt tccggttttg ttgctgagga agacttcatc     75000
     aaaagattgg gtcaaagacg tgccaataac acttactacc tatccaaggt cagaactggt     75060
     ctaattgttt ctatatttaa cattggttgt gctattggcg gtgtcgtctt atccaagttt     75120
     ggagatatgt atggacgtaa gatcggttta attattgtca tcgttgttta tattgtcggt     75180
     atcgtgattc aaattgctac tattgacaag tggtaccaat acttcatcgg tagaattgtt     75240
     tccggtctgg gtgtcggtgg tattgcggta ttgtctccta tgttgatttc cgaagtttct     75300
     ccaaaacata tgagaggtac attggtctct tgctaccagt taatggtgac ttgcggtatc     75360
     ttcttgggtt attgtaccaa ctacggtaca aaaaactacc ccaactctgt acaatggaga     75420
     gttccactag gtctatgttt tgcttgggct ctattcatga taggtggtat gctgtgtgtt     75480
     ccagaatctc cacggtactt agttgaagtc ggcaaatttg aagaagctag aagatccatt     75540
     gccatctcta acaaacttac accagaagat ccggcagtca ctttcgagtt agaaaatgtt     75600
     caagcaggtg ttgaagcaga aagattagct ggttctgctt cctggggtga attgttctct     75660
     accaagacga aggtcttaca acgtttgatt atgggcatca tgcttcaatg tttgcaacaa     75720
     ttgacaggtg acaactactt cttctactat ggtactactg ttttcaaggc tgttggcttg     75780
     gaagattctt tccaaacttc aattgttatt ggtatcgtta actttgcatc cacattcgta     75840
     gctttgtacg ttgttgaccg cttcggtcgt cgtaaatgtc tcttgtgggg agccgctagc     75900
     atgactgctt gtatggttgt ctttgcatca gttggtgtca ccagattata tccaaacggt     75960
     atggaccaac catcctccaa gggtgctggt aactgtatga ttgttttcac ctgtttctac     76020
     attttctgtt tcgcaacaac ttgggcacca actccatggg tcatcaactc cgaaacattc     76080
     ccattgaggg ttaaagccaa gtgtatggca atatgtcaag ccgctaactg gatctggggt     76140
     ttcttaattg ccttcttcac tccgttcatc acgggtgcta tcaatttcta ctatggttac     76200
     gtcttcatgg gctgcctatg tttctcctac ttctacgttt tcttttttat tccagaaaca     76260
     aaaggcttaa cattggagga agtcaacact atgtgggaag aaggcgtctt gccatggaag     76320
     tctccagatt ggattccacc atcaaagaga gacgccacct atgatgctga tgccatgatg     76380
     cacgatgata agccatggta ccggagaatg tggtaaaaac cgtcacaaag tttaatttga     76440
     catattttca cttcctttac cacacctttc caataggtga ctctaactgt tgattcaata     76500
     aaacatattc tttttcacta atgatcttca tgataatctt ttataaatag ttattactcc     76560
     acaattcaat tcttttgtag caaatttgga cactatatca aatagaacta gacttgttaa     76620
     ttttttctgg cccttccatt taaataagct cagtatgttg taaagagcaa tttttaccgc     76680
     accaatacaa catggaattt tattctttac tttatagcac cctcatttga acaattaaaa     76740
     agtgaatacc ctttgtgtaa aattgtgtag aggagttcac aatctcaact gcaacatgaa     76800
     tgtttcacac aaaatgaact ctaattcccc attactcaaa cctgtagtag gaactacaaa     76860
     atgttctaaa agctccggtt aataaattca atcacattgt acaactgagg ttaagtgttg     76920
     acctgttaga tttattgcta agagtcctaa tatcgcatta aaccatggct acgtttgaac     76980
     tgggaagtat gatgtcattt caataatgtg acatttatca cacttcaaag aaaacctctc     77040
     taggtctatt aaatgagtga caaacaacac ttaacgcaaa acaagcccga gttagatgta     77100
     tatattctca ataatacata ttagaggctg caacaaatat atggtactca aatgatgcta     77160
     acaaaattgc cctcattctg catttcaaat cgatgttact acctcttaac aatcgtacaa     77220
     aatcaagtca aaaagtattt taaaaacata atctgctttt cggaaatcat aaacatatgc     77280
     gttttcatgt tgtattttga tcgtaaaata atagatttat aaatacgcga attaatcatt     77340
     ttataaaatg atcacatgct attctccatg ctgaatgttt attaaaaatt gaattttagg     77400
     gccggttttc aaggcttttg cataattttt atgatatgtg ttatgggttt gttaggctta     77460
     tgataaggtt tctggatata aataaaagat gctatttcca ttacctattg aaattgatac     77520
     cctctttagt agactatttg aaagcaaatg aagacaagac tctgatctaa ttttgatatg     77580
     gatgaaggaa aaacagacgc ctcaggtctc ggaaaaatgc tgacaggctc atacattgtg     77640
     gataaggaca atgactattg taaagaatct gtactaaatg aaagggggaa gaaattgatt     77700
     aaaaatgtta gcaactgtag tgacagtgag gtttatgcgt caagaatgtt agaacaactt     77760
     ccattggatt atttcaccaa atcagagatg gccaggtcac taataaaatg gtcttcttat     77820
     tcacatattt attcatcttt gacaccttac ggctatccaa catgtttttt gcctactcga     77880
     tctcatcttg ttataggcac atcgaaagga atgatactaa tctttgattt tagagagttt     77940
     ctacatggta ttttaattcc tcagtcttct acttccgatg cagataatgc attaagagat     78000
     gctgtgaaaa tattaaaaat ttctgaggat ggcacacatg tggctggtgc ttatgagtcg     78060
     ggccatgtgt ttttatggga tatcaacatt acaggatcta atggatcaga tgatagtaaa     78120
     attgaaccaa tcagagcaat cttatacgtt gatgactata ttaatatgac cgttattggt     78180
     ttggactttt atggtaaccg tcacacaggt ctaatagtag gtgttcagga gacaggcacc     78240
     attacttacc attctggaaa acgcaaccac ctctggaagc tagtttacac taatgctatc     78300
     gtattgaaag ttcctagtaa tgagaggcta ttattatgca attgcaaggc ctatgaagat     78360
     gttgtttttt gcggaatatt gacaagtaaa tactttgcag tcatgaaatt gggtgaagtt     78420
     cctaaactaa tatataacga accaattaag gcaacaagtc agcaattagg actaaactat     78480
     tccatgtctt ggaatgcaaa catatctaga gtggcctatt ctgtcaatac aaatttgtca     78540
     tgtgtagcac ttgaaggaaa taacgcgtac gaacttatga aagtccatga ttatacaacc     78600
     tcggaaagca tatcttctct acaatggtta tctagagatt tggttggagt tttgacaata     78660
     tctcatcaat ttctgttgct tgactctagc aatggcttca aggcgaacgc aatcgttgac     78720
     cttttagaac aggatatatt acgtcccccg tcgactcatt ttcagtggta tgattccaaa     78780
     gcatttttgt tctcaactta tagttttaaa ataggacatt tgatgacctg gtcacaattg     78840
     gtacttacat cagtgcagaa gggtaattat atagagtcgt tgctgctgtt ggaatacttt     78900
     ttaaatgaag agtcaaaact gaataacatt ctattttatg agaataaaga tacgccaaag     78960
     aagaaggtac tatttgaacc cttctataac ttggcaatgg cagccgttgg atttctgatc     79020
     aagtctgaaa tcgcatccaa ttcaaagtat gaagagttgt ttactttaat ttttcgtatt     79080
     tggggtcaat ttacgaatgg tcgacaaagc tcgattgtcg ctaatgagga tctgatagac     79140
     aaaatttcag agttacttcc gaatgagaag aaatctttat attatgaagc actagcacta     79200
     gctgttgtgt atggaaaagt aaagagacta ccggctgaaa gtttcaaaga gctcattcag     79260
     gatcaagcaa caaaaaggca tgtcattcgt ctacaggaga ttttaacaag tttagatgtt     79320
     gctaatctcg atattgattt agctgttaga gtttgcaata aggaaggtct aattgatctg     79380
     tccatttaca tttggaatat gattttcaat gattacttaa caccatttat tgaattctta     79440
     caatccatag caacttcaaa tggaactaaa acgacagctg cacagaactt gtccataggt     79500
     ataaatgatc ctagaatggt tttcaaatac cttgagtgta tttttggcag caaacaatat     79560
     cctcttggga atcggaatat acctgttaaa tcggcacaaa ttgcatttga acaaatttta     79620
     agcgtcttat ttagtgggac ttcgatacga tggccgttat catctacaaa taatttccaa     79680
     ttgtataaga tggatgaaga accagctttt ccgtatttaa cgcttttgct agattataac     79740
     gttgaatcct gccttcaaat gcttgatcac ctatttgaat ccgatatttt aaatgtggac     79800
     gagtcagact tagatggtga cagtgtattt agcagacaat acatcacaga aattctaatg     79860
     gattatatgt tgaacaataa gaataatgga aatggcgttg cggtaggaac ttttatagca     79920
     aggaactgtc caaaatatcc tcaatttatt catgtgtcca acaaatacta tgatagtatc     79980
     atagatgtta tttgtaacaa taaaattgaa tctctaaaga agcgatcaga aactgcttta     80040
     gaggctatca tcagtaaata cactcccaaa gatgaaaatc agtttgttga aatgattaaa     80100
     aaaaatatgt ttctgaaggc tttagtgatg ttttatagaa tttcaaataa gttttctgat     80160
     atgattgaga ttattgttgg tgatgaatca gcttctgctt ttacttcaca agaaacttcc     80220
     gacattctaa actttgtttt aagaaatgtc aaagaaagta ttgataaact aaaaatcaaa     80280
     gatgctattg cttgccattt taatcaaatt atccaaaatg ttgaccttga tgaattcatt     80340
     actatttgcc aaaattttga tccagcattg catgattcaa tacttcttaa tgaagatgaa     80400
     gatctcaagt atagatatat taacattctg tttgatgata cgaagcttct tccagaagaa     80460
     agacctgcat tattgggttg gtatctgcat gagtctgtaa aacgtggaga tgaaaagaag     80520
     ttgatagatc ttctaaacaa aattacacgc cctccaaaag atgtgaataa cctgatagag     80580
     tatttaatac attcgacatt ctttgaatca gcttctatat tgtactccct acttggtgat     80640
     aaattccagc agttaaggac attgctatcc gctgttgaat gtttgaataa gaacaatatt     80700
     aatcaagaac tcatcaagcc gcatatcttt aaagccgttt ctatagcaaa ttcggcggtt     80760
     gttgatgaaa agaaatactg gtgtgcaata ttggaatgtc tgatacgtct ttttatttct     80820
     gacaatatat caacagtgaa tggagggttt caattatata gcatgatggt aaatgttttt     80880
     gtaagcatat cggaaaaggg atatgatata gataacgagg atacaaaaag gttcagtaag     80940
     atctttgaga atgcactgga aaaccaagaa cttttactag tgaaaagcaa tagattccgg     81000
     gatggctttg ttgagatttt taaccaatat aacctaagtg agaatgtatt aaagctagtg     81060
     ttggcagtgg tgatgaacta ctcctctgaa agtgatattt tgtatttgct gagtcaacga     81120
     agaggctggt caatcggatc cgatgtctgt gagatatgtg ggaaaaagtt gtggggtatt     81180
     ggattagcca aaaaggactt tgagacctgg aaaataagat ttgagaatga aagtgacttc     81240
     tacaaactaa gtttaaatca tgatgttgtt gtatttaagt gtaggcatgc tttccatgac     81300
     aaatgtctag gtaatttggg tcagaatggt gagtatcatt gcctattttg caggtacaag     81360
     gtataaatta caattagaca tatgtatact tttttgcgat cattagaaat agaaaataat     81420
     atattcatac tttaagtaag ttgtaccaac gactttgtac agtgaagcca tcattatcat     81480
     ccttgacaat taaattcttg ttgattagcc attggcaaat aacttcaatt tcctcaacgc     81540
     caattagact ttcgcaatcg cttgcaatgg tagtgctctg tacacctggt ttgaaaagaa     81600
     tatctgttaa cactattgtt agtagcgact tccaaatatc cgatctaaga gagccttcag     81660
     aatcaatcca tagcttggaa aatggttttc ccaatgggac tggaatttgc tttacatcaa     81720
     agtttatacc cgtacttcca ttaccattgt aaagaacaag cggcggcgtc aacgtcttaa     81780
     tttcaaatga ccttgttgta tattttaatg gtcttacatg tctttctaag ggcattatac     81840
     tgatgcaagc atcacctgtg tcgatcaaat ctataaatat ccaagaacaa acatcttcaa     81900
     actcttcatt aattactata ccgtacgaag aattcagcat ttgagctatt ttttccgaca     81960
     aattcgctgc tttcttgaac gccgaaaagt ctccctttgt ttgtaaaagt tcaaatattc     82020
     tttctgtagg tttcagtttt gagctatgga gatacaactg cttttgcttt gccatatcca     82080
     tgataatggc atctaattca tctctaggca catccttcaa gatatcgatt tcgttcttat     82140
     tcatctcttt cgactctact aatattgatc ttactattgt gcgaatctga tcttgcctgc     82200
     gagccttttg ttccacatct ggcaagcatt catgagatag tgttggtgtg tgttttaaag     82260
     aagcaatttc tctttggatc atggaggaca tagcaatgga gctgtgagta ctgaccgtct     82320
     tgttatcacc ttttttaagg aacgtcagct gttttagatt ttcttgataa ttatacaata     82380
     gttttactct ttcagagtca acctcttttt ctttatcctc ccacaatcgt agcaaaatcg     82440
     agagttctaa gttttcagtt tgttccagtg ttacaagctc ctcacttatt ccctgaagta     82500
     atattttacg ccatttactt agtaaggctt tccaaccatg ttgtcccatc ttgatgcggc     82560
     gagctgtcca ttgtcttttt aaattgtcta tagaattgta gggaaataaa gtcgtaattt     82620
     ggctccaaac aacctcattc tttatagatt tagaaatcac aaccagcttt attagcttgg     82680
     ctataccaag ctttgtagaa atattgaaat ctcttgaagc tttttcgagt tgtttatcct     82740
     ctacaatagg tgtaatgtta ccgttatgtt tttttgtcct atcaatccgt tcctttcgag     82800
     atctcttcct ttcttcaaat aatttaacag atgaagagtt agtgtttctg acttcactgt     82860
     tattattctt cctaccattt tggtactttc taatcctctc tgtagctttc atctttctat     82920
     taaatctgtc ctttgcattt tgatcgtaaa agtaaatatc tgtatcatgt aggatatcct     82980
     tgaaaaaatt cttcttgttg tcttttgtat cagtcagtaa atctgatatc tttgccattg     83040
     gtacatctgg aaaatgtatt acttttttct gtgtatcagg atctgtgtaa agtgttagct     83100
     ttgaattacc aatcattaaa tctacatcac cttttagtgt ctttttatcg atcacggtac     83160
     tggaggacat ataattagta acatcttcga aaaactgctc ccgaaggaga gatacgcctc     83220
     cacttttttc tagaactttc atgatagcct tctgtctact caatgatcta agtgaacttg     83280
     ctgaaaaccc atcaatattt aacagaggta gtttagtgcc ttcaacgtcc ttttctacca     83340
     aattatcgga tatatttcta ctccttttct cctgtactga tttcgatttg cgctctcctt     83400
     cagatacagt gatctttcgt ttttttgagc cgctaggaat ttcagggcgt tcgatatcaa     83460
     gctctccgtt ccagaaaaat atacgcttgc cactattgtc taatgtggtt cttagtgtca     83520
     cattcaaagg tgagaatagc tttttcgaca attggtaaat gttctggttc tgtttcttca     83580
     aatctgaggg ccaattataa tttttgactt cagcattgcc taccgttgtg tcagttaact     83640
     tttcgaaatt ttcttttgtg aagaaacgat aaaacttctt tttaccctcg aaatcataaa     83700
     gtctagttaa ctgatattta ttatttttct taaaattagc gccttttgct ttgctatttt     83760
     tcgacaccat ataataatca cttattttac caaacggcct cttgtaatct ctgccagtca     83820
     gtgaatttat aatatccatc gttggcaatc ctttaacccc ggtcttctct accattgcat     83880
     atgtttgatt ctgaattgga tagaatctat tcatatatat gttgttattt ccattagtgg     83940
     ttgaagtggt gttagatggt tcttgcaaaa ccaattcttg gccttgtaaa acatcagtag     84000
     tactcgtact attcagacgt tcaattgcct cgtcatcgtc attttctgct tcatcttcat     84060
     catttgacat ttcacccata tctgaatctg agaattcatt ggcgtcctga ctaggtttat     84120
     aatctttcaa aaatttgaca caccttattt tgacgtctgg attcactgga gatactacga     84180
     ttacctttct caaatatcca ttctcatcta accaagcaat tgcgcttatg aaagctcttg     84240
     acaatcgctt tgtcttatca aattgtaatt gtcttttgag atcactcact tggcgtatgc     84300
     aatttttcga gtttttaacg acgtctacga tctcagccaa atgatctctc atacttatgt     84360
     atacctcctc attctcctct tcatttatat ctgtgatgaa tttgcgaagt cttaagttct     84420
     tcaccacatg accgttatga ataacctgaa cacttttgat taaattgtcg agcttcttaa     84480
     gtcttcctgt aatactacgt ggatcctgtt tcgttatctg cgctagttcc atggtattaa     84540
     taccttgtcc tctggcgtgt gcaatctcaa ccaacaattg gaaggctgaa tttccgatag     84600
     aggagtcctt tttagagtaa ccgccagtaa gcacttgcca caacttctct tcactaatgc     84660
     tcaccacgca tgctgagtct atctcagtga ccgacttggt tacactgttg ccctcaccat     84720
     ccatgaccag cacttctggg tccgaaaaca gagactgtag gatatagcgc tgcatcggct     84780
     catcatcatc caatgctgta acacccataa ctgtctcggc aatattccac agctgcgcta     84840
     atgaaaccgc gcctttctca tacgctatct cctcacacaa ttgcgagact agctcgtcag     84900
     gatacaacac cattcttcct aagtttgtca aacactctac ggggaacgca attaaaacgc     84960
     gtgcgtccaa aaccaaagca caatggataa aaaggactaa caaatataat acaactctgc     85020
     cttagacagt accacagctc cccagttcct tataactata actggtgcaa atttatacac     85080
     ctcttggcgt ccaaaaataa cctatttgag tggccatctt tgactattcc tgatattgag     85140
     tgagtcccag gtcgatttac ccactcaaaa taacatcata tcacctaata cgtacttgtt     85200
     tgctacgcca gccttaaaaa gaagttttgg cgtcaaaaca tgcagtttat agcgatgagt     85260
     agtggtgagg tcgagtgagc gctagacatt tgcagggttg atacaggggc atacaggttt     85320
     tagtgtgagg atggttaagg ctgtggaaag acggcttgta ccgcagggtg tggttactaa     85380
     tttctacaac agagtgaagg aggatgggac gatagtacag tcgttgcagc gtggtggtgg     85440
     ttcgcggagg tcgcgggcgg tcaattactc tgaggttgat gcttttgagg attttgagga     85500
     gagcgatgat gaaaggcaag ggagtaataa ccgaagtgcg agcaccgagg cagttgtgga     85560
     tgataaattg cctgagaatg tggttctacc ggacctggag gatattatca cgggtgaaag     85620
     cgatccatct ttgaatgtac tgaagtttag gaaagttcga gatactttct tcggtggtag     85680
     gattgctatc aggtataaat tagaactcga tcagaatgag gtgcgatcat cttcactagc     85740
     tgtgccaata attgtgccaa taacgctaaa actagaagac actgctgatg gaatttccat     85800
     taccgactct ttactatgga acataaatga cacttcggta acgccagagc aattttccct     85860
     ggtttattgc cgtgatttag ggattttggg gaataactac atacaacaac agattgcaac     85920
     actgataagg gatcaaattg agaattacag aactttaagc gggcatttgt tgcaagccaa     85980
     cgaaaatatg cgatcgtatc cagactttca cgttcattta aacatcgcat gtaacttaaa     86040
     cagtaggtat tacgaggaca atttccagtg gaacatcaat gatgaatctt tgacacccga     86100
     gaagtttgct accattgtgg tgaaggatct tggtctaacg agggatttct tgccatccat     86160
     atctcaggtt cttcacgaac aattgttaca aataaagaaa gaatggatta aaggtgagtt     86220
     caatcatgag ctgatacatc cagatgagaa taatagaatg gtgagaattg aagccaacca     86280
     aggtgaactg gacagagcgt ggtcaccaag agttgaagta ttatcaatgg atgagattca     86340
     aaagagggaa gtagagagag aaagacaatt aagaagaatg aagagagatt ctgatagact     86400
     aggaagaaga ggtcgccgaa agtgatcgta agaattgtat tatatatttt tgcaaatatc     86460
     gttaatattt atcaccaaaa tataaaaagt aaactgcata tatggcatga taatgacaaa     86520
     ggtcacaaaa ctaccaatgt ttaaataaat ttatacacaa atatttttat ttatagttgg     86580
     tactttatat tcatcaccaa tccatttgta tacttcatac tttgagttta atttcttgtt     86640
     ggcatgcata caataactat taccactgtt tgccatcaag gcaccagtcc ttgccatctg     86700
     ttctataaat atacaccgtt taattctaga gtgaattagt gccattgaac acatagaaca     86760
     tggttcatgt gtggtataaa catcaaaatc caagcataaa taattttgcg gcacattgtt     86820
     acagtcttct aacgacctcc gcttcttttc agtatttgca accttgttta taccaaccat     86880
     aatactatgg tcaattttta aagagaggtg ttcttcttca ctatgcgatc tctgatctac     86940
     tgctataata aagtcaccct tgaatttggg atcaacaaaa actgaaacta tgggcaaaga     87000
     tccggattcc ttacctattc ttttagattc ctcttgaatg attttgaggt agaagtttat     87060
     ttcatccatc ttgaactctg aatcatttaa aatttgatca ttgggattac cattccaaac     87120
     caaaggccaa tacttctctg accattcctt cactaaatct ttatcatatg gacccctctt     87180
     gggtacctta ttgctcgagt taagattctc ataatcaaat ttaattaatt cccttacttc     87240
     gtcaatatta tcgtacatta gtgtggagca tataatgcat cgcaggagac tattaccttc     87300
     ttcatttatg actttccgaa ttctcttaca atgtgctaaa ggtatcgggt cctgatccct     87360
     agtgtttagc tttaccaatt ctatgaagga ctttgacaat tgtggctgga tatctattgt     87420
     ccacacgttg catagttcag gaacattact gatatcgaga ggttggattt gcaaaagacg     87480
     atcttccact atacagcgct tgaaatcaat cttaatttta ttgtctacct tcttcaccat     87540
     gttctagtta agcaattgca tgaatcataa aagatatagc tctaatgtag tagcttccat     87600
     attattagtt cctattttgc ttgcgatgag ctgtgcactt tttcaataaa ttttcacttt     87660
     ttagcgatgt cctgatcaaa atcggtgtga ttgagctgat taatgactcg aaagtattac     87720
     aacaaccaag agaaaataat atacatctac caaaaaaaca accatagaat aatttcttac     87780
     acatccttga taaattaacg actaatattc cattttacta tgctaacaga taataaatga     87840
     atgaaagtgc ttcgagaagt agttacaacc aatgaaaact ccctaaggca acttggcgta     87900
     ctcttagatt ctacttttgt gattgagaat gaagtacaga tcgatattga taaagatttc     87960
     tttgatagtt ctgctggtca cagaaagtta attgaccaat gcattgtgtt tctgctgcaa     88020
     aagagacttt tgaataatgt tttagtagca gggtataaat tggctaagaa taataccgtc     88080
     agatctatat tacattgtga gaacagcaac tctgcagtga agactttgaa atcttctagc     88140
     tgggagttac ttcatactaa tattggaagc ccaaagttcg ttaatctaat actaaatcat     88200
     tcaatattta cttttaacgg cgagtttaca cagcaagtag ctggcaactc attaaataag     88260
     ccacacttac caccttcctg gataatagac aatgactatg agcaagaaac tgatatcaat     88320
     tgcttttcaa taaataatcg gccctaccta tatcacaata caagaggatt ttgcataaaa     88380
     tctatcatac ttgacaggga tatgttaaat gagacattgg atatacaagt aaaatattta     88440
     atgagagaaa tatttgaaaa tgatattaag ctaaataaaa aagcgctgag gactacagtc     88500
     atagaaactg ttctgaagca agtgttagaa aaccagcaga gaatcccaat tattccaata     88560
     ctggataaaa tttgcccaaa aacctattcc aactatcacc tagatcgagc tactcctgtt     88620
     aagtgtgtta acaagttcat agttgtcatt ttagaaaaat tgaaaattct acaattaatt     88680
     ggatctagaa agaatagctt tgtattgttt tctaaaatct cccaactact aaaattgcca     88740
     ctaaacggta aaataaatgt caaagaattt tttacaaaac tgaatgtcaa tgcagttcgt     88800
     agatatctca gtattgaccc aattggacag caaaagcaaa gcatgagatt atacctgacc     88860
     tgcgttgtga attacctgct ctctaaatta atcccttctt tattaaagtc ttttttttat     88920
     tgcactgagg tatcatctta cagtaagata ctatatttta gaaatgatga atggaattct     88980
     atttccacac cttttttgaa agaatatctt gataagtatc tggtccaaaa cactcactgt     89040
     aatagtcatt ttagctatat ggaatctcaa ttcaatcact gcaattttcg cctgattccg     89100
     aagaaaggta ataatgaatt cagagtgatt ggaattccat ataaaggaaa taatgcagag     89160
     gaattattac agtacaaaca aaatcataca aaggttatag tgcccacaaa gttaatactg     89220
     gattatctac gcaaatctcg tcaaacaacc caaaaactgc tattttcagc tatgcaaata     89280
     tctgatcaca tctgtcaata caaatgccac ttacactcca aatatggtta tattccgaaa     89340
     ttattctatt taaaatttga tatccataat tgttatgact caatcccaat agcaaaagcc     89400
     aaaagtgttc tcaatagctt aattaataac tgcggctatg aagaattcta tgtacgctcc     89460
     gttaccattt taaatacaaa aaacaatgaa gttcgatatg atacaatagt aaatggtcat     89520
     ataaacataa gagactttga aataatggtt gataactcta caacaacatt cttgacaaag     89580
     gaggacatta tggatttgat cgagtttgaa atggaaatga caagtatacg attatttgat     89640
     aaatgctatc tcagaaagga cggattattt caagggttga gcctatctgc tacaattgtt     89700
     gatatattgt atgatgatat gcttgaaaag aatagagtat tcaaggatat cttaaataat     89760
     gatgggttgg ttctgcgtca tgcagacgat tttctcctta tttcaccttc aaaagaaatt     89820
     attagttatg caagattaaa aataaatgag ggatttactg aatataatgc ccaagtgaat     89880
     catcggaaaa ttgtattcag cgaatctgac aatattgcca atacagctat accattttgc     89940
     ggtgttgaaa ttattcccag aactttggag gtaataaaac gattttctgc tatgaacgag     90000
     actgatataa gcgatcatga aggtaacatt tattccaaat gtgcagttct ttttaaaatg     90060
     agattgaatt atggtacaat gaatgcaaac ttaaacagca tcagcacgat gttaaaacag     90120
     gtagaaaatg caacaataaa tattgtgagg ataattctga actcaaacca tattgcaact     90180
     tcagtaagta gtttttcatc tttcgtcaat gagttgtaca atatttgtct tctgtcaagt     90240
     cgaaatttga atttactaaa tcatagggac ctccaaagat ttcttactag cattaagaaa     90300
     accatactta ctgttttgct aaagaatctc aagagaaagt attctatata taacggaata     90360
     tctagaaata tgaactcgaa gcgaacgtcg aaataaaaag tttttagttc atgaactaag     90420
     taatgcatat attatattaa ccaaaggtaa aggaaatata tattaaatac caaaatcctc     90480
     tgtgatacta tctttacaac aattgtcctc caccaaaatt ggctcgcaga ttttcttcgt     90540
     ccttttctct tcttcttctc tctacctctt ctacacctcc tgatttcttc aagtttgaat     90600
     tctcaacaaa gttgcctaac tcgtctctga attcatcctc atctctataa cctctttcac     90660
     gttcccagat tttttctgct ctctctaaag cttccactct gctttcatga tcgggattta     90720
     actgctgaac agccattaac atctcttccc tcacttggtt aaaggttcca ggctttaaca     90780
     gcggtagtac tggatttctt ctgggtttag ctggggtttt ctcctgttcc ttgcaacatt     90840
     gatcaatcaa atcgaatgtt tcgacagcct ttttcaagtc ttctttcaaa tccacgatga     90900
     gatcttcttg taatgtcaaa aattgttgtt cttcacaaac cttatccagc tctgtttccc     90960
     aaatcttctt ccaatgaggc ttttcagtat cgataaatga tttcatcctt tgtagatcat     91020
     gctcagcatc gttcaattct ttttgaacca gttctaattt tctttttgac ggttgtgcac     91080
     ccctctcagc aacatccttt ctgataattt caataaggtc ttgcaaatcg tcaactttac     91140
     ttaataattt atctgataca tctcccagtt cagtttgtga ctgctcaata tattggcggt     91200
     tagaggagtt attcgttgcc agatttacgg atttgaaagc atcaaccttc tccagaatga     91260
     attttatagt tttctctaag gctttcttat tatcgatata aacttgtctt acaatagcaa     91320
     tttcatgctg tacctctttg agagtattgc tgtattcttt gtttgtcgcc acattttctt     91380
     tctcagatga tgatgcttga actggtgcgg aattaatttg aagacttgaa attctatcaa     91440
     gcatgacctg ctggttcttc tgaagctcat ctttgagcaa atctattaga tctgatccag     91500
     cacttgatgg gggggcttgt gtaggacgcg aatgcagttc aactaatgat ccttccttga     91560
     cttcttttag cccatgttca tccaattcat atgatatgtt gtgaacgggg tcgttaatat     91620
     atatgtccgg aaaagaatct ccacctggag agtaagcaaa catttcgaca aaaagtaatc     91680
     ttaatcctgt cattgttatt gggaaagtgg cttcacattt cttgactctg ttatcaagtt     91740
     tcaagaaaag aacgccttta gcttctgcct tatcagttgc ttcaacctgt ttcatagctt     91800
     caactttatc tatgtcagat atttgaacag cttcgggatt gatttcatct tcatgcttgt     91860
     cctcaagttc attctgcaat ctctcggtca acttgtttcc agtactcgac aacctcttgg     91920
     aaccttgtga aataatcctc tctgaagaca agtcattgtc tagactttga ggaagaccat     91980
     ttgaagcaag agctgcggca ttagcggcct ctgtagctga atggtttgtc aacttagcca     92040
     tgtggtatgc agagtacctc tttgaagcct tacgttgcag gttattaccc tttttcagct     92100
     gtgcaagcgc atctccttct tccggttgag aatcctccac agcggtcacc gaagttaatc     92160
     ccgcgcttgt ggttgtagat tctgtgtcag catcaacaaa ttgctgatca acagtcgcac     92220
     tgtttctctg cgattgcaca ttggaaacta tgctattaac tctgctgcct gccgtactca     92280
     caccaccacg ttcactttcc aaagatatag agctcgttat tgaatgctgc ttcctatgtt     92340
     gaggagatgt catcatcatt ttctgttcct gcttcatggt tttcaggagt gcctgcttta     92400
     ctttcaactt atcaagcaaa gtaactatga tctccctgat ctgaggcaag tacttgttaa     92460
     gtgactcgtc agagggcggc tcccttagcg ccacttccag tactttgcgc aacgccaagg     92520
     gtacgtcccc tagatcgctg atatccacct tcgcatgggt gaaaaacttg gatacaatct     92580
     tgaaatcatt gcccaaatgc acataggcat cagataccgc tctaggaccc acagacccac     92640
     gagaccactg tgttaacgtc tgcaagagca acttggtaga catcaatagc ttggtcaccg     92700
     tggtctctat gctggaatgg gtcttgccca gcggaagttt ttcctcagac atttactctc     92760
     ttcaattgcc acagggttaa ccaactagtg attttgtcct atgtacaagg ttcacctgcc     92820
     tctacttgcc ttcttaatat tttattttga tccgaaaagc tttaagttct tccaagttct     92880
     tgaaatttga atttaaaaac gcgatgagct tagaacaata gtgaatgcaa gttaatgaca     92940
     ctagctgaga gtgaggagaa tagagggcga acgcacagtg atatatgagt gatgaggtag     93000
     tactgggctc ggagacggag gaccaggaag tgctgttcca acaggactgg caggacacgg     93060
     atgtaccatc ttcgcagtta cgtgagccct tatctcaggc tccagttgcg ggagaacttg     93120
     gcgttaggca gtcagagaca gcacctttgg atgcgagtgg tgatacaaat gaatctagag     93180
     accagccagt accggcgata ggactcaggt ggtcattaag aaagcggaag gctatccaga     93240
     agatgccgta cagtttggat aggctaaagc acaagcaatt gcttcaaggt tatgatgtca     93300
     gcaatgacat gatgtctcaa ttggagttgc ctgcacctac agcagcagat ctggatacct     93360
     atttccaact tccggagtca gattcggata gtgagtctga ccccgaagct agtatagaga     93420
     ttaaagatga tgatgagctt ggcaacgaca gtctggaagt agttgtgcca cgtaggtaca     93480
     gaggtatacg cttagacagg tctttggatg atgatagtga cactgatagt gatggtgacg     93540
     atacggtaaa ttctcaaagt aatcaaaaat caagccagag tgagatcatg tttagaggca     93600
     ggaaaataaa cctgaagact ggtttcaaag gtttattacc acgttctgtg tgggaaaaaa     93660
     atatgaaaag ccaacagtct aaacctaagt ccaatacatc ctccacctca agggcgcaca     93720
     aaggtgtggc attaaggaaa agagtagcaa atagacattc aagcacactt aatgatggct     93780
     tccttattga cgatattagt gaagtagaag aagaagtcac acctttgaac ttaaactcag     93840
     cccaatctca cttaattgct gaagatatgg cgacatctca tgaaagacca ccgtatatac     93900
     ttgaggatga aagcggtata gattacattt ccaataataa acaagatgtt cagggaaggt     93960
     atagtactta catggctgga gaaatcttag atggaaataa aaacctaact cgggagttga     94020
     atcctgctta taactttgat gaaccttcct tgtcaatgat gttacacaga acttcaccta     94080
     ataaatccaa aaaggacaat aagtcaaggg cccccagaag taataagcca gggtctttga     94140
     tcaagaggag gaaaaaagaa aagtcaacct acaaccctat taccaaggaa tatagcatgg     94200
     taggtataaa atattcaagg cgctcaatta gacgtccacc taaagaaaag ccttacaaca     94260
     attatgaggc caatataact agtaaaaagg caagtggtga tttatccaat ttacaaccat     94320
     atctcaagat tcctgacgta gataagaaag accataaagg ggatcgacaa cagaaaacga     94380
     aatccagatc aagaccatat gaaatagctc cacctgaaaa tgctattttt aaaaggaatg     94440
     atattagaag cttcagtacc gttgtggaga aaattggtga tgaaattgtg gtgcaacata     94500
     atccaaactc aaagcttcag gtgacagaag atgcaccccc aggacttcag aatggatttt     94560
     tgtatctacg agagagattt ccagccatcg agtcactatt taatcacaaa gcaattgaaa     94620
     tacccaatgt gataaaaata tctcttggga atgaatcata tgttttatca aagatggatt     94680
     acaaagcatt aaaagataac ttgactaaat tgtttaccga aattgttaac aacggtgcaa     94740
     gtgatgatga gatctttgat tttaacgttc atgtcacttc cattttactt tacctaaata     94800
     aaagtgatat ttatgaaata attgaagatt tccatcgcaa atttcgaaca aaactttcct     94860
     caatttatca gaaagccaaa ccaatacatt tttttcagat agtaatgtgc cagctaatgc     94920
     tatttgaaat taccaagtat gctgatattt caactcagta taaaaagatt cttcaagata     94980
     gactatcaaa tcacactgtg tcattcttta acctgttaga tatatgctat gaaactttaa     95040
     aaacacaaga atcgctgtac ttaaatgaag ctttccacat tatctcttta attattagtg     95100
     attttgagga tgggattgaa ttaatttggg agaggttggg aaaaaataca tactctcctt     95160
     cattattttc aattatcatt actacattgc caatattaga accccaatgg cagtctgtta     95220
     aaataataaa ttcttatgaa aatctcaagg gtgtactaaa gctcgttaga tattgcaaca     95280
     gctactacaa atggaaacca aatgatctgc tgattctcca acttaacaaa atatttaaag     95340
     aaaggagatt tgaagacttt cctgaggagc atatggaatc agaactgaac catgtaattt     95400
     cctctccaac cgagaaaatt aaaagaaaaa cgatctttaa caaatacttg tcaattttga     95460
     ggagctcaaa tgttcacagt agtatcattg aaaagattac acctatgagt gaaattttaa     95520
     ccaccgacac cacatctata ctgattaaca gagttaattt aattatcatt ttgagctggt     95580
     tctctaatct aaatatagag aaaagattga gtgaactttt aaaaccagtt ttgaacgatt     95640
     catatctcca cgatagagat tctggtacca ctagaatagt tgctaggtct gtattagagt     95700
     catttttggc tttaatacgt acaacagcaa agaaaaatgg taaaatttcg ctgaaactta     95760
     atatatttca tctattcttt aaagaatatg tttcaaaaca tgactatcta gtttctatgt     95820
     ggattagctt cattaatcgt acagccaaaa taagtgcgaa cctaccgaca aggacgttaa     95880
     agagtgtttt gaaatattta gtaatatgtt tcgaagatat gcaaggcgat attgaaacac     95940
     ctttattgtc agccaacttg tctctcatga aatttatggt aaaacatttg gaaaatatcc     96000
     acatgtcgat aataaattca cgacttctat cattatccaa acaacttgcg aaaacatgtc     96060
     gaccatggat aaaatactac accattattt gtgattatat gattcagaga tctgagatga     96120
     ccttttggac atatttccaa tatagcggaa ttaattttga taagccaaat ggtctatact     96180
     ttctgagaaa agctttgtca attgctgacg atgcctcata ccaaatcata agagagaggc     96240
     tttacagtac cctaatagat aaactataca tcgatgagtc tgatgactat tatgccttat     96300
     ataacaccgt gctcggtaga gatttaggta ttaaattaga gtttaaaaaa atcagcggtg     96360
     aatctcatca gctagaactg gtgaagaggt tggtgcgcac tttggcgaaa ttacaaatgt     96420
     acccaaagat caatatctta gtacaacata ttatcagcgt ttttaacaaa aaattcatat     96480
     ctgagaattt tgcggttaac tttgttcaat ttatagatga gaattaccgt gactatttaa     96540
     tcgattatca agatttctcc atattgaagc gcctgttgtc tatgaacgat atcaagaatg     96600
     aaagactatt attcaaagaa agtttcagaa agtgcgaggg tcgtatgcaa cagatgttat     96660
     ttatccagaa gaatatacta agcattatac acaaattcgc taaagatgaa gcagatagcg     96720
     catctatgat cttgaaagat aagattgttc aactaatggt ctcacccatt ttagattgtg     96780
     aagttcattt tattcgactg atgattgaaa gtaatattat gccctctgac aatgtcgaga     96840
     tttattcttc aagtcagata tttatttcgt ttatgatgga tgtgctaaag ggctatcttg     96900
     actctattaa ttggataata gatagtgaca gcttccagga ttattatctg attgctttga     96960
     aacttatcat ggcttatcct gcatctttat gcctcgaggg taaatgcttc tttaagatac     97020
     tgactttcgt agacgtgctg ttaaataact attgcttggg cttggaggag tatagttttc     97080
     tctaccaacg taccatcaat gcaatagaca aaaatgccaa gccccagttc ttcgaagtgg     97140
     agatgacaaa cgaaatgtca aaattgctag catctatcaa gttcccaatc aatcgtcatg     97200
     aagatcatga gagaaacgac accacccggt taatatcaag attaaggaat tatacctgcc     97260
     aataaagaac ttttttggtc ctcttcattc aagttgtaaa taaattcacc cgcaatgtta     97320
     ctccgttcct aaaactccta gatatctatc aaatactagc atctctataa ttcatttgtc     97380
     cttatttgca ttgtccatcg gcaccaaatc agttgccatc ttagctatgc cttctgtgtt     97440
     ttccccacat ataaagcaag atttgtcaat tttgatccta tttacaaagc atttctgaca     97500
     gaagtaatgt ccacaattag ttttcacagg gcgttcatag gattctttac ataaaacaca     97560
     tttgaacggc accgcctctt ttctcgtctc ctccttctgt tcatcgatct tccaatcagt     97620
     ggccaaagtc cagcccgctt tgaaatcatc tcttgagtgc aaaaacttac aactatcgcc     97680
     ataaccacag taacccgtct gcttgaaatc cttacacaca tctggctgaa agtcagttag     97740
     aatagtatta cgtaggttcg ctgcttgttg tatcttcttg cttgatgcta ctggttcgga     97800
     gttcaacctg tcatgttttg tggcctgttc cttcagtctc ttaagccgta ccgctgtcgc     97860
     atctgcttca cctacagctt tttgatctag ttctggtctc gatgctattt cctcctctaa     97920
     cttggcaaca tgactcttat ccaatactgg cttcaccgcc accgcaggtt tctgtacagc     97980
     aggcttctgc accggagttt caaccttcac ccgctttcga gtcttactgg cagcactcct     98040
     cttcttaaac atcggatagt tctttcttgt ggacccaact tccacaaatt cactactatt     98100
     gcgatgagct catcgcaaaa ctcttaaaat ttcagttttt gatccaattt ttcacaaggg     98160
     tcggtgttaa tttagtaaat gcggtagagt gttgaagttg cataaaggaa tgcaatttaa     98220
     agggctaaag gaacagggct tgattgcatt gaggaaagcg ccaagtatac catgagtgat     98280
     aaggtagtgc gtgcaaagtt tgttgagagt gtgcagccgc ggctcggtgg agacaccacg     98340
     cgggttatcc tgaaggcgtt gcaccaaggg caagtgaagg aggttaagga tggtgaggat     98400
     gttgaggttg atgaggagca agaaggtaag agtggcatgg tggtgatgcc ctctccgctg     98460
     ttgagctcga cgccacctag cgtggtgcgg tccatggtgc gattgtatcc atacctgaag     98520
     ttaacagata aggctcttgg ggtactgacg tggagtgatt ttagcatatg gaatagcatt     98580
     gtgttagtac cggcttatct cctctttgtc ttatactatg aggtgtttgt ggcctacttg     98640
     ggtcatatga tagtgatatt ctgtgtactg ggccttatgt ggatttacaa ctttgtcgaa     98700
     tcacctcaag atgtaccaat tctggaagat atagtactta aaatgaatcg cgtgcagtac     98760
     aagtttgata aattcattga gccagtgatt acactaaagg aacaagatat aacgaaattg     98820
     ctgtacgtta gtatgctaat ctcgcctatt tacgtgctgc tggggtgcct gctcggtaac     98880
     gagttcattc ggtttaacat cgcaagcttt ggtgtgctta tattgacata ccattctcca     98940
     tggtgtaaga ctttgagaag actactgtgg aaattcaagt ttgtcagaac agtgatatat     99000
     agggtgatgg gtatacagac ttacgaagta caggagccca agatcaactt agacaagaaa     99060
     tacaaattta cgtatgtctt atatgagaac cagagaagat ggcttggaat tggatggaag     99120
     tcaagcatgc tgagttatga gagaacacct tggactgacg agttcttaaa tgaggccccc     99180
     aaaccatctg atttccaatt accaaacaaa gaatggaaat ggctcgatag tgaatggaag     99240
     cttgatctaa gcaatgatgg cgccattgag gtaccaggag agaggttttt aacgaatcca     99300
     aaggagaatg atggctatat atactatgac aatacttgga aaaacccaag catcgaggat     99360
     acattttcaa agtacactag aagaagaaga tggatacgaa ctgcagagct aattgagaaa     99420
     cttccaacag cagcaacaac gacggcaaca tcaacgtcaa caacaacacc atctgtaaaa     99480
     taatcattgc tagttggtat atgatttttc tgtatttgca tatatttgtc cctatttaga     99540
     tattcataac tccagaaatc ctaaagatat gagaatcaag aaaataccaa ccagtatctg     99600
     ggggcgtatt caattccgtt gtagagtcat catgagaaga atgctgtctt tgtagtatta     99660
     attaaaaaag taatgatatc aagctgttta tgatgtatta tatgtctggg tcctgcaaga     99720
     aagtataaac cacgtgatac aatcccccct taattttaca gtttgataaa tcatgtgaca     99780
     gtaaatcaat gccggccatg ccagcagttg aaaggtatat gcattataca atttgtatat     99840
     tattgcgggg attactagaa tcaggatgat agtccagcct tttaacagaa agttttgatt     99900
     aaattttgca gtcaggtata actttatagt tatacctgta ctgatgagtt gatgtcaata     99960
     aaatatgata ttaaaattat acaaggaaaa atgtatagta atgatgagat tcttataatt    100020
     tatccagaga atactagagg gcagagtggg aatccagtat taagaactat ccaactttgt    100080
     aaatcgtcca attccacatc acaccaaccc tattattatt caataggttc ggttgaatgc    100140
     gggagtacat tgaaacagaa ttttggggta caagtattgg aatagccgaa ctagatggcg    100200
     tcacgcatac ccactagtat tcttttaaag ccatgaccat ttttattctc atttttttat    100260
     gttgattcag tttgtcatat ggacggtttg tatggtaaaa taagttgtaa agtaaaattg    100320
     ttcattttat aaggtttgta ggaattgaaa aaatttgtga ttaatatttt ataaaaaaaa    100380
     tgcttaaatc tctattcttg tcgccttatt tacaacttgt taaccttcaa agttggtggc    100440
     aaagattgga tcaacttctt ggccttacca gcgtcgttga cggtcaaagt gtacaagtgt    100500
     ctggaaccac ggaccttgaa cttggtttgt ctgaattgct taccgttctt gttcaacttc    100560
     ttgttaatct taacagtagc ggattggaca tcgtttcttc tggtcaattc caagaattgc    100620
     ttgatatcag taacttctct ggccattttt gtatgtgatt ctttcgcgtg tagtttcgac    100680
     agaggtatct tgaaataaac tgtctaaaaa cacacacata gttatattat acctgcgctt    100740
     aagcgctatg ctaacaagta tagcccaatg gacaactggg taaaaaagtt tcagtgagga    100800
     atcctgagct tccagcagtc tccccgcgaa gcgagagctc atccacccag acaggaagag    100860
     aaggcagact ccactaacta cccaaccagg acgctagcct aggccacctt tgctagacag    100920
     aggcaacagc tggtctaggc agagggacga gaaactaggc agagggggat ggaggacttg    100980
     gccaaactgt ctgttcaccc acccgctggc ccccccacca agacggggaa cctcctgtcg    101040
     ataccagcgc aagcaagctg agataagaga atgtatgggt tttctagact gaaaatttcc    101100
     taattaggta aaaagattat ggtcttatgc atgcatccca gacaacctac ggaaaagcag    101160
     tcacaaaact aacaaagcat ttttagtggt gtttagaggg gaaagccggg taaatgtaag    101220
     tgaactggtg cacgtcagct gctcttctat ccgggtaacg tttctacttc caagtttttg    101280
     cttctttggg cgtggagtca taacggccac ggcagtgttt gctatggcct ggcccctccc    101340
     cctgactccc agcttgctgc tgttacgctc aactcgcata aactttggta tacacgcata    101400
     tatgggatgg tacgcgtcaa ctaattctat gtatttacca agggcagtga tttctgcttg    101460
     tagtcatggc acgatccggt aaggtcataa ggagtcaaat gtgtggggtt cacgaaaagg    101520
     ggatactcac ttacggtttt gtccctgaat cgacgtaagc atttataaag gacggagttt    101580
     tcgcacaaga caggccagaa ggattgtata ctactgtagg acacacgtaa atacaaaagt    101640
     aatgtctggg ctagtgagag actttatagt tgggtatgcg gaggatttcg cgaatgagta    101700
     cgcgcaggag aacttccagc cggtgattga cccgtactac gcgcgggtgg gtccgcagaa    101760
     gaagaaagtg cgccgggagc tgccagcgga gctgttcagc aagcaagagc gcaagcggtt    101820
     caaaactctg cagtctaagt cctggacaca cgaccggtcc atgtgcgggt gctgctgctg    101880
     gacggagtgc attggctggg cgcccgtgtt cagcatcatc cccgtggtgg ggccgatcat    101940
     catgtacatg atccacaact ccttggtcac gtacgccgag cgcaacctgt acaacaacag    102000
     gctgcccacg ggcctgaaga ccaagctgct cgcgaacatc acgttcgact tgtgcatcac    102060
     actggtgcct gtcctgggcg ccctgttctc ctggctgaac ggctgctcca cgagaaacac    102120
     agcccttata tacaacgatc tagtagagaa acgcatgaag caggtaccac agtatcagca    102180
     agctcaggct cagcaagctc aaactcagca agctcaagct cagcaagtac cacagtaccg    102240
     tacacaacag caagctccag ctcagcaagt accacagtat agaacgcaac agtatcggtg    102300
     aaaaaaaaaa ccggctcatc gcactaactc cggtttttat tttttgggcc tgcgtgcgtt    102360
     attgtatagt ctgtaacaaa tataactcgc gacggttctt tccgcaacga aaactgaaaa    102420
     attttgaaaa aaaaatttgg caaaaatgac gtcttccgtt tttatagggg tattgacaat    102480
     tttgttccta gaaggcggtg caggggagtg gggttgtgtg taatgcttat caatgggaga    102540
     ggaggggtct gatcatcgcc aggttctgtg gtggataagc accgtcagtg gcaggcgagc    102600
     tctggacagg agagcttgag agcttgagag cttgagagcc cgagaaactg acagctggag    102660
     agcaggagag cttgagagcg gttaatatat aatgagtcta tgcagcagcg gagctgctgc    102720
     tatagactct gtccccgcgc tctgcattgc actgacacta caagacaaaa aaaaatacaa    102780
     aaacatacaa acatggatcc tactagagac cctgacttca agccccggga ccctgacgcg    102840
     aagttgctgc cacctcctga cccaacctcg aagattccaa agtctgggcc cattacgccg    102900
     tatgtgctgg cggactacaa cgcgtctatc gacgctccgc tgcagatgaa gaagaacaca    102960
     actcacttgc cgcactcgca gggtaaccac cagcgcatac cgctgaacaa gagcgagttc    103020
     cagccgttgt cgaccactgg ctcctcagag gaggacttcg aattggacga cgaaaatatg    103080
     gacagcgaca gtggcagcaa gcgcgagagt ctcggccagc tgtcgggaca cggtatcggt    103140
     atcggtgtgc acaagaacca gattgccgac ttggaggaag tgccccacgg tattgtccgc    103200
     caggccaggt tcctcgagga ctacgaattc ccaacgcaca gactggctaa caggctgcag    103260
     gacccaaaca agatgcctct cgtcatagtg gcgtgcgggt cgttctctcc catcacttat    103320
     ctgcacctga gaatgtttga aatggcccta gacgccatct cagagatgac taggttcgag    103380
     gttgtgggtg gctattactc tcccgtaagt gacaattaca agaaacaagg attggcacca    103440
     tcgtatcacc gtgtcaggat gtgtgagctg gcctgtgaga gaacttcttc ctggctgatg    103500
     gtggatgctt gggaatctct ccagccaagc tatacaagga ccgcaaaagt cctagaccat    103560
     ttcaaccacg agatcaatgt caagcgagga ggtatcaccg tccatgagaa gaaacggaat    103620
     gccgacaaca gtggatacca catggaagaa cataagagag gtgtgaaaat tatgctgtta    103680
     gcaggtggtg atctgataga atctatgggc gaacctggtg tctgggcaga tgaggattta    103740
     catcatatcc tgggtaatta cggttgtttg attgtggaaa gaacagggtc tgatgttcgt    103800
     tctttcttat tgtcacatga tatcatgtat gagcacagaa ggaacgtcct tgttataaag    103860
     caactgattt acaatgatat ctcatctaca aaagtcaggc tgtttattag acgtaacatg    103920
     tccgtgcagt atttgttacc taactctgtg atcaggtata ttcaagagca caagctttac    103980
     atcaaccaat ccgaacctgt gaaacaagtt ttgagcggta aagagtaacg aaacgcaact    104040
     aacacaagaa acataaatgc catcttaacg aaattagcga tgacagaatg cagctaataa    104100
     gaactgcatt cgagccatca cttataaaat gaatgtacac taacgactta atgactcttt    104160
     acctcactca gctcaagaac taatattttt tgtaatttaa acagttgtaa acatacactc    104220
     tcgatgtttg aagaattatg gatagatagt aagagcgttt tcgaaccatt ttgtgtgcct    104280
     tcaactgcac tctcgcatta tgaaatttaa taattaataa cagctatcga ctatttttgt    104340
     tatcgatctc aataccttca gagttgtata caattaaaca ggcataaact tttctcctct    104400
     cagtcttttt ttttttttaa tttaaagagg acactaacat tcttaaaata tttttcatgc    104460
     tattgtctta gatcacaaat cactgagctc tagacaatat tgttctatgc taacaaagaa    104520
     aacaattttc agtagtacta atataatttt aaattaaacc aaagaaggtg atgcgctgtt    104580
     tgtaatttca acttagaagt agagccagtc actgaatagg ccaatgcgaa ataaaatatg    104640
     gtttaggaat gtattatttt cagatcttga agaaatcgta ccagttacaa aaatatgcat    104700
     ttcatcattt catttttttc ttttttacat agagttaaat tgtttatttg aaaggtatag    104760
     tgtgtactac ttacatatga tgtggtcttt ttccgctttt gtcttcctct ctatgtgcaa    104820
     gttaggccag tggccccccg cagagaaagc agtatattgc caacttactt ggttggtcca    104880
     accatgtttt caggaatgac ccattcgtcg aactcttctg aggtcaagta tttcaactcc    104940
     aaggcggact ctttcaaggt gatgttcttc ttgaaagcgt tctttgcgat cttggaggcg    105000
     gcgtcgtagc cgatctttgg gttcagagcg gtgaccagca tcaatgagtt gtgcaagttg    105060
     tggttgatct tctcgcggtt tgcctcgatg ccttcgacac agtggactct gaaggagtgg    105120
     caagcgtctg ccagcaatct gatggagctc aacaagtttg agatcatgac cggcttgaag    105180
     acgttcagtt cgaactgacc gttggcgccc gcgaaggtca cagctgcgtt gttacccatg    105240
     acctggacac agacctgggt catggcctcg ttctgtgttg ggttgacctt accaggcatg    105300
     atggaggaac ctggctcgtt ctctggcaag tgcagttcac cgtagccgca acgagggccg    105360
     gagcccaggt acctgatgtc ctgtgcgatc ttgaacagag agcaagccac ggtgttcagg    105420
     gcaccgctgg cctcgacgat cgcgtcgtga gctgcgagag cttcgaactt gttaggggcg    105480
     gttttgaagt cgatgcccgt ttccttggag atctgctcgg cgatcagctt gtcgaagccc    105540
     tccttcgtgt tcagccctgt gccgacagcg gtaccacctt gtgcgaggta cttcaggtgt    105600
     ggcagggtgt tctcgattct tgcgatgccg ttgacgagct gctggacgta gccgctgaat    105660
     tcctgtccga gggtcagcgg tgtggcgtcc tgcaggtgtg ttctgccgat cttgacgatg    105720
     tcctggaact cctcggcctt cttgtggagg gcgtccttca gctgggtgat ctccggcaag    105780
     agggagttgg tgatctccgt gaccgcggcg atgtgcatca ccgaggggaa agtgtcgttg    105840
     gaggactgcg cctgattgca gtggttgttt gggtggatct tcttggagcc gagctcgccg    105900
     ccgatcagct caatcgccct gttggagatg acctcgttgg cgttcatgtt agactgcgtg    105960
     cctgacccgg tctggaacac caccaagggg aagtggtcgt tgagcttgcc cttggcgacc    106020
     tcgtcagcgg cctgctggat gggccccgcg atctcgctgt ctagcgtccc gagcttctcg    106080
     ttgactatgg cggctgactt cttcagcaca ccgaacgccc tcacgatggg ctccggcatg    106140
     cgctcgcgcg cgccgccgat cttgaagttc tggaacgacc gctgcgtctg cgcgccccag    106200
     tacttgtccg cgggtacctt gatctcgccg aaagtgtccg tctctactct gtaatgcatc    106260
     atccgcgcgc tgtacccgat gagcgatgtc tttgccctac tgctagccct caacatttta    106320
     tctgcctttt ttttttgctt ttcgcttggt gctaagtagc cccagtagga agtgacaaga    106380
     caagagggaa gaacaagaca tcgcggctag gactagggta gggtatttat acttgcgagg    106440
     gggacgacta cgccgatttc tcggagtttg cacttccttc cccatccaac cccgtctctg    106500
     ctgtttctct gctgtctctc tgttctgtct gtactccctt ccaccaaaca acccctgaaa    106560
     ttctgactct tgacgcccat tggtccggag cgtttttcgg ctcgaaggag gagcccaaac    106620
     ttctccattt taccctcccc tcctgtgggt gtgtgggtgt ttctttttca gtggagatca    106680
     catgatgtac atgtacacgg tacatcacag ttatactttt acacgcatct gtcacatgtt    106740
     tttccagttt ttgcttcaat cacccatcga catcgcttgc gatgagcctt tatataagca    106800
     aacatacagc tacacatgta cagctacaca cacagagcta cccctaccaa accaatcaca    106860
     ccacaatggc aaagaagaag aaggacaagg aggcgaagaa ggcgcgtgcg gagcagaagc    106920
     tgaagaagaa ccaggcgaag gcggagtcga aggacaagaa gcgggccaag aagctcgacg    106980
     aggacgacga cgacatggac atcgaggaag tgctcgcgaa cttcaagaag gagcaggagc    107040
     agttcgagaa ggtggctgta gactcagtcg acaaagtgaa caagaggctg aacccatgca    107100
     tggtcggaaa cccctcggcg tcgagcagca agaaagagct tatagtgttc ggcggagagt    107160
     tcaccaaccc gcagacgtcc acgaccacgt tctacaacga cctgcacact ttcacgccgg    107220
     aaaacaacca gtggaagagg tacacgtccc agaacgcgcc catgccaagg tccagcgcgg    107280
     caatggccgc gcacccgagc ggtatagcgc tgctgcacgg gggtgagttc tcctcgccaa    107340
     aacagaacac tttctaccac tacagcgaca catggatcct ggactgtaac acaaaggaat    107400
     gggccaaggt agacgccaaa gtcgggccct ccgcaagatc aggacacaga atcacagtgt    107460
     ggaagaactt cttcatcctg cacggtgggt tcagagacct cggcaccagc acaacttact    107520
     tgagtgactg ctggctgttc gacatcacca cttataagtg gaagcaggtc gagttccctt    107580
     caaaccacca ggtcccagac gcaaggtccg gccactcgtt tatcccaacc gcagagggtg    107640
     ctatcctgtg gggtgggtac tgtaaagtaa aggccaacaa gaagggctac caaaagggta    107700
     agatcctctc tgactgctgg tacttgaaga tgaagagcga tatcagcggc ataagatggg    107760
     agcgcagacg gaaacaaggg ttccagcctt cgccaagagt cgggtgctca atggcttacc    107820
     acaagggtag aggtatcttg ttcggaggtg tctacgattt cgaagaaact gaagagagct    107880
     tggaatccaa tttcttcaac gacttgttct cctaccacat cgaaagtaac agatggtact    107940
     cgttgtctat tagatcgaga aagagtaata acaatgccgt ggctaagaag tccggtaaga    108000
     actcgaaaga acaggagaag gaattgaaga tgctgttgga ttctatcctg gagaaggcca    108060
     acttgcaaga caaatctgat gacgatgaag acgatgaaga gatcaacacc gcacttgcga    108120
     aggtcgatct ggaagacgaa gaagaagaac agttagcagt gcaacataca atcctcacac    108180
     aacttccaca tccaagattc aatgctacca ctactgttat agacgatact ttatttattt    108240
     ttggtggtat ttgggaactg ggtgacaaag agttcatgat tgactcctta tacagcatcg    108300
     acctgaataa attagatggt gtgactatgt attgggaaga tttgaaggaa attgaaagag    108360
     ctaaggaatt gggtgttgaa gattctgatt tcgaagatga tgatgaagat gacgatgatg    108420
     aagacgacga cgaagaagac gataacgaaa aggatgaagg tgatgatgaa gaaagcgaag    108480
     aagaagaaga agaagaaatt gaagaagaac ttgaataccc tgacccaaga ccttggttac    108540
     ctcatcctaa gccttttgaa actctaagag ctttctatat tcgtgaaggt gcggcattcc    108600
     tcgaatgggc catttctaat aataaaaatg ccaagggtaa gcatctgaaa aagcattcct    108660
     ttgatttatg tcaagaacgt tggtgggaaa gacgtgacca attgcgtatc gaggaggaca    108720
     aattggaaga aattggtggc gttggagata ttatcgagag agacaaatct gctagcagca    108780
     agagaagatg aatatagaaa ttttcgacca acaaaattta ttatttatta tgaaaatttc    108840
     tgataatcaa gcatcaccgg aattttgttt tttgaaatga ataaatagat attgtataat    108900
     agaagtgaat taaaaacatt actaatgaaa agaaataaaa tagaacaacg agaaacctag    108960
     agtaagaatt tataaatatt atagaatgag aaaatatcct gagatagctt attgctcctc    109020
     catgaaagac tcgaagcagt ccacgaaatt ctccatgttg tatccatctg gataatggat    109080
     gcagatattc aaaccatcct cctcacagtg ggtatatgaa agagacatta gtgtattttg    109140
     agagagactt gtagtgaatc ctgggctctt gatatgaggg aatctgatgt cgttgtcatc    109200
     gaaagatact tccgatacat cattaatctt tattagtcta gtgtttggcg caaacttctc    109260
     gtcatactta gtgaacttca ttctcttcat atcattatca ttgtaaccgt acttcttcca    109320
     agtactcatt ctttgctcaa tgctttcagt aacataagtg gcaatctgtt ggaactgtat    109380
     ttccagcagt ttttcgttgt actcaggatc actttcattt agacctggca cagagcattg    109440
     cttgtcatca atcatagaga gaggacactc tactctaatg tccttgtaga ccagaccaaa    109500
     atctctcttc tcgttcatcg agtctctcaa gttcatgggc attgagaaaa tcaaagtgcc    109560
     gttgaagctc ttaaccatag gcttcagaca cagcattgtg atggcggcaa taaaacttct    109620
     taggcatatc ttctcgttct tcacaaccga gttcaagtag ttgaatcttt cattggagac    109680
     ggaaccgaag atggtatgac cacagttaga agttgcagaa gtcagtatat tggtatatct    109740
     ggttctgaac agcttcaatt gattaccttc ttggctgata actgtggtgg agttatcaga    109800
     gttagagctg ctgttggtaa tgctcgtgat tggcatctgg atgaagtcca gaggcttctt    109860
     gacggcgtta caaaagatgg acttgaagaa ggactgggtc tgcaagttta gcagttctgg    109920
     gcgcgttgca ggcaagtgca gtttcaagtt gtcatagatg gactttggca ctgagtaatt    109980
     gttttcgaag gatttctgca acttaaacaa atactccaat ggcttctcgt agctctgctg    110040
     tggtctacac acagctatca gttccttcag aaacagttta tggaagttgg ccgcggagaa    110100
     tatgtcaaac aggatgtcct gacagtggaa caccagctgg gactcgtcga tcaggtacaa    110160
     gttccacaat ggcttgttgg agccgggctg gaagacatca ttcttcagga tgtggcggat    110220
     caagtaaggt ggtggaccgc cggagtggca gttgaccttc tcatccttct cgttatcgaa    110280
     ggtgaccaca gatatgacgt cgggtgttct tatctctttc aaaggagcga actcgagcaa    110340
     gtcgttcacg gtggtgtaca tctcggggtt cttctcaatg aggctcttca gggccctggt    110400
     aaccagcggc aaagtcaggg acagagcagg cttcttggtg gagcgagact ccactcttgt    110460
     ggcggctagg gtgtcgttgt cgtcatccca tatgtgctca tcggcggtga ctgagtcatc    110520
     gaatatgtaa ctggcaccga agacagtacc gttcttattg ttctctagta tctcagagag    110580
     caactttctc tcgtaactag acaaggacct agacatggtt tatgtgtgtg tgttggtgtg    110640
     cttgttggga tgtgggtgtg ggtgtacctt ctttcaggct ctacattaca accaattcga    110700
     ggatgtgtaa gacaagctta tatatgttgt gaagtaacag ttttcacata catgaaatca    110760
     aggctttgat atgatattcg tttagttgcc ccacccaatg agttaccata gccccgcccc    110820
     ctacccccgc aatcaatata ggcatttata agagggttat ttcaagaaga ggggtccaac    110880
     tacgaaccca aaatcgttta attatcgaaa acaagatcta agcaaacgta aatcgaaaga    110940
     caatgggcaa gatttcgttt aattattgca ggacaagacg tcattccagg agacaactcg    111000
     tataaacatg tcgtatacct ttcccaagtc caaagtccat gtagaagttc aaaggtcaaa    111060
     ggtcaaagtt caaaggtcaa gcccaaagtt caaggtacaa gcctgagaac ggggagtgag    111120
     cccaacacat ctgtatagct gcgtgataac cttccaccac ctcacaatac ctggaccacc    111180
     gacaacagct tatatatcct tcacatgcat tggcctgcac tctgggtgac acgtgatggg    111240
     ggagggtgcc tggctggtag tttggatcac gtgatacacc agccaatcat atctgatcaa    111300
     tagtttcacg tgactgaatt ccaccccccg gggaggactt cctgcgaaaa gctggtgccc    111360
     ccagacccct tccgaggtgt gttgaacgct cacatacatc aagcttgggt actttaggag    111420
     cgtatattta atggttgcat ggctctcggc taccagacaa taataataca aaacacaaga    111480
     tgtctgctgt tgcgaatgcc agtactgcct ggaggaaggc cgggctcagt tacagttcat    111540
     ttctggccat tgctgccaga accgtgcgtg agtcgttgaa gaaggagttg cagacgccag    111600
     ctgtgatggg cagaggcaag actgatgcag catacaccaa gtatgagaag ggctctccaa    111660
     agtccgaccc tatcccattg caggagtaaa tcactacaac aaactgagtc tatattcatc    111720
     tgcccctccc gcgagtgtaa ataaggaaaa accacatact taaatcatac tgaatatact    111780
     atataaaagg attttaatat catagcttca ttctatatca aacttctact ttcccccgca    111840
     cacacacaca cacatcaccg agctctttta tcactttgct catcgcgatt gcggaagaac    111900
     gactacatag cctactacta taagaggtct cttacctggc aacaactgtg ccccacaaaa    111960
     caattgaaat tggtacttgg ttgtacaggt tgccacagat tgccacagat aggggacaac    112020
     cgctgctgaa taggacatga agtactctgg aatagcggtg ctgaggggag tgcgagtgac    112080
     gcctctggcg ttgcccaggg ctgggagcag gtatctctcc ctgctcgcaa gaccgcccac    112140
     aagacagata attcataaca caggcgctgg ctatggcgtt tgggtgagtc ataaagtgct    112200
     gactagtagc actataagga ggccgttcac tgcgcaccga gcactgaaca atgaatataa    112260
     caccactgcc ggtaatgcca gtgtaaagtc ccaatctgct actaaggaga aaaacgagga    112320
     ggacagaaag tatagcaaga aggagaagga ggagcaatcc gagaccaagg agaatcactc    112380
     cgaatttagg gatatagtac gactgatgct actggtgaga cgagattgga agctgctgct    112440
     aactgccgtg ggtctactga caatctcatg ctctataggt atgacaatac ctaaagtcat    112500
     tggtcttatt ctagatcaat tgaagaacgc actggctgct aattccgtgg atggacagcc    112560
     ggtaagtata gataaactac cacccattgt gtttggcctc tcattttatg agttcctagg    112620
     cgggtttgca ttggcattac tggttggtat tgccgccaac tacggaagaa ttatcttgct    112680
     aagagtccta agtgaaagat tggttgctag attgagggct acagttatta aaaagacgat    112740
     acatcaagac gccgagttct ttgacaccca caaagtaggc gacttgatat ctagactagg    112800
     ttcagatgct tatgtggtat ctcgttcgat gactcaaaaa gtgtccgatg ggtttaaggc    112860
     tttaatatgt ggtagtgtgg gtattggtat gatgctggca ctatcacccc agctttcatg    112920
     cctactactt gttttcacac caccggtgat actgagtgca tctgtctttg gtaaacagat    112980
     tagcacaact tcgagggaat tacaagaagc caccggtcat ttgaccaaag ttgccgagga    113040
     gcaattatcg ggcataaaaa cagttcaatc atttgttgct gaacagagag aaataaacag    113100
     atacaacttt gcaatccgtg atatattcaa tattggtaag aaggctgctg ttataaatgc    113160
     aaaattcttt agttctacct ctgcaatggg tgatttgagt tttttaacgg tgcttggttt    113220
     tggatcttat cttgttttac aaaattccct gactattggt gaccttactg cttttatgat    113280
     gtataccgag tacacaggaa attcgatttt tggtctatct acgttttact cagagattat    113340
     gcaaggtgct ggtgcggctt caagattatt tgaattgact gatagagttc ccagcatatc    113400
     aaccactaaa ggtgtgaaat ataaacccgg caatggtgaa attgagttta aaaatgtttc    113460
     ctttgcttat ccaacaaggc catcaaatat gatattcaaa aacttgaatt tcaagattga    113520
     agctggatct aatgtctgca ttgtggggcc atctggacgt ggtaaatcta ctgtagcatt    113580
     gcttctagag aaatactata aaccatcatc tggtgaaatt ttaatcgatg gacaaaatat    113640
     caacgatctg aacagcaaat ctttgagaag acacattgga ctcgttcaac aagaaccaat    113700
     actgatgtca ggcacgatcc gtgataacat agtatatggt ctaactgaaa tgcctactaa    113760
     ggatgagatt agacaagtag ccaaacaatg cttttgtcac aatttcatta ccagattcca    113820
     gtcttcctac gatactgtaa ttggtcctca tggtacatta ctgagcggag gtcagaaaca    113880
     acgtattgct atagcgcgtg ctctgataaa aaaacccaga atactaatat tagatgaagc    113940
     tacgtctgca ttagatgttg aaagtgaggg tgcaattaat tacacatttg gccagttaat    114000
     gaaaaagaaa gaaatgacca tagtcagcat tgctcacaga ttgagtacta tccgtaggtc    114060
     agaaaatgtc attgtattgg ggcatgatgg tagtgtagtt gaaatgggta aattcaaaga    114120
     attatgggat gatcctacaa gtgaattatc gcaactgttg aatgaaaaat caactccaca    114180
     tcagacgact aatataactg taacaccacc acctacaaca atggcagaaa aggtagttga    114240
     agaagttgtc gagaatgctg aacctgaaac agtcatagaa gaccctggta gcccaccaat    114300
     gtacatcagt actgtatcag aagtatctgc agaaggccat gagttgataa atgagcagat    114360
     tgaagatact attgaaaatg taatgaagga tgttactagt gaacgcaagc cattaaagct    114420
     acaaaaagat gaaaacctct agaaggagtt cacataatta gtaccttatt gcttgcacta    114480
     acaatctttt attttgcaat acccaatttc attttattta tatatcatat atcctttttt    114540
     ttccatatcg attccataat aaagcattta atcaaagaat aattcatttc ccatatcaac    114600
     ttgttctgtt cgaatacatc cgataatctt tagtgctcat cgctatgatt ttcatcaaat    114660
     tcaaagggcg agaagtgaaa aagtcgaaga aaaaaaaagt aaacaaaaga gcaaagctca    114720
     tctcgactat aaactaccat gattagcgat tcatatcaat tgatatgctg atttgataag    114780
     agccgacgat aattctgaca attgaacgat gagcaaccat gagttgacgt tcaacaacga    114840
     tttgcagatg ctcctggaga cgcaactgcc ggaaatacat gacacaatat cgaaacttcg    114900
     aagtgtgcaa ttcatcaaag gtgatgatag cagtattgag gacctctgtg atgtgttgga    114960
     gtggattacg acgcaaatga atagaatact agaaattttt ccacagatta ttgactctac    115020
     ggggatcgag gtatccagtc ttttggagta ccttgattgg ttgcaagagc gcaaggagtt    115080
     attgtttgag cttgtaaatg atattaatag cataggaccc tttttatcag atatacttga    115140
     gggtattgaa gctaatttga acactgatcc aaataagtca ctggatgagc atgaaatgca    115200
     tttgatagac ctgatagagc gttgttccac cctgcgtgat gatcttgatc cctggctaaa    115260
     caaactgagg aaattgttgg atgcaacact tgagtttaag gaaatttcca atgatcacat    115320
     ggatgggtta gacaaagttg tttctgaaaa catacagtca tgtttcgata tacaagaaga    115380
     gcggttcacc tcacctgtac gacatgcacc ctcatttaca ttagagcaaa tagtggattt    115440
     actaaagcaa aactcagact cgaatgcaat ttcggtaccg acatttaaca agcaagagaa    115500
     gctgatatca gaaaggttct tggagttaag aagaagtgta ccagctattg aaaagagtct    115560
     aactgatatt ctacccaata gaattgacaa ttttgcaaga agagacatga caaacatcga    115620
     ttcattggca gaatttctta gagataagta caaagtattg atgaagaagt atgagttcat    115680
     gtcatctgag atatctgaac tgaatgctga gctgatagat aaacgatgga acattctttt    115740
     tgtaaacttg aatcatgaaa tcaatttcat tcttgatgac tatgaaaagt tgaaaaagaa    115800
     actgaattcc gtggaagaaa ttggcataaa cgttcagatt agagaaaaga tgagccatca    115860
     aatgactcaa aagtcgctaa ctatcgaaag aactttcaaa gttatcttca aagctcaaga    115920
     gttttcgttg ctagatgctg gcattgcttc gaaaacaaat gaaatgaaaa acagatggga    115980
     gaaggttaga gtagatgaca aacttctaag gagtgtaagt gtagatagtg gacctgagat    116040
     atcaagtgtg accaaggact ttgaatcact gacattgaaa aatggaagtt cacacggcgc    116100
     ttcaaataga agatctgttt cggaaggtac accatctgca agcaggcaat ttggtagtgt    116160
     gcttctgaaa aggatgcgta tcaagcctgt ctcaaacact aacaaggacc aattattgga    116220
     tgatccaaac cctttcttcg acaaaaaatc tcgaaatagt ggtaagttag tgctgaactc    116280
     cattccggct cttcctcaca ataaggatcc agttaccgag ccgaccaaaa tatcaaaacc    116340
     acaaacaatc tcaagttcta cgccggtgaa aacagcaaag tcacttgaag agctagaagg    116400
     tgaaaggatc atgtattata aaacccacgg cactaccaag ctgccgtctt tgatgaaaaa    116460
     ggcagaaagg actcaattca gtaagtacaa agaaactggg actattgcaa ctccacaacg    116520
     aacaccaaaa tcaatgaacg cttggggccc ctcgtcaaag agaggtaatg tattaagacc    116580
     acccacacca ctatcagcac tcataacccc tacatcttcc aggagacgtc ctttttgaaa    116640
     tttagttcat gctttataaa tagtagcaag gattcacatc tatggcatga agagttccta    116700
     attattctct ttgtaacaat actttaatac cttatatatc tgcacttgac tcatatacgt    116760
     agcggtgcac gacatactta tgtcagctta tttatgtgtc aaaaattagt ggcgatgagc    116820
     aagccaaaca tgatctgatc tgcaatctac tcgatgatcc gatacaaagc gcaggtaact    116880
     attcttggat gcatagatgc attgaatgta ccaattgatt atgcttttag tttgaggtag    116940
     cctgtatttt tgagttaagc attcaattat tatctgttat tgagaacaac acaacggtta    117000
     ttcattctac ctaaggtcta tgaaggtgag tgatggttca aaggaagtag tatgtcggga    117060
     gagaaagttg tcgagtgaat ctcgaaccag tagtgagtcc ttttcgtttt tacggcggag    117120
     caattcctcg agatctttgc tggatgatat cttgagttca tcaagtagca caagtgtgaa    117180
     aaagaatcta aagtctgtga agaagatggc tccatttctg aactataagg acctaggaga    117240
     aagtataggt gcgataactt acccgtactc gatggctcct tgggttccta accttttaga    117300
     agttgataac tctggaatca agctcgattc agatctggag agagtcatgg gagtgatgag    117360
     ggaaggtgtg gttttgaaga aagtgaccag gaaaaaacaa agagagtaca tgtttaaact    117420
     agagaagaat aagtatatta cgtggaaaga tggtctcaag aaacttaacc tagactcaat    117480
     caagagcata cggcccggtg aactcggaag caactacagg gaagagtata atgtcgatgc    117540
     aagttacagc aagtactggg taaccatcat ttacaaagtg tccaacaagt tgaaggcgct    117600
     ccatgtcatt gctagggatg agagcgacta taacgtattc tgttcgttgg tttttgggct    117660
     agtgaggacc aggagagagt tgatggagag tctggcggtt ccggaccacg acaagtttgc    117720
     cgacatacat tggaaccggg cgttatcacg caatcctgat gagaaagctg aggaggtgct    117780
     gggatttgaa gatgtacggc aaatgtgcca gcggttccac atatactgct ctgcgggata    117840
     ccttaggcga ttcttcgatg ctgcagatac caacaatagt gggacactga gttttgaaga    117900
     attccaagtg tttgtaaaat tattgaaagc acgcaaagag atcgatgatg tatggcaaga    117960
     agcggttggt ttacacgaag acaagctgac ttttgatact ttctacaagt ttctaaccga    118020
     gatccaacga gagaggatgg atgaagatga ggcacgacac ctgtacgagc ggtatgagac    118080
     tgctggtgga ggcatcaaca agcaagggtt tgagaagtac ctcactacct ccccgtacat    118140
     gctacccaac aatgaggact acagtaggcc tatgaaccag tattacatag cgtcctcgca    118200
     taacacatat ctcactggca agcaaatagg tggggcacca tcagtagagg ggtatataca    118260
     ggcattacag caagggtgtc gcagtgttga gattgatatg tgggacggcg agagcagtcc    118320
     cgttgtgtgc catggggtgc taacctctgc gttgccgctg agttccgtga cgcagatcat    118380
     tcgcaagtac gcgttcatca cctcgcctta cccgctgata atctccatgg aagtgcgatg    118440
     caacagcaag aaccagagga tcgcagcgag tatattcaag gacacatttg gggatttgct    118500
     atatacgtgc gaggaccgca gcgagctgcc ctcgcccttg gagctgcggc accgcatact    118560
     gttgaagatc aagaagacca agactgtcat tggcgactgc cacagcgaca agtctatgaa    118620
     tgtagtggtg tcgtcgtcgt cgtcttcgcg gtcatcctat gacgagagca ctgctatgac    118680
     aaagacgggc tcgcggattc ggcggctgag cttcagcaag cggcaggtag cgattgtgga    118740
     cgagctgtac gagctagcgg gcctccgggg cgtgaagttc cggaacttct ccctgccgga    118800
     gtccaagacg ctataccact gcttctcgct ggacgagcgg cggctcgaca agatgctcgg    118860
     ggacgcgcag gtagccgcgg cagtggacaa gcacaaccgc cggcacatga tgcgggtgta    118920
     cccgcacgcg ctgcggtacc gctcgaccaa cttcgaggac cccgtgcggt tctggcggct    118980
     gggcgtgcag atggtggcca cgaactggca gacgaacgac gtgggccacc agctcaacgt    119040
     ggcgatgttc cagctgaaca cgcggaacca gcagcagatg ccctctggct acgtgctgaa    119100
     accgggctgg cttgcgcgcc cgccgagcaa gcggaggcgc gagcgttgtg gtgcggtgct    119160
     gcgcgtcaca ttcgaagtga tcagcgcaca gttgctcccc aacctgtctg agagcacgga    119220
     gacgaagagc caggcggcta gtatcggtgc cgccgagacg gaggacccgt actacacgca    119280
     ggtcacatgc gagatgttca gctgtggcag cacagtggag aagagcagca agtgccacga    119340
     gaacgggttc agtcccgtgt ggcggagtgc gctgtcgcag gacgtgcggc gggatgagta    119400
     cccgttcgtg tttgtgcgcg ttgttgtgag gcggtgcgaa gaggttgttg ccacgacgtg    119460
     tgtgcgcgtg tgccagctgc gcgagggcta cagacacatc ccgctgtgca gccccgacgg    119520
     cgagcagtac gtgttttcca cgcttttcgt gcgctaccgc gtcaccgtgt aactcaccgt    119580
     gtaactcacc gtgtaagcgg actaccaaaa acacgaaaac cgagcagcga gagataaaga    119640
     aaaaggaact gcttaagctt ggtatataag ggaagggcgg tgctctcttg cagtgtagtt    119700
     cctgtctact cccagacgca ccaaaccaac atgagagtca ctaaagttag gtcacctgtg    119760
     aaggtatacg aggagagccg tgagacgagg cagcgggttc tgtctagcgt caaggccagg    119820
     ctggaactgc acgacgacaa agagaacatc acacagaaca tcacacagaa catcacaaaa    119880
     agtagcactc ttaacagtgc cacacacaac tgtacaaccg ccaatggctc gcccaagact    119940
     acaacacgta ggacgagcct gccgctgagg ccgcttgaca catcgaggca caaggggtac    120000
     ctgcacgacc tgcgaagaga cactgtgcgg gcactacagt aacttacata gcaaatgaca    120060
     tagttaatag catagctaaa tacacgaata cgtaacagaa aagcaaacga atacccaata    120120
     gacgcattta catctccgcc acacccctcc attgttttta tctcgagagg gcaccgaact    120180
     cctctgcacc ccattctgtg caggaaagca tagattgcat agagattgca tagagattgc    120240
     agaagagatt gcagaagaga ttgcagagag attgtagata tggcggtaga tatggcagta    120300
     gcctaagaga tcgggcattg tgccgaaatt ccacggggaa tttagtgggc aggttgccac    120360
     cgggcagctt ccactgctcc gagaccctga tcacagacgt ggagaataat ctgcgacaac    120420
     aaggtggaac ttccccacag atacgcctgc acgatcgtaa aaacgtaaac aaaagagata    120480
     agggtcctga taagataaga gataactgcg ggggggagga caccccctca caaacaaagg    120540
     gccaagagag agggagaggg agagagtcac acaatgccaa caacattcct cagagagact    120600
     cgcacagagg tatgtgcagt gcccttgaaa gatgcgactc cttcgcaaag agaaagttgg    120660
     agatgacctc ccaggatgag acagcggtat cgctgatgac gtagacagca tcgcggggag    120720
     gagggcatgg gggaagtctc agtactaagc aagagctaag agcagagcta agagcagagc    120780
     taagagcaga gcttagtaga gcttagtgga actgagtaga agtaagcagg agctaagtta    120840
     ggaaggagca gcactgacgg gagtgacggg agtgacgggg gaacgggaca gcgcggcgat    120900
     agttctccgg tttctgaccg gatagacgga gatgtcactt ttgtcttgca cctcgaggcc    120960
     aaccgaggat ccattgccga tctcgttact atataaggta acgcattgtc agcgacttac    121020
     tcccttccac caaccagtga cactgacaaa aaaaaaccat acaaccatga ctaccacgct    121080
     gtctgtacca cctgtgttct ctgagaacca ctcgatggtc tcgctgggcg cctctgactc    121140
     gcgcgggcac cacttgactg aacacactca ccatgaacac catgtgaacc acgttaacca    121200
     cgacaagaag gacggtctgg acatcaacga catggacaac ctgtccacgg tctcgtcccg    121260
     tctggaggac tctgagaagc aagacgacta catggacgat ggtaaggacg agcacaccag    121320
     actgcgcaag gacctgaagg cgcgccacat ctccatgatc gccatcggtg gctccatcgg    121380
     tacgggtctg ctgatcggta ctggtaactc attgtatacg gctggcccca tgtcgatgtt    121440
     tatcgcctac gccttcgttg gtgtgctggt gttcttcacc atggccgccc tgggagagat    121500
     ggcctcttac atcccactag atggtttcac cagttacgcc tccagatact gtgacccagc    121560
     tctgggtttc gccgtcggct acgcatactt gtgtaagtac ctgatcttgc ctccaaacca    121620
     attgaccgct gcagctctgg ttatccaata ctggctagac cgtgagcagg tcaaccctgg    121680
     tgtatggatc accatcttcc ttgttatcat cgtcgccatg aacttcatcg gtgtcaaatt    121740
     cttcggtgaa ttcgagttct ggctatccac tttcaaagtc atcgtcatga tcggtctgat    121800
     catcttgctg tttgtgatca tgcttggtgg tggcccaacc cacgaccgtt tgggtttcag    121860
     attctacgac catccaggtg ccttcaaacc atactcaaag tccatcgacg gctccaaggg    121920
     taagttcgtc gccttcgtcg ccgtgctagt ttacgccttg ttcgcctact tgggtattga    121980
     attgactggt atcgtcgccg cagaagcagc aaacccaaga aagtccattc caaaggccat    122040
     caaactaaca atgtaccgta tcatcgtctt ctatttggtc accatcttcc tgctaggtat    122100
     gtgtgtcgca tacgatgacc cattgctaaa gaaggccaag acctcaggta ctggtgctgc    122160
     tgcttctcca tacgttgtcg ctattatcaa ctccggtatc aaggccctac ctcacatctt    122220
     caacgcctgt gtgctaatgt ttgtcttcag tgcatgtaac tctgacttgt acgtcgcttc    122280
     cagaaccctt tacggtttgg caatcgacaa caaggctcca aagatattcg ccgtcaccaa    122340
     cagatggggt gtgccatact actcgcttct aatgagttcc tgcttctgtc tattggcata    122400
     catgagtgtc tcctccggtt ccgccaagat cttcaactac ttcgttaatg ttgtctccat    122460
     cttcggtcta ttaagttgga tcagtatctt gatcacctac ctttgcttct tcagagctgt    122520
     caaggcccaa aatgtcgaca gatccagatt cgcttaccgt gctccattcc aaccatacgg    122580
     ttcttacttc actctagctt tctgtatttt gattgccttc attaagaact tcaccgtctt    122640
     cttgaaccac cacttcgact acaagaattt catcactggt tacatcggta tcccagtgtt    122700
     cgtgatctct tacttcggct acaaattcgt taagaagact aagatctgga agccagagga    122760
     agtcgatcta tacactttca aggctgccat cgatgaagaa gaagaacaag gtaagatcgc    122820
     tgacgctgaa aggagagaaa gattgaagaa cagtaagact aagggatggg actggttcta    122880
     cgaaaaggtc cttggtaaca tcttctgatt tttcataaga caaagaaaaa cattgagaaa    122940
     aaaaccctca catcgtaact tatacgctca tttaacatta attggtttta tcttactatt    123000
     tttattttta cttccaggtt cggttgtttt tttattatat ttcctaatcc aaagaaccct    123060
     cgtttggcaa ttttatttta tcaccataca tgaggataga catgaccccc caaagcattg    123120
     ttttttattt tttttattat agcactttca ttttacaaaa atttcaaacg ttacgactta    123180
     attttttgag ttttattccc atagaagcca cggttactaa ttataatgac atctcatctc    123240
     ggtgagaaag atgtaacagc cgcaacacaa tcactcaact agaatagaca ttctaatacg    123300
     cgcacaaaag gaataagagg gatatcatat atgccaacaa atgacatatt tctgacatcc    123360
     ttatttttat tccatttgat tttaattatc acgacttgta gtagtacgag ggttacattg    123420
     tgtctatttt cgggtttagt acctagaaag acaatgagcg tgcaatccac ataaaggaat    123480
     tcttatttag ttccaggaaa gttgccaata aaccctacgt cgaagaactt ctgtttactt    123540
     ctagttaata tttaataata ttctgaatat aaaaatttcc cattatattt tcaacttttt    123600
     gttctacttt tcttttccct atttattttt aaaagttcta tttttacttt tgcccttgcg    123660
     gcctattaca aatgaaaaca aacatcatac aactcaatat ttcttattag aataaactga    123720
     ccgtaacgga tcaatgggcc ccaattcaag gaacgacgaa ttgcttatta gtgccgatgc    123780
     tctacttcag atgcctccca tgagtaaact ttgtaaaccc tcagaataac aagaaagacc    123840
     atacagtctt gtatgttctg gaaagctcaa gttcccggca tatttcattg tacttacgct    123900
     aggaatcgcc gagcggagaa ttctttgtgc ccatttatgt tttctacagc aaggggttag    123960
     aagtccaaat aatagatgcc gaatcttatt cccgaccatt cagagtttcg cctgctaaac    124020
     tgaatcccat tcactactat tacacattct acaaagtagc cccttttcac aagtcaaata    124080
     aggatttaga atgcaaaagg tgtcccaatt gcacgaattt ctaagactac caagcatcgt    124140
     tgcttatagc tctgaaggca ggttttggtt tgtccaataa tatcagctca attcagtttt    124200
     aacacatttc ttttttcctt tttcattctc atttctaatt tctaattttc aattttttga    124260
     gttttaattt tttcttccac agaataacaa ttgctagtat ggggaggaca ttgatcccca    124320
     ctctcatact gtaaattacc cctgcagaag aaccaatttt tgccactttt gggcattaca    124380
     gttgattgag gcccccccga ctctaacgat tatttctttt ggtcctgatg cacaggaatc    124440
     gtaccagctg gagaaagctt gtcgtaaatt ccctctatcc ataccttcaa gggaatattc    124500
     taggcacttt cgatttgccc ttctcccatc cattaatacc tgggaaaggg tcccttccac    124560
     ccccccatgg ggatttattt gccctccaga gtatggaaca attctatgct cttattcccc    124620
     attgttcaac acaaggccgt aggcaagctt ctgtgtatat caagaaacta aaaaagcaat    124680
     tttttcgaaa gacacaatag gaatactact tgacatagaa atactggtat ggccagtgtg    124740
     agcctggggt taatctgtaa tatgcggtca aatctggaag tacacttcct atcgtctgta    124800
     gtaaatcgga tgccagagtc ttgtcgtact ggtgaaacga ggctaacctt tgagcaacct    124860
     ctctgggata acaagaagtt agcggacact gttcttatct aaccattggg ctaaagagga    124920
     ggtaacaaaa ggtagtggaa ttctccataa aaatagctga aataaaaaca attgaaatga    124980
     aataattgta aaaaaaagaa aaagaaaaag cccttgctgc ttatagtact cattgagaat    125040
     aaggtattac atcacccata tcaaacaata gtaggctgta ggaaacaaaa cgtcctgggc    125100
     aagacggaaa tcaagtaata aagaaaaatg gtgttatttc ggaatcttct atatttgtac    125160
     cgcttttggc aatacaacag caaagaagtg gaagagaccc tctagatcat gtgtagaaga    125220
     aggacaacga gatcccagca ggttattttt aattgtcaaa aggtatattc acgggttttc    125280
     cttttactat gtgcttcttt ttatcaattg atccaaaact aaattctgtg ggaaactatg    125340
     attttttttt gcccttagat tgcactgtat gaacattcat gttcattgta attaagttca    125400
     catgggtccc cttcagcaag tccttctgta agcaattgtc catttcattt cattacaata    125460
     atctattgta acagtaaggg attagaaaac tcagtagact gatgtccggg atgctgatgc    125520
     ccttctaaag tattttccca ctatagccgg atcaaggaca ttgaaaggat ttgcttattt    125580
     cagtttgatt caatgagaag aaaaaaaaat cttgcaagat atcaaagccc atttttgcag    125640
     tctttatttt cctataaata ctagacataa atgcaagata atcactccct tccgctcgag    125700
     caatttcaat taatcttgta ttttgctgta acagcattag atatcgaaga aaacaacaac    125760
     attatccaat tagtcaaata tggactctga tttggaaatt caaaacaaga cacaggtcga    125820
     acatgtcgac aagatggggg actcagatgt tcctgaatct gtttccaaca gcgctaacat    125880
     gctgaggtca agattcaata ttggcccaga ctctgttaga aaccacgtga tcgcatttat    125940
     gggtgagtta tgcggtactt tcatgttctt gtggtgtgcc tatgttattg ctaacattgc    126000
     taaccatgat gtctctttaa aggacagtcc accacatggt tctcacccag gtcaattgat    126060
     catgattgcc ttgggtttcg gtttttccgt tatgttttct atttggtgtt tcgtcggtgt    126120
     ctccggtggt gcacttaacc cagctgtctc tctatcctta gccttggcca gagctatcac    126180
     cccaaccaga tgtgttgtca tgtggattgc tcaaatactt ggtggtatgg ctgctggtgg    126240
     tgctgcttct gctatgactc caggtccagt caagttcgac aacggtctag ggctaggctg    126300
     ttctagaacc agaggtttgt ttttggaaat gttcggtacc gctattctat gtctaactgt    126360
     cttaatgact gccgttgaaa agggtgaatc taactttatg tgtgctcttc caattggtat    126420
     ttctctattt atcggccatc ttgccctaac cgcctacact ggtaccggtg tcaacccagc    126480
     tagatctttt ggtgctgctc tagctaagag atatttccca cactaccact ggatctactg    126540
     gattggtcca ttattgggtg ctatcttggc ttggtttgtc tggcaagttc tacaatggct    126600
     agactacgct aactatgttg ccagagagaa ggaggccgct gaaaaggcca agacccatta    126660
     aataatagag tatctctact gcagcaacca aattctaact atttaattct tagaaatttt    126720
     caaactacaa gtcgctacac tattgcattg caatttttat cataaattgt ttcaagtaac    126780
     agcacagcgc aatgcaatct attcagttcg cacagcattt cattacataa cttttaccta    126840
     ataatttctc taattctaat tcacatatac ttctcgttat ttagcgcaat ttcaaaaata    126900
     gacatttgaa ctttaatgtg gttctttttc attttagtat attcttctat tgtctataaa    126960
     ttaggaattg aaagtattga aaatcatgta taccagattc aaggtatata tactaattac    127020
     tactcaaaag aaggtattaa tttagggaga aagctattat cattaattga ctactataca    127080
     taattaatta cagtttgtct caactcgaag acgtttagca gcctttgaga ctttgagtgt    127140
     atcttgtatc agtttgtaaa tagaagctcc cagaatttta ggtacaatta tcaaggttta    127200
     acaacaaaaa aaaaaagaaa tagtaataaa agttttctca agaacttaac aatcaatgca    127260
     aaattagagt attttaagga acagatcata aaaaaagtgt ctgattttat gaacaatttt    127320
     aatcagcaca tatcaatagt tagtggaatg ggagctcaca atggtaagaa taataaaaaa    127380
     tagaacagta ggtacattcg aagattgttt tttgcatcta acaaagagca atcggcaaga    127440
     aaaacgtagt tgacctttta agaatagtaa gacggatatg gagaagcgta atgcctgagg    127500
     agcaattatt tgtcaaaggc cttctcgtta atttcggagt tcttgacgga gatagtggac    127560
     aattcactct cgtcgtcggt ttgaataccc attgtagaca agtcatagcc ggtggatgcc    127620
     aagtattcca tgaacttatc gtcttccctc ttcatggcgt cctggtccaa gtcaggcaag    127680
     aacaagaatg ctagcagagc ggagaaacag caaagggcag aagagacgta gtaagggctg    127740
     cttaggccgt ggttcttgat cagtgatggg aaaacgtatg taccaacgaa ggcgcctact    127800
     ttaccgatca ttgcggcgac accatataga gtggctctta ctggtgtggc gttaaccttt    127860
     gaagcgacga cacccatgtt gttaccggca gacagttcac cgagtgtgat gaagacaccg    127920
     tacatgaaca cgaagccgac gatatgtctc tttaagtggt ctagggagcc ggcgagggcg    127980
     aaaccgatgg ctgcctggac aattagaccc acggagatca ctagacgtgg gccgaagtag    128040
     tcagagagca aagcaccgac gattgagcct ggcatataga acaagttaaa cacgacgttc    128100
     cagccgaagt tcttgtacaa aggtgcgtcc tttggcagca ctaggccgat gataatggaa    128160
     gagtaggtac cgaaagcgta agaggagaag tcatagagga accagatgat ggatacgatt    128220
     gccactctga accagtagaa cttgatgatt ctccagacgg gcacttttct gttaaacctt    128280
     gtttcgcgga acttcttgcc ctctttgtag aacagtctta gcacgaacag agagcaaggc    128340
     gggatggcac ctaggccgat ggtgattctc cagactgggg tcaagtggtg ggagccgcag    128400
     atccacagga gcaccagagg gacgaatgct ccgatgacga agccgaagtc gatcatagtg    128460
     ttggtgaacc agatgaagta tctgttacgc ttaccgcggg gcagcaagtt cgaggcctct    128520
     gcggcggcgg gggagctact ggagtactca ctaccgatgg cgatacccag gaagaatctg    128580
     taagcggtca gcgctgcgaa gaggccaccg gcgtgggtgt tcgtggtgcc tttaccccat    128640
     gcaccagcgc acaggatggt gaacaggatc agcatggatg taccgagcag cattgagaac    128700
     ttacgggagt ggtggtctgc caaatagccg aagatcagca taccgcacac ggtaccggcg    128760
     aagacaattg atgagatgtt tctgatggcg tgtgactcgg agtattcctt cccgtatagc    128820
     agcgataggc atgtggagac cgtactgatg gagttgttga tgtacccgtc ggagaacagc    128880
     cctgcacccg tggtgataat gggccagtac ttctggaagc ccttcttgtg ctcagtgctg    128940
     tcattgtcgt tgtcattgtc attgtcgtgg ttgtcatcgt tggccttact ggcaccgatc    129000
     gggtatatct cgtgcttgtg tctgccgcag atggcgtact tccactcgct ggcagaagtg    129060
     gggatatctc tcagtacagg gtttctaaga tgcttggaca tttgtgctta tctacatttg    129120
     ttataagata ttgtgttgtt acaattgggg ggatagccct ttttatatac ttttctaaag    129180
     aattttctgg aacacgttcc cggaagcaca tgtcatgcta ttgcatatcc agaaattgca    129240
     aacacaagtt gcagttgcac ttgccaacaa attgcacaag cacttgcaca tccacaaatg    129300
     gcacaagttg cactagcagt tgcactagca gttgcaaaca caagttgcaa acacaagttg    129360
     cactagcagt tgctgttgca gttgctgttg cacaagttgc aactcgagat gactcgaagt    129420
     acgtcatttt tcttgtgagt cgagtcgagt cttatcttta tggaaaggaa ggatgcgtgg    129480
     gggggggatc catgtgggtt ttatatgaaa gataagacac atgtggctga agttatataa    129540
     gcacgagggg gaggggggcg tgggggggtg tcgcacgagg ggttgatcct acacgtggat    129600
     gatattatca caggtgtagt tacatctcat gtgttgtatg ttctaccacg aggattgtac    129660
     aaaaagggat aaacataaca agacaagtta agacaagcaa gtattacaag tattacaaga    129720
     catagacaag acattattat acgtattata cgttatagta tagtatacta ctagtacagt    129780
     gctacgtaca gcaacaatac gtcatttcat ttgctggttc tcgagggact ccgactcttt    129840
     ttgccgttct gaagatgaag gggctattct ggtttggtcg ctgactccct ttgtaactgc    129900
     tggattctta ctgcagcggt gattattccg gttttcccgt tttcccgttt tcctggtttt    129960
     tccgtttttc cgttttcctg gtttgttccg ttttcctggt ttgtttgttc cttcgttcct    130020
     tcccccgttc gtccgcgtct ctcatatccc acgtcttccg gaggtttttc tctacggttg    130080
     tacaggaggt cctctcgcgc acaggtggta ccccttcctt gcagctcgga tttactcttt    130140
     tgggacagct gttgtcccga cggagcttgc ctggtgcctg tccctgtgct tgctgttcta    130200
     aggccccccc tccagatctc taatgtcttt acttattcac ccctctccac gcgggtttgt    130260
     ctgtttcttc gagcctgcta ttgggtaaga cactcttgtg atgtggctgt gtgcagcctt    130320
     ttcttaccgc gggattgtgt cattggttgt ttgtatttac gcactaaaaa aagattttgc    130380
     gtaaatactt gcgcggcctc tctggttctc tggttctctg gctctagctc tttctgcatt    130440
     cccacctcat gaactcagac cctcccccca gtggactagt gctaattaga aaaacaatct    130500
     acagacaagc aggacaatgg aaaatctgga caaaatatga ctaactctac gggagggatg    130560
     caaggatgca gggaacaatg cgtagatttg tcaatccctt tcctcgaact gatcctcacc    130620
     cacttcacta caagacaact caacatattt tgactttcta aattaatagc aatcaaaact    130680
     ttaaaaacta catctacaaa tcagatgtgc actgcaacac tagaacactg aaacactgca    130740
     acactgcaac actgcaacac tgcaacactg caacactgca acatgcctac ttccctaacg    130800
     ccccacatct ggaaccactc cgtcattctc cagctctggg aaatgcgctg catgggtgat    130860
     cttttaatta atatgtgtgc gtgcgggtga aaatgctatc tttagctata cgctattgca    130920
     tccctcttaa tgatacgcaa ttgcaaccgc aaccacaacc acaatcacaa tcacaaacat    130980
     aattgcatta atcaaggcaa cgttttttct tacaactcgt aagataaccc tctaattgtg    131040
     ggaccttctt cgctcatgct cgtttgcaag acacctccaa aggcaagtat tacattatga    131100
     tgcccaacaa gagctgatat catacaactg ttcaaaagta acctttcccc cctcccccct    131160
     ccaactgaac tctcctggct ccttgagaaa catataaata gaattgccac tatgcccatc    131220
     cattgttttc aaaatacttc attatatcag atgctagtcc ataatcggat ttgcaaataa    131280
     cacatcagca attgatataa tacaaatacg catatcaaag caatagataa aatacaacta    131340
     acaaaattta atacacggag aatgaacgag aagatctttc ggtatctgac tctgttattc    131400
     ctgttcgaac tggccagttc actgccagtg gaggataaac tgaatattaa aaaagtgttc    131460
     gagaagaggg ccgtggactt cacaccgttt gcccactacc caagacccga aggttgctca    131520
     agtccaccaa actcagtaag cgtgggtttg cacatgaacc tttacaacta cccttacctg    131580
     tacgtgaaac cttcaacaaa aggaatgttc actaatgata caaacagcga ctccgacggc    131640
     gagactgatg gcgattctgc gggcggaatt gaaggaaggg ccggtcaatg ttggaaccca    131700
     gagtaccagg accccaactt cccacgtttc gggtacaaac aatacggtga atttggcgct    131760
     agtgataacg tcaatggtga tatatcatgg gaccacaatg agttcacaga gggttgtaag    131820
     cccgtgctgg cagctttgcc tccaggctat aactatcccg acgagataac gttctcaaac    131880
     ttcactatgg ttttgtccgg ctacttcaag ccaaagacct ctggtgtcta taagttcgag    131940
     ttgaaagcag atgactttat tctgtttaac ttcggggcta agaatgcttt tgaatgttgt    132000
     aacagagaag agtccattga taacttcggt ccttacgtcg cctatgccat gtggcctaat    132060
     caagccgacc aagaattgga agtgtacttg ttcgaagatt catactatcc attgagattg    132120
     ttctacaaca acagagacta ccactctaaa ttcaagatcg gcttctaccc accgggacag    132180
     accacgatca ctttcgactt cgacggttac ctattcatgt tagatgatac cggcaatgaa    132240
     tgtagggact cgattagata cagaactgtc tgtgacgata aggtcgtaga tgacactact    132300
     tacagcaccc ggtacagtac aagtatggtt cctggtggtg gttcagatgt aataaccatc    132360
     tattatatca ggatgaagtg tgaagaggaa gattgtcttg gtcaatggga tccaatcaat    132420
     aacgtctgct attctccaga tgattgtgcc gatgacggcg ggtactggaa tggtcaaatg    132480
     tgtgaccaaa gttgtaagct agagggaggt atagttaatc ccgatactgg agattgtgac    132540
     aaatcttgta tcgaatccgg cggtttcttg gatgaaaatg gcaactgtga tacaacctgt    132600
     agagacgatg gcggtatgct agtcgaaggg cagtgtgatt atcagtgtaa ggaagcaggt    132660
     ggtattctag taggagacca ctgtgacact acatgtgttg actctggtgg taaactcaac    132720
     gaagatggta cgtgtgacca tagctgtaga gaccaaggag gtcaactgga cgagagcggc    132780
     gaatgtgaca ctagttgtaa ggacagtggc ggtatgttga ttgaaggcga atgtgatacc    132840
     agctgtaaag acgaaggtgg tcagttggac gaaaataatg aatgtattaa ccactgcaaa    132900
     gatcagggtg gtattataga cgagaatggc aactgtgata cgagctgtaa agattctggc    132960
     ggtaagttag atgaaaacgg cgcgtgtgac actagttgca gagatgaggg cggtattatt    133020
     gatgagaatg gcaactgtaa taccacatgc agagatgatg gtggtatact agttggtgat    133080
     cactgtgaca ccagttgtag agatgcggga ggaattctag aagatggtat atgtaactct    133140
     acctgtcgtg actctggtgg taaactcaac gacgatggta cgtgtgacta tagttgtagg    133200
     gaccaaggag gtcaactgga tgagaacggt gattgtgact atagttgtaa aaatggcggt    133260
     ggtaagttgg atgaagacgg taattgtgat atgtcctgta aagagaacgg cggtcagttg    133320
     gatgaggatg gtgattgtga cttgagctgt aaagaagatg gtggtaagtt agatggtaac    133380
     ggtgattgtg attatagttg caaagaagaa ggaggtatca tagatgaaag tggtaactgt    133440
     aacaccacgt gtaaagattc gggcggtcaa attatcgacg gcgagtgtaa ttatggatgc    133500
     atagaagttg gtggtgttgt tattgatgga gagtgtgaca ctagctgtgt tgattctggt    133560
     ggcatcttag atggagacgg taattgcgac cgtagctgta ttgaatcagg aggcgttcta    133620
     gaagatggtg catgtaacac tacctgtcgt gactctggtg gtaaactaaa cgttgatggt    133680
     acgtgtgata ccagttgtag agacgatggt ggtatgctag tcgaagggca gtgtgattat    133740
     cagtgtaaag aggcaggtgg tatactggag gatggtgagt gtgttttccc tcctacatcg    133800
     tcttccacct ctgaaacatc ctcgacaacc gatcagtctt cttcgcagtc tgatgatagt    133860
     agtgtggaaa gttcatccac cccgatggat agttccacca ttgagagctc atcctctgag    133920
     atcataacat ccgaatctga aagtgaaagt gtgcctattg ctagttcatc atctgaggtt    133980
     atgacctctg aatcagaaag tgagagtata cccattttaa cttcatcttc tgaaatacct    134040
     attgcaagtt catcttcgga aataataata cctgaatcag agagtgagag tgtacctgtt    134100
     gcaagttcat cttcggaaat acctgttgca agttcatctt cggaaataat aatacctgaa    134160
     tcagagagtg agagtgtacc tattgcaagt tcatcttcgg aaatacctgt tgcaagttca    134220
     tcttcggaaa taataatacc tgaatcagag agtgagagta taccgattga aagtacatct    134280
     tctgaggctg tatctagtag atcagagagt gatagttcat atccaacttc aacccctaca    134340
     actactacaa gtactacatg gccaaatcca attcaaccca caactagtaa ctcatctcca    134400
     attgtgtcaa gcagtacaga aactcctgga atagcagaat ctagctcaag aattagtgat    134460
     ttagaatctt caagaagaac atcaatctta ggtgacgacc gtaccagaac tagaacaact    134520
     attacatcca cgattacaga agatggtcaa ataataacca taactacaac agttaccgga    134580
     tttgttcccg aaccaacagg agaaactgaa ggtaatgggt ctgatgatga gaatctcgag    134640
     aacccaattg aaaacaatac ggacgaaaat gaattcgtag atccagaatt tactgacgat    134700
     attccagatg atccggctgg tcctgaagat aatggcaatg gtccagtgaa ccctgaacaa    134760
     ggtaatgata acgatccagt aaaccttgaa gatagtggta acaatggcgc agtaaaccct    134820
     gaacaagccc cagtgaacga tgaagataat ggtggtaatg acccagtaaa ccctgaacag    134880
     gacaacaata atggtccagc taatcctgga caagataaca ccaatggctc tagtaactct    134940
     gatcaaatcg acaacaatcc acctactcct gaggaaaatg ccggtgatgg caattccaac    135000
     ggtaacgatc cagcagaccc ctccagaaga acctctatcc taggtgatga acgtacaaga    135060
     gcgtcaccag gaggtacctc ccagcctact ggtgctaatg gcaacgtcaa tggtaacagt    135120
     ccaggcgcca atgtcaacgg aggtggtaca ggaaactcca acaacaataa taacaataac    135180
     aataacaata acaataacaa taacaatggt aatgcaccaa atggaggtga tggaagtaat    135240
     ggagatgcca accaaggccc ttccagaaga acctcacttc tcggtgatga gcgtacaaga    135300
     gcaggccaag cggcccctac tggaggatcc tcgccaaaca acggtgttgc gggagatacg    135360
     agcaacaatg gaggagcgat tgtgtcgcag caagtggatg acggtggagc aggctctcct    135420
     agaagaacgt cgatattggg cgacgtgaga tcaagaacaa cgctgaatgg agaggttttg    135480
     aacttcgagg gcagtggtgt gagacgggca gttgctggca acctagccct gccactgatg    135540
     atggttggcc tggtattcaa cttgtgaacc ctttggcagt tgacaagatg tctacgtttt    135600
     gccaatgtgg ttgatttttc tttccctcat tataaacatg tttaatgcac tttttgtttg    135660
     taatttcaat aagtatgttt ccgttttaaa taagcaataa aaaagaatac tcagtatctg    135720
     taaaacatga aatggtggtg aagcccagct atatactact atatactgtt tagtggcacc    135780
     gaatatgtgc cgatgcttgc agatgagagc tacccgggta tgcatcagcg agaacatgtg    135840
     ccctcgaacg attacaccac cctgcaaagc acaccgcccc ggcatagcag gctttccccc    135900
     gaaaacgtcg cagtgaacag gacatcggcg cccgatccta tagcaatagt cccaccagcg    135960
     gacaccccag gtgtatatat cggcggttac gcgttcacag gcagcaggtg cagccacttc    136020
     ctcgtgtacg ttagcagcag caagcctttg agatcataca gcgcgcaagt aggccaggta    136080
     aacacgagag aatcaggttc ctgaatatag tccatcacgg gagcagcttc agagcacttg    136140
     ataagcagta caggaattct ggtaattgtg gtaattgtgg tagtacgata taataccaac    136200
     agctgagagt tgagaacgga gtccgaattc gagtcaggag aagcaagctt aagtactgga    136260
     gatggctacg aaacaagagg agcaggcgaa cttgagcgac gtgctgacgc ctagcatgag    136320
     tctgacggag ctggaaatga agtttgcaga tgagacggac ggtaaggcta aggatgttgt    136380
     tcaggcgcgt atcaagaagg ctgaagacgg catccttcct ctgagactcc aattcaacga    136440
     cttcacacag ataatgtcaa gtctcgatga ggagaggtac gccaacgtca gcaagcagga    136500
     gaagttccaa atgataaggt cgaaggtgtt ggggctcaca gagagactgc aggaattgtc    136560
     gaacgacttt gaagaactgc agccactgtt tgctacagtc ggtgaatact cgaagacata    136620
     caagaacaag aacttccagg tgctggagaa cctggcgtca tataatcaca gggggaaagc    136680
     tggtgcttcg atctccaaca gcacgcctac accagcagca gccacaccga caacggcccc    136740
     aactcccggg gctggcacga agaaggcagc gaagacagca cccacaccaa cggcgacggc    136800
     tactatcggt acgccgagca acaatgctcc gacaccagcc accacagcta cgacgccagg    136860
     aacacaagcg aagaaacccc gcaagcccag gcagacgaag aaacagcaac aggctgcggc    136920
     tgcggctgcg gccgttgctc aagcacaggc ccaggcccag gctcaagctc aaaatcagaa    136980
     ccagaacaat atgcagaaca aaaatataag caatcctggc atgaactcga atatgggtac    137040
     tccagtaatg ggcaacccga acatgaaaca aatgcaaagt cctattccag cgaatgctat    137100
     gaacaacatg aatgtaccgc acaatggggc aatgcggccc agtgtgccaa atggtaatat    137160
     gggcaatcca agtatgggta atctaaatat gaatgcccca aatatgggta atccgaacat    137220
     gaacaatcca aacatgaaca accctaatgc aatgatgtcc cccatggccg gtcaaggcca    137280
     gctaaatcag atgttcccaa tgcagaacca caaccagaac ggtcatttca tgggccagca    137340
     atcgccgggt cccaacattg gccaaatgca attcccacca aataatggaa atatgaacgg    137400
     catgcccggt acctccgaca tgaacctcgg catgaaccct tccatgaata tgaacatggg    137460
     tatgaacatg aaccagatca cacctgccaa tatcttgagc atgaacacga aggggaaaga    137520
     cgaccagatg cagaacattg gaatggacca gaaccagaac cagaaccaga accagaacca    137580
     gaaccagagc atgaacatga acatgaacaa cgacagcaat aaccccaaga gtgcatacga    137640
     tctcgtggac ttcaactccc tcgacctctc cagcctgaac atggacttct tgtaatgttt    137700
     tcaagaatgc aaggaaaggg gaaatgaggc gatgcatgca agggagatct acgtgtccaa    137760
     aaaggcaccg aagttttcca tccatcggga gcaacagttg gcttgcgcgg gaatagtcac    137820
     atgtacaact gtcactctct gtaatataac aagtaaagaa tcacatccca ttgttatgaa    137880
     atgggtaata tacacttcac gacgctgaac gatggtatga tcaaaatttg tagccaaggc    137940
     acaatacttt tgcaaagatt taccacagta cttgctatat gaacgggcat ggttttaggc    138000
     atcacagtat ggatgatgat aagatatgac atgaaatgat atgttatgat agggtaacga    138060
     taagatgaga taagaaaaga taggaatgat aagaaaagat aggaatgata agaaaagata    138120
     agctaggata agcaaagtat tgtagtcgta caataaatta agtatattat cgaggagcaa    138180
     aagaactgtc ggctagtggc aaaatgaatc tattcagtag ctttcatagt tgcatatttt    138240
     ttaccaaaag gatatgcgaa attgccaatt ttacggtaat gtggaaaaca cgattgaatt    138300
     tattatccct tgtcccagca ttataataga gtgtcaagta caccattcca taataattca    138360
     caataatgta gaacggcagt tcatcatgaa ttcatcccgc cctttgaagt gaatgattgg    138420
     ctccagagta attgaagcct attctgactt ggcatagaga gccaagttac atgagttgga    138480
     tagtaccata gttatagcat ttcttgcgat acaggtaccc aaactgggga tgatgattat    138540
     ttagtagcag ttgtgatgat taaagagggt ttgaatataa taaatatatc gtgagggatg    138600
     tgactgccat ctacactgta agcctttaca atggaaaata cgtcattaga ggttcatgaa    138660
     ggcaatcctt tggattcctc gagggtccct gaaatggttg ccattccaac atacgtgccc    138720
     atgttttgcc gttcttgtta tttttggaca gcccactaca atgcttaaaa gtcctcacaa    138780
     aatgatatgg gcacttgccc tgcactgtat tctctgccac gatttgccag tttttcctag    138840
     tttcctaaaa ttctttccgt tttggcagtt cgtccgtggt tttcttcccc tcatcccacg    138900
     tcctatttgt agactgacaa ggtgctgcag gggtttctca gtaagtaaac cccccttgtt    138960
     cttctagcaa cggatttacc aattagggtt tctggtgtga tgcctccatt tcaacttgcc    139020
     tgtgggagtc ttacgtgtgc aggccgctct gagacctaga ttcacatatg gctgcaaccc    139080
     cacgcgggtt ttgtgtggtt gtgcttatat ggctactggt tctaattggg taagtgttcc    139140
     atgcattgtg tgtgtgactc tcgtgcgggc ttttcttaca gaggcactag attaggcaaa    139200
     cttgcaatca gtcaatctat ttttaagatc ttctagcggg tctgcgtctc tgccttgggt    139260
     gactcggatg actgttgtcc taatatagcg caagtgagca atgcagtgag acagtgatgc    139320
     agtgatgcag tgatgcactg tcgtgattca gtggctatca cagcaagcaa tgctgtggtg    139380
     cagtgaacaa tctacagaga aactaagtga acaatctaca aagaaataaa gtgaacaact    139440
     ggtaggtatg gtagtctcgt tctcgaagtt ggtccattgc tcacccactt tgagacaaga    139500
     ctcaagaatc gcttcacaac ctataattat cacaacctat taatatcaaa aagcttaaat    139560
     acccaaaaag cttaaaatgc ccaaatagct taaaataccc aaaaattgaa agtatcgcaa    139620
     gaatttctgt agagttatta ttatacgcat catctcattc tcgatagtac gatcgctgct    139680
     gctagacctt gagctaactt gccgtttcca tgctttctag ttggtctgcg aaccctcata    139740
     tgtgtgggat gcttagtgcc aaatactcac acccagagat acctacttct ccatacacat    139800
     gcgttgagat actaatttct cattattcat gctttgagat gcatatttga tttgctctgc    139860
     agaaggcgat cttcattcaa atgtgggtga cttccaacct tgtttcaccc tctaagttag    139920
     tttatccaat agtacactac catcacagct atgtctgaaa tatccaaggg cagcatttct    139980
     tattccaccc tctaaattgt acacttttat tgccagtcct tctctagaca gcatgatatc    140040
     cttagacttt atgcatcaca ttatgaagtc actaagtgga tgaaatgcag aaagaataca    140100
     atttaaccct cttcaatgcg atcccaaaaa aacatataaa tacacccgct aatttgctct    140160
     ttttgtcttt tccaaatgct ctctttcatt gtatattatt ctatttccca tattacaaga    140220
     atacatcagt aattgatata attcgaaaca acatataata ctattcaaaa caccaaagca    140280
     acaagcagct tcatacaacg aataatgaac gagaagatct tttggtatct gactctgtta    140340
     ttcctattta acctggcaag ttcattgcca gtggaggata aactgagcat caagagagtg    140400
     ttccagaaga gggccgtgga catcaccccg tttgctcact acccaagacc tgaaggttgt    140460
     tcaagtccac caaatgcagt aagcgtgggt ttgcacatgg acctttacaa ctacccttac    140520
     ttgtacgtga agaatccaag aactggattc actaacgata cagatagtga tgctgacggc    140580
     gagactgatg gcgattctgc gggcggaatc gaaggcagag ccggtcaatg ttggaaccca    140640
     gagtatcagg accccaactt cccacgttat ggttacaaaa agtacggctc ctttggctct    140700
     agtgatcatg ttaatggtaa aatctcttgg gaccacaatg aatttaaaga gggatgtaag    140760
     ccaatcatgg cccggctacc tactgcttat aattatcctg ccaaaataac tttctcgaat    140820
     tttactatgg ttctatccgg ctacttcaag cctaagtcta ccggactcta taaatttgaa    140880
     attcatgctg atgactttat cctgttcaac tttggttcta agaatgcttt tgaatgttgt    140940
     aacagagaag agtccattga taattttggt ccatatgttg catacgccat gtggcctaat    141000
     gaggctgacc aagaattgga agtgtacttg ttcgaggatt catattatcc tatcaggttg    141060
     ttttacaaca acagagacta tcattcgaaa ttcatggttg ggttctatcc acccaataca    141120
     gaggagatta catatgactt tgatggttac ttatatatgc tcgatgatac cggtaatgaa    141180
     tgtaaggact ctatcagata caagactgtc tgtgatgatg atgtcgttga tgacactact    141240
     tttagtacac aatacagtac gatcatggaa ccaggtggag gtacagaagt cataactatc    141300
     tattacatca ggatgaaatg tgaagaagaa gattgcattg gtcagtggga cccaattaat    141360
     aatatctgct acacccccga agattgcgct aatgatggtg gttactggaa tggtgacatg    141420
     tgtgatcaaa gctgtaaaat ggaagggggt atagttaatc ccgatactgg agattgtgac    141480
     aaatcttgta tcgaatccgg cggtttcttg gatgaaaatg gcaactgtga tacaacctgt    141540
     agagacgatg gtggtatgct agtcgagggg cagtgtgatt atcagtgtaa ggaagcaggt    141600
     ggtattctag taggagacca ctgtgacact acatgtgttg actctggtgg taaactcaac    141660
     gaagatggta catgtgacca tagctgtaga gaccaaggag gtcaactgga cgagagcggc    141720
     gaatgtgaca ctagttgtaa ggacagtggc ggcatgttga ttgaaggcga atgtgatacc    141780
     agctgtaaag acgaaggtgg tcagttggac gaaaataatg aatgcgatac ccactgtaag    141840
     gatcagggtg gtattataga cgagaatggc aactgtgata cgagctgtaa agattctggc    141900
     ggtaagttag atgaaaacgg cgcgtgtgac actagttgca gagatgacgg cggtattatt    141960
     gatgagaatg gcaactgtaa taccacatgc agagatgatg gtggtataat agttggtgat    142020
     cactgtgaca ccagttgtag agatgcaggt ggtattctaa tagaagatca ttgtgacact    142080
     acctgtcgtg actctggtgg taaactcaac gaagatggta cttgtgacca tagctgtagg    142140
     gaccaaggag gtcaactgga tgagaacggt aaatgtgact atagttgtaa aaatggcggt    142200
     ggtaagttgg atgaagacgg taattgtgat atgtcctgta aagagaacgg cggtaagttg    142260
     gatgagaacg gcgattgtga cttgagctgt aaagaagatg gtggtaagtt ggatgaagac    142320
     ggtaattgtg attatagttg taaagaagaa ggaggtatca tagatgaaag tggtaactgt    142380
     aacaccacgt gtaaagattc gggcggtcaa attatcgacg gcgagtgtaa ttatggatgc    142440
     aaagaagttg gtggtgttgt tattgatgga gagtgtgaca ctagctgtgt tgattctggt    142500
     ggcatcttag atggagacgg taattgcgac cgtagctgta ttgaatcagg aggcgttcta    142560
     gaagatggtg catgtaacac tacctgtcgt gactctggtg gtaaactaaa cgttgatggt    142620
     acgtgtgata ccagttgtag agacgatggt ggtatgttag taggagacga gtgtgattat    142680
     cagtgtaagg aagcaggtgg tattctagta ggagaccact gtgacactac atgtgttgac    142740
     tctggtggta aactcaacga agatggtaca tgtgaccata gctgtagaga ccaaggaggt    142800
     caactggacg agagcggcga atgtgacact agttgtaagg acagtggcgg catgttgatt    142860
     gaaggtgaat gtgataccag ctgtaaagac gaaggtggtc agttggacga aaataatgaa    142920
     tgcgataccc actgtaagga tcagggtggt attatagacg agaatggcaa ctgtgatacg    142980
     agctgtaaag attctggcgg taagttagat gaaaacggcg cgtgtgacac tagttgcaga    143040
     gatgacggcg gtattattga tgagaatggc aactgtaata ccacatgcag agatgatggt    143100
     ggtataatag ttggtgatca ctgtgacacc agttgtagag atgcaggtgg tattctaata    143160
     gaagatcatt gtgacactac ctgtcgtgac tctggtggta aactcaacga agatggtaca    143220
     tgtgaccata gctgtaggga ccaaggaggt caactggatg agaacggtga ttgtgacact    143280
     agttgcatag atgcaggtgg tgtactggag aatggtgagt gtgttttccc tcctacatcg    143340
     tcttccacct ctgaaacatc ctcgacaacc gatcagtctt cttcgcagtc tgatgatagt    143400
     agtgtggaaa gttcatccac cccgatggat agttccacca ttgagagttc atcctctgag    143460
     atcataacat ccgaatctga aagtgaaagt gtgcctattg ctagttcatc atctgaggtt    143520
     atgacctctg aatcggaaag tgagagtata cccattttaa cttcatcttc tcaaatacct    143580
     attgcaagtt cgtcttctga agaagtaaca tcagaatctg aaagtgaaac tgtgcctatt    143640
     ttaacttcat cttcaaagat catatcttct gagtcaggaa gtcaaagtgt gcctatttca    143700
     agttcatctt ctgagattgt aactagtcaa tcagaaagta atattccatc tccaaaccca    143760
     gaacctagaa cgaccactat tacaacaata attacagaag atggtcaaat aataaccata    143820
     actacaacag ttaccggatt tgttcccgaa ccaacagggg aaagtgaagg taatggggag    143880
     tctgatgatg agaatcccga gaaccgaatt gaaaataatt cggacgaaaa tgaattcgta    143940
     gatccagaat ttgctgatga tattccagat gatccggctg gtcctgaaga taatggtggt    144000
     aatgacccag taaaccctga acaggacaac aataatggtc cagctaatcc aggacaagat    144060
     agcaccaatg gctctggtaa ctctgatcaa atcgacaaca atccacctac tcctgaggaa    144120
     aatgccggtg atggcaattc caatggtaac gatccagcag acccctccag aagaacctct    144180
     atcctaggtg atgaacgtac tagagcgtca ccaggaggta cctctcagcc tactggtgct    144240
     aatggcaacg tcaatggtaa cagtccaggc gccaatgtca acggaggtgg tacaggaaac    144300
     tccaacaaca ataataacaa taacaataac aatggtaatg caccaaatgg aggtgatgga    144360
     agtaatggag atgccaacca aggcccttcc agaagaacct cacttctcgg tgatgagcgt    144420
     acaagagcag gccaagcggc ccctactgga ggatcctcgc caaacaacgg tgttgcggga    144480
     gatacgagca acaatggagg agcgattgtg tcgcagcaag tggatgacgg tggagcaggc    144540
     tctcctagaa gaacgtcgat attgggcgac gtgagatcaa gaacaacgct gaatggagag    144600
     gttttgaact tcgagggcag tggtgtgaga cgggcagttg ctggcaacct agccctgcca    144660
     ctgatgatgg ttggcctggt attcaacttg tgaacccttt ggcagttgac aagatgtcta    144720
     cgttttgcca atgtggttga tttttctttc cctcattata aacatgttta atgcactttt    144780
     tgtttgtaat ttcaataagt atgtttccgt tttaaataag caataaaaaa gaatactcag    144840
     tatctgtaaa acatgaaatg gtggtgaagc ccagctatat actactatat actgtttagt    144900
     ggcaccgaat atgtgccgat gcttgcagat gagagctacc cgggtatgca tcagcgagaa    144960
     catgtgccct cgaacgatta caccaccctg caaagcacac cgccccggca tagcaggctt    145020
     tcccccgaaa acgtcgcagt gaacaggaca tcggcgcccg atcctatagc aatagtccca    145080
     ccagcggaca ccccaggtgt atatatcggc ggttacgcgt tcacaggcag caggtgcagc    145140
     cacttcctcg tgtacattag cagcagcaag cctttgagat catacagcgc gcaagtaggc    145200
     caggtaaaca cgagagaatc aggttcctga atatagtcca tcacgggagc agcttcagag    145260
     cacttgataa gcagtacagg aattctggta attgtggtaa ttgtggtagt acgatataat    145320
     accaacagct gagagttgag aacggagtcc gaattcgagt caggagaagc aagcttaagt    145380
     actggagatg gctacgaaac aagaggagca ggcgaacttg agcgacgtgc tgacgcctag    145440
     catgagtctg acggagctgg aaatgaagtt tgcagatgag acggacggta aggctaagga    145500
     tgttgttcag gcgcgtatca agaaggctga agacggcatc cttcctctga gactccaatt    145560
     caacgacttc acacagataa tgtcaagtct cgatgaggag aggtacgcca acgtcagcaa    145620
     gcaggagaag ttccaaatga taaggtcgaa ggtgttgggg ctcacagaga gactgcagga    145680
     attgtcgaac gactttgaag aactgcagcc actgtttgct acagtcggtg aatactcgaa    145740
     gacatacaag aacaagaact tccaggtgct ggagaacctg gcgtcatata atcacagggg    145800
     gaaagctggt gcttcgatct ccaacagcac gcctacacca gcagcagcca caccgacaac    145860
     ggccccaact cccggggctg gcacgaagaa ggcagcgaag acagcaccca caccaacggc    145920
     gacggctact atcggtacgc cgagcaacaa tgctccgaca ccagccacca cagctacgac    145980
     gccaggaaca caagcgaaga aaccccgcaa gcccaggcag acgaagaaac agcaacaggc    146040
     tgcggctgcg gctgcggccg ttgctcaagc acaggcccag gcccaggctc aagctcaaaa    146100
     tcagaaccag aacaatatgc agaacaaaaa tataagcaat cctggcatga actcgaatat    146160
     gggtactcca gtaatgggca acccgaacat gaaacaaatg caaagtccta ttccagcgaa    146220
     tgctatgaac aacatgaatg taccgcacaa tggggcaatg cggcccagtg tgccaaatgg    146280
     taatatgggc aatccaagta tgggtaatct aaatatgaat gccccaaata tgggtaatcc    146340
     gaacatgaac aatccaaaca tgaacaaccc taatgcaatg atgtccccca tggccggtca    146400
     aggccagcta aatcagatgt tcccaatgca gaaccacaac cagaacggtc aattcatggg    146460
     ccagcaatcg ccgggtccca acattggcca aatgcaattc ccaccaaata atggcaatat    146520
     gaatggcatg cccggtacct ccgacatgaa cctcggcatg aacccctcca tgaatatgaa    146580
     catgggtatg aacctgaacc agatcacacc tgccaatatc ttgagcatga acacgaaggg    146640
     gaaagacgac cagatgcaga acattggaat ggaccagaac cagaaccaga accagagcca    146700
     gaaccagagc cagaaccaga accagagcat gaacatgaac atgaacaacg acagcaacaa    146760
     ccccaagagt gcatacgatc tcgtggactt caactccctc gacctctcca gcctgaacat    146820
     ggacttcttg taatgttttc aagaatgcaa ggaaagggga aatgaagtga tgcatgcaag    146880
     ggagatctac gtgtccaaaa aggcaccgaa gtattccatc catcgggagc aacagttggc    146940
     ttccgccgga atagtcacat gtataatcac ccacatagaa aggtgtatta ccactgctat    147000
     gacatcacga tagacaacat cacaattgac gctattactc atttttccac aatttttttt    147060
     tcaccaaaat ttctttttag tcatttttgt cagctaccaa gctgtgcaag cctgtaaact    147120
     ggtattggta gaattgctca ttaatcgcat catcaaagtg gatcgatggt tcttatttaa    147180
     gtctgggttg tactttccaa ttttcaatct acgttttatt tggtgtactt gccgtcatat    147240
     ttttgtgggg attttacttc attatttgtt atctctgtgt tgacataata agactatcgt    147300
     aagcacaaga taatgtctca tcaacttaag caaacatttg ccaatgcgaa aaatgagggg    147360
     cgtaatgcct tggtaacatt catgactgct ggttatccta gagtcgcaga gaccattcca    147420
     ataatgaagg gtttccaaga aggtggtgtt gatgtcattg aattgggtat gccattctct    147480
     gatcctattg cagatggtcc aacaattcaa gttgccaaca ccaaggcttt ggagaacggt    147540
     gtcactttgg tacaaacttt ggacttgtta aagaaagcta gagatgaagg tgttactgtc    147600
     cctgttatcc ttatgggtta ctacaatcct attctaaact atggtgagga aaaattcatt    147660
     caagatgcag cggatgcagg tgcaaacggt ttcattattg ttgatttgcc acctgaagaa    147720
     gccattaaag tcagaaacat gatgaagaag cacggattaa gtttggttcc tctagtggct    147780
     ccttctacca cagattctcg tcttgagctt ttggctaaaa tcgccgattc gttcgtctat    147840
     gtcgtgtcaa gaatgggtac tactggtgtc caatcatcgg ttgccagtga cctagatact    147900
     ctggtcagca gagttaggaa atacaccaag gaaaccccta ttgcagtagg ttttggtgtc    147960
     tctactagag aacatttcga atctgttgga agtctatccg acggtgttgt cattggttcc    148020
     aaaatcgtta ctttatgtgg ggaagcccca gaaggtaagt gtggtgaggt cgcaaagaag    148080
     tacgtcgaag agatactaaa tggtaagaaa cacaagattc tatctggtga agagtaccaa    148140
     ctaatgaaaa cggccaccaa tgaactagaa tccgattcgg accaccacga atttgaagaa    148200
     gaccacaaac acccaataag atttggtgac ttcggtggcc aatacgttcc agaagcttta    148260
     catacatgtt tgaaggaact agaagaaggt tttgaagatg caattgctga tcctactttc    148320
     tgggaggaat tcaaatcctt gtactcttac attggtcgtc catcttcttt gcataaggct    148380
     gaaagattga ctgaacactg tggtggtgcc caaatctggt tgaagagaga agacttgaat    148440
     cacactggtt cacataagat taacaacgct cttgcccaag ttttaattgc aagaagattg    148500
     ggtaagacag aaatcatcgc cgaaactggt gctggtcaac acggtgtcgc tactgcaaca    148560
     gcatgtgcca agtttggttt aaaatgtact gtttttatgg gagctgaaga tgttcgtcgt    148620
     caagctctga atgttttcag aatgagaatt ctaggagcta aggttgtttc cgttactaat    148680
     ggtacaaaga ctttaagaga tgctacttct gaagctttca gattctgggt cacaaatttg    148740
     aagagtaccc actacgttgt gggttctgct attggtccac atccttaccc aacactggta    148800
     cgtactttcc aaagtgtgat aggtaatgaa accaaagaac aatttgctgc tctaaataat    148860
     ggtaagcttc cagatgtagt ggtggcatgt gttggtggtg gttcaaactc aactggtatg    148920
     ttttctccat tcgaacatga cacgagcgtc aaacttctgg gtgttgaagc aggtggtgat    148980
     ggtatcgata ctgactatca tagtgctact ttaaccgcag gtagaccagg tgtcttccac    149040
     ggtgtcaaga catacgttct gcaggatcaa gatggtcaag tccatgatac acattccgtt    149100
     tcagcagggt tggactatcc tggtgttggt cctgaactgg cattctggaa ggcaacggga    149160
     cgtgccgaat tcattgctgc tactgatgct caagctctag aaggtttcaa gttgatctcc    149220
     caacttgaag gtattattcc agctttagaa tcatcacacg ctgtttacgg tgcatgtgaa    149280
     agagcgaaga ccatgaaacc agatgaacac ttgatcatca acatttctgg tagaggtgac    149340
     aaggacgtcc aaagtgtcgc tgaagttctt ccaaaactcg gtcctcaaat cggctgggac    149400
     ctgagattcg aagaagaccc ttctgtagga aattagatat tattataaat agaatagttc    149460
     tgttttaatc ttactgtaac aaatatgcaa ctaattatta ttttgtgatt attactttta    149520
     gctcttaaag ttattttgca aagtgaaaaa aaataatcca ttttaacaca tttggccgat    149580
     gcatcaaaat tgatctttac aaaatacata agctgatata taagagacag ccacgaagct    149640
     accaaatcaa taggtattaa ttgtcaattg ggaccataga attgaacatc gtgcagaact    149700
     tatactgaga accaaaactc tgtaccgctt tcgccgttgt tgcttcaaaa tgcttaggac    149760
     tctaattctc tcaacgatat tggagcttat ctgttttgtt caatcccaaa attttgagac    149820
     ctatcaggat tatagaaagc acaacaatga ctctctacta tggggtgctt atagaccaca    149880
     tacatatttc agtgtcaaac ctcgttatgt tgataaaagt cccttcattt tggggttaat    149940
     gtggatggac agttattcca acaatggtat agaaggtcta agacattttg tggaaccaca    150000
     tgaacagggg cttgagcact atgggtggca gacttatgat cccagaatcg gtggagttga    150060
     aacgattgtc gataagaaga ataaccttaa tttgactgtg tctctagcta agagtaaaga    150120
     tggtgctaac tgggttacaa gagtatctgg taaagctatg gaccccaaaa gaaagagtac    150180
     aggttctata tttctttact tgaatcaaca aactacgaag gacgatcaaa agtcgatgtt    150240
     gcatttgact ccaaatgaat tgaaagggaa aatgacattt aaaggtgtct cttccgagtt    150300
     aggtaaatat aatgttgatg ttatagataa gaaaggaaaa tattatagat ctaggggtaa    150360
     ggataaaccc tatagcaaac ttgttgatgc ttctcaaacg cgccatgttt cctttagagt    150420
     cccagaggat aattactgga aggcacatga tttggttaaa actctcatct ctgaatcctt    150480
     aacagatctt ttacataact atgatgttgc aaaagtcaca aagaatgaat ttcctgattt    150540
     ttattccatt agagatatgt tcaattttaa tgagggaaac tttcatatta ttcaaaagac    150600
     ctttgacaca tctgggagtg atggtgaatt cgagattgaa atcatttata attccattga    150660
     gtctaaacag aagataaagc cagctgaaac aaatgcacta ataacacaat ctttgctcga    150720
     aattgataga aagttcaata agcatttcca actatctgaa tcccaaaagg ataagacaga    150780
     gtttgtaaaa tcaactctcg ccaacttact aggtggtatt ggttacttct atggtaatca    150840
     aagagttgat agaattacta cagtagatga gaaacatttt gatgaaatta aactctctca    150900
     tggagacgaa gatggaccat atagtctttt cacatctgtt cccagtagat ctcaatttcc    150960
     tagaggtttt tattgggatg aaggttttca tttattacaa atcatggaat atgactacga    151020
     tcttgcattt gagataatat caagttggtt caatatgatc gacgagaagg gatgggttgc    151080
     ccgtgaggtt attttaggcg aagaggcgag aactagggtg cctgatgaat ttatcactca    151140
     aaatcctaac attgctaacc cgcctactat cttacttgct tttagtgaaa tgctacaaag    151200
     ggcgtctaat agttacaagt tagtaggtga actaggtgat agcggtgctg ataaggactc    151260
     cgatacatta gaatacaatc acaaattctt gatagagtat agcagagaaa tttatccaaa    151320
     acttgtcaaa cattttgatt ggtttgtgaa ttctcaaaga ggattcacag aagagtatga    151380
     aggcttgatt gaagaaaatg ctatatcaga taaagttcat ttaaatgaga tctttgcttg    151440
     ggttggcaga accaacagtc attgtttgcc aagtggctta gatgactacc caagatccaa    151500
     accatgcgat gtaacagaat tgcatgtcga tgcattgtca tgggtaggtg tcatggccag    151560
     atctctgaaa caaattgcaa ccattctgga tgaagacgca gatatactca agtatgaaga    151620
     agtagaaaat aatgtaattg agaatttaga gttgctacac tggagtgaaa aggaccagtg    151680
     tttctgtgat gtggtggttg atgaatatgg agaagggatt agttacgatt gtcatgaagg    151740
     ctatgtatct cttctaccgt ttgctttaaa attggttcct aaggaatcca aggccattgc    151800
     cagcgttcta aagctaatct cagataaaag caagcttttc tcaccttatg gtcttctgtc    151860
     gctgtcaaaa caagacaaat attttggtca agatgaaaat tattggcgtg gaccaatatg    151920
     gctgaatatt aattatttgt gcctagatgc gctgagatat tattttccag aaatccatgg    151980
     tacaagcaat aataataaag ctagcgtatt atctaagaca gctaaaacca cttacactca    152040
     gctaagccaa aacttgatca aaaatgttta cgataattgg aaagcaactg gctactgtta    152100
     cgagaactat agtcccgttg atgggcgcgg taccggtgcc aaacaattta caggctggac    152160
     atctctaatt gtaaacataa tcaactggaa ttagccagta ttttgcggat agtggagtgt    152220
     gctgaagagt agaattcaaa aactgggcat ctcaacaaat attttgcact tatcggggtg    152280
     agatcctatc tgaaaacaac ctaatactgg tattcaatac ccaatacagc atacttatgg    152340
     atgtcttgca tcattacgat atacaacact tcggacccac acacacacta agagcttttc    152400
     tccacggggt catctgagca atctttattc taaaaaaata atgctggcta ctaaatcagc    152460
     gcaggaaaaa gctggaatga tttacgtttt attgttgaga tgcagaaaat gctggtatct    152520
     taattaacga aagtaacatg actttcaata ttttgatgct ggttaatatg aattccagta    152580
     tatttgagtt ttgatgttca gtgtttagag ggcagctatt acttgacagg tatttgattt    152640
     gatatgcaat gccttccaat gttgttattt attttatgta aatatgggtt ttggtaaaca    152700
     aacatatcat acaagctaca atgaaaacaa atactcatca gctaaaattg atgagttgat    152760
     agatggatat cattaatgca cactttgttt gtatttggtg tatgaggctg ttaggtggga    152820
     atgctggtaa aaatttcgat ctttcatatt aatgatttat ttgtaaaaga gaattgatta    152880
     taaaaggaag acaaaatgct tttattttca tctgggtacc tcaattttga tattcatttg    152940
     ttctcaaatt gaaaatagtc taaataaaaa aataaatcac aacacattcc tttctttaaa    153000
     ttactgtcaa gcaataacaa attattgatc caactagata cactccctca attactagac    153060
     aaaatttgca cattcattca ttcattgcca aaacatttcc aactaagata taaaacaata    153120
     acaaactaat tttttaaatt tttgaaacaa tataatgacg ctatcattct caattttttt    153180
     gctgctactc gcaaccattc aggctttccc tgtttataga aaaagagaaa tagttactag    153240
     gatgcacact gccagtacaa caaacactgt tactgacttt tactctacaa ccacagaagt    153300
     tattattgcc ccaactgtcg aattcattgt aagcggatca gttactttta ccacaactct    153360
     ttaccctgaa ggtgtgaacc ctaccgctgt tgcatctaca attacaacta ttcaaaaaaa    153420
     tgtagcacca acacctcaac cagataatag tggtgataac aactccaaaa acaattctaa    153480
     taacagcgat ggaaactctg cttcacaaaa taattccgag aattcaagta actctaacaa    153540
     caactccgac aacaacaact ccgacaacaa caactccgac aacaacaact ccgacaacaa    153600
     caattccgac aacagcaacg gcaacaacag caacaacagc aacaacagca acaacagcaa    153660
     caacagcaac aacagcaaca acagcaacaa cagcaacaac agcaacaaca gcaacaacag    153720
     caacaacagc aacaacaaca acaatgacaa cagtaacaac aataacaaca ataacaacaa    153780
     taacaacaac agtggttccc agagttctaa aatgtcatct tcaacttcct cttctagctc    153840
     aaaaaccata actttgtctc caaccgcctc cagcttaaaa tcaagttcaa gctctactac    153900
     tacatcttca gtttccagtg tgtctaatac agttacattt tcaaaatcct catctgccga    153960
     atcgacctct accacaacca ttactaccac agaatgggat acttcttaca ctacaacttt    154020
     tactactatt tctggaagca gtggtattaa tagtgccacc aaaactgttt catctagttc    154080
     aaaggtatca aattcagatt ctccaactag ttctacgtct ccatcaggcc ttcttaaagg    154140
     tgttccacat agtttgacct attcgccata caataacgat ggttcctgca aatcagcaga    154200
     ccaagtcttt agcgacttgt cacaaataaa ggcaaagggt gtcagcaatg ttagaatata    154260
     tggtaccgac tgtaactcac tagggactgt gcaaccagct gctgccaaat taggtattaa    154320
     aattaatcag ggtttatgga taaccgctgc tggtgttgat tcacttgatg ctggtcttca    154380
     gctactaatc aactacggta aaaccaatgg ttgggacatc tttaactaca ttactattgg    154440
     taacgaggct atccattccg attactgttc ggttgaacaa ttgattgcta agatcaaatc    154500
     ggttaagcaa gctttgaagg atgctggtta ttctggtcaa gttactacaa gtgaacctcc    154560
     agttgtgttc gaaaatagcc cagatctatg tactcaatca ggaattgact ttgtcggaat    154620
     caatgcacat gcctactttg accaatatgc tagcgctcaa actgctggtt cgttcgttaa    154680
     aggacaagtc caattaattc agaatgtctg cggcacaaac aatgtcgttg ttacagaaac    154740
     cggttaccca tctgctggta agcaaaatgg taacaacatt ccttctcctg aaaaccaaag    154800
     aattgccatt caacagatac ttgatgaaat gaacggtcaa gttactgtgc tttcctcatt    154860
     tgatgatatg tggaagaacc cagggccata cggtattgaa caatccttcg gtatcattga    154920
     tattctggca taagtgtaag ctctaagcta cacagcaata caaggcttta tcgtgtgtga    154980
     ttagccttcc atcagcctcg gcaacaaaca caactgcata tattcattct aaattaccat    155040
     taaattttat gacagccata tgtcataacc cttaacgttt tcctatagat tttcttttcc    155100
     cttagcttgt atattatatt actactattt gtattattat tatttaatta atgttatcct    155160
     ttttttgttt attgagttgt aattagccaa aataacaata agttgtctga gctcacagat    155220
     gccgccaaaa cataaaaccg tgaaagctac ctatcgataa aaatttggag actgtacgct    155280
     gaaattccta atgtatgatc gtcattacta acattattat tgtactgtat agtttcaagt    155340
     atataaagat ctatttatac actgatcaag ggaagattat gaacttttcc aaaataaatg    155400
     agaaatgtaa atggtatagc ctcaagacca acaggattat tcatcaaagt taataagcgg    155460
     ttttagctca gttgggagag cgccagactg aagattcgaa aacttcggtc aacaagttat    155520
     ctggaggtcc tgtgttcgat ccacagaaat cgcaatttat ttttttttat ttaaaatctt    155580
     ttttttttaa gatttaagtc agatagcata cgtgaaacgg tatatgtgaa tgtcattgta    155640
     atatgctgtg aaatcattta agcacacgta cctgcatatt actgacactc tgcgcgaacc    155700
     gacgatatta gaacggctat aggggattta tggtatgaat atatcctcat taataattgt    155760
     ctagtatata attatatagt gagaaatatg caataacata gtgcttggct agaagagata    155820
     atataaaata aacatagaga tgtttgattg tattaaaacg cttaagccaa agcggtcaag    155880
     atatcggagt caccggcatc caaaacggag acgacaccga ctctgaacaa cttaccgacg    155940
     gcggtaccca attcgttgtt accaccttgg aagtagtaga ccttggtctt ggacaacatg    156000
     gcgtagtatt ccaactcaga ctttctcaag actggggtgt tggcagcgat gatgatcaac    156060
     ttagacttac cttgtcttag agacttgatg gtagacttgt aacctagggt aaacttaccg    156120
     gacttgacaa ccaaggccaa cttttggtta atggattctt gagtcttgat tggggcctac    156180
     tcaaatttta aaagaaacaa acaatttcat ttcatttatt attgttagta aaaggaactt    156240
     tcatcggact ctccaagcag ttcaaaccac aaactcatac atatgcatga atctgaggtg    156300
     ctgctcgagc aaaaaaaaat tgatttatct tatactgacc atctctgcgt attatgtttt    156360
     gataatgcta tagtatattt taacactccg gtcgctattg gttatctagt agataagaga    156420
     taaacaataa ctcattaaaa accaaactac caacgtttat accttttgcg atgcgtcaag    156480
     tctggtcttg caaaacttcc cagcttccgc ttcggttcag aaaatttttt tttttcaaaa    156540
     gttaccctgt tcaatcctca ttttgtgact gccctgtggt acacccatac acctgtacca    156600
     ttggccatac tgaaccaaga ctctagcggc gttgtgtttg tggaggcggt cgtgtgtgcg    156660
     ttcgcttctc cccccagcgg tgtggtagaa cgtcagaaac aggcagaacg atcggataga    156720
     attacccaaa caggaaggag tctgagttta gcaggagaaa gcccatctgc ccgtggtacc    156780
     accaccagta ctacccccag tacctgtacc agtactacca gtaccaccgc cagtggtaag    156840
     gctggaagga ggtcctgtct agctcccttc ccagtatgct cgactcggtt catgtgtagg    156900
     tggggggtga gcccatacgt cctaggcagg accaactgta agcctagcct ggcactacac    156960
     tggctaggga gaaccttcct tgtggagggc aagtgggccc aatccactga gatgcccgat    157020
     tcgagcttgc cagtacgcac agtgtgggag gttggcgagg tttgacgagg tttgacgagg    157080
     tttgacgatg gtgtaatcgc agctaccgaa ttagcgtgtt tcgcaataat tggaaatttc    157140
     aattgcgcca atacatatta aagaatagtc gaactggatt tgttcattat ttcttacagg    157200
     gcaagaaagg tgtaggacca caagtcggaa agagtatgtt gataagcgtt ataggtggct    157260
     gtgttgggct gtgccggatg gcgatgcttg acgtaccaga caccattgat tgagaataga    157320
     caattaaaaa gaaaatgcaa aaaaaagttc taatttacta actattattt gttaataatc    157380
     ttttgaaata aaaaaaacaa ctattgaaaa gcctgaatac gtgtgccaag aacctgacct    157440
     ggaataatat ttttgataaa cctagtgtgg gaaccaagag agcaattagt gttggtaatt    157500
     cctggtaaga tatagaggta acgaatacgg taagagtttg aacattatta atattatcca    157560
     gtaagtggtg atttgggata gctttttctt attgtttttt tgagagatat ttaagacaat    157620
     ttttgataca gagataaacg aaaaatgaag gttgaaatcg actccttttc tggtgccaag    157680
     atctacccag gtagaggtac tctatttgtc cgtggtgact ccaagatctt cagattccaa    157740
     aactctaagt ctgcttcttt gttcaagcaa agaaagaacc caagaagagt tgcttggact    157800
     gtcttgtaca gaagacacca caagaagggt atcactgaag aagtcgccaa gaagagatcc    157860
     agaaagaccg tcaaggctca aagagctatc gtcggtgctt ctttggaatt gatcaaggaa    157920
     agaagatctt tgaagccaga agttagaaag gctaagagag atgacaaggc taaggctgac    157980
     aaggaaaaga agaaggctga caaggctgcc agaaaggctg aaaaggctaa gctagctgct    158040
     gctcaaggct ccaaggtctc caagcaacaa gctaagggtg ctttccaaaa ggttgctgcc    158100
     acctcccgtt aaagaatgtc aaatcataaa ataactcatt ttttaattta aaacttttct    158160
     ttacttctat aaaaacatca caataaaaaa taggcaataa taataaatcc atatttttac    158220
     actttttata actatcgtcc aaatagtgta ccttctcgag tctctactgc ttgaagtctt    158280
     gcacattagg gagaccttaa tcgtgctctt gacgttgcct aatagcaatt gtgtcacaac    158340
     aacttgatac gactatacta gttagcttgt ttcatatagc tagcactgtt attaattcac    158400
     ttccctttat taaagattca acgtcaaact ctaagtttca atgtctcctt accaacagtt    158460
     tctaaagtca tgtaatttac cccattcggg aatttacatg ctcttcacga aagcttccca    158520
     ttgataaaac ttgatgcctt tttactacac taccactgta ataaaaaata gatttgtatc    158580
     aagctataat aagttgagga tacatatagt agtcaaatcg atctataaac tcaattgatt    158640
     aggccttata tccctaaact aatatataaa tatggaccgg ctaatcaatt ttttatgagc    158700
     actataatcg cttattagcg gatttagaaa tttagcaacc cttgtatagt tagtaatacg    158760
     acaacagcat agctataaaa tgaagttaag cattgtttgc ctactgtttg ccatgattat    158820
     agactatgtt tcctccgata ttgttactac aatctgtgac aaaactatac ctccaaatac    158880
     gttggaaact acaccttact catcttcaac aaccaatata gtagccaatg gtaaaaaaat    158940
     gataggtgtg ttccagtatt atagatcaat caaatatatt agcgactgtg aagaaaaaga    159000
     agatgttgtt gacactaaga taatacacgg attttaggaa ccagtacatg aatagaaaga    159060
     aattatcaaa ataccaccaa acacctagag atattaatat cgaatctttt gatttaagtt    159120
     cattcattaa tatttaaact aattgatttc ttcttctttt cattctatat tttttcatac    159180
     cctagtgact cctaaataaa attctgtttt gttagtattc tgtcaataaa aaacaaagag    159240
     ataaggataa aaagcgaaag atagaaaatc gattttatct ccataacaca taccaataac    159300
     tctgccattg tttcaccctt tttcagtaac ccgctctctt taataattgc aaggaggtcg    159360
     ttgattagct tctttctcga ggctagatct ttctttagat ttttttccaa gtttttcaat    159420
     tcattgattt ctttttggtt agttgggtcc caatttcttt ctaggtcatc taattttgca    159480
     tctatatctc tttcactctc ccgtaaggtc gccaagacat ctaaaagttt atcgttctca    159540
     ggctcactaa acaaggcatt cttcttctcc aatagcgtag atttctcttt ttctagaagc    159600
     ctgagctcct ctctaagctc agagatcaag tcatatgtga ctttattgac atcaactccc    159660
     tttggaagct ccagatcttg ctctttgcag cagtatatgg tgacttttcc aaacggcttt    159720
     gatactattc tcccctcgtc caccaacgta tccagcgcct tcagaaccac gggcttggag    159780
     aacttgtaat ccttctggag attgcttacg atatcgttga tggcaaaggg tttgtactgc    159840
     ttctccaggt acgcctggat aacgccgcac acatccccgt cttgcttgag acatgctttc    159900
     tttttaggtg gcatttttat gtctcttacg aaactacggc aactttgagt gcataataca    159960
     gcaataccgt atgggaatgg cccgctaatt taatttacaa catgctactt gaaactaata    160020
     ttaccatagt aaggcggcag attataagtc attgcatacg catgattctt tgggaaaggg    160080
     cttgagtccc tgaaatacat gaaatacatg aaatacatag aaacataggc cttaattaaa    160140
     gcagttaccc atccttgaca tcattgcaag gcgttatcga tcctcgaggc aatcgggcca    160200
     acgctaatgc cagtctatac acagatcctg ttgcaagagt tgttccgaac aaactccatg    160260
     ggcgatggag cgaacttatt aaccccactg ccataatctt attcctcaca gaactttccc    160320
     agtttcctgg ccagagagaa cacccagcac accatgagtc ttctagaagt tccgttgccc    160380
     cccctcattc tgacaaaaat cccaatcgaa gctttgcttc ctaatcgtct tgtccccccc    160440
     cacttcaatt acgttgtgct tacgtctctg tgccccacct ttctcattct ataaatcaaa    160500
     taggaacgat aattctgaga actgagatct gattttttct tttttccgtg ttctatgctt    160560
     ctggacacag aatatgtcgc agtgcaagga acgttcaccg aggaataact acttattact    160620
     ttttctcgaa gggaagacaa tgcaagttat aattaattga gctcaggatc cgttgcatga    160680
     cgtgggttgg actcccgtaa tgaagctgtg ggagggtcaa aatatatagt atagatgtaa    160740
     tcgagctgtg aggaaaggag gggtggacca aaaaagaaag aagtctgccc gagttcaagg    160800
     gtttttccgg gtgatatgtg ctgtttatca tttgggcagt caagaagctg gggtaaaaaa    160860
     ggacgggggc aggccccaat attgccaaac gtgaagactc aaattgggaa gggacccttg    160920
     tgggcaatgg ggactcagac ggtgaaaagg tggaacaatc tcaagagaag aagaaaaaaa    160980
     aactttcaca ccgtgctttc aacaacgctg gcgttcatgt aaactagaaa acaagaaaaa    161040
     aaaaaagaaa tgtaagtgaa agtgaaaaaa aaaatgtctt ctcttgcttt aatatagttg    161100
     aatagattat atataatgaa tagtagtcgt gttttcataa taacggagct ttgtacttat    161160
     tagttgccag tagaggtaag cataggaact aaaagaactt ccataactag aacagctttt    161220
     tatagcatct gaaagataaa aaaagaggac gtcaaataca gcaatagaac catattagat    161280
     accaaatact ttatagattt gcaaatccaa cgggtcgaaa taaaatatgt ctgcatcagc    161340
     gagtccggaa cctcatacac ctgaaaataa tccctcgagc gttacgaatg gttcatcgac    161400
     tccgaactca ggtaagtcca aggctggtaa gggagatgac gcaccaaggc cgcatgtgtg    161460
     ccctatctgt ggaagagcat tccataggct ggaacaccaa actagacata tgagaaccca    161520
     tacgggtgag aagccacatg cgtgtgactt cccgggatgt gtcaagagat ttagtagaag    161580
     tgacgaactc acaagacata gaagaataca tacgaaccct ctgcctaagg gtaagagagg    161640
     taggaagaag aagcctgaaa ccattttggc tgaacaaaga gcacgtgaag aggcagagag    161700
     gaacaagaat aaccccaact ataaaccacc cagtaagagc agtctgagga ggaagacgaa    161760
     acgtaacacc acattcgagc ttggtgaatc tacgccaagt tcaagcctca cgccaccaca    161820
     acaaccaaac ccccaagtcc aattacccag ctcacctatg gttggtgatg aaacaacaaa    161880
     cgccccacat tccgatggca tgacacctat agaacctcaa agattcttat catcgccacc    161940
     gaaccacgtc aggcctgtct ttggcagtgc caacaacagt aacagcagca gcagaatacg    162000
     gcttaacgcg ttgtcttcat tacagatgat gacgcctcta tctggcagaa acagtagctc    162060
     cactatgaat ctatcacagc aagcgtcaac cacgttcttg gataatcccg atggctctaa    162120
     gaatcaaaac atcatcctac caagaccaaa atctttgaca gatttcgcat ccatgcatgc    162180
     aaatggcagt tctaccaact taactacatt aatgcagcaa cccaatatgg gcaacttgat    162240
     gaaacgtccg aactcggtat tgagtctgaa tgagttggtg acacaatcgg gtgcgggcac    162300
     acatggttat gacacaggga acaattcatc tctagaggaa gacgacctca aggaccctga    162360
     actagagaac gaccaattac gaaagaagtc gaagacagct acacctacaa ctggcttgag    162420
     cagatccgca agtggcctga acctctcttt gaagacgaag tcactaacaa acatgcaaga    162480
     catgaacaaa gtaaacgaga aactgctaca ataccagaaa aacgtggttt ccccacaaat    162540
     agctccacag gacggcctcc caccattgag aagtttgcac ttgcaatttc caactggttg    162600
     aaaaaaagaa gtctacagtt cctcacttct attttttttc tagagtgttg ctttaccagg    162660
     tcccatttca acaacgcaca gtacacatac gcacgcacgc acactaatta tatagcattt    162720
     tatagacttc taagtaaata attattttcg tgttcttagt gcaaatcatt attccattta    162780
     tccctcccac acacggtatt tacattattc cttcttggat acctttcgta gacttcacac    162840
     tttccaagga ctcgtaatac cacgtcaccc ccacggcaat ccagcaatat gtggaacacc    162900
     atagaaaaac tactggtacc cacggttccc ctccccgtgg gaacagtccg gacgtagact    162960
     cacagggctg ggccaaaccc tctgtagcct cttttcgtcc ggtgggcctg aggggtcccc    163020
     cccaccggag aacaggccct ttgtctagcg ggccatgggg aaaaggagaa ttaattccct    163080
     ctggagagag ggattttccc tgcgtaaaaa gcaatttctg gtgggggggg ggagggttca    163140
     gtgttgttga gctggtgcag tggattgtgt ctgtgtttgg taccttatta atagaaatcc    163200
     atgggattaa cattggaaag agtaaacgtt ggagttaatt attggtgcaa tacggcattg    163260
     agtcaaagag agtaagaaaa aaattgtgag aggatgatcg ttccttttaa gtgcattatc    163320
     aaaggcgatc aaatttagaa taaaatggta tataactcgt gcttcttttc ttgattaatc    163380
     actatcttga aaataaacct ttaatatctt ttgaatatct gctttctata ttcacccaaa    163440
     gagagattaa ataatattaa aattaaaaaa aagataacgt caatacaata cctgtgatgc    163500
     aactgtaaca cacacaaaaa aaaaatacca ctcattaaga aaaaataata gcaatattta    163560
     aagatcaccc aaacccaagc aaaaaaatta ttattaaaac ctatttcaag tattcatagg    163620
     atatatcgaa acaccaaatt ccaattatca atttcacccc ctacactact gaaaattagc    163680
     gtattatttt tttgacctta accccccaaa aaaaataccg ctataacttt gcatttctac    163740
     actcttttaa acaaaactat aactaacaga tgtcttcact agatgagcag gaactcatat    163800
     tcgaggatga tatcgcccag gaggtcgaat tcgatatgac tgagatagag gtgaatcgct    163860
     tgatacgttc accactgctt atgccacaag atcgagatca catgactcca caaagtgatg    163920
     ccgcctacta tggcacctct attgctaatg aattgatgaa caccgagggc gaatggccct    163980
     cgtatgatga ctacaaccgt caggaacggt cacaacagag ctacgatatc cctagagggt    164040
     tttccgggtg catgcaacca ttgtctagta ttgttgagca tatggccgag actaactaca    164100
     aactctggct acactcaaaa aactaaccaa tgagaatacc aacacccatc attgcctcaa    164160
     aaaaaaaata tcacactcaa caaacaaata aaagctacga taaaaaaata attactgaac    164220
     atttctgaaa caattttact actagagaat tcctttttca aatgaattat tctattgcta    164280
     atgataaatc ctaccaaaaa aaaaaaataa aagattatta tctttattgc tatctctact    164340
     ttataggata actattacaa acgtatacga ctttttttta tacaatttac tgcaccccca    164400
     ttccgttaac ggtttggtat atattcacat attcaatttt ataaaagaat tactgcattt    164460
     ttttcctcaa gatcgtgtat cccgaattct ctccgtcgaa ctcctcaaag tttgctccag    164520
     taactcctat ctccatgaag tcggatttca agacatgaac taaaatcaaa aaattaataa    164580
     gaaaaagcaa cctgagcgag ctccttaaca atatccattt tgactcattt gtcttgcact    164640
     tcacatgtct actttttagg attgcggatt atctatcaca tgctaattga ttgtaagcca    164700
     tttatactga agattattgt gcgatgaacc ccactatcat ttagtgcata aatatttata    164760
     aaaactatgt atcatttgct attactacta ttattagtac taaggtaaga caggtataga    164820
     taacattaag ccaatttatc tgatatcagc cagtctggtt gtattcatgt gaatcttgat    164880
     atccatttca tcagtgttct cctcaatgtc acggatacgt ctttgttggg aatctaactc    164940
     ttcaccagtc gcaagggcca gcttctttag tctaccactg atctgttgga tcttatctag    165000
     atttctatca atctcaactt ccatctcatc atcctcttcg tcgttttcaa attgatactt    165060
     cttagctgcc gcaagtactt tttctctttg atatttctct ctcacagcac tagtctcatt    165120
     accgccacct agggctccct caattctttg agtagattgg tgtaattctt gtgacatgtg    165180
     ctctgctctc atcttgtctt ccatcttacg acccttaatc atgtcttcac gctcacgtct    165240
     tcttctctta gagttaaatg ggttagagac atgaacagcc aaaatatttc tgttcagctt    165300
     cttcaattca gctacctttt catcggcagc tgtattctgt atcttgatca aatcaagatt    165360
     tctctcaaca ttattcagtt tttcactttg gtggccaagc atacctagtg tattcatacc    165420
     agccatttca gcttcttgtg ccattttcag agtatttcta gtggaagcaa cagagctctg    165480
     cttcgtaaat ctaatttgct ctttgatttc atcaacagcc tgatcttctt cttctttttg    165540
     acgctcttct tcttctcttt gtatctcatc aaaagtctta tagcctctgt tcatatcatc    165600
     ttgggtacca taaccgtatt cctcttcttc tctttgccat tgcggttgct gttgttgttc    165660
     atacatgtta ccgtatccag tggcattaag atcttcccca cggtcattta tagtggcatt    165720
     caaatctagt tcgtccagcg cagcagagtt ttctgcatat ttagattctc tacccatgta    165780
     tttgtcctca aagacaaact cattagcatc ttcgggagca tcgtttaagt ccaattcatc    165840
     ctgattttgt tggttctctt cctccgctag tgcaacattg ttcgaatcag gtgtgatata    165900
     tccagcctga ggcggtacgc tattgctagc attccttctt aaatatggat tagtaccaga    165960
     tcttgagata tttcctgatc gtgtaccgtt taggtatgag tcaccactaa tcgcagcata    166020
     tggatttgaa cccgccggtc tgtcattgac accaggtgtc gatccataag aggcgttccc    166080
     gtaggggttt gatgcagatg tatttgttct acttatcggc ttggatactg gtgctgatgt    166140
     tgtcgcactg ctgccatacc cagaaccata tgaggcgcca ccatatggat tggagccact    166200
     aactacgcta cccattgctc caactgcacc acctgcagca ccacctgcta aagcaccaac    166260
     accggcacct gcatatggat ttgacctatt ctgattatta tatccgtatg ctggatcttc    166320
     acgggcagaa tctcttctgt caagaactgg ggttgctcta ttaactggct tcataggttg    166380
     gccaggagtt ccgttgtaag cattcaagtc ctctgatcta tcacgtcttc cgtactcatt    166440
     accataactg ggtccatttt cgtaattatt gaattcatta tatacgccgc tgctcgaaaa    166500
     tgctttctca ccagctgctc cagcgccata agggtcaggg ttatacctat aggatttttc    166560
     tgttctggca tatggatcct gtactgctgc tggttcatcc tcttgttggt gtttcttctt    166620
     cttcttcttc ttatcctttt tggtctcttt ctcgtccagc tcagatttgt tcaagtcatc    166680
     ctcttcgcct tcctttttct ctagctcttc aggtggtcta gcaaagtcct catagccagg    166740
     tggcgcgtag atcttgctgg tagccctatc cttagcaaac tgaccatacg cagcaaattt    166800
     actctgaggt ttcttggtgg tacttttagt ggcaataccg atatccatca aattctcacg    166860
     gttctgctct accgtgtcct ccttcggagg cttgatctta aaaaacttct tgatacccat    166920
     atcacaatag aaacaagctc gactcttatt atgcccgtgt tagtctaaac tctaaaatat    166980
     atccttatag aaatggaggg tatcctgatg taagtcctct gcatgtactt tgacgtactg    167040
     atctactgtt aactttaatt gcaagttact agcttggttc gtgtaatgtt ataatattga    167100
     gcaagtatac ggtattcagt aagcattaga agatgtatat aagattatct ttgatatttg    167160
     tatccaagca ctttgaaagc ggcatggtgt gctttccaag tttctattgt gcaatatgaa    167220
     gtcaaagcat tgttagtgat cttatttttg ccctgttgtt ggtgcatttg tccattttac    167280
     acttgattcc attatcggtg tcagtttgtt catttgaacc gattcctgta ctttgttctg    167340
     atctataggc aagaatgggt tcacttggct gttcgctttt actgcagact ctgctggcat    167400
     gaaggtaggt gcggcgtagg cgttaaattt cgccggcatg atggttttat tctcttcttc    167460
     tctactgaag ccaaatttca tatcctcagg cagtaaatca aggtattctg ccaatatagt    167520
     tttcttgtgg tcaacatccg gctgttttgt gttgattatt ttggtatata tcaaagaata    167580
     gtccgatgaa ccatcgttcc ataagtgaac ataggtcttg atggtggacc tacaaagttc    167640
     gttctgctta caccatattt tgaatttggt gtgttttgat tggaagaata gataatttag    167700
     taatttgata gatatcctct gaaaccctgt atcatcgata gacactcggg atactatttt    167760
     taacaagtgg tacagtgcta cactctcatt gacaagaagt atatttgtga cctgttcctt    167820
     tatattattg gtaaggatct cggcatacat attccaagtt tcattactaa ttaccattgc    167880
     ttccgatagg gattgcatct gttctgccaa caacaagctg gaaaatattg gaataaaagt    167940
     caaaaggtga acatttttaa taagttggaa tttggagtgt ttcaaattga tttcctcctt    168000
     cccttcaatt tcaaatggat tgatactggc tgatcgatat tggtttaata tcttactact    168060
     gatctctata cacaacatta aggagtccaa aatcgtaaca atcatgtcac tatagcttgc    168120
     cttaatcaaa gagtcatcct taccatatat gaacaacgat ttaaaaatag gtggtaaagg    168180
     aaatatcata gtcttgtcaa accaaggtgg caattgaaat tcaaaagaag taatattctt    168240
     gaaggcttcc ttaacagcag caccagtact tatatcgtag ctctcactcg tcttttgtaa    168300
     aactttacaa ccattaataa atccaagcaa gaatttcgac aaacaatact gcacatagga    168360
     gagtaaagct aacaaagtct gcgtagtacc caattcatcc aattcgtaat gcaactcaga    168420
     gatatcagta tgtgattcag acaaaaacac aaagctgctc cccagcagtg ttactaaccg    168480
     agggaactgc agtaaattta tgtcaggttg atcgattatc tccattagtg tcattagcga    168540
     cagccgtaca tttggcagag gttgcgtcat ctcgcagaca ctgttcttca caataagctc    168600
     tttgtagcac ctttgataga ctgcatcaga tataatcttc ggaaactgca gcactctact    168660
     cataactgag tactgctgat acttgtctat agagtcaagc agatcgtttg tgtcaccatt    168720
     atgcatggat ctacagatca agagatcagt ggctaagttg ccagtattac agttataatc    168780
     cttggaactg atcaagctca gtaactccct gatcggataa tggaagtctt gaaagtttgt    168840
     agtcttactg ctgcgatgaa ttaataatac ttcgaatatc ccaacgtcat tgtcgattct    168900
     agtttctggt gaatcgttgg catccctaca tgatgcctct agtgtctccg atgtctctat    168960
     ggctatgtca tcaggggaca ctaccagtaa tacatagcag agtagtatat attgcaagct    169020
     ggactcactt ctcactgtga cgtccttgag cccgctatga cgcaggacat ccagatcaat    169080
     actgcgtagc gcttccagca ctgtagtggc cagattgaca tcccaggact cagacagctt    169140
     acggatgcca ttctcaatcc cctccattgt caccaggctt ccaaactcaa ctgcccactc    169200
     cgcaatttat cactgaccca gggatgagtg attttaaaaa ttgttaatta gtatcttagt    169260
     cactatcaaa ctcgtggagg gacgaactct tgtcaaagat attccagtga cgtagactgc    169320
     tgtgtgaaag ttagcagtgt tcttctatcc ccttgcactc cttggtaaat aaggtccagt    169380
     ttaatcactt aaagcggaaa ccataagact agtaagccat cgaatcatag ggattcttat    169440
     ataaaaactt gggttttttg tagagacttt gaaacagtag gaatccatgt ctttggtttg    169500
     tttcaaactt gcaccacttg tgtaaccaat atctcatcaa accagattga aacaaacagt    169560
     gaaacaatga agacgctact agttatcgat gtgcagaacg acttcatcac gccggaccac    169620
     tccatgtacg tgccccaagg cgaagaagtt gtttccccca ttgtcgagct catgaaggac    169680
     ccccaatggc accgtgtggt ggtctccagg gactggcacc cgcagaacca catctccttc    169740
     gcgaagaacc atggtgtcga ggactacacc gagaccacgt acaagtcccc acgcccaggc    169800
     gacgactcga cacagccggc aactctatgg ccagtgcact gtgtccagaa caccagaggt    169860
     gcccaactgg cacctgacat cctcgagctg gtcaactcga agcacatcaa gatcgtcgac    169920
     aaagggtact tgtccaattg cgagtactac agtgcgttca acgacacctg ggagtggcac    169980
     aagactgagc tcgacgagta cttgaagaaa caccacacca cagaggtcta cgtcgtgggt    170040
     ctcgccctcg acttttgcgt caagaacaca gccatcagcg cggcaaagct gggctacgac    170100
     accaccatcc tgaaggacta cactaagccc atctacacag acgaggacca ccagcaacag    170160
     ctcgagaaag acctcaagga acacaacgtc aaggtcaaat agggcgccag cgccaccagc    170220
     tacgcccata cactgcgcaa ttgggaaata tggaaaaaat aaattatata aaagtcacgt    170280
     gtgtaatgaa tttttagtct aaaataaagg atttaaccgt ctaattggga tcagttaaaa    170340
     ttgctaaaag ggtttggccc ggatataagt ttagactaga cccttggtgg gggggggggg    170400
     gggggtgagg tgtccctaac gtctgcaaac tggtgggaaa gcagccatgt ttttcccccc    170460
     cccccacaca caactacaca tacaattgat ctttggagca agcctcttgt aaatacattt    170520
     ttcatggagc aatttagcca agaggacacg aaatgcccac tttgggattc ccctccaagg    170580
     aaagcagcac tgtagtatta aaatagatct tgcctaaatc tagatttgga tttgactttg    170640
     aaaaaagaaa tgaaagctag atccgtctta gctggcccta gccattgtgg ccctgtgcag    170700
     ctcttcatta gaaggagatt cagaattttt ttggctgcaa cttttagagc tacgtttctc    170760
     tgtcatgcac gagaggttga tttgtagaat gatggcgtac gttttatcaa aaatgtttta    170820
     tatagcttgc ataggcaatt gaaaactaat ataaaggcca attcttgccc agggatataa    170880
     agttcctgtt ctgagaccaa atagcaaacc gaagctggct tgatacagta aattcagtga    170940
     tgagtaaatg gcagaagagg cacatagtgc ttgcggtgct ggtgctggtg gtattcttac    171000
     gtgttcacgg taatttgcga ggcttgagcg ggcaattcag agctaagtac ccaaagaatt    171060
     atctggtgtc taacggtgat acttccggtt tgaacttgaa gcagctcaag ttcaattcca    171120
     atgatctacg gtctgatttg agcaaagctt tcccttatga tccttcaaag cctataccaa    171180
     gacgtgtgtg gcagacttgg aaagtaccaa tagactcacc agaattccct ggtgatctga    171240
     aaccgtacgt ttccaggtgg gaatccaaca gctatgaagt tgatgaggat gagatatatt    171300
     cacaagagaa tgagcagaac tactatttac tcccagatga ccaaattgag tcaatcttgg    171360
     agagtttcta cggtgaagtg ccgataatag tgcaggctta taagctgatg cccagtaata    171420
     tattgaaggc tgacttccta cggtatctgc tgttatatgc cagaggtggt atatatagtg    171480
     acattgatac gttcccattg aaagatttca gggattggcc ttccatgaac caagaagata    171540
     tgaagaaatt gaagaaagcc aagataattc catacaagaa ctttgataaa acaatgataa    171600
     acggtatgaa ctttattgat ccaggtctgg tagttggtat tgaggccgac cctgatagac    171660
     ctgactgggc tgactggtac tccaggagag tgcaattttg tcaatggaca attcaaagta    171720
     agcctggaca tcctgttcta agagagctaa ttctgaatat aacggctacc accatatatt    171780
     cttcagctaa aactcctgcc catttgaagt cattgattga taattctgcc gatgaaaaag    171840
     atttcaatat caattataga catcgtagga ggtttgataa agaatatgat cacagtcaaa    171900
     agaaacaaag gaaaaatgtt gatggtactg atattatgaa ctggactggt ccaggtatct    171960
     tctctgacag cattctaaat tacttgacta atatcattag aaagaaccgc aatatattgt    172020
     tattgaatag taacttagat tcaaaacaaa aagaaatacc ctcctcagca gcaggttctc    172080
     aagaggaaga ggaagaagaa gacttaactt attcgacaaa gaagttttat aatgaaattt    172140
     caactagtct attatcatct gcaaagatgc catgggagtt tttctcacta ataacagaac    172200
     ctttattagt agatgacatt atggtattac ctattactag tttttctcct gatgtgatgc    172260
     aaatgcaggc cgaaagtagt cagcacgaat tggcacttgt gaaacatatg tttcatggta    172320
     gttggaaaga agaggctgac gggcattaaa tgtctattag aactgtttca taaatatgca    172380
     tatagagaat aatcaatcac tcaggtatca tagtcaatac ataaataagt gaataaactg    172440
     ctatcgacag ttccaaaaaa ttattacaag attcgggacg aggtgtatct gcattgttca    172500
     atgaatgaat agaagctgga tgatcagtat ttacattaat tacttctagt ctttttgcat    172560
     aatgattagt tattatggaa tatttacaat tatgactgtc tttttattta cattctatct    172620
     acaggtgtta cccccagcaa cttcagtcca ttatatagta tttgtctcga agccatgaaa    172680
     agatgtagtc tggcttttgc aacatcatct ggttgtcctg atacccacac agtacgatag    172740
     cattttgata cttgatgtgc gatcttgaat aagtatgtta ccaatgttga tggctccctg    172800
     gtttctagag ctttttttag aacttcgtgg taccggctca ttacccttac taaatcaagg    172860
     gcatcttgct ctcctatcaa ttcataatta actggtgtta aactttcatg gaggtgttta    172920
     tttttgagtt caatagattt aagcctggaa tgagcatatt ccagatatgg gcctgtatca    172980
     ccctcgaaag taagcattct ctcccatttg aatttatagt tgttttttct tttactttgc    173040
     atatcctgaa tcataacagc agatgtgcct atcaggtatg caatttcaga tggattttta    173100
     acctgagtaa attttacgtc attcttcgac attacactta acatttgctg ttgtgcttcc    173160
     tctagaatat tatctagaaa tatcacggta ccctttcttg tagacattcc ttgaaccatg    173220
     ccaaagttaa tgtgttccaa tgaggttgcc cattcaaatt tcagttcctt gagaatttga    173280
     tacaattgtt tcatgtggag atcttgttgg gaggctacta cgtatatcat tttgtcgaaa    173340
     ttatattctc tttttctttc tattgcagca gctatatctc tggtaatgta caagctagct    173400
     ccatcagatt tttgtacaac cacagccccc agagattttt gagctttaga caagtccaca    173460
     actttagctc catttgattc tttcagcagc ccagaagcct gtagcatgtt gtttactaaa    173520
     agaattgttt ctttagagac ttgggattcg ccagagtaaa catcataatc gatattgagc    173580
     tttgagtatg tttctttata tttccgaatt gaaagattgc ggaacttctt ccatagtttt    173640
     atagcatctg tgtcattgtt ttctagcttg caaaaatatt ctttagcttg ttcatcaata    173700
     agacttttcc cattagatga cttttcgttt tctatatctt tattgatctt aacataaact    173760
     tcaaataaat ggtttatggc atctgtttct agcatttttt catcgccata tctttcgaat    173820
     cctacagcta agacaccaaa ttgtttaccc cagtcaccca gataattcat ctttgtaacg    173880
     ttccatccga aattctggaa aagattgctt aagaacccac ctattatggt cgatcttaga    173940
     tgccctgcat gaaacggttt tgcaatattg ggtgaagaga actctatcaa caccttctta    174000
     tcttttacca atgggatttg tccatatctc tctctttctt ctaaaatttt gggtagtaat    174060
     ttcccagtta agtagtgtgg ttcaatgaag aactgtaaaa aagggccatt agcaactacc    174120
     ttagccatgt atggctgatc cgataacttc tccccccagg ttcgtgctag tgataccaag    174180
     tcttctttgt gtgccacaat cttcggaagt gggatgatta gatcaccttt ctctaaccct    174240
     gatgtgacgt cgatagagtt gaataccttg ttattatcaa ctcccgatag actagagagt    174300
     ttgtttgaca aattttcctt gattatgtca aggacattgt gttcaggaaa gcttactttc    174360
     gcaacactat acgacctgct gaacaccaga attcgagttg aagacaagca tcgactcggt    174420
     agcattatcc ttgattaata atgtgaaatt ataagcccac aaatgttcaa ttggattggt    174480
     gataacaagc tccgttgcga tcaatgcatt tagtttagtc ttcaagtgtg aattatgtga    174540
     atttcattga ttttctcaga atgacatcct ctaattttcc gattgtacga aatcttctag    174600
     ggtggtatct agttttcctt tcaaaggacc ctttaaaata taaaatccga tcctcgagat    174660
     gagctagtgg tttacatagc tatacactca gtatctatga actcggatag gatttaatga    174720
     gagtaattta gatgaattta taatctgaat tatcaaaagt atttataata tttaaaagtc    174780
     ataaaaattg gttcgttaaa attgttggaa agaaaaaggg atagatattt cccaaagtgt    174840
     attaaagtgt cacgatgcaa atcaggtaaa gtatgtggct taccttgatt tgtacctcta    174900
     ttccgacgta ttaaaaagtt tgctttaaaa attaattgcg acgctagaca acactggtca    174960
     cattgatgaa tctattaaac agatggctct aaagaaagct agggactagt catttcctta    175020
     taggaatctc ttgtaccatg gggtgtcatc gtgcatcaaa gcatcggcat cataatcagc    175080
     acctcttctg gatggaggaa cccattgaga agccttccat ggcaagacac cttcttccca    175140
     catggtgttg acttcttcca aagttagacc cttggtttct ggaacaaaga agaaaacgta    175200
     gaagtaggag aaacatagac agcccatgaa gacgtaacca tagttgaagt taatagcatc    175260
     agtaatgaaa ggagtgaaga aactaatcaa gaaaccccag atccagttag aggcttgagc    175320
     aagagccata cacttggcct tgactctcaa tgggaaggtt tcagaacaga taacgaaagc    175380
     tagtggagcc caggtggtag cgaaacagaa aatgtagaaa caggtgaaga caatcataca    175440
     gttaccagca cccttggaag aaccattacc cttaccgtga ggccatagtc tggtgacacc    175500
     gacagaagcg aaaacaacca tacaagcagt catggtagcg gcaccccaca atagacaggt    175560
     acgacggcca aatctaccga ccaagaaaat accaacgaaa gtagagaaga agttgacaac    175620
     accgataaca atggaggtct cgaaggaatc ttccaaacca acagccttga aaacaatagt    175680
     accatagtag aagaagtagt tgtcacctgt caattgttgc aaagattgaa tcatgatacc    175740
     cataaccaaa cgttggaaaa tcttggtctt ggttgagaac aattcacccc aggaagcaga    175800
     accagccaat ctttcagctt caacagcagc ttgaacactg tcaacttcag caacgacagc    175860
     tggatcatca accgaaacct tgttagaaga cgcaatagat ctcttggcat cctcaattct    175920
     acctttctcg accaaaaatc ttggagattc tggaacgaag gtcataccac tgatcataaa    175980
     gatagcccaa gcaaaacata gacctaatgg aactctccat tggacagagt tggagtagtt    176040
     cttggtaccg aagttagtac agtaacccaa gaaaataccc aatgtaatca ttagttggta    176100
     gcacgccacc agagttgctc tcaagtgctt tggagagact tcggaaatca acataggaga    176160
     caagacagca ataccaccaa cacccaaacc ggagataatt ctaccgatga agtattggta    176220
     ccacttgtca atagtagcga tctggataat aataccaacg acataaataa cgacaacgat    176280
     aatcaaacca ggcttacggc cgtacacatc acccaatttg gacaagataa caccaccaat    176340
     ggcacaacca atgttgaaaa tagagacaac caaaccagtt ctaaccttag acaagtagtg    176400
     tgtaccattt gcacgctttt gacccaatct tctaatgaaa tcggtttgag cgacgaaacc    176460
     agaaatggta ccagtatccc aaccgaaaac aaaaccacca aaagcgatga atagacagaa    176520
     gatagaaaca gtaacataag cagaagcagg cttctttgga atgtctacta ttggagtttg    176580
     ttcggcttct tcttcaagct tcttgacatc attttcatat ggggaagcag atgaatcttg    176640
     ttgggataga gatggagaaa agtcattttc tggagatgcc tcaggaacgg cctgaggatc    176700
     ttccttcttt tttgagaaaa gcatattgat atttttttgt tctctattat atgttaatca    176760
     caaagaatta actataattg tttgttatta ttcttcagat aaaagatttg aaatataaca    176820
     taatggaaaa gagattgcaa ctgaatacta atatttttcg aatattaggc cagtatttat    176880
     atcttttttt ttacaacatg tttcttcaaa aattgtttgt tcaaagtaaa acacaatcgc    176940
     gctgtttcta cagtaattca cggatagtga ggtggacagt ccaccatttc ctctaacatt    177000
     tctctaatcg ataccaagta cttactagta ctagtaaaaa ttttctgtta tttgcttgtt    177060
     atttgatttg aaattatttt atcaatgtgg ggagtggaat taatatttga tacagctaat    177120
     actgtgaaat aagagacccc acccccggaa aaattatttt ttcaatggta ttacttaatt    177180
     tattgaaaag ttttttattc ttccagctaa tcctttgaat cagacatcgc ggaggtttaa    177240
     tggggactaa tttcaatact ctcatggtgg gggatacaat cagacaaatc atgcaggact    177300
     agatatcaat catattattc cgaggataag caaaaacctt tcttacccct ccatccttct    177360
     actatggtat tttcttttgt ttcaagtggt tcattttttt tttgccattc ggtaattttc    177420
     ccgcccaacg taatcgttcc tgcttgtgtt tctgtctttg atcttgagtt tttgtcatgt    177480
     tcacacagat tcttccgcat actctccgag attttcctgt attgtgctga ttttctctcc    177540
     atgatccgga tcgagcactg gacccctgct ttaatttgag ttagctaaat tttccggaga    177600
     caagtgcacg tagcttcgga aatttctggg caattaatca gttcaagggt cttttctccg    177660
     ctattctcca cgtaaagtga cttttttctc cattcatgtt tccacgcgta ttcttagaaa    177720
     ctccttgctc agttgtaatg tgatcccacg cttaaatcct ctatatttac cccttgcccc    177780
     tcctcaaacc cccccccact ttttgttgat gctggcacaa tatcctagct cagcacacat    177840
     tttgttagtg gctaaacaga taacggtttg tggtgggacc agaggggagc tcttaaaagc    177900
     aaggagccta caggttgtat ttgaacattg gtctgcgaca tcctctgtgc ttgtctttgc    177960
     agagaaaagg caatgtacgc acagatatac tgttcccaaa tggatatgta gttgaaaatg    178020
     tttttccgtg cacagtttct cccagcactc atcaaaagga cacttaacat cccatacgcc    178080
     agtccgtctt aaaaaagtga tgcaaagaaa agatctcgag gaaaaagtag catcggtgtt    178140
     ctctgcacaa ctctctgagt gttcggctaa taatgcacgg ctccttttgt aacaaaaatt    178200
     ttcccgtttt gtgctttcct tttttcccag ggccgtacgt aatctgttag aatgtggacc    178260
     cattcccata caatagcatc tacaatgtac ttcaaggacg ctcgaagaaa ctgctgcgcg    178320
     ggtttttttt tttattttat tttcacttct atttccagtt atttttttcc gttacaatgc    178380
     ccattgatct agaataattt ttccgtgtat ctcctatttg taaaggggtt tgatgcacgc    178440
     tttcttctaa gaaatctgaa tcttgtgttt ttcccttcga ggataatggc gtaattttaa    178500
     caaaagatat agaaaaagaa agaaaagttg aatgaagaag atcaaaatct cgcaacttgc    178560
     tttgtgcgaa ttctctgcgc ttattgcgct tatcttttcg gaaaaattat atatgacgca    178620
     tatgctatta aaaattgttg aactcttaag aaaagtatgc agtagtgtcc gacgcataag    178680
     atacaaacaa ggtcttgaaa aagaaatgat aacttactag ataattgcgt cattttgttt    178740
     cgtaatacca gcattacaac ttgggacgat gaaggaagct ttcatggaaa taggaaatag    178800
     gaactgctta tgcagttgtt ttcctgcttg gaagaactgt gttatgggcg gagcggaaat    178860
     tcaaacaata ttgaagttgt gtgtgctgag ggaattatac tatatgagga aatcttgaaa    178920
     caaaaaatgc ctcggataag aaaggtcaca ctcgcatatt attcggttac tgaaaaagaa    178980
     agaaaccttt ctaatattgt atttctttgg actgtgatgt tctagatttc ttttttgaac    179040
     agagcggcgt atccccattt ccgtaccact ttatctacta cttgccgcca acacagagag    179100
     aaatgctttt ggttgtcggc acataagcct gtcaaagcta taatccagac aacttgctct    179160
     acatatttct cctttcattg ccggcagaaa atacctctta atatgtttcc aaaaaaggaa    179220
     gatatggtaa aattttgaca gtaaaccaaa catgttcaga gccactttgg aaatttgccc    179280
     ctcattaatt tctattaaac taaattttta tggggtaaac taaccatagc ttgaacctgt    179340
     tttcttcaat ggcgtggggt aatttcaaac agtgcaatgt tttagtttta ttacttttaa    179400
     tccctgtaag tataagaaca acaggtactc atataaggga taataaggtt gcaattggga    179460
     caaaaaaatt aatgaggggt aacaaaaata gaaactttgt acacataact gactcttcag    179520
     ttgattttgg tgtattggcc ctcgccttgg atttatgaac acgtcattta atagctctca    179580
     aattattagc attccaaaat gatcaaaacg cgactataca ttttcatcaa tagatagcat    179640
     tgtatccaga agttggtgta ttgttataac ctacatattg gcgacgccac atgtcttaca    179700
     atttggaata cgatttatgg tttatcatta atattaacta aaaagttgtt atttaggtaa    179760
     aaaaatagaa acattaaaaa cattgaatgt tgaaaaaaat gaaaaataac gcaaacacat    179820
     acaatcaaga caagcaaagg tagttaaatc tatatggact acacttctgt cctggcttgt    179880
     atactttttg cggtcatgaa actaaaattg aatttcagag aagtgaacat aatcccaaat    179940
     agcgacgtaa gccatcaatc ccttttataa tatagaattg actgattttg aaagtttcgt    180000
     ggctcgtaaa attgtgagaa ggttaactct ttatttaaaa ttctttattt ttgtcataaa    180060
     tgaaatgaaa catgatcaaa tgcaagagtg caatagaaga tatgatgata atcgttagaa    180120
     aaatttgata tttgtcaaca tcaatttaga tttggaccta ttcattgaaa gcaagacact    180180
     taacctctac caacaactct cttgtaccat ggggtgtcgt cgtgcatcaa agcatcggca    180240
     tcataatcag cacctcttct ggaagcagga acccatttgg aagacttcca aggcaaaaca    180300
     ccttcggcat acatttcgtt aacctcttct agagttaaac cctttgtctc tgagacaaag    180360
     aagaaaacat agaagtatgc aaaaaccata cagcccatga aaacatatcc gtagtagaag    180420
     ttaatggcat tggtgatgaa tggagtgaag aaggcaatca agaaacccca catccagtta    180480
     gcagcagttg caatggacat ggccttggcc ttgattctca atgggaaagt ttcagagata    180540
     ataacataag cgattggagc ccaggtggta gcgaaacaga agatgtagaa acaggagaag    180600
     acgatcatac agttaccggc acccttggaa gagccattac cttgaccatg gggccataat    180660
     cttgtgacac caacagaagc atagacaacg taacagcaga ccataccgat agcaccatac    180720
     agtaaacagt tacgacgacc gaaacgatcg acagttagca aagagcaaca ggtggagaag    180780
     aagttgacaa caccgaaaac aatggaggtc tcgaaggaat cttctaaacc aacagccttg    180840
     aaaacaatag taccatagta gaagaagtag ttgtcacctg tcaattgttg caaagattga    180900
     atcatgatac ccataagagt acgtctgaac atagctggct taccggtaaa taattcgccc    180960
     caagaagcag aacctgcaga tctagcttca tcaacactag cttgaattaa gtctagttct    181020
     tgttggatgt atgggtgatc tggggaacat ttgttgattc tggccaagga tgatctggct    181080
     tcttcaattt gaccagcttc aaccaaataa cgtggggatt ctggaacgaa ggtcatacca    181140
     ccgatcatga aaagagccca ggcgaaacat agacccaatg gaactctcca ttggacagag    181200
     ttagtgtagt tcttggtacc gaagttagta cagtaaccca agaaaatacc caatgtgatc    181260
     atcaattggt agcaagaaac tagagaacct cttagatcac ttggagcgac ttcagaaatc    181320
     aacattggag atagaacaga gataccacca acacccaaac cagagataat tctaccgatg    181380
     aagtattggt accacttgtt aatggaagcg atttggatga tgataccaac gatgtaaata    181440
     acaacgacaa caaccaaacc catcttacga cctttagtgt caccaagctt agatagaata    181500
     ataccaccga tggcacaacc aatattgaag atagagacaa ttaaaccagt tctgaccttg    181560
     gataagtatt cagttccgtc aggatgcttc ataccaaatc tgtgaatgaa atccttttgt    181620
     gcgacaaaac cagaaatagt accggtatcc catccaaaga caaaaccacc aaaagcgacc    181680
     atgaaacaac tgataatgac accgacaaaa gcacctttac cagtgtttgg gttggcaatc    181740
     atttcgttct gaacaaattc gtcagccata tcattcttgc cgacttggtt tagatatttg    181800
     gattcatgag aatccacctc atttgaagaa gaggattttt gtggacttat caaatccggt    181860
     tgagaattca taatgtttaa ttattgtgtt gtttttttat ttgttgtaag ataaaaataa    181920
     ttgaaatgag ttaaccccag atgaaaaaca tcaatgcaaa aaaatacttc tgggggaaat    181980
     agttcctctt ttatactcca gaaaaatttt tctcaattcc cagttcgtac cttacttcca    182040
     ttattgacgc atttactatt ctcgtttcgg ctcctatatc gcaatgaatt tggggaatat    182100
     gttagtaaac aatatcttca cgccattgtg gtgtgtactg atgttatgtc acccatacta    182160
     tgctatctcc tttcttttca tgtcggtcag tataattagt gcaatatcaa aaaatctcgc    182220
     gggtacgaat gtacccgaaa gcactctaca ggctacttgc aggtacgatt atgttttagc    182280
     gtttatgtta ttagtgccgc tgtgggaaaa tgacatatca aaaagttttt ccgaaaatga    182340
     tacggctgtt tcactgagtt tttccggctg atgcagggat cgatgttttc ttaaaaggct    182400
     ttttctttct ttttttataa tttgctatat aatttcgcgc aaaccttcat ttttacggag    182460
     ttcccacgga aaaactctcc tgatatttta gtttttccgt ggtcaagcga gatttttaga    182520
     tctgaattgg gactatattt ggcccaatga cgccatatct gcaggaattt tacgtcatat    182580
     ctacatttcg gagagatgag gtcaaattag ggcttcctgt atcattgttt tttctatatt    182640
     tctgagatac cattgtttgc tattgcaaga aattgccgat cgtatattgg cgggtaccaa    182700
     ttgcttcaag aatcggtaaa gtcatattat tcaggtgtta agttttaatt gtgatattag    182760
     tttcttggta tcttaatttg gaacagaact aatgtttgaa ttgtcgtttt tattatcatc    182820
     ttttctaaag ttttgtcata tatttgagct tgataagatg aaccttgttt ttgagacaaa    182880
     tcgaaagtct agcgaggcca aaaacctgaa atttctcacg cagtaatctt tacgagattt    182940
     ctttgtgagc aagcatctcc cttaagatat ttcttgcacc tcttttgtgt gttatagttt    183000
     ttccgatgca caaaaggctc atcaaaaaag gcacctatta taccatttga ctgttatcgg    183060
     gattttaatt cagatatttg tgacgcgtta acttgaataa aactattaat aattccgaaa    183120
     taaataaaag ctcgtgttag tgattggcga tctaatagaa atgtattagc cgagtttctc    183180
     catcataata tgtctcgctt ttcctctgtg gtacatgttc cctaggaacc ttttgaagct    183240
     ggattcgatt aaaataatat attcttcgtt aaaaatattg cgggacaata ttactttgat    183300
     attactaggt catgcacatc tgggtttacg cgtatacagg cgactactgt caaacggatc    183360
     cgtgcattat attttggtga tgtttttgct attgtttggt ggaaatgttt ctcaaaaact    183420
     cttctaccaa aagcctatca catatagaaa tatgtcagtc taagaaagga atgaattggc    183480
     cttagcattt ttaaaggctt tgggttaagc ataaaagatg aattattcaa atattaccca    183540
     acagtgccct ctttaattcc aagacagata gaaaaccatg catctagcat caattcagtt    183600
     tgttatgaac ttcatatgcc gatcttgacc atgaacaatt ttgctattta acctcaccta    183660
     taatggcaat tatttttgca ccagcggcat gtcaataata gaatggatag cttgtttggt    183720
     attaatgata tattggctaa atgattggtg aatattggtg aaaaagtgaa aagtggatta    183780
     aattaaaaaa ttacaaaatt tttttgatat atgattatta gtgtagtcat tattattatc    183840
     aattttaaaa caatagatta gagaataaaa aaaaccttgt cattcattaa atgtttgcat    183900
     ttaatagttt attaatagtg tgtaatattt gtgacaccaa tgcaagctca atcaacgttt    183960
     ttaaaaagtc ttgtttatta ttattgtgga aataataaaa ttgctgagat tatcaatttc    184020
     ttgagaatac tctcttatac catggcttat catcgtggga atagtcatcc aaattgtact    184080
     cggcagttct tctgtctgga ggcacccaac tggatgactt ccatggaagt acaccctctt    184140
     catacatttg attaacttct tctagagtta atccttttgt ttcagggaca aagaaaaaga    184200
     cgtagaagta tgcaaatacc atacagccca tgaagacata tccgtaatag aaattaatgg    184260
     cggatgtgat gaaaggagtg aaaaaagcaa tcaagaaacc ccagatccag ttagcagcaa    184320
     tagcgatgga catggcctta ccacgaattc ttagtgggta tgactcagag acaataacat    184380
     aggcaattgg tgcccatgta gtggcaaaac agaaaataaa gaaacatgca aaaacaatca    184440
     tacagttacc agcacctttg gaagagccgt taccctcacc atttggccat agtctcgtta    184500
     caccaacaga ggcatagaca acgtaacaac ataccatacc aacacaaccc cacattaaac    184560
     aattacggcg accatagtgg tctacagtat acaaggcata gaatgttgaa acaaagttga    184620
     caacacctaa aacaattgca gtttggaatg aatcatctaa tccaacagct ctgaaaatgg    184680
     tagtaccata gtagaagaag tagtttgcac ccgttaattg ttgtagcgac tggatcatca    184740
     tacccatgat tgtacgtctt aacatttgtg gtttacctgt gactaattct ccccatgatg    184800
     cagagccggc cagacgttca gcttcaactg atgcttgata tttgtccagt tccaaaagga    184860
     cgattggaga atctacagtt gttttattgg ctctggcaag agaacgcttg gcttcttcta    184920
     acttgcctac ttccacaaga tatcttggag attcaggaac acacataaca ccaaatatca    184980
     taaataatgc ccatgcgaaa cataacccta atggaactct ccattggaca gagttggagt    185040
     agttttttgt accgtaattg gtacagtagc ccaaaaagat accacatgta atcattagtt    185100
     ggtagcaaga aactaatgta cctcttaatt gttttggaga aacctcagag attaacattg    185160
     gtgacaagac agcgatacca ccgacaccta aaccggagat aattctaccg atgaagtact    185220
     ggtaccattt atcaatagag gcgatttgga taacaatgcc gattgtatat acaaccacga    185280
     ccgtaaccaa gcccaatctt cttccccaaa tatcaccaag ttttgaaagg gtaataccac    185340
     caatagcaca tccgatatta aagatagcga caattaaacc tgttctaaca ttagacaagt    185400
     aataggtacc atcacttctt tgttgtccaa atcttctcag aaaatctgtt tggttaacaa    185460
     aaccagaaat agtacctgta tcccagccaa aaacaaaacc accaaaggca accataatac    185520
     agcataagga gacaaatatt aggtcactct tctttttgtg gtgcagttct tcttcaacct    185580
     ccttttgaag ttcttcctta gggccgctga tcatactatc agtccttgtt tgcttgacgc    185640
     cgttggcatc gtaaatataa tctgaacctg actttgagcc ctcatcggaa attgtggctt    185700
     gagttggtgg gatatatcct gcatttgttg tctgagtggg tggtatatac gctgggttcg    185760
     tgggatcaac gttggacatt gtggctaaat tataatagaa ttaattttat caaacgctaa    185820
     aaatataaca ctttccaaaa tttaaaggat taaaaaccta tgaaatataa ctgttaacac    185880
     ttttgtagta tttggtcaat tttaatgtta tatggatttt ttattgcaaa aggaggccaa    185940
     cttcaagagg agttcgatat atacataact cgggtgatag tttgaattac ttttatacta    186000
     atttggagga acatttttag agccaggtgg tgttcgatta tccggctgtt tttacaatag    186060
     attacatttg taatgccaat ttttagggat ttttactgtt gaaataagtt ctcatagaac    186120
     aatcctgctg gtttgtatag tatgaagcag ttatttggaa atgctggcct atttacatta    186180
     cctttaaacc cctcagtaca ctattgccat tatactctag tagagtggca caaatttccg    186240
     ctactttgat aattggtatc cctattatat tttgcaagtt gatgtaaaga tgagcaaata    186300
     ggctaagaat gtggacgata tttctggcga tacagtcatc cctagcagtt taaatttaac    186360
     cttgtagcga actgctgtta tattagaggt gcagaactag ttttgttgct atcgtttact    186420
     atttttaccg tgtgtatgga tgcactaacc cctgcttcaa ataactataa taatgtctgt    186480
     atacatctag agtacaaagt ctattttctc cacaccagtg ctgatgggca actttccata    186540
     ttaacacgca gcacattacc gtctatctaa attaacacct ggactaacgg caataattct    186600
     aaggtttgtt ctaatatcaa aaaggaattg gtgttggaca aggctaggtt gctacaatga    186660
     atatagttac atataccttt ctcttcctct aaactctcgg agttccaaga actgcaagta    186720
     tgaactttgt acactgttga gagacccctt aaaatatagt tacggggagg agttgctgtg    186780
     tctattaagc ttctgacaat acatgcttgt ggtgagaggc tattatattg gctaattaat    186840
     ttgttcatat tcagctgttg tattgtatga accccgtttt tatttctaac agctttaacg    186900
     cttagaatcc cctacaggag cctcttcact ttagggtaaa ggtatctgac ctcactaaaa    186960
     ctccgcggta tgatgcgttt gcgggtttag ggtaaggcaa cgaaggcaat tttagaaaaa    187020
     taaagtttat attgctatgc agcaacttct agcttatttt agtttgttgt ggagcggaaa    187080
     aactaccctt caaatgatca aaggttgtat ctcttgcact gaagagcccc tacagattaa    187140
     tttcgctttg gtttctctat ttaaatatta tgccggtgtt tcctacgagt gtttctgaga    187200
     acatcggtga aatttaggga aaattgcaaa gttcttccct gttgattggt gccaagacat    187260
     ttgaacaatg ggagcacaga aatggtgcgg aaggttctgt aagaaaatag tgaacagttt    187320
     ttccggattc tccgatcttt attggctgca aaatgtttct gcggggttca taagtggaga    187380
     tgagcctcac taatttttac ccaaaaaata attattgtgc agcattttct ctgtgacgga    187440
     agaagagtga ccactggttg atttacccgg cttctacact tttaacaaaa gtcatgggtt    187500
     tattgaatgt cttaagtatt tcatgttttg tagatgtcag ctcactaaaa acagtacaac    187560
     tgccctaatt atttgtatcc acaatcttcg tgcggtgaaa ttattgtttt cctcattcat    187620
     tgaacacatg ttttctatta tcattacaaa ttatcttttt atatactggg gtggctacca    187680
     atattgaatg ctacgttggt tagtagcatt cttcttggat gggggagttt gttatagcgt    187740
     taaatattta aagtaataac ggtggagaag agagcttata catcttttct actccagcaa    187800
     acaaagaagt ggcactctta aaggttcata aaaaatgtgg ttatcctatg agctacagca    187860
     tatatcaacc tatcccatac ttagttttca gatttccttt taaaattgaa caaatttttg    187920
     gtggatatcg tctccaccac gactcttcgt ggagatcttg atgtaatctt ccttcttcaa    187980
     tttctcctga atttgcctat gcaaagcaac gaaataattg tcaccactct cgatcatgtt    188040
     gatactcttg tcctcacata atacctgact gataatagag ctgtaatatt gatcaatgtt    188100
     tggtctcaat ggaataattg gcagagattt cttattaacc atttggcccc aatatctaat    188160
     caaattaaat gccttgttgt taatctctgt acctgtctca ggtagcatac ccccatagag    188220
     tgttatttga ttgataggga aatctgggtc aattccaaga agatcttgca acaataatct    188280
     attagtgtgc acattgaacc acaagtacac ggaatcacca ttgaagatca agtaacaacc    188340
     tccatctgtc aagtttgaat gcatattacg gacagatact tcatcaagag aatcctcttg    188400
     aatctgtaat agtttatcat tagcatcgta aaaagagaaa tcattttctt ccagcaaaac    188460
     atgcattgga attatttgtg ggtataattt gtatagtagc tccgctgggt ttattgtctc    188520
     atatctgatc aaatcataca ctctctcatt accacgagtg ctttgttggt taggtttcat    188580
     caaatcctgc ttttggaaac tcaaaatata agatggtaga gtctttagtg agtcaggtaa    188640
     aacaagttga gaagagctgt tgccgctaac caaacctctg tattgggtca aaatatcgac    188700
     cagtttggta tcgagagact ttcttatagc tgcgaaatca caatcgccta acgtcctgat    188760
     aacatccttt acaatgatac gcaaaacact attttgattc acgaacttaa atacttcacg    188820
     aacattattt gaaaccgcac cattagtatt caaggaacga acttttctga taccatgcac    188880
     atcagtatac aacaaagcac attggaaatg tatatcggta ccggccttca acttttcttg    188940
     atatttcaga agcacatcaa tggtcgtatc tttggttaaa acaggaagaa tcacatcttt    189000
     atcagtgtag ccagatgcat ctgtatagta catgtccaca ccgacaccag tggaacaacg    189060
     tagttttaac acagcttggt aaccaactgt attagcaata tttgatacca tatcttggac    189120
     caatctcgcc tcgtcattct gttgtataaa gtgtggatag tacttaagag aaccgtgagt    189180
     aactagagtt ggatgaccga cattagtcaa atcaacaaaa ccaccacttg taacaattaa    189240
     atctatggaa acatagctgg ctaataggtc atgtgcaagc tttttgtaaa agtcgttatc    189300
     acatctcata tgatgaacat gtgcattgtc cttttttaaa tataagttac cattaccgat    189360
     tgttggtagt gagttcaaag aacacacaac tttaccaccc tcgtcacctg tgaaggtttt    189420
     caatgctaat ttcgcagcct gaatagctga cccgaaacag gcctgtggaa cgtggtagta    189480
     cttgtcgtta gtaataaaag cagccaatct acttagagtt tggtcaatga catgcttaga    189540
     ttcagcaggg tctgcaaata agccattata gaaaggtagg aatacatcgt ctaattctga    189600
     aatcacgtac tcttgggctg tctctaattc aggtttcaga ttgaaaaact tcaatttgtt    189660
     gtcatatgca atgatagcaa gtttacagtt tggttgattt tcgataatgt agtcaacaga    189720
     gcttctgata ccttcaatga cagccaaaga actaccattt tcatttgcta atgatgtaac    189780
     atctatcaaa aagacataat gcaatggtac acttggttta tctgggtgtg cattatagat    189840
     aggtggaaca atgaaatcga cagcgccttt agataattca ggcctgattt ctgcatcagt    189900
     tctttgccca tttggaccaa cagcactgga gtaatcataa ggtgctggct gcttaatttg    189960
     acaaatatta caaatcgcct tcgaatcata gttaaattga aacttgggat tgatgtaaca    190020
     acggcaacgt ttacatctca ttggaccttc taaattcttc atagtatctg cagctatccc    190080
     atcaccagaa actggaacag agcctggtgt aatatcagca aaaggctgaa tagtaacacc    190140
     caaaggcaat ttagttgctg ctctcaaatg ctgatcctcg gggatgttat acatggacaa    190200
     ttgcatcaat cgaggatcac acgaaccaga gtcgctagag taaaactcag tggtagacga    190260
     tggcggaacc gagtcccttg tggtatcaaa tgctttagtc aaataacgaa gttgctcttc    190320
     ccaacgttga gtgggaacaa tatgagagaa gacattttcg ttattgccat tggggaaaaa    190380
     ataacctggt gagtgtgctc ttggagaagc attaccaccc attactggtg tcctaggagg    190440
     gttaccatac tgcaatactg gtgaattaac agtctggctt tcaaccctct ttggcgtaaa    190500
     aactccattg ttgtctgcaa cttttggagt ttggtaattt gattgaaatg catacatgtt    190560
     cgtagttgga gaagattgca cagggttgcc tgagaaagta tgaaaagccc ttgttggtct    190620
     cttggactta ccctttttca attcattact ttgggattgc tctaaggaaa gatccgacat    190680
     ggacccagct agctcaaaag acatggtcca ataactaaaa tggagaagta aatagatatg    190740
     gttattcctg gctctttttt agtcccagaa aattgaacac ttgcagaagt agaaggtttg    190800
     atgatcgatt ccaaggtaaa attccaaggt ttttagtttc cttttagatt tatcaggttg    190860
     ctttttaaag ctgaatctct gaaacacaac tgcaattaac agatcctctt acagaattcc    190920
     tattttttac caattaagct tccaaaaact ggtgaacaat ggtattattc ccagttttgt    190980
     tcagcatttt gatctacgtt ggttgacaag tcgattggat tcgcaagttt cccacttcga    191040
     acgtcggatc gtcgtgcaag tctcacgacg tagtaactga tcgtcacatg attttaaaac    191100
     tcatacagtt tgatatttat tatgttaaat actcatctac tagcattgaa gatagcattt    191160
     actataccta atgcatagtc actcttctat ttatgtcttt ttatgtgatt actatatccg    191220
     cggggattcg cgctctctat tcccgtaggt ttgacatgac gtgcatataa aggatcgaga    191280
     aattatttgc tgtaaacgat cgtaaatata cctaccggaa catacactaa ttaatcagca    191340
     tgaagaaata tcccacctag tgttattaat attcagtaga cactgagctg atggagccct    191400
     tctgttaatt tcgtaacgag aaccgttcag gcaagtaccg ttattcagct taaactgttc    191460
     caagtcgctt gaagagctac aaagcttccc gttaaacaag gaagagaagt ctacaacttc    191520
     agcaacattt cggaatcctc ttctgctctc accggttagg atgaattgca acccggagct    191580
     atcaggtgtg gtactaataa catcattgga gaacaaaggc actgatgtag gtaatctatc    191640
     ccaggtagca cccatattca aagagtacac aaaaccagtg gtatttctca agccattgtc    191700
     ttccgcaaca atgatgttac caaagttacc aagggcaact gcctttgagt aatctaatat    191760
     ttgttcccac gtcataccac catcctttga caggaatgtc gtggtcaaaa ggtagaaatt    191820
     atcgaagtaa tcatcactat cagtttctat atccgttaga ttgtaatcgt catacaagtc    191880
     atcaagatta gttatattga aggtcctgtt gaagtcttgt ggagttaaat taatatttcc    191940
     ttgcgcgacc atgataccgg tctttgaata tcctagaatg gcggacaact gtaaggtaca    192000
     gttgttgtgt gcaatacaag agtaatttcc ctttacacta gaactgttga ctttcaaatc    192060
     attccatgtt gcaccattat cagttgatat ctttgatgtc gagttccata taccaagagg    192120
     agccatgatt atagtaccat ttaaatcccc gaaagtgtag agttggctga acaatgagtc    192180
     actgtagctg atattagcac tagtgaaatt caaccctgta gaatcagaaa taaatacaga    192240
     agaaacatta gtagaactat tagaagccgt actattcgtt acctccgtaa atcccaatgt    192300
     gaatggtgag aagccattac taaatattaa cttacctccc attatttcac tcactgagaa    192360
     gacattgtaa gtaatggctg gaatgttagc cctattgaaa tccttaccat ctttggatac    192420
     gtaaagatca actgttctga acaattcaga tatttgacta aacagatccc ctattgcacc    192480
     atcaatacca tcgattccag aaataccgtc aatgccagga ataccatcaa caccaggaat    192540
     accatctaca ccatctacac ccggaacacc atcaacacca tctacacccg gaacgccact    192600
     agcacctgga attccacttg tacctgggat gccacttgcg ccaggaatac caggcatacc    192660
     tggaatacct ggaataccac taataccagg aatgccgctg aggtgtggta tatcgctaat    192720
     gcctggaata ccactaatgc tagggaatcc actaatacca ggtataccag ggaaatttga    192780
     aattcctggg aagtcactaa cagttggcgt aggaggtaag tcatcactat catcagaatc    192840
     atcgtcgctg tttccgttat catctccaag attgaataac caattagcag ctgtagtatt    192900
     agcggtctgc atgatcacat atgagtctgt tatctgaaca tccaaaggat aaattccaga    192960
     cgataaatta acggcttgca aagttacacc aaaatctcct gagaaaaata cagtattatt    193020
     gaagcccctg ttagtagatg tgaagaaaca tactaaatca ctactgtttt tgaatttagt    193080
     ggttggagta gatgccagga agtgacataa gaatttgtca actacactgt cattcaagtt    193140
     aggaatagat ggctttattt ctctaaaaga tgtaccgtta ttgaccgata tgaatgatct    193200
     accacggtag tgttttgtat ctaacacctc gatgaaatta gatataatca aactcttatt    193260
     gtgtacgttt gtagacacat caaagagcat agaagagtta gttaagtttg aaataggtcc    193320
     agatgtttca tttctgccct gggcgtcaaa aacgtagaac acattcttaa aaccataaaa    193380
     tgctcttgat tcactataca aaggatcaat aattacttca ggttcatagt aagattccat    193440
     atcatcaaag tattcactat ttaggaaatc gaagtagttg aatgtcctat tgctaccatt    193500
     atgtctctga ggtgtcgcag tattgttaag caaaacagtc cagtttttac cgtagttatt    193560
     actaaacaac acagaagagc tattgtatct cagcaaactg cttgagttac tgaagacagc    193620
     aacactctca gactcagtag cattgaaaga ggtagcattt ggtgtaaatg cacatgaaag    193680
     cgatgccaat gcgcacaaaa atatcaacga atatatcatc tttttgcttt attgtcgact    193740
     ttgaatacgt taaaatttaa acaagacatt gaaggagata ctttttgaag atagaattgt    193800
     catacctctt ttatatgttt tctaaaacca attaaaaatg agcgaattaa gttcaaagta    193860
     tggactgaaa tttccctgac catatccttt tatttatgat cttttagtac cctttaattt    193920
     tgtaagagca atgatatatc gttattgatt cataattgac agttgcaata aggctaggga    193980
     attttgatag acaggacgca ttgctatgaa agcaaagtag catgtgcgat atttttatga    194040
     tctaccttga ctgaataagc ctgttcatcg ccaagccttc attggtgtta ttttggctgt    194100
     ctcattgttg tgcatgaaga ggaactaatt acatattgag taacggaaga acgccttaga    194160
     gacattcttt acatctaaac ttcatgatcg gtaataaagg gtagtgacaa tttaggggtg    194220
     gcatcactcc actgagtgaa ttaccgttaa cacataaaga atctatgctg ttgcaaataa    194280
     tgtaataccc aattcagcaa attcgtaatt ctcaagccaa tcagccctta ctgaagtcag    194340
     aatccctaat ttctgtgtca tacttttgac atgtattagt gagtacttaa gggtactatg    194400
     acgtgagcag taccctttcg cagcagcact agatacatta aaaagtcatg tcctttaccg    194460
     caagtaaact atcggccatc tgtagttaaa aaccctcaac agacacggat ccatacatac    194520
     tctgcatact tatttttttt tataacaccg cctatccaaa tgggacactc cccacaaaca    194580
     catcacagac acaacaaagg aaaacaatcc cctccagagt ctgcattaca aaagcctgcg    194640
     ctctccacca cctacttgac cctcagtggc aaaggacccg gcgtgctata cacagcaaat    194700
     gtagagagac cccaggtctt tacccaccta tctcactact tgggcatagt tttgctctcc    194760
     aaagtagcat ttttaaaggt ttttcctaat cgggtaatag atcacgtgat aacgatgctt    194820
     tcctagtcaa atcggcattt tcagtgttgt tttcccaaat ttttctcttt cccgtttggc    194880
     atcgccatcc agtttggcgg gaaaaaaaca atacaatttt agaacacaac agtgaactag    194940
     atctgagcta tatttctaag cgccgaactc aattaccgga gtgcataact attgtgatcc    195000
     aggacgcgaa acacgggtca gaaggatctt ttcattttgt tttcgaagtt ccttaagctt    195060
     atagattttg cttgctctgc ggaagcattt ccgagaatac aactttaccg ctctggatat    195120
     tgcatagact atatagaaag caagaatggc gtccgctgat cagattagtg agtatgccga    195180
     gaaattgaag gacgaccagc agagtctggc gtcgcggtac tcgacggtgt ctgagctgta    195240
     cgatttgatg cagttactga acacgcctga agaatttcaa atgtttctca cctctatggt    195300
     gcctatcatc ctggagcaat tggaaaagat tgacataagc ttcgagtcca actcctacga    195360
     gcagaaacta aggttttcct tgctggaaat tttgaacaag tgtatggtga accaaagctt    195420
     tgagccatac gcggtcagag tagcagatgc actactagat attcttccta aggaaaacga    195480
     aaagaacggt gttataataa ccaagattct gactatactc ttcaagtcat tcaagaatat    195540
     tttgggtgaa aaggtgaact ccttcatcga tatcattatc caattctata agaacaggcc    195600
     cgagcttgtg gagaagactt tttactccga tgaaaatggt gggttggaga actccagtag    195660
     taatgatgat gacgatacaa ataacaattc caatgatgaa tctactatgg agtctaataa    195720
     cgatagtacc aacatcctgg acgtcaagag ctcaaggggc tctgtggatg atgatgttca    195780
     cgagaactca accaaaggtc agaagctcag accatcttta cactccttta aaatcttatc    195840
     ggaatgccca attacaatgg tcaccttata ttcttcctac aaacagttaa ccacgacttc    195900
     attgcccgag tttgctccat atattatgac tttattgagt attgaagtca aacaacagaa    195960
     acaagcaaga gaggaagctg agaagagagg cgaacgcttt gtctctgtat caccactaat    196020
     taatgataaa gcagcataca acgacttcat cttggctcaa attaaagcta catcattttt    196080
     ggcatatgtt ttcattagag gatacgctgc gaactcacta caaaattata ttccaattgt    196140
     gcctgatttg attatacgct tgttgcaaga ttgccctcct gaattgccat cagccaggaa    196200
     agagctgtta catgcaactc gccatatcct ttccacgaac tataagaaat tatttcttcc    196260
     aaaactagac tatctgtttg ataaaagtgt ccttataggc aatggcttca caatgtatga    196320
     aactcttcgg cctctcgctt acagcacagt tgctgatttt atccataaca taagatccga    196380
     gctaaaactt aatgagattg aaaagacaat aaagatgtat accgaatatc tcatggacga    196440
     gtcccttgcg ctcacagtgc aaattatgag tgccaaatta ctgctgaatt tggtggaaag    196500
     gatcctgaaa ctaggtaagg aaaatccaca ggaagcacct agagctaaaa aactcctaat    196560
     gattatcgtt cacgcctatg ttactaggtt caaaaaatta aatagacaat acaataccat    196620
     tatgaaacag cataagaaaa ttgaaaagga gaaaaatata aaacagcatt caaaaaagaa    196680
     ccctctacca gaagttgctg atgataccga caatttcatt aagtcagtat tgaaggagaa    196740
     ttacctggaa gacactaccg ccaaaaataa ggaagacaaa tcagagggta aggtagaaga    196800
     gattgaagtg gatgagcctg taaatataga actctttgaa ttgcacgatc ttcttccaat    196860
     tcagctatcc ccaaagagtc ataatgaccc tgttaaggat gcattttacc tttacaggac    196920
     tctgatgtcc ttcctgaaaa ctgtggttta cgatctgaaa atatttaatc catcagccaa    196980
     tgagtacacc ctagctcatc caaaactttg ggcttctgta tcaagagttt tttcatatga    197040
     agaagtttta gtattaagag atttattcca tgagtgcatt attgggctaa ggttcttctc    197100
     tagtgaaaat cctgttaata aagacctcct ctcgaagaag cattttgata ttacaatgcc    197160
     aagcctccct gtatcagcta ctaaagatgg tagggagttg atggattact tagcattcac    197220
     ttttatgcag gtagatagtg caacatttaa tgaagttgtg aacgccgaaa tggacttttt    197280
     atatgataga atgctagaag attcagcgct attacatgta gcacaatctt ttctaacaag    197340
     cgaattaaca tctccgaact ttgctggcat actgctcaga tttctgaaaa gaaaactgaa    197400
     aacattgggc aacactgatt ttaacacatc caatattctc atcagattat ttaaactttc    197460
     atttatgtct gtgaacttgt ttcctaatat taatgaaatt gttctattac cacatctcaa    197520
     cggactaata ttagattctc tggaatactc caaaactgct gaagaaccgc tagtttactt    197580
     ctacttgatc agaacgctat tcagaagtat tggaggcgga aggtttgaaa acttgtacag    197640
     atcaattaaa ccaattcttc aagttttatt acaatccctt aacgagaaga tcgtttctgc    197700
     tagattacct cacgaacgcg aactatatgt ggagttgtgc attacggtac cagtaagact    197760
     gagtgttttg gcaccctatt taccatatct gatggagcct ttagtatatg ctttgcaaga    197820
     atatcctgat ttagtatcac agggcttaag aactcttgaa ctatgcattg ataatctgac    197880
     tgccgagtat tttgatccaa tcttagagcc agtagttgat caagtctcta aagctctttt    197940
     caaactgctg cagccacagc cctttaacca cacaatcagc cataatgttg ttagaatact    198000
     gggtaagcta ggaggaagaa atagacaatt tttaaagaca cctaccgatc taaaaacagt    198060
     tgaatcatta aatgtcgatc ttgttacaga agcaatggct aatggtaaaa atggctcaat    198120
     gtcactttct gttactcctg gtgttgaggc tgcggtatca attattgaaa atcatgcatc    198180
     agatttggag gccaaattaa gtgcttataa gtatttgaaa tcggttttct tgctgtttat    198240
     caaatcttcg actaagtttc cagatgatta tcacaatata atcaaaaaag caattgactt    198300
     gttacagcaa gacaaattag aattgaagga ggattattct ttagagtgtt acgttcatag    198360
     gaaggaattt tatgatcaag aggcgcttct gataaagata tttgaatcta tatttctggc    198420
     aacctctaca cctgaattaa aagaggatgc aatgaaatta ctaaataaac ttgctgacca    198480
     tttctccttg ctacaggtca ataaagctct gcaacaaaaa cggttccagt cagacacatt    198540
     taacatagat atcaaatact ctgatccgat gttttcgacc aatattctca caaaagctct    198600
     catgtcggca ctatccagtt ataaggaaga tgtaagagag tccagtatat tgacgataaa    198660
     gagaatttgc gaaagaagtt tacttatctt tggttctaaa ttagtcttta aatactcatt    198720
     agtcccagac ctgatgaaag atgcaattca tctgtgtttt gacgaggcat tttacaataa    198780
     aagagctggt gtactaggta ttggtgcaat aatagataat atagaagcat cagaggagta    198840
     cttaaagtct ttgagatttg agctaattga tggtctgctt tttgttctca aggatactcc    198900
     cgaagaagct cccgttctta ttacaaatga ggctgaaaac ttattcaaca aaatcttaga    198960
     gagaacctgt tcggaaatct cggaagatga tctctcatca aagggattac aaaacacctt    199020
     aactgatatt gtttgtgaac taagtaatgc caatcccgta gttcgtaaag catgtaagaa    199080
     tgctttagaa ctaatttcaa aaaattctaa tatgcctatc gtcaaattaa tggatcattc    199140
     gaagcacttt ttgctctctc caatctttgc aaagcctttg agggctctac cttttactat    199200
     gcaaataggt aacctagatg cggttacctt ctgtttaagc ttaccaggaa cttttttgca    199260
     gtttaatgag gagctattta gactgctaca ggaagcaatt gttcttgctg atgccgaaga    199320
     tgaatcacta tcaacagctc agagagctgc agaatataag acttcccaac aactgacgca    199380
     attgagagta tcctgtataa aacttcttgc acttgcttta aaaaacgaag acttcgccaa    199440
     tgcacagcag ggtaatatca gaattagaat actggccgtt ttcttcaaaa caatgcttaa    199500
     aacatcacca gtcattatag aaactacata tgaggcacta aaagatgcac tctctgaaaa    199560
     ttccaggctt ccaaaagaac ttctccaaaa tggtctgaaa ccacttttga tgaatttatc    199620
     tgaccatcaa aaacttactg ttccaggcct tgacgctctt tcgaagctat tagagcttct    199680
     aattgcctac tttaaagttg aaataggtaa aaaactacta gatcatctta atgcttggtg    199740
     tagagtggaa gtacttgata ctttatttgg tcaagacata cacgaacaga cacctacaaa    199800
     aattattgtt agtatcatta atatcttcca ccttctcccc ccacaagctg atatgtttct    199860
     aaatgattta ctactgaaag ttatgttatt ggaaaggaag ctgagattgc aaatcgattc    199920
     accttttaga gttcctttag cgaaatatat gaatcgtttt agttcatcag tgatagaata    199980
     ctttaagaag aatatggctt taagacagtt ggttgtattt atgtgtagca tcatacaaaa    200040
     agaggaagcg aaagatctag caacccgctt tgaaaatgaa ctatcaaact tttatgaatt    200100
     ttatatgaca tcgatccctt caaaccaagt ccgtgtggtg agctttttaa ctaacatgct    200160
     cgatatattt acaactgttt ggaagatcag aggtaatgaa tggctgaaag atcaaaagga    200220
     ttttgtaatg aaactaaaag atatggttgc attgactatt gacacaataa aggagaacaa    200280
     attttatata gaccatctgc aactgtcaca atccattgag aaattccaat tcatatatgt    200340
     caacttgcta acacattacc ctaatgaaca atcattattt tttgaattta tcgagttttt    200400
     aaatgccaag gatatctgta tgactgactg cttcgatgac ttcatcttca aaaatattgt    200460
     gtccttgtct gataaagaca aacaaaatag cttacttgag gagtcaatag aatactctct    200520
     aaaaactaaa tcattaaatg tgagtgtatt catctacaaa aaaatagtca acccatcact    200580
     aatatttgaa gttgctcaaa accaagatct taaatgctat ggtgaagcaa aattgccagc    200640
     ctggctcgaa cttatcgact ctaaaatttg gaagactaag aacagcttat tattaggtac    200700
     caccgcaaat tgccacgaca agtttaggtt tgagttgtta caactgactg ccatattgat    200760
     aaagtatgca ccaaagattc taactgatgt caaaagagat ataattaagt tcacatggca    200820
     ttttattaaa ctagatgata tcatactgaa gcaatccgca tatttgacaa cagcgcttta    200880
     catcaaagaa ttcgactttc ctattaaagt agccactcaa gttttcgttt cattactgag    200940
     atcaagtcca tcagagggga aatttttagt gaagcagtca ttagacgtcc ttgcacctgt    201000
     gatagatgaa agactcaaga cgacagaaga tccagatatt tggataaatt gggtaaagag    201060
     agtaatgttt gagaacactt cgagtcagaa cattattcta taccagttta ttatagacca    201120
     cccagacttg tttttcaaat ctaggaacct atttgtttca aatataattc atcaaatgaa    201180
     taagatgtct tttatgttga actcaaatcc agagaatcat atacttgcga tcgacttagc    201240
     ttctcttatt ttgagatggg aaaacagatc tgcaggtcaa gcgaaccagc aattattgga    201300
     taaagatggt gatatctcta tgtcagatgc taatgacacc aatgagatta aaactgaaca    201360
     tggtgagggc gaagtcgtaa taagtactat cccaatgaat ttaagagaaa cttgtattgc    201420
     tttcttgata agatatatct gtgccagcaa caaccgtgct tctgattcgg aactgggatc    201480
     tcgtacattg caaatactat cagaattctt atctgagcaa agctgggaga atgttaacgt    201540
     caaattagaa tactttgaga aatttctcct ttcacaagat atggaaacgg aaaacctatt    201600
     atattattgc atcaacgctt tggatgtctt atatatattc ttccaaaata agaccgacaa    201660
     gtggatttat gaaaatcttg ctaacatcga acatttgttg tcgaaatgta ttagagcgca    201720
     tcatcatgat ctccaagaag ctttacaaaa agttctcggc ctggttttga gagctatacg    201780
     cttacaagag agccaggaca gtagtgaaga agaacaacct ggtaagggat ttatcagctc    201840
     actaatcaat gtcatcgaaa aaaatcttca ggagacagca tctgttgcag ctggtgttac    201900
     tttgtcgtgg acattattta agacattccc tgacagtata gaatctttac ttttaccctt    201960
     aatgaaaacc tttagcaaac tttgtaagga tcagctaagc atgactcaac ctaaagatgc    202020
     tgtcgcaatg gaagaagcac aactaactac caaattgcta gaaaaagtct tatttattct    202080
     ttcaatcaga atcggctcac ttggtgattc aagaagaccg ttcttgtcga cgatggcatt    202140
     gttgatagac cattcaatgg atcaaaattt cttgcgtaaa attgttagta ttactcgtta    202200
     ttggatattt aacaatgtca gcttcccaac agtgaaagaa aaagctgcta ttttaacaaa    202260
     aatgcttgcc ttcgaagtta gaggagaacc aacgttatcg gaactatttt acaataccgt    202320
     cttaaaacta tttgacgatg gacaatccac caatccagag attacttcgc gaatggaaca    202380
     acccttcctt gttggaacat gcaccagcaa taaagacata agaaagaaat ttatgtccat    202440
     attaaattcc agcataaagg atgatataaa agagagaatc tactacatta tatgtgatct    202500
     taactgggag tttatcgctg actatccatg gttgaatcaa gcgttgcagc ttttgtacgg    202560
     ttgtttagac tctactcaat catatgaaat cattaatagc tatgaattat caactccatt    202620
     aactttgaag agtcttttag aggaaacgaa ctctgaaagt tctgctgacg aaactactga    202680
     agaactaaca gcctttatta ccactcataa gaatgatatt gaacaaatat gtgaaatcaa    202740
     gaaggctgat atttttgatc cattggtaga aatattttat aaagaccata aatcaattca    202800
     gagggcttgg gttaattttt tccctgaagc ctataagtgc attccaaaag atgaaaagta    202860
     tggcttcatc cgatctttga tagttttatt atcaaaaccg aaccccacca gacaaaattc    202920
     aaacaggttg aatgtaatta acatgtggtt agaatccttt gggaagatag agtcattcga    202980
     ggttccacca catcttgtaa aatatctggc catttcatgc aactcatggt atcaatcgat    203040
     aaatattttg gagtcaatgc agaataactc acaaattgaa aatggaaaaa taatagaggc    203100
     cgttgaagat tccttacttg aattgtacat caaccttcaa gaggaggaca tgttttatgg    203160
     actttggaga agaaaagcca aatatactga gaccaatatt gctttatcat atgaacaagt    203220
     tggtctttgg gaaaaggcac aacaattgta tgaggttgcc caagttaaag ccaggagtgg    203280
     tgctttgcct tactctgaac cagaatatgc gctatgggag gataattgga ttatatgtgc    203340
     agaaaaatta caacattggg acgttttgac tgaattagcc aaacatgaag gtttcactga    203400
     tcttctactt gaatgtggtt ggcgtgtggc tgactggaat acagatcggg aagcactaga    203460
     acaatcagta aaaagtgtaa tggatgtacc aactcctaga agacaaatgt tcaaaacgtt    203520
     tttggcacta caaaactttg cagatacacg taaaggtgac caagatgtac gcaaattatg    203580
     tggtgaaggt atacaactaa gtttacacaa atgggtctct cttccagaga gatacactcc    203640
     cgcacataag tggctacttc acggttttca acaatatatt gagtttatgg aggcaaccca    203700
     aatttatggt aacctgcata ctacgactgt acagaactta gacgccaaag cacaagaaat    203760
     taagagggta ctacaagctt ggagagatcg acttccaaat atctgggatg atgtaaatat    203820
     gtggaatgat ctggttactt ggagacaaca tgcattccaa gtcataaata attcttactt    203880
     gccattgatc cctgctttgc aacaagctaa taataatggc aatattaaca cacacgctta    203940
     tagaggttat cacgaaattg cttgggtaat taacagattt gctcatgtgg ctaggaaaca    204000
     caacatgcct gatgtatgta ttaatcaact tgcaaggatc tacaccttac ctaacatcga    204060
     aatccaggag gctttcttaa aactgagaga acaagctaaa tgccactatc aaaataccaa    204120
     cgaattaact actggtcttg atgttatcag caacactaac ttggtatatt tcggaactgt    204180
     tcagaaggct gaatttttta ccttaaaggg tatgttctta tccaaactaa gggcttatga    204240
     tgaagcaaat caggcgttcg ccactgctgt tcaaatcgat ctaaatctcg caaaggcgtg    204300
     ggctcaatgg ggttttttca atgatagaag attaacggaa gaaccaaaca atattagttt    204360
     tgcaagtaat gccatcagct gctatctaca agctgctggc ctatacaaaa attctaaaat    204420
     ccacgaacta ctttgccgta ttctatggct gatcagtatg gatgactctt caggatccat    204480
     agcaaacgca tttgaatctt ttagaggtga ggtacctgta tggtattgga taacttttat    204540
     tccacaatta ttgacttcgc tgtctcacaa agaggccaat atggtgcgcc aaatattaat    204600
     tagaatagct aagagttatc cacaagctct acactttcaa ttaaggacta cgaaggaaga    204660
     tttcgctgta attcagagac aaactatgaa ttcatcagcc gagaaaaagg ataaaaatga    204720
     acaaatagtc agcaacggag atcatcgtca accatgggaa tatttgcaag aactaaataa    204780
     tattctaaag accgcatatc ccttgctagc tttgtctcta gaatccttgg ttgctcaaat    204840
     caatgagcgg ttcaaaacaa gtaccgatga agatttgttt agattaatta acgttttatt    204900
     aatcgatggc acattcaatt ataacagact acccttcccc aggaaaaatc caaaactacc    204960
     aacaacaaca gaaaacaatt tgatgaaatt tgctaacacc ttgttagcac cttatattag    205020
     acctaagttc aacgctgact ttattgaaag taaaccagac tttgagacat acattaaaag    205080
     acttcgctat tggagaaaac gtctggaatc aaaattggac cgtgctcctg ctgtggaaaa    205140
     cctcgaacga atttgccccc atttgagtaa ttttcaccac cagaaattcg aagatattga    205200
     gattcctggg caatatctcc tgaataaaga taataacctg cactttgtta aaattgcgag    205260
     attcctttct cgcgttgatt ttgtttatgg aactcacttt tcttacagaa ggatcaccat    205320
     tagaggacac gatggtagct tgcattcttt tgcagtacaa tacccagccg tacgtcactc    205380
     cagaagagaa gagcggatgt tccaactcta cagattgttt aacaagacat tatcgaaaaa    205440
     tgttgaaacc agacgtagaa acattgaatt ccatcttcca attgctgtac cattgtctcc    205500
     tcaggtacgt attatgaacg atagttcatc atttgtgaca atgcaacaga tttatgatca    205560
     atattgcgaa aagaataaaa ttgaccctta catgattcag gattttattt ccgaaaagtt    205620
     gaattccgca tatgataagg cacttcctcc acctgatagc actgtcctga aggtagaaat    205680
     tttcagttct atccaatcat tatatgttcc aacgacagtt atgaaggatt atttcttgaa    205740
     tttgttcact tcttttgaag aattttggct tttcaggaaa cagtttgcct ctcagtatag    205800
     tgcatttgta ttcatgtctt tcatgatgat gatcaacagt agatcaccac ataaaatcca    205860
     tgtcgacaag aattctggta atgttttcac ccttgagatg cttccttcta gatatccgta    205920
     cgaaagagtg aaaccattac tcaagaacca agaattgaac ctaccatctg atgctccgat    205980
     tttccataat aacgagccag ttcctttccg tatgacctct aacatccaaa ctttgattgg    206040
     agaaacagca cttgaaggtg tgtttgctgt ggacctgttt actatagcaa aagcattgat    206100
     tgaaccagaa aacgaactaa acacgttact gaccctattt attagagatg aaattatttc    206160
     atggtacagt aatctacaca ggccaataat tgaaaatcca caattgagag atatggtaca    206220
     aaccaatgtt gatttgataa taagaagagt tgcgcaaatg ggacatgtta gttccactcc    206280
     tactgtcatt acgcaattca ttcttgactg tatcagtgca tcagtaaacc ctaggaacct    206340
     agccaagact gacatcagtt tcatgccatg gttttaggac atctttttgg tttctttata    206400
     ctttgtaata ttaacatgta acttaaatga tatacttgta tacataacat tgtttttctc    206460
     cgatgtatat aaaatatctt gatatgctgt tactagagct ttacctactt aaaacaattg    206520
     ataaaaaaat gcgcaagccc ggaatcgaac cgggggccca acgatggcaa cgttggattt    206580
     taccactaaa ccacttgcgc ttagtgtctt attggttggt gaaaaacaat taactagtat    206640
     cagtgctcta agtaaaatgc tcgtgtgctc tgaattcctt catataatag taaaacaaat    206700
     gatttagggt ttacaaagca gtatttatga tattgaaacc gaggcacaat gcgtgctttt    206760
     gcttaacata tttaattttg ggacttttgc caatgaattt tatactaggc actacagaaa    206820
     ttagtgaaaa aaaaatttat caccgagatg aatgcgatga gctacaagaa caaatcaatg    206880
     atattttata ggatcagaaa attaatacaa ttccaagctt tgctatattt atcaaagaac    206940
     atattagtta aatccaagag aatatcgaca aatattgatc atgtcagata cagaacactc    207000
     tacatttgag gacgacgagt atattagcaa accgggcgac gtttaccttg cctttgttga    207060
     cactccagtt aaggaagatg atgaactgac catagaggac acttttatcg gcggggaacc    207120
     agtttggcta gctgaggatt ctttgccccc aaaagatatg ctaagatgtg gtgcatgcaa    207180
     aggatcaaac aacttcaaac tcttgttaca ggcgttctca ccattggaca tagcccaagt    207240
     tgaagaggta caaaaaaaat tgagtgtaca agaccttacc catgtaaatc cagatgatga    207300
     tcgggtttta tatgtattta tctgtactaa gtgtcaaagg aaacccaatt ctgtgcgttg    207360
     cataagaggt ataaaaaaga acaagagtac cacaaaccgg gaaagcgttg ataaaaagat    207420
     gcaacaattg tcagaaccaa aagaatttaa gatcaatcca tttgacatca ccaaaagtga    207480
     cacttcgaat cctttcagca atccttttgg atcacaagac aactcgaatc ctttttctac    207540
     aaacgttaaa agtggagaga tagatgatat aaaagaacct caattatcta ctaaggccca    207600
     actgaaagca gctcagtcag agcatgataa aaagaagaac aaagagtttg acacatcaaa    207660
     agtgttcaag agctatctgc tatacgtaga agaagaatct ttcaaaaata agaaaccaga    207720
     tcatctaaaa ctaccgaaaa acctgaaaat tgataaagaa gcacttgatc taacaggtac    207780
     agacgaagat gacctcgaaa aagatcctat aaaactagat cctagaactg aaaaactttc    207840
     caagttcttg gatgacgata ctttccaaaa gtttcaggaa gttgtcgcat acaatccaca    207900
     tcaagtacta cgctatgatt taggaggtat gcctttgctt tatgccgaca tgaaaacgga    207960
     acaacctcca ttccgtgttc caaatccaag ttacaattct caaagttgta gggtttttga    208020
     aatgcaattg atgccgaagc taataatgga tttggaagat gaaaccgatg ttaacgaagg    208080
     tatggaatgg ggtacaattc taatttatac tgatatccaa aatttcacac cacaatgtga    208140
     tgagaatgat gttgcatatg ttgaagagta tgtaaaagtt caatgggaat cgaggaaata    208200
     acgcgactct aatattaaga tctttcaaca attgttagcc gttagggtaa atgcaatttt    208260
     atttatacaa gaactatgca tttctatacc tatctatgta catgttataa ttataggtat    208320
     ctttgttgtt gaatattttc ataaacctgg ataatatcac ctttttcata attttcaaaa    208380
     ccagaatcaa atgtaatgcc acattcatgg cctttagtca cggttgcgac atcatcttta    208440
     ccgtgtttta atgtcgatag ttttccatca tatactatat ttttgtcact ccctctcgtt    208500
     aattgtacca gtgaatttct atttatctgg ccgttcaata ctttacatcc agcgattttg    208560
     agtttcttct ttttcaaact atattcgaat atatccctaa tctcagctga tgccacaatc    208620
     tttttctcaa atacgggctt caaattgtca ataagaattt gagtaacatc ttcaatcaat    208680
     ttatagatga cgttgtattg tctaacctga acttttaatg tgttatttag aacatcatta    208740
     ggtaatggcc caagattaaa acataatatt gtactgttag taatattggc taattgtaag    208800
     tcactttcag ttggaatgcc tactgagctt gagacaacct tacattgtac ttcctcattc    208860
     cctaaatgcg atatacttcc cacaactgct tcaacagaac cagagacatc tgttttgact    208920
     ataaaattaa tgtcttttac cttaggtatc tcatcttcta catcatcatt ctcaaattcg    208980
     tcaacatcat cggatttctg agcttgcttt tgaagtgcaa cttgcacact ttcctcattc    209040
     attttctcaa ccagctctgc gcctttttca gcatctagta gtttctgtct ttttgtaata    209100
     tatttctttg ctactgattc actttttact tggattatct cgtcacctac atcagggaga    209160
     tctttccatc cagatatttc aactgcttca gcaggtggag caagattcaa ggatttatta    209220
     ttttcgtcac tgcctctcat acttctaacc ttacaataag tgtttccaca aagtaaaata    209280
     tcacctttct ttattgttcc tttcttaact agaactgtag cagcgtttcc gatggtcttt    209340
     ctaactttac tctcgaggat ccagccttcc gccacagttc tgggaccatt ttctgacctt    209400
     atgtccataa tatcactcaa taatacgatg gactcttcaa atgtatccat gttttcacca    209460
     ttctttgcac ttacaggaat aacttgtaca tcaccaccaa ttttttcaat ttcaattcct    209520
     tgtgaaatca gatcattctc aactttttcc aaatatttat ttctttggct tttatctggc    209580
     attttgtcta tcttcgttat tgctacaatt agttgattac ctgagttttt tatgtgcttt    209640
     atggcttcaa ttgtttgcgg catgacagaa tcttctaatg aaactactaa aacaataata    209700
     tcggtaatat tcgcacctct ctctctcatt tttaaaaacg cagcatgtcc aggagtgtca    209760
     agaaatgtaa tttttctacc agagaggggc gttactactt ggaaagcccc aatatgctgt    209820
     gttatacctc catgctcctg ttcaaccatg gaagatttcc tcaaataatc aatgatcgtt    209880
     gtctttccat gatcaacatg ccccataatg gttaccactg gtggacgttt ttttaaaagc    209940
     tttggattta taggtgattt cagctcatca tatacattac taattgtcag agcagacgct    210000
     gatgaagaaa tgtcgtagtt gtactcttgc aaaatcaatt ccgttagttc cttagacaat    210060
     atataattgt ttgtaatact ctcaaaaccc agctttctaa gatctcgaat taaatcctcc    210120
     accctacaat ttattaaatt ggaaagtttg ttcacagaaa tgtagttcgg tatactgaat    210180
     gtcaacggtc tcaattcagc tagcttcctt ttattcttca gcttattgtt cctcgataat    210240
     tttggtgctg ttgatgtgta ccaattaacc attgaagtcc tgtatggtag cagccatcta    210300
     gatgatggcc tggctgtcct cagagtgtgc ttcaacattt ttccacaatc acctctaata    210360
     cagttttata atactaatga tgtacagcaa ctattaggta tagccttctt acacttctca    210420
     attgttcaca tgtgttaaaa cttggatagt tttcgaatat ttaatatcca taactagaat    210480
     ttggcaaatc cgctggatta ttttgtcaat aatgatttga atttattcag gcttgtttga    210540
     ccgtaacgaa aggtctctaa taaaatacta aattacatag acatattggt atttaatatt    210600
     tattctatag taagtggcaa taagataaaa tgataatgta gattccataa aatacttctt    210660
     cggcccaccc tcaatgaatc gccgttggag cttttccttt tgacaattat tcgaatagct    210720
     ttgatctgtt gtaaatattc tttttgaagt cttcatactc aaatgaagat cttcttctgc    210780
     cagttaaggg tctttcctgt tgtctggaat gattgtttct tttcatgtag tctacttcgt    210840
     cttcttctgc cactttatta caattgcttg tcttactatc atgatctgat tgctctatag    210900
     aggaaagctg atgtctggca ttttgcatat ccattgatat ggggtcactc tcctcgtttc    210960
     tctttgaact taacgcatca atatagttgc tagacctacg tctatttaga aattgtggtg    211020
     gtgtttggat atcttgttct ttcgcctctg gggcctcctc tatatgtgtg tagctatgat    211080
     tcatcattgt attgtttata tggtttgttt gctgtgtgat attcaaatat acaagattaa    211140
     gtgttcatag ctataaatgc aagacttagt attgctcttt catcccgtaa tttatatacg    211200
     tttcaatgaa ggtatacgca ctttacagct gatagaacgt taagtgatgg aaacagacca    211260
     tgccggtcaa ttcagaagct tatccattac aatttgtttc gaaaagggga gaggtttatt    211320
     gacgtatagc ctgtgatctg gtgataggtt attgtcgaag tattttagag taagtgtgac    211380
     tcgacaatgc agaaaaggag ataagtgctg caaacattag taattgtgcc aaaaccgaac    211440
     agacatacaa gttaagggat cgagtaaaca tacaggagag aatcattaaa cgtactcaac    211500
     tcaacaaagg tccccttggt tgatgactcc ctttggcaag gggattaagg gagcaatgtc    211560
     aaatgaaggt gggagagaac tatcaaaggt acaaaatgac ccttgacact tctacgagcc    211620
     ccatcatctc aagtcatgaa gactttagcc ttaccctttt agacttgatt gaggtattaa    211680
     tgttacgaga agttatgaaa cgcttcattt atatagtcta ttggacgtgt attatgtgtt    211740
     ggtacagatt tgtcaggttt cgaaattgtc aatgctgtat aatcaaaact gactgattcc    211800
     caaaaaaata aaataaacat cttacattct agctatcaac agtatggaaa gtaaatggtg    211860
     ggtaagctgt taggaaattg tttgttggta aagtggattc agcgattatt ggtactaaat    211920
     acttactata ccatgtggtc tccaaagcca gtatttcttc gtagtgttca tctagtagtt    211980
     tcttcaagat agactgtgca atatctctga ttaagtcctg tttatcttta ataccataat    212040
     gtaataaaca ctctataact ttgcacacta gtagatgttt ggtgatatca aggcgcgaaa    212100
     gagtagtgta tatcattgtt cgcaatgttg ccccgttatc tactttcttg gagatattgc    212160
     ccgccttaaa ggtatggacg aagctcttat tcattcgtag atggggtaat aaagcctcag    212220
     caatcaaatt ctcatcattt ccgctaagat atttgtcgtt atcgccatcg gttactctaa    212280
     catcgatcaa atgatcaatt agctcaataa tcgattgtaa ctcctcaaga ctcacctgat    212340
     ctttgccgag atattcaatt aaagtgaaaa caacagcccc tttcctctca ggaattggtg    212400
     ttgaaatttc agtttttaat tcttctatgc ttaaaacttc ataagtttca aatacttttc    212460
     tatcaaagtc ttctagacgc tcaaaaaagt gtgtaaaaag actgaacgtt ttcgaatcca    212520
     aattagagtc agaaactttg gattttatac aatttaattt ttcccttgct gtagcgaggt    212580
     gtggtccaaa ctgtattaca ccagtacgtt cagcaagaaa tacatcgtaa agtatgttca    212640
     aggaatgctt tacaattaca tcgtagtcac ggttatagat atcaatatcc tgcaactctt    212700
     cctccgtcac ctccagtaga ttactagagg tgtcgtcacc ctcaaaatct actgtaaaac    212760
     ttaaatcttc atcataattt gaagacatac ctgcatcaag ctcgtcaaga taagcttgct    212820
     ggtcaatatc ttcaacgaca atatcggtat cactttcagt ggtaactagg tcgttattat    212880
     tgtggtgttt attaatgaca tctctggatt caatcgacgg gataatgttt gttaaaatat    212940
     tgagaactcg atcgagtaac aatatagaaa ggtcggacgg taatttcgga tgtccttcgt    213000
     tggtaattgt tccctgtaat aagtaatctt tcaggttaga gataatttct agcatttttg    213060
     aaatgtcaga cttctcagtc tctttggtaa tctcatcaat cagcttggga ataattcctg    213120
     agcagcattc agcgaatttg taccaattct tggacatgaa cttcagatta gagagactga    213180
     aatattgctg cgtttgtgcc acagcagcga tatctgtgtt ttctattact ttattgagca    213240
     gcatctcact tgacgtattg taatcctcat aatcatgaag gctttcgata cacattttca    213300
     gagctttcgg gctaaggaat ctgagtctac catcatagga aacctctata agtttttgta    213360
     ttgtttcttg atatccctgt agacccgcta cagtagtttc tttttggctt tcctttagca    213420
     taaaagacac tagtttcatg aactcttcat cttgatattt ggactgatag ttatcgctca    213480
     gaatttgatc attacgtgta acacttttga tattcaaatc atttgaaatc aatatattta    213540
     gtatatttct caacgattgg actagcagat tggttatggt ttcattacca gattctaaag    213600
     aatctataat aggataaaat acgtatcttt cgatataagc ccacatcagg ccattgctgt    213660
     tgtattcttc tacttgtgaa tcaaacaggc tcaaaacagc gcgaggtaac acttcaaagg    213720
     acaccaattg ttgcaactca gaatcaacgt tatgggtcaa aactggtaaa taaagattgg    213780
     ccataagttt atcaaaatct ttctgaatac tgcgaatgag cactggttgc ttcaatgtca    213840
     tatatctgaa gtcattgtcc ttggcattat tatactcttc gataatgctc gaaacctcca    213900
     ttttatattt gtatgacctt ctggataata attggataga ttattagctg ttccaacact    213960
     atttcaactg tataattcgt tttggtacag agatatgcaa attaaaccaa cataagtaaa    214020
     gaaagcctcg aaatgattca atttttcacg caagagaact tttgacttcc ctttattgac    214080
     taaatgtttt cctttgcagc agtgtagctt tttttcttct tccttctgtt ggacaggaag    214140
     aagctacctt caaattaacc agtcactctt ccctcccccc cattgttcaa tcccaaacgg    214200
     gaattgatgt tccccttagg ggacatcaat cactgcaaga acttcagcaa ggagaactga    214260
     ctgcaatcat taacttccca caagagaaac ggtgagatcg ttattggcca ctcaaaaaac    214320
     atataaatca cgtgaatata gatcccccat tacatccata gcaaggttga ttggcacaga    214380
     caaagccgaa gaatcactgt ttctgggcag cttcacctac tttgcataga gaccactgca    214440
     cagagagccc agtttttccg agttttgatt tataaccgat gcaagatctg aaaatagttc    214500
     cgatcgcagt attcaatgca gagaaaacgc gcagactatc ccaaaaaaag aaagaaagct    214560
     ctctctaacg ctttttttcc gaagaaatcg ctatttatta agacgttgct gttcggtcac    214620
     ctcatttgta cgtacgtttc actggtaatg gtggtgtatt aatcgattgt ataacagttg    214680
     ttccctttct ttcttttttt tcatttcata tttttccgag tcgagacaat gcagttaccg    214740
     aatagtgtgc cctcatttca gagtaaatac atttttgcta tccttgagtg tatcaccatt    214800
     ttgcttcttg ctataagctg taccgcttgc aagagctgtc ttgtatcgta tggattgtcg    214860
     ggtaccaatc acacggagtt tggactcgcc ttttcgaggc atgttgtttc ttttttttag    214920
     caactgatct ctatgtatat gcaatgcatt agtgaagcaa tgtagaactc agatcaggta    214980
     ttcagtacga gagaagtagg cttcttttat tgttgttcgg tgtcatttct atatgtagat    215040
     aacagcaagg attctgcatt tttttagaat cgaaatggct ccgtgccctc tggtcccgca    215100
     tcaagattac gtcaactgag aatattgctt gaagagacat tgctatttcg ctacagaact    215160
     atgtgttttg agatctagca ttctaggctt tctatagtga gtacataata gcacagagcg    215220
     atgcttcaca tagtttaatc tcacaactga aactgatatg ttgattgtag agcaaaattc    215280
     ttatgtagaa gttgttcgat atctctattt ctatatgagg tactctcgac aatagatccg    215340
     caattagtat aggtttcata taaattaaat acattttgct agagctggag aagttctgcc    215400
     aattcattga atccgttggc attcagcaat agtcccacag accaaaaatt tcttttgacg    215460
     aacatagggg tcacaagctt ataatctgtt aaactattat ccatatacag atcacttatc    215520
     tatttgatta gattatcatt ctttagtccc tctcagatac tcattccaag atccaattca    215580
     gtacctatat attcttttga aacggccact gggcacaatc aaaccttcaa aattattggt    215640
     gagcacctaa gattacatca tccacaggtg ccttacttca tcatagctag gtcatcacaa    215700
     agaaggaaca tctaagcatt tgcatcaaga cattggcatt ctcatccaat acattgcaga    215760
     tattgaaatg gtagtaagta agaatagcag ttcaagggat ccccttcttt ttgatataag    215820
     gttacaaagc acagaggatg gtatcatttt actgaaggga tcaccagagg aggcctcatc    215880
     catatttctt tctgggacaa tagtggtttc tgttcagcag cctatatata tcaaaaactt    215940
     gacgttaaga cttaatggga gaatattgat gcatgttcca ataactacca atactccaaa    216000
     gggatcatac actagatata ccaaatttca aaaacgattt taccaccatc aatgggatga    216060
     ttttaacatt aaaaactatt ttgctaatct gtatgacaat tacggcaagg ctgccattga    216120
     aagtgaaagt aatgtatcta aggaggaacg gaaagctaca gagaatttgc tgaaaagaaa    216180
     gagagccaaa tcaacaaact ccattctttc attcacaggg acttcctcga acgcaagttc    216240
     aaattatcat acacttgtaa ggggaaacta cgagtttcca ttcacagcaa ttttaccagg    216300
     ctccctaaca gaaagtgttg aaggtcatcc gaatgctaca gtcatgtact atctagaagc    216360
     agttatagaa aggccaaaac aatcggacct gatttctaag aagcatttaa gagtgataag    216420
     aacactaagg cctgatgcat tagaattgac tgaaaccatt tcagtagata atacatggcc    216480
     ggagaaggtg gaatattcaa ttagtatacc atcaaaagct gttccgattg gctcaagtag    216540
     ccccattgat atttcaatta caccattgat gaaagggtta aagttgggtc ctgtgaaagt    216600
     tcagctagta gaggttggtc aattgtgcag tgccactggt gtctcttcat tagatgatag    216660
     actggtgagt aaaaccaaga taaaagatcc ttttgggcac ttagcaaaat tacgtaagaa    216720
     gaagtatact gcaaagagtt taactgatcc taattttaac accggttctg atgatgattc    216780
     cgatatggat ttccaagata aatgggatat taatacaaca attgaaatac ctccaaattt    216840
     gctggcttgt gttcaagatt gtacggtcct gaataatgta aaaattcgtc ataaattaaa    216900
     gtttgtcatc tgtttaatta atccagatgg gcatatgtct gaattaagag catccttgcc    216960
     tattcaattg tttatatccc cttttgttcc aatcaagacc aagtctcccg aagcgataga    217020
     gagagacatt aaactatatg gtactaatta tgcaaatggt tcttgtagac ccacaataac    217080
     gatcggtagg tcttctggaa ataatagtcc tataatacaa caggaaagca ctttttcaaa    217140
     taatgacaat tctggtgcct cagagaatga agatctaata ttttcgaaat cactttccgc    217200
     agttgagtta tccagtatga atgtcaatac cagtgagtca gtttcatctc taaatggtct    217260
     catggttcct ccaaattatg caaatcatgt gtacgaccga ttatggaatg gtagaatgtc    217320
     gcctgttgat gtggttcaaa aggacactga acccagtttt tcaccagata atcgatcagg    217380
     gtattctacc cctgttgcca atagaaacaa ttttaatgta gaacaacttc agggaagctt    217440
     gcaaaatcta gttatagaaa atgaacaaga gggaaccaat gaaaatgaaa cccaacaatt    217500
     gactgctatt caacaagata tgttgttggc aagtccttcg ttggaaccgg actatgtaca    217560
     tatttctaga agtgcttctt ttagtagatt agcatcatct gcatctttga aaagcgactg    217620
     gcaagtaaag gatttaacta gtgtaccatc gtatgataga gctatgaaat cggatttggt    217680
     gggtgatgat ctgccaccag cttacccaga tgaggacaat caagactcga aggatgctat    217740
     tgtccttgag agaccacaat ttatacatca aaaatcgaac tcttctctta acgttcctgg    217800
     aagaagatat tcgcataatt ttagcaggag taataatagt tctagcactt ccttaaataa    217860
     tctctcaatg gcaacatccg ggtatggtca aaacttagga gtcaataatt acaataaggg    217920
     gagcacagca agtaaaaaat ttgccttcga aatgacacca gttgatagta accacaactt    217980
     tgaagaaagc cattcctcca tacctatgga gcgggcatca tcgagggcaa gcctgaactc    218040
     taatcataga tctggttctt ttgcaagttt ggttgaacta tttaccaaga agaggtaaat    218100
     cgtttatagg tgtacatatt tttatgtaga acttgaacat tttgagtttt catatattga    218160
     ttaatattag gaatgacaaa accgaaacga agacttgtta gttaaaagaa ttatcatctt    218220
     tcaggtaccg gtttaattat gtcatttgtt agattagaat caccggtatc aaagacaaac    218280
     gggacgccta cattttttga atcctatgta ccaccagcta ctgacatgag cttatacgtg    218340
     tatatccaga tcacatgata ttcttacttg ttatgatatt tatctatcat tttttagata    218400
     tcattcaaaa cattgggcgt gtggcgtagt tggtagcgcg ctcccttagc atgggagagg    218460
     tcttgggttc gattcccaac tcgtccattt tttattattt tttgcattat gcagtagtat    218520
     tttacttaca attgtgttct aaattatgta taaaaatata atacgtttgc gtgtgtcatt    218580
     aaaatttagc tatattaatt ttacaggatc agtgcatatg ctataaagtt gtctaataag    218640
     taagtatatt actcttagta agaacggcca aacatacagt attgaatggc agcgcgatca    218700
     catttgacac acttttgtcc ttcctttaga ggtggttgct caaatggtat acataaggat    218760
     ttggcaccca tactaggagc cttttcatct tgttcaaatt cttcaccatc atcctttctg    218820
     gcagaggcat ccttaatatc ctcttcacag tccataacgc cacaccatgg agaaagtatg    218880
     acattcttct tgttcaaagc aggaacaaag tccttccatt catcaacaat aattctgtgg    218940
     ctgtcaaata gttccttggc tttgttgtac atatcgttat gcatctcgtc catgatttca    219000
     ggaattcttg actcaagttc atccagcttg acaacgtact tacgggaatc atttctacga    219060
     acaaccacta cttgaccttg ttcaatatcc tttggaccta actcgacacg caaaggaata    219120
     cccttcaact cgtattgaga gaatttccaa cctggagtgt agttgtcgtt atagtcaccg    219180
     aatgctctaa cagatgcctt taggagacgg tcttcaacat tctttgcagc atcatgaatg    219240
     ctcttacgtt gttcgtcagt agtcttctta gtgataccaa ctgggataac tacggcttgg    219300
     tgttgggcaa ctcttggagg aacaactaga cccttgttgt cagagtgggt cataaccatg    219360
     acaccaaggg tacgagtaga tagaccccag gagttttggt aagcatagac ctttggatgt    219420
     tctggaccca atggattttc aacagaaagg ttaaacatct tagagaagtt ttgacccaag    219480
     tggtgagaag tagcaccctg aataccacga ccagtttctg gaatgtaacc ttcaacagtt    219540
     gtggtaaaag ctgcaccagc gaacttttcc ttttcggtct tcttaccctt taccactgga    219600
     acagccaata gttcgttata aataccggcg tagaaatcca aaacttgcaa cacttccttt    219660
     tcggcgtcat cttggtcaag gaaagcagtg tgaccttctt gccacaagaa ttctctggtt    219720
     ctcaaaaatg gctgagggtg cttgaattcc catctaacga cagagttcca ttggttcaac    219780
     ttcaatggca agtctctgta ggattggatc cattttgcgt agtatgggta aataacggtt    219840
     tcagaagtag gtctgatagc aattggttct tcaagttcag aagaaccagc tctggtaacc    219900
     caagcgactt caggagcaaa accttcaacg tggtcctttt ccttttctag cacacgggag    219960
     gagacgaaca ttgggaagta agcgttcttg acaccgatgg ctttgatttt agcgttaaag    220020
     taatcttgga tggattccca gatggcatag gagtttggtc tcaagatgta acaaccagag    220080
     atatcatagt agtccaacat ttcaccctta gtgacgactt gctggtacca gcctgagaag    220140
     tctagagact tgtcaacagt gataccgatc aactttgcat cttcaatagc agcgttagtt    220200
     tgagctggct tttccttctt ttgtttaggc tgggcttcct tcttgatttc aacagagaag    220260
     tcgacaattt gcttgtattg atcaaattga gacaagaaag agcataggtc ggacttcttg    220320
     atggacaact cgtcgttcaa ttgcaataga gtttctgggg cgacagactc cagattgtta    220380
     tcaattaaca gcttgaattc agattctgcg ttagtcaagt aagccaaagt gaagccctta    220440
     gcggtttcac acttgaagaa agattgaaac aattcatcac gagccaatct tgggtccttt    220500
     aggccagagt ggtgagcaat agctggagat ggagtgttag tggattgcaa agcaacaacg    220560
     acaattggaa ccggagtggc agtcttagca gtctttggct tgaaaactag cgacttgaca    220620
     gcaacagcat cagctggctt atccgacaaa cagagcttag caaaatcaac tggcattttg    220680
     ctattcttct tttggatgtt tttgtttcct tgcacttgct gccgccctgg actacaataa    220740
     tttttttgta tatacgaaat aataacacca gccgctagtc aggaacaaac gaaatcacag    220800
     aacagtggtt tcttgcaaga gttgtcacga acagagttga gcattatact catcgaaagt    220860
     caatatcatg ctgaacgtca ctgaaaattt tttagttttt ccgtttgttt tgtttttttt    220920
     caagcaaatc acttgtcctg aaatccgtag taaagtgaaa aaactttttg aaaaattttg    220980
     gaaaaaaatc aataaatcgc aggtcatcgc aagaaggaag tcacttcaac tgctgagttg    221040
     tagtgtttaa tgctgtactt agtgttctgg tgacaggtac cattgggaag agttaacttt    221100
     tctagctgta atgagtaatc tgaagtgacc agagtggatt catttttttt tcacttgtcg    221160
     acgtctattg acacaaactg tgaaatgtct ttatctattg aaattcaatt ggttaaaggt    221220
     tataagcttt gtaaactttg tatactgcat tataaaaaac ttggttcagc actaataaag    221280
     aacaacaatg tctgtgtata ttcacgaggt taaaggtgtt gacgagaccg gtgttgctgg    221340
     tactcaagaa caaccattca agactgctgc tttcgctcta ttttgcagtg aaactgaacc    221400
     aaagttgttt gtttacaagg aagctgatgg tgaataccaa gaaatttctg cctctgcttt    221460
     gaagaaggct cgtaagggtt gtgaaggttt gaagaagaag gccatcaagc agaaggagca    221520
     agatgctaag aagcaacagc aggatgccga caatgccgca aagcagatgg cagctttgaa    221580
     cattaagatc gaagaggaca agtctctccc agaagccaag aagtgcaaga ttggtcagtc    221640
     ctatgaacta gttggtcaaa gagtcaaaat ctccggctgg atccacagat tacgttctaa    221700
     caagaaggtt atgttcattg ttctgagaga tggttatggt tacttgcaat ccgtattaac    221760
     tggtgacttg gccattgccc aacaatcctt ggacttgacc attgagtcta ccgtcaccct    221820
     atatggtacc atcactaagg ttccagaagg taagtccgcc ccaggtggtg ttgaactgct    221880
     tgttgactac tatgaagtag ttgggttggc tccatctggt gacgaagctt tcactaacaa    221940
     gatcgccgaa ggtgctgatc catctttgct tctagaccaa cgtcatttgg ccctaagagg    222000
     tgaaactctg tcagccgtga tgaaggtccg tgccgctctg atgaagtcca tcagacgtgt    222060
     ctacactgaa gagagtctaa ctgaagtcac tcctccatgt atggttcaaa cccaagtcga    222120
     aggtggttcc actttgttca aattggacta ctacggtgag caggcctact tgactcaaag    222180
     ttcccaactt tatttggaaa cttgtttgcc ttctttgggt gacgtctact gtgttcaaga    222240
     atccttccgt gctgagaagt ctcacactag aagacatttg tctgaatata cgcacattga    222300
     agccgaatta gctttcttaa catttgagga actgctagac cacatcgagc gtgtattgtg    222360
     taagaccgtc caatacatat tggaagaccc aattgctggt ccactggtca aacaattgaa    222420
     cccagatttc caagctccaa agatgccatt catgagacta gagtacaagg atgccattga    222480
     atggttgaag gaacacgata tcaagaacga ggatggtgaa gaattcaagt tcggtgatga    222540
     cattgctgag gcagctgaaa gaaagatgac tgacaccatt ggtgttccaa ttctattgac    222600
     caagttccca gcagaaatca agtcattcta catgcctcgt tgtaaggatg acaaccgtgt    222660
     cactgaatcc gttgatgtct tgatgccaac tgtcggtgaa attactggtg gttccatgag    222720
     aattaacact gaagaagaac ttttggccgg tttcaagcgt gaaaacattg atccaaaggc    222780
     ttactactgg tttattgacc aaagaaagta cggtacctgt ccacacggtg gttatggtct    222840
     aggtactgaa cgtatcttgg catggctatg taacagattc actgtcagag actgttctct    222900
     ataccctcgt ttctctggta gatgtaagcc atgaattgta agatattttt tatatatcat    222960
     aataattctg cataataaaa taatgacata gttgaagaat ttttgttaga gatttttata    223020
     agttctcttt actagaaaca cagatagatt tgttaatgtg atcttgttgg ctcctataaa    223080
     taatactaaa aagcacatac tacaagcaaa taatctagcc acatatttga agttggtaaa    223140
     aataatctca tagcacgtac cattcattca acaatttgta tagctttgat gtaaatggta    223200
     aggtaaaaag ataactgaat ttacccaaat aaaacgttct cttcaagcca aatagtgagc    223260
     atatagctac atgtaatttc tgaaatgtat tacctccttt cattttaata aaacagtata    223320
     ttggccaata caggtcattg taaatgttag agcctttgac attaagatat ttgtaatttg    223380
     atagttgacc acctaattgg aaaagaccaa cattaatcat gtaaggatcg aaaatatgtg    223440
     agtgcttgag ctcttcaaaa atagtggtca ttaaaccaga tattagccat tcaacaggat    223500
     gctcaacatt tttcatattt actgataatg aggggttgta tattaaagtt ggaattctat    223560
     ttgagttgga gttttgcggt aagtgagggc tgatggccac aagagtactg taatatatca    223620
     aaacgttaga atggagttca ttttccaact gttctaaagt aacttgtcca gttgggtgat    223680
     aggaaagctt aggtatcaga agtatagcgg ataaagtatt agtcgggaat ttcctaaaga    223740
     attcggagaa ttttgcccaa tcggatgttg atttgggatc gatatagttc aaaaagtcat    223800
     cttcatcgtt atgcgtttta taggtaccag cattttcgag acacacaaag agagtgaagc    223860
     cacgtctgta aagatccatg acttgtcctc taatgatggg atctctcata tcgccgaaga    223920
     ccaagatgca ttgattttct gtagtgctta agattggacg tacttttagt tgtgtggagc    223980
     cccaatataa agcaattgat actgctggga tcgccattag gctccatgat cttttggtat    224040
     gtatgcctga taataaggta aagggaagtc tagttatatt gcgaagaatg ttgtcgttat    224100
     cagatctagg tatcgttgta tttgtgcctg catcaattac ttgagatccc ttatgtaata    224160
     ttttattcaa gattgcagag ccgttcttta tggcagcttc ttctgaattt tcgacacatt    224220
     gcgacacctt atgtacaatg ttatgccctt tgtcaaagat cttgtccaaa aagtcgcgat    224280
     ctgagttcat ttctcctagt atatatgaga aaccaaaacc acaggcttga aaattgaata    224340
     atataggagt cttaaaaatt tttaggaaga aagactttgg aattaaatat ttcatgctaa    224400
     tatggcttct ccagtctcgc tgtgatagca ctttaagtat ttatcaccgc acttcgcttc    224460
     cgcaattttg tcatcttttc ccgtcacatg catttgctgc tagcaagagc tgacaatgat    224520
     ggatagggca tgagtgatca atactcgaat ttaaaagtca tgagtaaatc tcaagtgtta    224580
     aaatactgag gaataaatag tacatgcgtt ggtacttgtt aaattatagc tagctgaatt    224640
     agaattgtct gggatgaatc gtgacaatat attgtgtgta agatacatga atctttgaaa    224700
     ttaacggagt ataataacat gtgtgaaata tgaaacatca tgttgtggtt tctagatatc    224760
     ctatagttca gacttagtaa ccttggtatt atcaatgaat ctggtctagt tttagtgagt    224820
     tttaacattg ccctgcatgt cttgcattat aattgtgatt tacggagatt tacgtaattt    224880
     atagatctca gaaaaccccg tacacattac atctacaaaa tgcgtggata ctatttttcc    224940
     gagagggaat attgtgtcta cgtaatcgca gcaatgcagc attaatttta ttgggatcct    225000
     gagtaatttt gaatcatctg cattacgaga gtaataaaaa ggggaaatta tgagataggg    225060
     gggatcaaac gttagctaca tgtctattct aattaaatcg acagacagag ttttcatcat    225120
     tctttgatgc tcggagcatt tgttattata taaacagcat gcagatttta ctaattccaa    225180
     actgaatcct cattcaatac ttttgaagcg atgattttta acaggaaaga acttagtaaa    225240
     tattaaacac atattgtaaa aaatggtcgg tctttccagt ttgacaaatc cagttccaag    225300
     gggcctagca aatgaggctc aaaaggctgc aaaaattctt gagggtttta tagatccaag    225360
     gcaagcgtat ggtcctgatc aggttattcc tccttcagtg ctaagaaatg ccaaaggtct    225420
     ggttataatt tcaatcctta aggcaggatt tttattctcc ggtagggctg gttcgggtat    225480
     tattgtggct cgtctgaggg atggtacttg gtctgcacca tcagccatcg caatgggagg    225540
     tgctggtgct ggtggattaa taggtatgga gctaacagaa tttgtgttta tcctgaatac    225600
     cgatgaagtt gttgattctt tttctgagtt cggtacagtg acccttggtg gtaatgtatc    225660
     agtagctgca ggacctgttg gcagagatgc ggaggctgat gcatcagctt ctgctgcagg    225720
     tattgcgtca gtctttacat attctaaaag taaaggattg ttcgctggtg tttccgtgga    225780
     gggttcagcc attgtggaaa gaagagatga aaacagaaaa gtttatggtg atagaggaac    225840
     tactagaaga atccttaacg gtgaggtgga gccattgccc tcgatggata ggttgtatag    225900
     aattctggag tcccctaatt ttaccccaca accgggcgag ggttatagga ccagcagtta    225960
     ttctgaagag caagcccgtc ctgacgaaag gtatggcaga gaaagatatg atagaagata    226020
     cgatgaagca ttatatgatg aaaaacccag gagcagagct agatgggatt cgggcgacat    226080
     gccgcatagc cggggaggag ttgagagaca ggatcattta caaagaaatg attatgattc    226140
     acacaataga ggaggatatc ctccacctcc ttgtgaaaga aataaggatg tacaaggtca    226200
     tggttctgac gctcatgcgc ttaatagaaa cagaccagtt ccgcctcctc ctccagcgga    226260
     gcgtagtttt cctaaagtga gggcattata tgacttcaat ggccaacaac agggtgatct    226320
     ttcattcaaa aaggatgaca taattgttgt acaaaagaag acagactcgc ataatgattg    226380
     gtggtacggc gtagcccatg gagttgaggg cgtttttcca gcgaattatg tcgcagacct    226440
     ataataaatt gtaatgtttt atattatcac caacaaattt tgaagacatg tagaaattgt    226500
     ttctgctata tatgataaaa attgatattc aggatcttgt cagtaatcta acatggtaaa    226560
     aagtaatatt ataatacaac agtgaccata aagtcaaata gcagaaacca aaaaataata    226620
     ggtcctaccc ggattcgaac cggggttgtt cggatcaaaa ccgaaagtga taaccactac    226680
     actatagaac cttttgaagt tcttgataac tgtacaaatt ctggtcttct tgaatttctt    226740
     atttgaaatt atttagaaaa tattatacat gcagcattgc ttactttatt ggagaaagtc    226800
     ttataatatt acaccacaaa tcctaacctt cgataatcct cttcttatga agtttctaat    226860
     gcaacatagt atcaataagt ttattatttt taaagtgaag attatattat attattatat    226920
     ttctctaaaa acttctagct tcgtttacat tctttcaaca ggtgttagac ctagcaagcg    226980
     cataccgttg tatagaactt gtctggcagc accatatagt gcaagacgag cagtagcaac    227040
     ctcttcagtt tggcctgcaa cccataggac atcgtaacaa gaagaaactt gatgggttaa    227100
     tttgaacaag taggtaacaa cagtggcagg ctcatttgtc ttcatagcat ttcttaacac    227160
     atctgggtat tggcctagca atctaacaag aagagcggca gctggttcct ttagttgaga    227220
     gaagtcagct gaagcccact tttcctttgg aatttcagcg gcatttctct ccacagatct    227280
     caatctagaa tgagcgtatt gcaggtatgg accggtatca ccttcaaatg aaagcattct    227340
     ttcccatttg aattcatagt tgttaatacg cttagattgc atgtcttgga tcattaccgc    227400
     agatataccg actaagtccg caacttcatc tggattatcg atttgagcat atttagcttc    227460
     attcttcttc ataacttcgt gcatcttctc tttggtttct tctagaatgt tatccaggaa    227520
     aacaaccgta ccttttcttg tagacatacc ttggaccata ccaaagttga cgtgttgtaa    227580
     cttgttagcc caatcgaagc ctaattgttt caagatttcg aagaattgag ctgtgtgcag    227640
     atcttgttga gtagcaatga cataaatcat tttatcgaaa tgatattttt cgtaacggtc    227700
     catggcagca ccaacatctc tagtcaagta taaagtagta ccatctgatt tttgaacaat    227760
     gaccttaccg agctttttgt tgaactttgt taaatcaatt agagtagcac ctctatcttc    227820
     gtgagtcaag tttttctcat ggaacatttt tagggccgtt tgcatagatt ctttagaaac    227880
     ttgggattca cctgagtaga catcgtattt aatatttaga cgggcgtaag tgtcaatgta    227940
     cttttcaata gagaagtcac ggaatctctt ccaaattttc aaagcttctg ggtcaccatc    228000
     ttccattctc ttaaagtatt cacgagcttt accgttggta gattcagatt caggtagaga    228060
     gtcaccttct tcttcgatgt ccttgttgat acgaacgtaa acttcgtata gatggtggat    228120
     aggatccttg gctagctttt cttcgtcacc atatctttcg aaaccaacgg ctaagacacc    228180
     gaattgctta ccccagtcac ctaggtagtt cattctagtg acatcccaac caagcttttc    228240
     gtaaaggttg gacaagaaac caccgataat ggtggatctc aagtgaccag catggaaagg    228300
     cttggcaatg tttggggagg aaaattcgat gatgatcttt ttgttgtcga ccattttgca    228360
     agcaccatat tcttcacctc tagtgataac atccgggata acagtcttgt ataggaattc    228420
     tggcttgaag aagaattgaa caaaggcacc gttggcttca actttttcca gaaagtcacc    228480
     gcatgggaac ttctcggccc attcagtagc aatttctctt gggttggagc ccttggttct    228540
     gaccaatcta ggaactggga tcaaaagatc acctctgtcc atggtgttag tccattccaa    228600
     tgcagggaag atttgagcag catcgacgcc ggaaatcttg ctcagttcct gggcaatata    228660
     gtttctcatc aaatcaacaa cattgacttc tgggaaagaa ccttcaagag cctttggctc    228720
     ttcaatagat agatttttca attgggctgt caagctagtc atggttggat caatatacta    228780
     cccttctcag tttcttccta aatccaaaac aaaaattaaa aaaaaatagc ggcaatatat    228840
     caaacataat atatatttca agaaatattt aatacttcgc aaaagtgagt atgtagagac    228900
     aactaatcat tgaattactc attctgcgat gagctacaat tgctgtcatc cgttcaactc    228960
     agctcttcgc agtgaaggat tttgaaaaaa aaaaaatttt caacctgtgt gtcacatggt    229020
     ttatacattt atacgttttc ggatctcaat gattttcgtc ttttcaaatc aattggatct    229080
     tgcattacta catacgctgg aattaaattg tggggtcccc tatatagtag catatctggt    229140
     aaaatatata attatcgagg cactatagaa gctaatagat aatcaattgt ttttttgaat    229200
     aaataaaaag gtattattat tctttattta tcatatatga tatatctaaa gagagtagta    229260
     tattatatca tgaataaaca gatgttaaaa tgtcattaga ttttgattag aatccttgag    229320
     taaagagatt aaaaatcaaa tattaatacg ttgcgtgaca aaaaaaaaat tagcattaac    229380
     agcgtaatca gaattgcatc ccgatataga aagagattgc aaaacaaata aaattaagag    229440
     ttgtttggaa ttaataaagt tcagatttga attaatatta tcattgagaa aaagatttat    229500
     cataagccca aattcatttg agaattctaa taatgattat tagggttcag gagatttaaa    229560
     caaatctctt gtaccatggc ttgtcatcgt gcatcatagc gtcagcatcg taagaagcat    229620
     ctctcttgga tggtggaacc cagtttggag acttccatgg caagacacct tcttcccaca    229680
     aagtgttgac ttcttccaaa gttagaccct tggtctctgg aatgaagaag aaaacgtaga    229740
     agtaggagaa acatagacag cccatgaaca cgtaaccgta gtagaagtta atggcattgg    229800
     taataaatgg agtgaagaag gcaatcaaga aaccccagat ccagttggaa gcttgggcaa    229860
     tagccataca cttggcctta actctcaatg ggaaagtttc agagttgaca acaaatggaa    229920
     ttggagccca ggtggtagcg aaacagaaaa tgtagaaaca ggtgaaaaca atcatacagt    229980
     taccagcacc cttggaggat ggttggtctt gaccatttgg ccatagtctg gtgacaccga    230040
     cagaagcgaa gacaaccata caagcagtca tagcagcggc accccacaat agacatctac    230100
     gacgaccgaa acggtcaaca acgtacaagg caacgaaagt ggaagcgaag ttaacaatac    230160
     caatgacaat ggaggtttcg aaagaatctt ccaaaccaac agccttgaaa acagtagtac    230220
     catagtagaa gaagtagttg tcacctgtca attgttgcaa agattgaatc atgataccca    230280
     taatcaaacg ttggaaaacc ttagtcttgg tagagaacaa ttcaccccag gaagcagaac    230340
     cagccaatct ttcagcttca acagcagctt ggacattttc aacttcgaaa gtgacagctg    230400
     gatcatctgg agaaaccttg ttagagatag caatggatct tctggcttct tcaactctac    230460
     caacctcaat caagtaacgt ggagattctg gaacgaaggt cataccaccg atcatgaata    230520
     gagcccaggc gaaacatagg cccaatggaa ctctccattg gacagagttg gagtagttct    230580
     tggtaccgta gttagtacag taacccaaga agataccaca ggtaatcatc agttggtaac    230640
     aggaaaccaa agaacctctc atgtgctttg gagagacttc agaaatcaac ataggagaca    230700
     agacggcaat accaccaaca cccaaaccgg agataattct accgatgaag tattggtacc    230760
     acttgtcaat ggtagcaatt tgaataacga taccgacaat gtagatgaca acgacactga    230820
     tcaaaccgat cttacgacca tacatatcac ccaacttaga caaaacaata ccaccgatag    230880
     cacaaccgat gttgaaaatg gagacgacta gaccagttct aaccttagac aagtagtgag    230940
     taccattagc acgagtttga cccaatcttc tgatgaaatc agtttgggca acgaaaccag    231000
     aaatggtacc agtatcccaa ccgaaaacga aaccaccgaa agcgatgaat agacagaaga    231060
     tggaaataga gacgtaagcg gaagcaggct tctttggaat ttcaaccatt ggttgacctt    231120
     cctcatcgac ataagccttg aattcgtctt ctctgtcagc cttactgttg gaggctgaca    231180
     agacagattg tgatcttgat tcttgatcag acattattgt tatttattat ttgtaatagt    231240
     ttgaataatc aactattgct tgatgatttt ttattatgaa gtaagatatg agatagaata    231300
     gaaggaatga ttgaattcga atttatgttg aatacttgcc ctctatttat accatttttt    231360
     ttggttcaag aactcgattg ttgttgaaca agatcttggt atttctgaca agatagaatt    231420
     caaggagaaa agttttttca ttgcatattc ttctagcggt ttgctccttc tcgagcatcc    231480
     cacatccccc ggattaaaaa aaatttcttt tgaagtttta cttttttctt cttcgtgctg    231540
     tctagaataa gtcactaggc gcaaaagaaa agctcttaca acattagatc acaattagtt    231600
     aagttctatc tctttgtttt tttttctttc aaaaattttt cttaacagaa cgcgatggac    231660
     ctgcagcatt ttgacttagt cagtgaatgg aaagatctaa ataactacaa gatacagaat    231720
     gaaagtaaaa aaagtaagca gcagaaattt ttgtaagaga cgtaaagttc ttagctggat    231780
     agtaagcatc ctcgcagcat agtttagatt ttccaactac aaggacattt tgccccttgc    231840
     gatactacaa tcgctactca tcgaatgtat gatattccca tctactttta catgttatcc    231900
     aacatttcta ttttcagaaa cactactggg caacctatgg gagttactga acaagggagg    231960
     tttacttttt ttttacaatt ttacaatttt acaaatttac tttttctatt gtatttgtcc    232020
     aactttatga cccgaggaac ctaccccccc ctgtccccca tattaaattc acttttcttt    232080
     tcacacaatg gataatactg gaataacaag ttctattagc atttcactag tatgaacgaa    232140
     gatatgatcc aatctggcag cagttgcttt tttcatttca gaacattgcc cctcaccccc    232200
     attatagttg catcgctgga aggggggggg aagggatgaa aggaaaagtg ttgtgtgagc    232260
     aaagaatcag ttacactact caccattctg tgcctggaaa agtcattgtt ctttgctaag    232320
     ttgtacaccg gaaaatcccc tgtactctgt gggaacaaca gggttcggga aaactttttc    232380
     ctatgcagag aaatagctgc agggctgagg ttgaacaccg cgacctgact tctttcattt    232440
     aaattgtaaa cctttttttt taaaaaaaaa gtggggcaaa atcattctat tagtcttttc    232500
     gacattgtac gttgctctct tagctggaaa aaccattttt gttgatatag cgaaatcatg    232560
     attttccgaa aggaaaaact catgtgtttt gggagaaaag ggggggtcaa ggagactaaa    232620
     tttagagaat ggtacgagtt aagaaagtga caaaaaaatc atggtggggg tgtcttactt    232680
     agacaaatct gtagcagagc aagtacagct atcacaataa ggaaaaactg ggcccgggaa    232740
     tcagctcgag cgggcgaaag aagaaaaggt cctttgaaag agattttcca tgtagcaata    232800
     acggaaaagc tttttcaatt gctaggacat ttatctgtgt actggggttt gagagggtcc    232860
     ttgtatcctt ttgtccttaa aatgatctcg tacttgagta ttcgttgata acgttctgtt    232920
     ctattgttgg ttcacagaga aacaatcgga cagtagctgt tttggtgctg gttgcgttca    232980
     cctcccatac aaacttttgt tgttccatta tgtgtagtgg gggggtagtg gaaaaattct    233040
     tatttttccg tggttgcaca aatccttctt cgggcattag gcttgtgaat tacagatacc    233100
     aaccgaaagt ggaaagacaa taatacttat tattagttct caatggtact agcgtttttt    233160
     cttcttcaga gtaaggtggg gtgtaagggt ctaggaatgg aagtaagaat actacagtga    233220
     tgtccacagt aaatagcaag gagacggttt ttattttatt gttcccgatt aagtaaactt    233280
     aacacctacg ctgggtgaaa tgataatatc gtcagggttt tcttctcttg aagaagaaaa    233340
     aattgaacca gacctaatgt ggggccccgc aataatcttt atttctgatg tgtaattcaa    233400
     tttattctgg aaaccctgga aaacaagaaa aattaggaca aatttctata ttgggaagaa    233460
     atgtaaacaa gttagcttca cagcaagaaa aatgctttgt tcacttgcaa ctgacaaaat    233520
     ctttacctta ccaaggacca aagggcgaag actaaacttg gattactacg tccaaaatct    233580
     tctacatcag gaaatgagtt gcgagaaaga aagcaggagt ggcattgacc actctcattg    233640
     tgtctttggg tcggaataca ttgttcttac ctacaccatt ttactaaggg ctcgaaagtt    233700
     tttccgaagc atgttacttt tcaagaagct caatgtgcag cagcaggaca gagtttggat    233760
     agcctttatt ttctaaattg ttatgcgaag ctaatttgtc acttactgtc tgcccagtaa    233820
     aatagaaaaa gagatagctg ttatattttt gcctcacctt tcgtaatgta attggactta    233880
     cgtatggttt ggataataca gtgtctacgt aacatatcca tatgacgcct tgctttggat    233940
     aagacagtta tgagattttt gtcgccaatg ctttctgatc acgtatgaat tggaaatata    234000
     caatttcgtc agacacgaac catacatata tattgcccct tgatgttttc tcttgcggtt    234060
     catactgtgc tgaaaagaag cgctcttcaa ggtttttccg atacttgagt tttactactg    234120
     tgcgtcagtt tacagttatt cttcaccctt gtttcgctcc accccctgcc ccccactata    234180
     tttacgtcaa ttttatttta gcaaatttac ccctcgatga tttttctgct gtattgctat    234240
     tagtgtttct taggctcaac acgtaaacct gttcgaattg acaggtgatt tcaaagtact    234300
     cttgttaata aaatctattt tagggacatt atttgataat gacagctagg acataacata    234360
     cattgttgtt tctactacat ttaataaggt ctttctacag gcgtttatac attagcctgg    234420
     ggggagatgg aagggcgttt ctttgcacac gttgtaacaa aaggactggt gcaaaaaact    234480
     atcggatgtc tattaatgat atcgtaatat tagttcttat cctagaagcc actatactag    234540
     atgttcacgt attagtattc ttttactagt gctgatataa cggaatattc tgagagatga    234600
     gtattttggc gtttctttct taatcacaca acagattttc gcgcatcttt tcttaatacc    234660
     aaatgttgct cgcccagaaa tttccagacc gtgaattcaa gaatcagcgc aaaagattta    234720
     gttcactcca ttaattcaac aaaatattac tatactggga aaaatttatt gagattggat    234780
     tgcttctaat tgttttgtgc tgttatcata ttccgtcatg gaaatcatag tttgtcccgt    234840
     tgcattataa tcctatttac ataattgaat gtgggggcgg ggaagggaaa gactacattc    234900
     tacatcgata ctttttctga taaattgaaa taattgagcg attttttttc ataatttttg    234960
     taatatgaac cacttcccca caattttttt atcaattttg ctaatttaac tggaatgtaa    235020
     ggttaaaact tgattaaact agttcccatc ggatagttgc ataagatacc accaggatct    235080
     gggggatcta aggtggcttt aaaattttaa cgagcctcaa aataacttga agatattttt    235140
     tgtttcaatt actagctttg cgtcacactt ggtggataaa cgaggtgttt tcattgaatt    235200
     ttacttcata tgatttcaac aattcgtagc aaaaaaagag tactagatga ggattagcca    235260
     tagtgacaac tacttcttca agttgttgta ccaactccct tttgttaaag cactacaaca    235320
     gtaaattctt aatggttcat tgaaatttaa tttgacacta actattttaa atcaataaaa    235380
     tattcgtgaa aatcaaatag agatgtcaag actcaacctt aagaaatcat ataatacaaa    235440
     caatccagaa tagaaatttg tgttatgttt gctggattgt taatcgaaaa atgtagtaac    235500
     aaagaaaatt ttcatctttt ccttgtgagg atagttatat gagggtgacc tagtatagga    235560
     aaccgaataa atcagtctct gttacaataa cagagtgatc atcaaacata ttgaaagaat    235620
     aatattagga aaatctctga atatttttaa aagtctaatt aaaattactg aaatagaatt    235680
     tgaaattggt attaataata tataagacta tatcatgaag gacattaaaa gaaagggatt    235740
     atgtgttgga ttaaaaaatt aagttacctt tcaaaaatta atgaaaaaaa ggaacaagca    235800
     aattaaactg tcaattgatt taatagaatc tcttgtacca tggcttgtca tcgtgcatca    235860
     aagcgtcagc atcgtaagaa gcatctctct tggatggtgg aacccagttt ggagacttcc    235920
     aagccaagac accttcttcc cacatagtgt tgacttcttc caaagttaga cccttggtct    235980
     ctggaatgaa gaagaaaacg tagaagtagg agaaacatag acagcccatg aacacgtaac    236040
     cgtagtagaa gttaatggca ttggtaataa atggagtgaa gaaggcaatc aagaaacccc    236100
     agatccagtt ggaagcttgg gcaatagcca tacacttggc cttgactctc aatgggaaag    236160
     tttcagagtt gacaacaaat ggaattggag cccaggtggt agcgaaacag aaaatgtaga    236220
     aacaggtgaa aacaatcata cagttaccag cacccttgga tgatggctgt ttcataccgt    236280
     gaggatatag tctggtgaca ccgacagaag cgaagacaac catacaagca gtcatagcag    236340
     cggcacccca caatagacat ctacgacgac cgaaacggtc aacaacgtac aaggcaacga    236400
     aagtggaagc gaagttaaca ataccaatga caatggaggt ttcgaaagaa tcttccaaac    236460
     caacagcctt gaaaacagta gtaccatagt agaagaagta gttgtcacct gtcaattgtt    236520
     gcaaagattg aatcatgata cccataatca aacgttggaa aatcttggtc ttggtggaga    236580
     acaattcacc ccaggaagca gaaccagcca atctttcagc ttcaacaccg gcttggacat    236640
     tttcaacttc gaaagtgaca gctggatcat ctggagaaac cttgttagag atagcaatgg    236700
     atcttctggc ttcttcaact ctaccaacct caatcaagta acgtggggat tctggaacga    236760
     aggtcatacc accgatcatg aatagagccc aggcgaaaca taggcccaat ggaactctcc    236820
     attggacaga gttggagtag ttcttggtac cgtagttagt acagtaaccc aagaagatac    236880
     cacaggtaat catcagttgg taacaggaaa ccaaagaacc tctcatgtgc tttggagaga    236940
     cttcagaaat caacatagga gacaagacgg caataccacc aacacccaaa ccggagataa    237000
     ttctaccgat gaagtattgg taccacttgt caatggtagc aatttgaata acgataccga    237060
     caatgtagat gacaacgaca ctgatcaaac cgatcttacg accgtaaaca tcacctagct    237120
     tggacaagac aacaccacca atggcacaac cgatgttgaa aatagaaaca attaaaccgg    237180
     ttctaacctt agacaagtag tgagtaccat tagcacgagt ttgacccatt cttctgatga    237240
     aatcagtttg ggcaacgaaa ccagaaatgg taccagtatc ccaaccgaaa acgaaaccac    237300
     cgaaagcgat gaatagacag aagatggaaa tagcaacgta agcggaagca ggcttctttg    237360
     ggatctcaac cattggttgg ccatcctcat cggtgtaagc cttgaactcg tcctctcttt    237420
     caactttgct gttggaggcc gagagagcag attgtgattc ttcagacatt tttaatgtta    237480
     gtattatttt atgtcgatca acttcttatt tgataatgtt atctaagaag taatgtgtta    237540
     tgaatattga tgatcgatat tagtgatggg ttctttttgt gagagaaagg aaataatgaa    237600
     tgaatcagaa aacaggaaat tgaaactgga ttattgtatg aaataattga tccttttata    237660
     tgtttttttt ttttgggaac atctgttcta tctctgatga agatacattt gagcttcaat    237720
     gttgtctttt ctgttttgtt gaattgtact tattttctcc acataaggta atactcaaat    237780
     tacctcgagt gtatgtgtgc agtgtatgtg tacgcaatac tgcctttcaa cttaactcat    237840
     cgagggccca aataagaaat gtaacaagca aaaatttgtc ctggaggtat tcgcagagga    237900
     gtcacactgc cgttattccc ttctctcttg gttgcatatt aacaaaacag aagaacaggc    237960
     tgtttctact tggaagcaat gagctcggat aacagactca cacaaccgtc agcttgttct    238020
     ccgccatatt tgactttgga ttgtcgcctt ttctttcggg agagcccttc atcggaaaaa    238080
     ctaccaaaaa atgagaagca attcagtaaa atgagcgtac aaccaatttt ttttttggga    238140
     agggatggac gagtggaaaa actttttccc tgtgtctgta ctaggtaaat gaacatcaat    238200
     ggttttcacg ggtgtttgca ggaaaattgt tatgaaacca aaaatatctt atttagggag    238260
     ggatggaggg gtctcatcca aatttgtacg tacaaagctc tgcattcggt aatggaaaaa    238320
     aatgggagtg actaacgaaa acagggagat taaagactct ggaaaaacca gcaatcaggt    238380
     ctagggggta cgtacttttc tgtgtgatct gcaacctttg gagtttttcc ttgtagactt    238440
     tctgttgctt cccctttgat aggactagtt cttagcggaa aaacaacaac aagaagaaaa    238500
     aagtccaaat tgatttgccc ctcgctaccc ccccccccgg aaaatctcct tttttccttg    238560
     aaacatggaa caattttttg cggggtcgat gagttcctaa ttacgtagat gtgagtccac    238620
     ctctcccatt taggcagcgt tcaaagataa tatacttagc actgtcaaag ttcataatag    238680
     aatttttccc aactaccatt atttcggaaa aactttagca agggactctt ttcttctata    238740
     attattccat caagggcact gggatagttg caagggatgg ccaaggagtg cgaaatggcg    238800
     cggggggtaa gggaggtggc gcacagtgag tattgttaac tgcgatttag ttgaatgccg    238860
     caatgtcata tgatggatat cctccggatt aatttctgta gctttgataa aaattacaaa    238920
     atgaggcaaa tgcgggggtg ttagctaata agattcattt ggtaatacca tgtatccatc    238980
     tcaggttttt ccgggtgtat acacccaatt tagcattggg ttcgcttttt atttccatct    239040
     gtgacccccc ggaatagtta ttttgtgtac atcttttctt tacagcaaga agatagtgtc    239100
     aaaatttgat agaactgtat aggccaatag agacagtggc atgattatat tttaaaagat    239160
     acagatcgtt gttgataaga gaaactcact catgttaacc attctacttg atgaggttgt    239220
     tttaacatac caattgtcca gacctatgga atagaggggt tgttgggagc aaggttccac    239280
     atatatatcc tggttcaaac cgattgtaag aaacatgaaa cccacttgtt tcctttcatt    239340
     aaaaagtatt catttgatgg gaagcgtatt tttggtactt tttttgtagt aacttgacat    239400
     tcaaattttg ctctagcata tcatgttaac cttccattac tagccaaagc tatagctgca    239460
     attatagtaa gtttatatgg agaggagaca ttgcaaccgt ttgtatttgc ttttttgatg    239520
     aataaaaatt aacttaaata ttggtgaaat agcaattttt tttaatagct gaaaattcaa    239580
     caagtatgcg ctgaatttca gaaagaagac aatcacagcg tttgaatact ttttgttagc    239640
     aaaaggaatt ggtctttcgt tttccaattc atatataaat cacgttctca ttgtagtgat    239700
     tgtaatctat tattgaattc cattgttttt taatcataca atactattta atggcattat    239760
     gtgctagttt tgcatttgac gactgtaatc gtttactttt gtagctttga ctaatgcata    239820
     agagtggtat tactctactt gaggtattta atctcgtata aatattgtga ttagtatcgt    239880
     atgtgctaaa aaaaatacta tgtatcatat cagaatggct atgtaccagt agatacaagt    239940
     ttttattata ttgtgaagca tcttcccttt tttcttttat cagtgtctcg gtcaattcgg    240000
     agcaaggcat cttaaagcaa taagagctca agcaataata gttagatgag gtattttata    240060
     gtttcataat atacgttatg tttgctttag tttttttatt tataatataa atgccgagga    240120
     tatgttataa caatcatttt gtagaattcc tataatttgg aatttgatcg ctctttctag    240180
     gtttaattct ctttgtgatc ttagcattaa gagtactaat ctgcattgat tttaatgaga    240240
     tatctttaac gtgttaagct gcttattttc tatccataaa atattctgca ttatttgagt    240300
     gcaggggtat caatttgata ttattggcta tttcaagtta tactgcggct cttaaagaca    240360
     acacatgccc cacatgtaat atccacatcc tgtatcagag ccgtgtaaag tattaagttt    240420
     ttgagtatat agataagctc ataaatttaa gataaactcg aacctactta ttattctaaa    240480
     caaaagtgat tatatgatca tactgtccaa gaatatgagc gttcaacgac catggcgtaa    240540
     ggctatagca gactactcat accggtacag aagttagtct atgaaagata agataagata    240600
     agattcctaa tcaggaaaga aaccgagtta gggcttctta gaaccagttt atctgccaaa    240660
     gatgaaaggt ataaaaggag ccctcatctc tattagtcta tgaagttaaa cctaagttct    240720
     agtatcttat tctgtataat gaagaaggat tagcagtata ttttgtataa tattccatta    240780
     gagttttgaa ttactatctt atcatcatgt cttctaagta taactggaca catgaactaa    240840
     ctactccaca agatcatctt acaatatcgc aacaatgtcc ttcaccacac attgtacgtg    240900
     aaggctagtc tttgacgaac acaaaaataa caagtgcatc tggcatttat gagtgactgg    240960
     ctaggatatt agtttcgtca cgattgttgc tgaaattttt ataaaagtga gaaacttttt    241020
     attggaacta ttatcttact gtgaatttca ggaatatagt tcctgtcaga taggaattgt    241080
     agtcatgata tttgttagat attattctga caaataaata atttcgtctt gcatatgatt    241140
     cctcaaatat gacattgagg atggaaaatg caaggtatcg aacttggtta tagtaagcta    241200
     ttctcaagtt ctaatattct ctgatcctaa tttggagtgg tattgccacc tttcctcaat    241260
     tacaattaaa aatattgcag agaaaattcg ttcctgttac ataacaacag cagtcttcta    241320
     tcttaatgtt ttctctacaa gattagaagt tgtttgttct acgtagtgat aaaatacttt    241380
     ctttaatgtt ggcctaaatc attttcaaga tatattataa tgcagaattt gtgaaatact    241440
     attgatttta tgtagaaata ttactataaa ggttcctatt tgttattgat ctcatcttgt    241500
     tagtctgagc cattttgata gagaatctaa taagcaccct tttatataaa agaagatgat    241560
     aacagatatt tcacacttca gatgccaata tctccagatt gtaggattac aattagataa    241620
     attattatac aggcatataa gctgggaagc aggtcgaaat ctctttttgt ttctttaatg    241680
     tgttacatgt ttttattcgt tgagcttttt ccaaggtcac caaatcaatt aaaacttttt    241740
     gccgctgtta gcacgtatac gtaactttcc agcgtttttt actactttct tggcactaag    241800
     taaaatacaa gttgggatat ctttgaatat catgaaatat tttaccttct aatacgtctt    241860
     tcgaaaaact caccgatgct caataggtga tctctcgtgt agctttcttg tttaatctcc    241920
     atactgatat caaaaattac taagaataac aattttattt tccttattat catcttgtgg    241980
     gatcgagtaa cacaattaat cttaaaaatg attattttgg tataggcagc caacagtaca    242040
     tagaatggta gtatatgggt ttcttacaaa atggaggtta cgtgaaagat gattatccag    242100
     atgagggaag agcattgatg ctggtctcag aatattacgt acaacacatt accaccgcta    242160
     actattataa taaatgtgtt aaaattatcc tgatcggttt aattgtgtca acaaacttag    242220
     gtctttaatt tctgacttct tttcttttat ttagattcag taattgtgtg aactaaaata    242280
     ttataaagtg tgctagacta taaaggatgc agtagaacgt cagatctctg tttatctagt    242340
     atagtgtatc gttagaacct agaatttctg caagaagatt tcgttgaaaa ccttttttct    242400
     ttattatcga tggttgcaaa ttgaacaatt gtcggttttg atgttgttgc aaaatactaa    242460
     cttgcaggaa taaacggcag tcaatattca actcttactg ctataagaaa aaattgttaa    242520
     catagccgca aaaaaaaatg cctacgtaaa tgatctggat ggctaaatat gaatgtctag    242580
     ttatcttgca agataggggc attatgtaaa cacagaaagt ggcaggatat ttgacaatac    242640
     ggctgtaaat gacaagttgc ttatatcagc taagaagaaa aaagaaagaa aaagaaaaag    242700
     acgtaaataa aatattatcg atattatgat ccgtagcaca gtttcttttc ttgatcgcat    242760
     gtttctgtaa atgttctcaa tagtgtttgt attgcctatg tctcataaaa tgataccact    242820
     agtaagacac gactaggact atggtttttt ttttctagct cctacgattt gtttgtactc    242880
     aattaaccca tttaacagca gagaaattta tgttttatgc cagcacaggt gtaaacatgt    242940
     caagatttta tttctgatta tacgaaaaac tactttgacg gttagaggtg cgtatggttc    243000
     gttaacactt ttttcttttt ttcataattt gcaattgcca agacagatgt gtttgttttc    243060
     ttgctgttgc tttgacagca gtaaaattac gtacaaagtt taagttataa gtaatatgac    243120
     gtcatctaaa tatacaattg atggtcctcg gagttagtgg gttacggtgc gaaaaacgaa    243180
     aacttaatct ctcacttcaa agtcaaatta tgcgggaggt tttcacgcta ttcttcacgg    243240
     ctcttagtat ttcacgagga tttctgggaa ttcttcacta cataaagttt cctcacaatc    243300
     attccagtta gaaatgttgt accaactgta cttggcggtc tatgtatcga gagctcttta    243360
     aaatccaaag ctacggcgcg catttaactc gttaaaaaaa ccaaaaaaat attatgctac    243420
     tacttattag gtgctaaata gctaagtgta tataatttaa attacttaga ctgtccctat    243480
     taaaacagcg caaatttagc tgttttggct agttcataat agatatagat atggtcaaaa    243540
     cagggaaaga atattgttat tgataatagt attgatgaga ataattattg tagttgaaaa    243600
     agtaataagc ttaactgctg tttgtacaag tagaatgtga aacactttct gggtacattg    243660
     tgtaggagaa tacttgtgtt tttgatttct aaatagttac cttctggatg ttagtaaagg    243720
     tgacgaacca gagaaaagca aaataagaca aaatctatgt aacagtttga ttttattttt    243780
     taatttgact gataaaactc gtctcttgct cagtgtacta tttagcgttg ggcacctcgt    243840
     ttcaatatta ttttttttcg tatttttgaa agttgcaatt ataatttttg ttgcaagaca    243900
     tagtgcaaac gtaattcaac aaataacatt ctgaaaatta gctgtgagca ataccctcct    243960
     atattgatga cctgttacag ttttgcgacc atttactgct agttctctca ctttctcttc    244020
     gttaatttcg gaatacaata taggtagcgc tcgtaaatat cgtcagagaa agtaattaaa    244080
     ttataccaga ggacttctaa tgctgttaat aacaatttat ttctttattt ggcgtaaact    244140
     gaagcaaatg gatgcaaaac tcaacaaaag gtgttcataa aattatggta atggaggaat    244200
     aagagcacaa gtattatttc tcagaatagt tacgttgagt tgatagaatc tagttttctt    244260
     ctatttatta cagtgcacaa tagaaatgat attattagta acaatagaca tagagggtaa    244320
     ttttgataac ctgattgttt agacttctcc tttcctggca aataagatga agacgccata    244380
     tttgtaacaa aagaaagtgc ctcataattt gtatgaagtc gtaatgtttt tcttagaacc    244440
     tttctgtgac taagaagtag catactctgc tctattagtt caacttaaaa tgataaaaat    244500
     atgaattttt cgatgcaacc aagtaaacag tttaatggca cccaccatga aaatttttta    244560
     tataaaaaga gctctttgaa cccaaaagta acaaacataa atgtcttctt ttagtagtgc    244620
     ttatatgata aattcggaaa taaccaagca aataaaccat tcactacatt cgctttgaaa    244680
     tcatgaaatt tggtggattt tctactctta ctcaagctgc tgctgcgttg gctttgttca    244740
     atgctgtcga tgcgttcgac gcttcctctc caggacgtac tgatttgaat actactgaaa    244800
     ttgacactgg ggctttcttg ggtgacttgg atgtcgtcaa agttccagaa agtgcaaatt    244860
     tgagtgagta catcttgact tacgcaggtt ccgacaaagc attgcttgac gaaaagactg    244920
     gttatgtctt gttgaacatc acccagaact acgctggcaa tgacaccatg gccaagcgtg    244980
     atgttaaggt ttacggctat gatggttggt accaaacctg gcaccaaatg cagaccgtta    245040
     acaaaggtga atggtggtct ccatggtacc caatctccca gtgtgtttcc aatggtctga    245100
     acgatgctga ggcttccatt agtgttaact ttgcctatac ctacacctgg tctttggaat    245160
     ggggcttgaa tgctggacca gatgttgtcg gtgcatcgat cggttactca attagtgatt    245220
     ctgttggatg gggtggccaa ttccaatgta acattgcacc acacactaga ggtcaaattt    245280
     ggtaccaaca aagagttgcc tgggcagata ttcagaagca agactgtcgc agggaaaaca    245340
     atggtaaggt cacctgtagt ccatggtcag ccttcaaccg tgttaatgca ccattgaagg    245400
     gtgccgacaa tgttcatttg ggatgtagtt ctggagagga taacatccaa tgtgatgctc    245460
     actttgattc tcgtttgggt caaatcttca gaaacatttg aaggacataa aatgataaaa    245520
     agtccacttt ttatttgtat atcctatcat aattttcaaa ttggaaagct ttttgttttt    245580
     attttatgtt actttgcatt gaatattaga tgagcatagc atattataag gtctagatca    245640
     aagcactgga gataaatgtc cagattattg aagtgctttt aaaaaaccta tatattgtat    245700
     gatctgtatt gtattcacat aggtgttatt tagtcaataa aacattaatt tttttcaaat    245760
     acgtggtttt taataaaatt tccatgattc atccggtaat ggaactcttc agtcggctag    245820
     ttctgtacta tggagctctt tattggcctt tatcatcttt agtctaaata aacaataaac    245880
     gacaattaca tggagagcgt ggttaaccaa tcaaaactct atttaataaa attggttgct    245940
     ttctttcgat tataatgatc tatgagagtt aacaaattta ctatccttat ctcataatct    246000
     acgttctatt tatgttttgg taacaatata ccacgtttcg ttaattacag cgaatttgtt    246060
     cacacggtgt gagcacttat tctaagtaaa tgtcgacctt aaacaatacg cagataacac    246120
     ttctattctt tactattata ttgtgcgtca ttatcttaag atatcatatt gggagtattt    246180
     cttgctccta tgtatagcgt taagactacg gtggttaacg atacatacaa gatactaact    246240
     aaggaaacat taaatcacgc ctgagtttgt ggtttgtact actagcaata ctttcttaaa    246300
     agggtaggat ttgaaaccaa acattccttt ctagttgata ctcaccaaag caaaatctgg    246360
     accattgata taattaccaa tattaagact taacaaagat caatgcgcca tatatgctta    246420
     atgttccatg tggaagaact tagtagttga aacattcaat gttctggcct gatatctggc    246480
     aattaaccta ctaacgagtt gaacttgtct gcaatttaat acgttgatat ttctcttggc    246540
     ccaaccacat taatgacatg atactcttta gggaaatctt cgacttcaca tattatgaga    246600
     ctgatttagt taatcatccg aaagataaga caggatgtaa agacctcgac tgtcataatt    246660
     cattttccat taattcaaag ataggggcat aatttactaa ttttgagtga ctttattgaa    246720
     atttcaaatc tatcttgact acaaagcaga attactacgg aaatgcaaat agctagtaga    246780
     ttgctttcaa tatcaaaaat cttactactt gaaattcatg cattctaaat aatcgtcact    246840
     gttgcattca aaataaaaga ttctatatgg tgcttaatct agtaaatgta tatcacttgg    246900
     ttcttgaata ctcaagatat ttcttttcag ttgctacagc cccatacaac atgtctcagt    246960
     ccaatcacac aagtgactta ctgaaatttc gcatagttaa taaaaaaatt ccatcgctca    247020
     tagaattacc acaatggcga tagggaaaga tgactaaccc ctcattttcc gcatgtcttg    247080
     ttgtccaaca atgcatgtta aactttctca acaagtgact gtagaaagaa attgctgtag    247140
     gaatgaattt ggttgcttct caaattggct gttcaaaaac ctcaacaata tgcttaacta    247200
     gctacattga agtgatctac ttttttgaag ttgtcttcaa gatcatctgt aacaaactaa    247260
     ggtctcagcg aaatgggtaa gcaacaagtt cacaactaag agatccaatt agaaatgatt    247320
     tacgagttat gaaagttacc aataatcaag agtcatcccg aattttagtt catgccaaga    247380
     gtcgggttct aaaaatatga aaagagctgg aaagcttcat aagttattgt ggtacctaca    247440
     aataacggtt gcttaaggaa ataatggttg caaaaacaat tgttacaaaa tcaaggttta    247500
     cagaactgta agaaaacaat tgagtgtatg aaacgtgtgg gtcaagatgt atttgcgaaa    247560
     caagacatag aactattgat tggtcaataa aattatagtg gtaatcaagg aagagttatc    247620
     cccataagac tggattcctg ataagggggg aaattatgcg cacctttgga gaaacatcaa    247680
     taattagtcc cgttattctg acttctttgg acttaactca cagagtgtta taggtgtagt    247740
     ttgtaaagta ctgataagca ttttcatctt tgtgagcgtc acggtagagg ttgtacaatt    247800
     gcatacattc accagctgaa atgaaaataa aagtattgaa ctatcataaa ggttgaaaac    247860
     ggtacgtcga aattaagtgg taagcataac taatatgatt caagaaatga taactgaata    247920
     ataattttga ctagattggc tcgtggcata gtgaaatatc ttctttttag gtgaattggg    247980
     ttaagtttat tagtcaatcc agtagcactc tgtttcttgt atttatcaaa cggttcaatt    248040
     tgtatggtag aaatatctac ttaatgtttg agagtaactt aatttattag tcacttggag    248100
     aagttcatta atactattaa tttgagaata acaagctgaa taaaatttaa gcttgtgact    248160
     cactgcagga tgaccttcaa tccaaattgc cctggaggta gaatggaaac tttctaagca    248220
     gcagtcggca aagaactaat cttcaataca attctcgcca ctcaattggt cgagcatcca    248280
     atatctgaat aattagatga acaactcaca gaaagtcatg gagagcggtt acaaataatg    248340
     atattgtgat gctctccaca gttgtaactt ttgtgtcttg attattttta aaaggtataa    248400
     aaggtgacac taatttctct tgaaggatat tatatgcctt tctctttgtt acttttgttg    248460
     aaaacagaag ataacaagta ttatcaacag aaacttaata ttacagatac ttttttatat    248520
     catgaaattt ggtggatttt ctactcttac tcaagctgct gctgcgttgg ctttgttcaa    248580
     tgctgtcgat gcgttcgacg cttcctctcc aggacgtact gatttgaata ctactgaaat    248640
     tgacactggg gctttcttgg gtgacttgga tgtcgtcaaa gttccagaaa gtgcaaattt    248700
     gagtgagtac atcttgactt acgcaggttc cgacaaagca ttgcttgacg aaaagactgg    248760
     ttatgtcttg ttgaacatca cccagaacta cgctggcaat gacaccatgg ccaagcgtga    248820
     tgttaaggtt tacggctatg atggttggta ccaaacctgg caccaaatgc agaccgttaa    248880
     caaaggtgaa tggtggtctc catggtaccc aatctcccag tgtgtttcca atggtctgaa    248940
     cgatgctgag gcttccatta gtgttaactt tgcctatacc tacacctggt ctttggaatg    249000
     gggcttgaat gctggaccag atgttgtcgg tgcatcgatc ggttactcaa ttagtgattc    249060
     tgttggatgg ggtggccaat tccaatgtaa cattgcacca cacactagag gtcaaatttg    249120
     gtaccaacaa agagttgcct gggcagatat tcagaagcaa gactgtcgca gggaaaacaa    249180
     tggtaaggtc acctgtagtc catggtcagc cttcaaccgt gttaatgcac cattgaaggg    249240
     tgccgacaat gttcatttgg gatgtagttc tggagaggat aacatccaat gtgatgctca    249300
     ctttgattct cgtttgggtc aaatcttcag aaacatttga atgatttttt ctgttatttc    249360
     gacctgggta gctgtcgatc tttttcattt accctttttt ttttattatt tgaaagtccc    249420
     gattaatcaa taatgatcta tgaaattgcc attcatatac aagacgtgtc gtaaagttaa    249480
     ttatcgccat aattataata tattcttaaa aaagagcaga ctctgactta aactgttaaa    249540
     aaaaaaaatg aaaaagcact taaaaaaata aaaaaataat acttgtatgt taatgggacg    249600
     gtatcctgtt tcccaactat caattactgt aaacgcacgt ccttcaaaat cactaattag    249660
     ctttatctac tttgtatatt tcttatattg attaatttag aaactgactt tcaaatcgac    249720
     gtttccttcg tattctattc gattccgaca agtgaaaaaa agagtgcctc gccttgttaa    249780
     cttaatgggc tttcttaaca actagataac tactaatttc atcaatccct tccttttttc    249840
     caggttcaac tacctgtcga tttcaaaact gtaccagagt gaattggttt tggtctaacc    249900
     agaaacagaa agccaggact atatatttat aaatgactca tatttaatct attatacata    249960
     aaattacctg gatagctgag aatcatattg gccctgcttc caccatatga ttccttttcc    250020
     ccgctgctca tcaatttgtt tcatacatat gccccaattt ttgggagtaa aactatgaaa    250080
     ttcaagttgg agagtcattt agaaccatat cagatttttt aatccacctc attcgtttca    250140
     ctaacaacaa tttgtcagtg ctagagcctt ctttactggt tacctaattg agaaccttta    250200
     ctgcaccaga aatctttctc gaagtaccat tggcagccat tcggaaaaat tcctagaaaa    250260
     cgactgatat aagcaaatgg tcaaattgaa agtgggatgt agactgataa tacccgttga    250320
     cccttgcaac gttgttagat attgcagtag ctaatagtac cgttgggctc atctgcaaga    250380
     tgaaggctct gggcgaacgg caccttaaca tatcaagttt agtagttcat cgcacgtaaa    250440
     gttcctctcg gcagaagtac ttgtgtcgat aaataatata ttgatatttg ggcacagagt    250500
     tattctgagc aaatgttcct gttgattaat tataatacaa gttgggaaaa actaaacaat    250560
     acgtaatacc taaattcttt tactactacc attgtgtgtt acaactaagg gcttttattt    250620
     caacaagtct tttaaaacct cagccttcga tgcaaccata ttatgtagtt gtacatattt    250680
     gtttcatata taagatagga acttttaaat cgaaggaagt tcatgtatta tgaggtcgtt    250740
     ttcttggcat tttctatgct ttattttatt tgttgtatct cgaacattcc acatcacttc    250800
     atatatactc taattgtata tatatctcac tcatagtagt tcctgaaaat atgtccgctt    250860
     tgaatgggag agcatacgtc ccaaaatttg ctttgaaatt ggtatgtctg ctgctatgct    250920
     ttgaacttgt ctctattgtt tctgccatgg gaggtatccc tacaggtctt ccagaaccac    250980
     aattacaaaa caatttagac gtcgatgaca gtgacaatct tgttacgatc ccggatgagg    251040
     gaaacttcca cgactacatt gagaagtatg ctggaaagaa tacaccatta ttggacaaga    251100
     gatcaggtaa tttaatcgtt gatatcaaga aggtcaaaga tgcttccgac tctagcagta    251160
     ttcaaccaca tactacaaaa gtctactcta agaacaaaaa aactcataca tttaaagtta    251220
     tgagtctaaa ctctactgaa gaagtttggt ctgactggtt cccagtctct aaatgcgata    251280
     taggtttagg tgataacgat aatcagataa aacttaagta tgcgtaccat tacaattgga    251340
     ctaaagaaga tacattagat gctgatttta agcatataaa atctctgtta aaattgccca    251400
     tttccaaaga agttggaatc gggaatacct ttaaatgcgg tgcggaagct gggcaaactg    251460
     tccaagtgtg gttacaacaa agatgtataa aagcattaat tcagacacag gaatgcacaa    251520
     aggaatcttc aagagtcata aagtgtaatg actgggataa tggaacgtat attatggcac    251580
     ctttgaaagg tataggcaat gttcaatttg gctgcagtgg aactgacaat catactgaat    251640
     gtgatgccaa gatggaccct aaattaggaa agaaatttaa gaagtcatag ctttatttat    251700
     gatactaaag ctcatacatt taattttgca tattttctcg attagtgttc caagaatttc    251760
     ttgacatctc tcgcaaacaa tatatacgta aaatacatat attctatatg caatattaca    251820
     aaagtacttc tcagagtcca ttttagtcca tcatttacta caaagatatg tggacatcat    251880
     aatgtgtagt aatcactagg aattgctgtt cgatttcgcg aaatcaataa ctaagtacaa    251940
     tgggttgaat ttgatgataa tatcctttta aattaacgta agaaatttaa ttttatatgc    252000
     atgaaatatt ttaaaaaaaa tatgctaata tacaatgaca aaaatttagt ttgaaaatgg    252060
     ggtaatctta tatattaccg caataatcag agtttcatat caaatgaact ttattcatcc    252120
     acctgggatt cttcttcata tctgagaatt gatttatata gtgatcagtt ggtagtgccc    252180
     aaatgacggc attaatttct accaatgact ctcttgtacc atggtgtgtc atcatgaagt    252240
     aaagcatcgg cgtcatagct gtcatctctt tcggattctg ggacccactt ggaggacttc    252300
     catggtagaa caccttcggc gtacatctca tcgacttctt ccaaagtcaa acctctagtt    252360
     tcgttgacga aaaagaaaac gtagaagtaa gcaaagacca tacagcccat aaagacgtaa    252420
     ccgtagtaga agttaatggc attggtaata aatggtgtga agaaggcaat caagaaaccc    252480
     cagatccagt tggaagcaga ggcaatggac atggccttgg tcttgattct caatgggaag    252540
     gattcggaga taataacgta agcaattgga gcccaggtgg tagcgaaaca gaagatgtag    252600
     aaacaggaga agacgatcat acagttaccg gcacccttgg aagagccatt accttgacca    252660
     tttggccata atctggtaac accaacggaa gcgtagacaa cgtaacagca gaccataccg    252720
     gcggcaccgt acagcaaaca gttacgacga ccgaaacggt cgacggtgaa caaagataag    252780
     aaggtagaga agaagttaac gacaccgaaa acgatagagg tttggaaaga atcttccaaa    252840
     ccaacagcct tgaaaacagt agtaccgtag tagaagaagt agttgtcacc agtcaattgt    252900
     tgcaaagatt gaatcatgat acccataatg gtacgtctca acatagcagg cttaccagtg    252960
     atcaattcgg accaagaagc agtaccagcg gcattagctt cttcgacctt ggctttcaag    253020
     atggtgaatt cttgttcgat gaatgggtgt tcagctggca acttgttggc agcacataga    253080
     gacttacgag cagcatcgtc atctccggct tcgatcaagt aacgtgggga ttctggaacg    253140
     aaggtcatac caccgatcat aagcaaagcc caagcgaaac atagacccaa aggaactctc    253200
     cattggacag agttggagta gttcttggta ccgtagttag tacagtaacc caagaagata    253260
     cccaaagtga tcatgatttg gtatagagag accaaagaac ctctcaattc cttaggagcg    253320
     acttcagaaa ttagagttgg ggaaagcaca gagataccac caacacccaa accggagatg    253380
     attctaccga tgaagtattg gtaccacttg tcaatggtag cgatttgaat cacgataccg    253440
     acaatgtaaa ttagcacgac agtcaccaga ccggccttac gacctttagt atcaccgatt    253500
     ttagacaaaa caacaccacc gatggcacaa ccgatgttga agataccgac aactagaccg    253560
     gttctaacct tggacaagta tgaggtacca tcagcgtgct tggaaccgat tcttctgatg    253620
     aagtcagttt ggttgacgaa accggaaatg gtaccggtat cccagccgaa gatgaaacca    253680
     ccgaaagcga ccaaagcaca ggagatactc actgcgatgt aggcgctctt accgttaggg    253740
     ttttcgatct tggcctcctt ctcgagggta tctggatcca gatcatccct cttgtagctg    253800
     ttgtcagaat tttgcgaagg ataattctca aaagactcgg aatctttatt agaactactc    253860
     attttttttt cgaacttgta tttgtttgtg tattgtagta cttattggta ttcataactt    253920
     caaagagaat ataccaactt agagagctgg atgtccaact tatatagcaa tttcgaagca    253980
     aaaagaaaca agctaaaaag aaaatttttt ttttggttaa tggagagaac ttccatggga    254040
     ttggaattga tttcccataa aattatgggg gaggttatgg ggagggaggg attggaagca    254100
     aaaaatatac gcggagtagt gctttattaa taattttgac ccaataatag gacaaagggt    254160
     caaaattact ttcttttttt tcttaaactc ttgtgttgta ttcatcattt gttaaagggt    254220
     ccagtacaat cccaactcag tgtgtaatgt taggttgaaa tattagaatg ggttgggcag    254280
     ctcatcggta ttattgttaa aagtccttcc attgggctta tattgggcac tactgattct    254340
     ctcagagacc tgcgtagtac ccaaatcaca gtcgaggaag aacattcctg cgtttccgtc    254400
     tgcgtcgccg tatctcaccg aataaaaaaa gaaagaaaat gtaagcatag aatatgagaa    254460
     gcagcagaga accattacga agcacctctt cgatccattt tgtggtacgg gatattcagt    254520
     ggggggtgat cggtcttttg tctcggggtg tttctgtgtt tctgtgctct gtgtttctgt    254580
     gctctgtgct ctgtgctctg tgctctgtgc ttccgacgga tccacgggtg tgggcatcga    254640
     gagggatgta ctgcccggag tcggagtggg aagactcaga gagacaggtg gaggactcaa    254700
     taaaggcagg tagcaaaaaa aaagaaagaa gaagggaggg gggatgtacg gctgtttact    254760
     cggcagatag aataaagtcc gtacatttct tttcctgatg ccacggtgct aaaacacggc    254820
     tgtacaggag ttacttgggc tgcataacag gaagataggg atggagttgt acgggtgttc    254880
     tactctggag acaaacccag caccaaccct cccaagccca atagagaaag cgcttgtgcg    254940
     agatgatcaa gcaaaccagc atttgcaaat tagaaagacg gatgcgtcct ccgtgcacct    255000
     ctgtctgtgc gagtccttat ttagcagcgt gccgaaaaac ggaatttacg gagagaacag    255060
     tgcagggatt tccatcaatt accattataa aagtaattgt agcagaaaac agaaaaaaaa    255120
     gaaataaaga taagagatcg gtgctagatt ttctgggcgg ggagcacaat gccgagcaac    255180
     cctaaatagt accaatgtgt gcgagtgttt ctgtgtcata gcacatcccc cccaaactga    255240
     tctcgaagcc aaagatgtgt tggcgagaga tcctgatacc agagaaacag agcatgccag    255300
     agaaacagag catgccagag aaacagagca taccagttga gcatgccagt gagcagcaat    255360
     ttcattacgt catttacttt atacgtctga cgtgatgata atactagtgg ttctcacaag    255420
     gctctgattg acaatgatga gaagagatac acttgctggt acatattagt caaaaggacc    255480
     actatttgga gtcgatatta ctaaactata attgtggtca atggcttatc agtttcggct    255540
     gggctcttcg atgccaaata ggagaaggaa tgggggggga gggccaagtg atggggtcaa    255600
     aatataaatg caattgtgga acaaacttga tgtttatccg gtttttctat gataaataat    255660
     agcgcatacg taaacaaaca agtgtctctc gatagatctt atgacaagat acactttgcg    255720
     ttaacaaaaa cgcttctgtc ttggattact cctctgcccc tctctcatcg cagaaacgct    255780
     aaaaaatgct cattagtata aagtgatata tcaatggtgg ccattataaa catattttac    255840
     tgtctctttt gcactaaata agagaggttc ccttggatta actaataaac ataaatagaa    255900
     aatatggcta cgtaaaaagt atagaaagca caacgcacaa tttttgggtg gaggaagaag    255960
     aaagatcaga gaataatgac agataggcac tctatgtgca tgcaaaagat gtaactcgct    256020
     atttctctcc tgcgggtaaa aagggccttt cataagtaaa acacctttgt tcgtgcagat    256080
     ttgggtatta aatgacgata ggattttaga ctggataatg ctgttatgaa aatgaagatc    256140
     aaaggatgca attgtagtta tgaaatacaa ttatcaaaac tgagatacct tcaaatatca    256200
     ataaatttct tgaatcagaa aaaaaaaagt aacttttgac agatttgaac tattcctcat    256260
     tgtaggattc ttcagtaaca acctcagact cggagatgaa agtaacttca acccaagcta    256320
     aaccattctt cttttcaccg tcgtctaatt ggaaatggaa attctcggca tcgccgaatt    256380
     gatagatgta aggctttgta ccagcaacac cggaaacgat gttcttaaca aagtttggaa    256440
     cttcgcccat gacatcgatt ctctcaacca tgttttccaa aggaccttca acaacagctt    256500
     tgatcttgtg ctcatcgttg tcagcttcaa cgtcttcatc cttggcgcta gacttgtgac    256560
     ctttcaattc gactctgatc tgctttggaa cgttccaacc gactgagtca atttcctggt    256620
     tcaggtgcag agcgctgttg tcgtgtgtca ctgccagaat ctccttgtca ttcgttatga    256680
     taccgataga gaccttagtg ttagagtacg acttcggcgt cgtaaattcc atcagcacca    256740
     ttgtattttc cttggaatga aagaacatga agttccatgc cttagcggcg tgatgtggct    256800
     tcataccttg gaaagccatg acgaacatac agtacgatgg gtcgtcctca ccgaacttca    256860
     gtgttctctc ttcgtattcg atagtctctt cgacagcttc gtcctcaccc tcttgttctt    256920
     gctcctcttg ttgttctttt tcctgtgctt gctcctcggc agtcttttcg gcggtctcct    256980
     ttggtatctt gactttgatc tcaccaacac atgtgtttct tggccagaaa acgtgtctca    257040
     tggaccccca aggctgttcg acgttgtcac cgtagtaggt agaaggatcg tcaccgagct    257100
     tggcaccggg agttagcctg gttaccgtca agtccacgat agattgctcg tttaccttgg    257160
     agatcaagcg gtactgtgtg ttatccgcat tcaactcaac ggacaagtcg tcagcgtaga    257220
     agttggcatc ctcgatgcgg aagttctcca gcttggtgga agtccacaaa ttcaacttct    257280
     cagggttctt ggagtcgaag attctgaagg tgaactgcgc agcggtgtgc aaaccgatga    257340
     tgtttgagtg gataatctgc gcgaaaccga caacaccagt ggccaagttg ctgaaataga    257400
     aagtcacagt ctcgacattg gtatggtcgg gactcttcca gaagaaatcc tcacgggtgg    257460
     tctccctgta aggctgctta ccttccacac gctccgtgac cgtgtgtata tactccttac    257520
     cgtactcagg ctcagcgata cctgtcacag cagacaaacc tccttgaatc cactttagca    257580
     ttgcgtatac tctactctgc tctgctcata gtccccaatc acaccaacta gctcatctgt    257640
     taaataagtt tcaacttatg ctaggaccct tcaattctcg aaagggtacg gagaaactga    257700
     tgttattaga aaaaaatttt actctctacg gcgatatcta agggaaagcc aaattattat    257760
     attatattat attatattat agtatattat atttgtattt gtatttgtat ttgcacttgc    257820
     acttgtactt gtacttgtac ttgtatatta tactaccatg ctttttgcat cttctattgt    257880
     atgttgcgca ttgaaatgta gtttgtctgg tgcttaaaac aatttatccg atgatatttg    257940
     gttgattaat tgatctgttg aattttattg caaaccattg caacgtgtag tagctggtac    258000
     caacatcatg ctaattacta tgcaatcctt gctctacaaa ttgtattgtt tagactgtat    258060
     tttaatttcc ctgtaataat tttaaatgct atttgtaata ctatcgtccc ttgggttcaa    258120
     tatggtacag cattaaatat ggcactacac tacaagctct gcattggaat tctgttgtgt    258180
     gtttccctat ttcatatgat tgcaataaat actacattgg tgtgagttgt aatttatcaa    258240
     cttcaatcac atacaagaac aagacaattt gtagagctgg acatggtctt gccaagctag    258300
     taccactctg aacaccgcat gaaaacacac tattgtaaga ttaattcagt gcattgtcat    258360
     ccataattct aattacaatt tcttgcataa ggattataat acttgtggat tgattttgct    258420
     ccactataaa tatcatactc aatcaattct gccttgtaac cgaattgcca tttcaatcaa    258480
     caaaacatag catagcactt catcctacaa tgccatatac ctgtgaatat tgctactgct    258540
     attatcttgg gaagtgatat cacttttgcc tgacctgggc caacttcaaa gctgatattt    258600
     gaagaagctt actatgcata cacactatac gcacactaga ttcaacaata ccaaagacct    258660
     gctaagatgt tctgctcaag atcggttcct aggttgaggg cgtgtgccag gagatggtac    258720
     cagaggccca gcttacaaca tgtatcgccc gacaaggagc ttcccggtgt gttcactgcc    258780
     cgaggattac aaaatgcatg gtttgagaga gctgaccact acgctgcgca gttgaacaag    258840
     tacacccagg gcacccagga gaccgctctg gagaatatca tctatgagga gtcccgctct    258900
     tacatcaagc gtcacattac caactacgcg agcttgctct acaacttgga attcgctatg    258960
     cagtcgttgc aagggaaccc acaaaacaag ataccacagg gaccaatcgg tagagagtca    259020
     ctgttggaga cacccgctac ggagcaactg atcaagaatg agcctaggag ctctggtaac    259080
     acagatttac accagctgct ggagaattca tttgggtcaa ttgcagaatt caagactttg    259140
     ctactcaact cggcgttggc catctcagga gaaggtttta cctggcttgt agcaagaaaa    259200
     gtaacacaat cagaaatgga cagagtttca aactctaccg gagacaagat actgttcgat    259260
     aaattgtttg tgctaaacac ttacaacgca ggatcccctt tcaattttaa cagggctgga    259320
     tccatcacta cattgaacaa gacagagaag gctaaagagg ccaaatcaga acagaattct    259380
     acaactgaag tggatgagtt ttctaagact ttgaaagata ttagaagggc taaagaagaa    259440
     gctgtggacc cagagttggc atacatccca ttattggcta tagattcttc accaaaggct    259500
     tggctgcata actacggtgc atttggtaag agacagtact tagaaaatgt gtgggaggcc    259560
     acagaatgga aagtagttga aagtagactt gctggtttga ctagatcctt ggactctagt    259620
     atttaagctt gttatctccc ttcgttttct cttttctaat tccaaactat gaaaatattc    259680
     gcggttccaa ttaaccatgc catttcattt cccgttaagt aaatatatat ttgaacttta    259740
     ggcaaaatgt attctacctg tatataaatg tatcacataa atttattata gtacccgcct    259800
     acagcattaa atgccatgat tacgagaaaa agaaatatta tcaaaactat ttaatcaaaa    259860
     gtacagtaaa aaaatggtaa ttaaaagata ataatttata gttcagaaag aaaaaaacag    259920
     atagagtccc tatgaaaaat agaatacaat gaataatcaa aagttaatgc aacagcactt    259980
     ttgccctggg tattaggaag aaaaatatta aaaataaaca taataacgga atttgaaatg    260040
     acgaagtaaa agtaaaacac ccatgagatg ttcggtttcc agtttatttt ctgccaactt    260100
     tcaaactacg tactcttttc ataaacttac tgcctgaaga tttctttagt gatgatgttg    260160
     gaagtcccag gtatacatct tcttcatcgt cgtcagcatg ggaggagtta tgtctggcct    260220
     ggtgaggtct ctcttctgta ggtccactcc gtgttctgga caagcctgcg cctttgtaac    260280
     tatctgatct cgatgggcga ctactatctg agcctatccc cagtctctgt gacagcgatt    260340
     tatgcctctg aacaccagaa cggtttgtgt gtgagtgctg ctttatgtcc tgtcttatag    260400
     cagctgcaga agctggagca ccatctagga aagtagtaga tcccagacct acagtggttg    260460
     ggccgtgtat cttctccgtt ttactcttga tatccatctg cttgatatca ccgacgttag    260520
     gtttgattgc gtccttggtg ttaaccgatg tggtgctgcc tgctacctgg ccgctaattc    260580
     tatataaatc gttatcgtcg tcatcctcct cgacaccaaa cacctcgttc attgctgact    260640
     tcttagatgt gacaccacca atagtgctgt ttggcccgtc cgctgggaac gccagcactg    260700
     gcgcagcttt cgtgttcttg tttctgtgtg gtgtgactgc atcaaagggt ccgtcatggt    260760
     ggaaggaccc accgaagaga cccgtgacgt ctagcttgtc gatggtatcc acgttcttgg    260820
     gcgtggcaac tttgttcttc ctcttctctt tcttcgccgg cgagctgttg tcttggtgac    260880
     ggcggtggct gtggtggcga tgcggagccc tctctgcact tctgctgtac tcctcgcggt    260940
     gcccgctgct ccgagagtgc tcccggtgca cattaccgct gtaagactcc ttctcgcgag    261000
     ggtatccctt gcctctgccg ccagcaacct cctcgtacga gggaggcagg tccctcctgt    261060
     gcgaaggacg ctcctcacgc tcgcgatccc gctggtactt ctgcctcaac tgctccttct    261120
     cctcctctgc actcaaggcc ttgccatacc cctgtggtgg ggagtgcact ggctgcactg    261180
     gctgcaccgg cgcacccata tgacccgagt cgtgcatatc cccgtcatcc agaaacgggt    261240
     tagtattctg cctaacgggc actggcttct ccgccatgcc cagcggcggc gacacgctgc    261300
     cgccgcggga tggcgacgtg ttcccgcgca cccactcctg gtactgctgg tcgtgctggt    261360
     acctcgtctc catccccgca ctcctgaacg gattgttcac actgaacggt ctgcctgtca    261420
     tcgtatgtgt tcctggggac cctccatatg ccaaacaaca gctccgatcc aacaccctgg    261480
     cctttatata caaaagttga tccccagcct caggagccca aactgaaaat atttttcgcc    261540
     gaaatttttc gtgtcacaat tacccggact tttatacagc atagccttct atattctcat    261600
     attctcatat tgtctattct atattcttat attctctgtt ctctgttcta tattcttatg    261660
     ttctctattc tatttctgca aactatatca taacgtatca taacatatta gattcggtgc    261720
     aatgctcgct tatggagtca ttgcgacgct actcgaatgc gggtaccctg ggttgtgggt    261780
     acccgggtgt ggttgccgaa tgcaatgtag attatatcac catggagccc aggagcacgc    261840
     atgcggtacc caggagggat accagccagg ctggagatgt gtgctgcgct gtgttcctgc    261900
     gcgacgtcga gctggtggac gccagcgagt cgttccaacc cagggtgccc gagagcgaga    261960
     agctgtcgaa ctgtgtagag gtctgcagct tcgtagtggt gcgcgatgtg tcgtagaatg    262020
     acctcccatc gcccgctatc acgccgccag ggtacaccgt gccggctatc tggcccggta    262080
     tgctggtgat gcggctgccg accttcgacg ggtacagctg catcgagtcg tacgcggagt    262140
     cgctctcgta agtagcatac ggtatgtagc ccgaggtcat cgacgaaggg actgtgctga    262200
     atgtagccac tgaagtcttg ttcaaggaat cagtgaacgt gacgatactc gcctgcctgg    262260
     taattatctc cttgcgctcc ccagacttga agttggccgc ttggcccatc gctactccct    262320
     tgccctccag gtcaacggcc aagtatgcgt tcttcatgaa cgcctggccc agcacgttgt    262380
     acccggtgaa tgtgttaggg tacagttgca gcacacaggc ctcctggcct gtgttgaaat    262440
     gcagtgtggt gtttgtgctc tggtcgtgcg tcgacgcgag caggtcgctg agcggcacct    262500
     tgatggtcag gtctccgaac gagaagtcca ccgtggcacc actcgacgct acatcgcacg    262560
     acaccagcca caggtcgagc gactccacat acaccgccgc tatctgtata gctatctgta    262620
     taatcgcctt agtaggtagg tagctcagcg cgaaactggg gtccagcagc accggcgcac    262680
     tgaagccatc cgtagtgaca ttgaggctcc tgcccgagct ggacgttata tagattggtc    262740
     ccataggcac cacagggtag ccgtatgcga ctttgcccgt ctgcgggtgt atgtatggga    262800
     tcatgtcgaa tttcctgaac tcgccctcca ccaagttggg gtccaccgca ccgaatatca    262860
     gatacccggc ctcgttggcg tcactggtgt ctgcgaatcc gttcctcttc tggctcccca    262920
     gccacaacga ataggaacta ctgtttatca ggcgtgcctc tttcaacgca tccaggaaga    262980
     agaacgagtg gttgatgaag tcgccttcca gctcggtgtc cgagttcaga gtcccaccca    263040
     gacctagaga cccgtacagg taaccagacg agtagtcagc gttgaagaac gacaggttct    263100
     gcaccgtcag agtgtggttc ctgaaactca caccgctgtc cacgcccgac acgttcagcg    263160
     acgagctcac gttcatcagc cgcatcacat ccatgtaccg cgtaccgttc agcgaaatac    263220
     cgtctatgaa gttgatgcta tacttgtcgc caccagtgct cgacgtccgc gactcctgcg    263280
     ggtagtacag cggacccgac aggcacccgc tgtccagcct gttgcactgc gagtccgcat    263340
     ccccagaaac aacccacaca tagggctgcg ccagccccag cccaagctgc tgccactggc    263400
     cgggagtacc cagcgtcgca ttcacatagt acataccatc gcgtgtgagc cccaccggta    263460
     tgttaggaaa ccgcaagtcc gacttgaaat attgctccag cggaacctcg ctggagttgc    263520
     tagcaaacac atactgcact aacagcaaaa gaaacagcat cgtacgcgta gccattacct    263580
     gttgtacctg ttaacctgtt gtacctgttg tacctgtggc caagaatatc cacttgctct    263640
     tatatattct cttatctgca aaagtttgtc actgatgacc tgcaagcaaa aatacgtcat    263700
     tctgctgatc gcaaccccgg ggggggggca gccaagccat ctagtaccac acttcagcgc    263760
     gtataccaga tggcttgctg tagcgttcat gtatatgggg tgtggaggga gtgaacaata    263820
     cactttcaat acacacatac ctgattttgg agttaccgct agtgattccc tgttttatcc    263880
     ccgtacacca acaaataata tgcttctgta gctcagtcgg aagagcgtca gtctcataat    263940
     ctgaaggtcg agagttcgaa cctccccagg agcattttct tttttgccat ctgtatgcac    264000
     gtatgcacta cactgccctc caaactgccc tctacagtgt gctctcaaca tgcactgctc    264060
     tatcttttct gttacttgta ttataagaat atgtatacct gcgttacgca aatgattatt    264120
     tactctgttt cctgcctgaa gcggcccggt gctatacact ctgcatcagt tccttcacgt    264180
     cctccacgag ctccgcacac tcctccgtcg gctcttcctc gatgatgcta tcgagcttgt    264240
     cgtcctccag cagatcgtgg ttgaaatggt gtggcaggga ccagccttgt tgcaaaacga    264300
     gctccacgag cccgtggtgt ctgacatcaa acccgctctc tagtatccgg gtgtaccact    264360
     caaacgcttg ctctggctcg ttcatctgca gcagtcgctt gaccatcgtg tagcatatct    264420
     ggaaactcaa cggcacgttg taccgctgca tcaactgcag caacgcgtgc aactgctgcg    264480
     tggtgacagt gccgttgtcg tagatcacca tggagaaggg acacttcttc gcggtattct    264540
     tgacgctctg caccatgctt tcccgcccat agaagtccac cagcacctca tacgcgagct    264600
     tgtcgtccct cagccggtac cggatgtggt acaggataac gttcaggaca cccgtgtcga    264660
     acttccatcc tcgcagcttg tgcttgttct gctcgcagaa ctgcacgtag tgggagtaca    264720
     ggtcgatgca gcagtgcctg aacttatcgg gactcatcac actcgagcta tatgacagaa    264780
     acacgcggta cagctccgtc agcagcacaa cgtcaacgcg cttcatggcc ttcaacgcag    264840
     agacgctgtt cgctttctca aacttgtctc tgtcctcttg cagcgacttg ggatcgatct    264900
     tgccgggctc gccgtgcact atgtaccgcc acagccccag ctcgttgagc aactccggga    264960
     acttcgtgcc cttcgccgtg gtcagcagga acttgagcat cagcgtaggg tcgttgaaag    265020
     tccgtatcgt cgacgcaact gtgctggtca agtaagcatt gaacactttg ctccgggact    265080
     tggtctgcag cgcgggcagc agctcgaata tgaggtccgg ggagttgttc ttgcggagca    265140
     tctgcacgaa caagtgcacg ggcttcagca gcgcctgctg gacctccgcg ctgtccgagt    265200
     tctgcagcgt gctgctcttg atgtactcga cctcgttctt gaacgtgcgc aggaacatcg    265260
     gtacgttgcc ttccatcagc aggtagtaga gcagcgagtt gttgaacttt atgtacatga    265320
     gctcagcgtc ctgcaccgtg cgcgtcctgt ccgtggccag ctccgacatc ttcctcgtca    265380
     gcgcagccag gtagaacttg acgtaccgga agtcccggcg cgcgatgagc ctgtcgaata    265440
     tctgcagcat catgtcgaag gtgtagagcc tgtggaactt ctcgaaaaac acctgctggt    265500
     tctcctcgtt gatcaggaat atctggaacg tcgccagttg gaactccacc tcggagcccg    265560
     tcagcagctt gttgaagaac cgcgtggcat gcgccaggtg cacaccgtgc ttgatcagaa    265620
     agtggtagtg cgagtagaac ttgctcccac gcacatgcgt gttaaaccac cggtgtacgt    265680
     ggctatccag cgccaacacc cggcctccac cagtagcagt agcagtagtt gtagttgtag    265740
     cagtagttgt agctgtagca gtcttagacc ccgtagcact gatcaacttg tacagccgct    265800
     gcaacttctc gccgttggcc acagacctgt cctgcaccac ccgcagcagc tggctgttca    265860
     cacgtcccat catcgctgcc cgtctagcct ccccagcact cttgatggcc aatatttgcg    265920
     aagtcgcttg atatacttcg atgagggatg tgccgctgca cgtcacaggt gaaaaaataa    265980
     acaaggccaa ttttaaaaag tggattcgaa tgagggacta tataattagc tgtgagctct    266040
     ggaccaggga cccaatgcag aagatcagtg ttgcgtctat gctgaaacct gtgcggctgc    266100
     acacagtgcg ggaggaagcg gtagcgggag ctgaagcaaa agccaaagtg ggagctaaaa    266160
     cgggagctaa aatgggagct aaaacgggag ctaaatcagg actggaagct gatacggcag    266220
     ctggggagac actggacgct ggcgcgtcca gtgaggtgct gcagctgcat gtgcctcggt    266280
     cgcggtcgca ctcgcagtcg atatccaaga gcaacagtgt gatctctggc agcagctact    266340
     ctagtgctgg gcggataatc ggtgtgaact cggcgaggag gccgagcgat aacctgatgc    266400
     tgcagatcag tgcgcactca gacggggact cagacgatga agccggcgga gacacgccgt    266460
     cgaaggcggc tgagacacat gcgaatgcgg taccgaagcc cgttaggccc acctcagaca    266520
     attccattag atcgaacgac accgcgctgt tctcagcgaa ccccacagac tcctctaacg    266580
     gatctgcctc tgatagcgat tacgacgagc agcacgacac ctcgatggtt tccggcaaga    266640
     gcgccactac gatgatgagc ccgagcctcg cgctgtcaat tggcagcggt atgaccaggt    266700
     cagatgtgat cacgccgaac aagtacagca acctggactc ggggtccctt gggattgcgg    266760
     aaacaccgaa ggctaggtac attttctcca acgtcaacag gaacagatcg cagtcctcga    266820
     tcaagagctc agagaactct tccccattga ggttcgtcga tggaccgaac cagagacgta    266880
     ctctcccagg tgcctcaaac acgtacttgc actccaacag tacctcggct atcctaccaa    266940
     ctagtagagc catgacaccc tcacacagat atagacttcg caaggagatg agagatgtcg    267000
     ctctaaagaa atccataaaa cagaaagaga aattttacga agaacaggat tctaatctag    267060
     acttgaaaga cgataatgtc gatgcttctt tgatatggaa cattccgatg gcttcatact    267120
     caaccagctc tttccttaac accaccgatt ctaaacataa ggatacgaac ataaaagtca    267180
     cttcaccgga gaataataga gtaattaata acaaaattga gcgccaggat cgccgcttcc    267240
     ctcagaaaaa ccaagtgcat tcgagaagcc agcccaacct acccagatta caacagaggc    267300
     ccatgaagcg acctgttcat caacaacaac aacctatcac ttgtttcgag gacattccag    267360
     ctactccaat tccaggtgtc tcaaatgtca cagatacaga attcatccag gataccatac    267420
     aaaacttatc ttcagtgtac ttacactccc aggaaatgaa gtctcgtggc caattggaga    267480
     aaagacaatc ttcaacccaa tacttacctt tgaacgtcaa agaaatgagt gatttgggga    267540
     tggaagacct tgtgctagtg tctgacaaaa aactggaagc tgtgagctca tccagaccaa    267600
     cttatctgcc accaaaatca actaaggaga agcaaatgca cgaacatgaa atatcgaagt    267660
     acatgaagat ggcatcagat gaacaaattc agaggaaaat atcacagact aaacacatgg    267720
     aagaggacaa agcaaaccac gaaagatatg ctcatttatt gcaaagaggt atcacaagaa    267780
     aatcttcttt gtttgactta agaaaaattt catggaagac agccataagt gatgaactca    267840
     gatgctctat ttatcatact attttggaaa gtgatgccca attagtatca tcaaagtact    267900
     tggagaattt tgattatttg aacagcattc tggatcagat ggatttccca actgataaag    267960
     aaagtgaaat taagcagata atcgagaaga atattacgac caaaatcgga tactcttcag    268020
     ttaaagacaa agaattgaca ttgttactga aattgaagtc gatctccaag caggggctta    268080
     tggttggtga tgctcaactt ttccataact tcttgaattg caaatctttt aaaactttga    268140
     aggacatttg ggagatagcc aatctgattc aactgacttg tttcaacgac acatgcaaag    268200
     acaagtttga cagccgtatt attgaccctc gtggtatcac agctagaatt ctgcatagtc    268260
     caagtttcaa agcagagatg actagctcaa ttatgaattt caacacctgg tggaacatta    268320
     tgtcccgcat tgacaacaac ctatttatgt ggatcatgga tattattgta attgaaaatt    268380
     gccaatgctt caccaacaag cagattaaca aagaccagct gagagataag aattgggatt    268440
     actatgtaaa caaatacgtt gttgttaact acaagatcct ggcctcgcta gcagcttctg    268500
     ttctactgga ctaccatttt gggttcaacg acctaaaaca tctggaacgc attgacaaaa    268560
     aattctgtat accactctac tctgaggaca ccgaatgcaa catcatcaat agctcattca    268620
     tcaagaaatg gcaccaccag tacaaaaaat actagcataa tgaacctcta ctgaattcat    268680
     gaaactttat tcaatctttc ttacctattc attataattg catattacac ccacccaaat    268740
     tatacattca cgaccccaac ttgcaagcaa gcaaacctat tgacgatata taacaagtaa    268800
     atacaattgc tcttttatca gatatagaaa tataacgtcc attctactat ccagctaaga    268860
     cttcattcct tgagtcacct catacaaatt ttgcaaaatc gcactgcaaa aagaagcagc    268920
     aaactcatca attaacatag ttattaatgg tagtacattt cattacgaac cccagtaact    268980
     gttcattgct tatgctcata gttaacataa gaatagaatt agtgagtgag tttgtcctgt    269040
     gaaagaatac aactgcgttt atattttgaa ctaaagaact gttttgccga tgtcatgcgc    269100
     aaggtccctt tggcctttca tttctaatat caacggctca gtgtcgtttc tgagttcatt    269160
     tgtttctctg tttcctcaga ttatagagac ctataaggat aagacagtag aaggtttatc    269220
     cccgttgttt cttatgtgct ggcttagtgg agatatcaca tctcttatcg gtgctctaat    269280
     gacgggacaa ctgaagtttc aaatagcgct ggctatatat ttcctcttta acgatctgtt    269340
     tgtgtgttgc cagtactatt actacggtgt cttacatgag aacaagttgg ccactgttgg    269400
     acatgaaact gtccctgtca tatcgtcctt gatcgatgat ggcataatta ctgttgatga    269460
     aaacggcctg cagaacacag actcaaggcc cgagaccaac atggaaggta gtaggctcag    269520
     caactctagc atatacagtg gtagtagggc cactagatct cttctggcta acgccctagt    269580
     ctctgttaag agcagcaatg cacaacaaat actatccagc ctgcaagtgc caccaaatgc    269640
     accataccca ggccatacag gtcgtggcca gatgggggtt acattgtcat ggctgggtgc    269700
     ctctttctat gttggtgcca gaatcccaca gttgatcaag aactatcaga gaaagtccac    269760
     agatgggttg tcacctttcc tgttcgctac cactctactg gggaacatta cttacaacat    269820
     aagcattttt acaagttgca atttcctgga caccgaggac aagatggcat tcatattcaa    269880
     cgagctgccg tttatttttg gcagcgcagg cacagttgca ttcgacctga tatatttcta    269940
     ccagtactat gtactctact ctagggacaa caagctgaga gaactggaaa gggagatata    270000
     cgacaataac gaagacgaaa ccacaccatt gatagattag cattacactt ccacaaccgg    270060
     ttttctgcat tacttgaagc cccataactc ttttattttt tatatatcct ttctttaaat    270120
     gcacaactaa taaaataaaa aggtatttta ttattattgc agaccgcaaa tgtattgaca    270180
     acagaagtac aactctaatg aagccaatac agactattta atatgtactt attgctctga    270240
     ctgcgatatt atcactcgta agtcatctga tccacaccca cagtaattcc gactgattcg    270300
     gatgcctcga agaatccatc tgatacgcaa tgagcattga gaaagctata agagtatagc    270360
     accccaatgg tttcgtgatg actcttgctt ttgcaattta ttaaagtttc gtactggaaa    270420
     gaagcctatc aacacatatc caccgtgtcg tccacaatat ttaaaaggtt tgctagcaag    270480
     atgcctcaca acagagttac tattattggt tctggtccag ctgcccacac agctgccatc    270540
     tacttggcca gagctgagat gaaacctact ttgtatgaag gtatgcttgc caatggtatc    270600
     gctgccggtg gccaattgac caccactact gaaatcgaga acttcccagg tttcccagaa    270660
     ggtctaacag gtactgagtt gatggacaga atgagagctc aatctactaa gtttggtacc    270720
     aacatcatca ctgagaccat ctccaaagtg gacctatctg ctaagccatt taagctatgg    270780
     actgagttca acgaagatgg cgaaccaatt accactgatg ccattgtgat ggccactggt    270840
     gcatctgcca agagattaga cttgccaggt gaagacaagt actggcaaca aggtatttcc    270900
     gcatgtgctg tctgtgacgg tgctgttcca atcttcagaa acaagccatt ggccgttgtt    270960
     ggtggtggtg actctgcttg tgaggaagct gagttcttga ctaaatacgg ttccaaggtg    271020
     ttcatgatag tcagaaagga tcacttacgt gcctcgacca tcatgcaaag acgtgtcgag    271080
     aagaacgaga agatcgaggt cttattcaac tccgtatccc ttgaggctaa aggtgatggt    271140
     aagttcttaa acgcattgag aatcaagaac gttaagacca acgaagaatc cgatttgcca    271200
     gttaatggtc tattttacgc cattggtcac aacccagcca ctgatattgt caagggtcaa    271260
     gttgagactg acgagagtgg ttacatcaag actgtcccag gtagctctct aacttctatc    271320
     ccaggtttct ttgccgcagg tgatgtccaa gactctagat acagacaagc tatcacctcc    271380
     gctggttccg gttgtatggc tgcactagat gctgagagat acttgactga attggaataa    271440
     acatatttca gtatataatg ttgcagttta tcttctaact gatatgtaac tgatcttaat    271500
     attattatca atgctttagt ttaccgcaaa acaaatactt tacgatatgc ctcattttaa    271560
     gaggcagatc tcttctataa tcttatatca aaaatagata gtaaacatca ataacacaat    271620
     caattagaaa caataacaaa gcctttaaaa taaagttaca taatcttgta tagcacaatg    271680
     acttcaatgc tttctggctt gtagtcttct aacttcctct tccattcttt tcaccttggc    271740
     ctgaatctct tccaggtcac catttagctt tgttctttcg tttatgatat tttgctccca    271800
     ttgcctgaat ctatgttctt cagctttaac ttgctcagtg aagtaactct tcaaagcatt    271860
     ctcttcttct ttatattttg gattattcga aagctttcta gctggagtct tgtacgtgag    271920
     cgaggcaagt ttctcgctgt cgttgggttc gtctctattt ataccttcta agcgtgtcct    271980
     tctgtaattt tcgtaatgtg tttgttctgt ggaagtgatc aggtccagca tgtaagtgcc    272040
     caatagcagt gctctcaatt tcctgaagtc acagtgctca tcgttctcca cttcgaccag    272100
     gccccatggg tatttacggg ccagcaccat agtgcccgag ccgttgtcgt acctatcttc    272160
     agagcccact atggcgaagg gcatcgactc gatcagctgt cttgcgtgtt ccaacgcagg    272220
     ggcattggcc tcgtccaagc taccggcggc gccttcggca ccgtcggtgt agtctagagg    272280
     cggcgtgaag atcgcaatct cctgcgcttc aatcacctgc cttatcctcg acttgaacag    272340
     ctgcagctcc tgtgcggtca gcgtgtctgc cttggagatc acagggatca agttgcacct    272400
     ctgcgacaag tgcttcatgg tccatatatc cagcggcttg agcccgtgcg ccgtgggcct    272460
     gatgaagtac aacaccgcgt gcacacggaa gtcgaaccgc acgtcgcgga agggctgctg    272520
     ctcctgtctc aggtacgagt cgtactggtc gtctatgaag tccacaacgg gctgccacgc    272580
     cctgttgttg tcgactttgt ccccaaacgc aggcgtatcg acgacattaa accgcatagt    272640
     aaagcctttc tccgtcaatt gcgccctcac aatgtccact gcctcagtgg acaccttctt    272700
     acccttgcgc tgcttcaacc cagggaacaa agtgttgatg aaagtggtct tcccaagacc    272760
     actttcacca cacaccagca tattgaacac agaacccgcg tcgtgcactt tcttgaacac    272820
     ctggttcgga agcgcagcta cacctaccat cgtcgtcata gtcgtcatcg tcatcgcaat    272880
     gcagtctggt aaactctcta caattcgatg aagtgaataa atatttgtgc caaaatatag    272940
     cttcacttca tcgaattttg aaaaaaaaaa aatgggaccc agaagagaac tttccgctcc    273000
     accagagaat cgaactccga acgccgaata gcagggactc actccatata gcgcataagc    273060
     atataaaggc tggattaatc aatattaaac agaaacgttg aacagaggtc tttctatatg    273120
     aactcccagc aaggattttc atccatctgg ttggcatatg ttggagattt gggtatggcg    273180
     atgtgtagat aacgttggct actgtcctat agagtagtac ttacaaacaa taatccctcc    273240
     acatcaataa ttatgtaaca gatgaagttc atttaaattt gaagtatgaa ggaaggagac    273300
     gatgctcagt aagtgttaac agaaactgat aacaggagct gggatataga gaaatggtgt    273360
     ccaaatacta caaaaaattt aaagttgttt actgctttac aattgtttta agacaatgtg    273420
     ttgtagtacc aggaggcaaa tagccacata tacaactgga agagatggta gtattgttaa    273480
     tatctgaaac aatattataa aaatattcct ccgcattatt tcgaatttga acgtttgcat    273540
     gttattttga gttgttccac ctttaatctt tttcttgttg aatgcatttg ttatcaatgg    273600
     tcttgcaata tactttagtt ttagcttgtt ttatggtcgt tatcatcaca taatagatct    273660
     acatgacatg taagtattga atatcattta gtatagatac gtagtctatt cccttttgtg    273720
     catataagtc gacaatatag acaaaatatt ggcataggag aaatatttga caactactta    273780
     aaattgaaga tttatatatt tttattaatt taattaacaa ttattttagt agaagatttt    273840
     gtggaagact ataaaactaa gaagatataa tattatgtat gtggaataga tcaaggtatg    273900
     ataatagaca tgtattgcat aatccaaacc aatgtgtaag agaaagaaaa tttaataaaa    273960
     aaaatgatgg tattaaatca cccattctta ttcataccaa caagtttaga taaagcattc    274020
     agtgtaacga ataaaggagg gcttccacat aaaataatat aaaattgata aagatttata    274080
     tgatagttca aataaatggc taaaaaaggg atatcaaaca atagaatata aagaaaataa    274140
     taaaatgcat gtaaaaatag aagaaatata acaaaagaat agaagataat aatgcaccag    274200
     ccattgaaaa agctataaat attgtaatac tgatataata gcattgaaag aaaaatgcaa    274260
     aaatataaat atggaaaacc attacaaaac atatatttta ccataattaa gaatgtaaga    274320
     taatagactc ctgtttaaaa ataatttaaa attggatggt ataaagcgaa atatgaattt    274380
     ataagaagaa taaactgtgg aggagcagta caaaaatata gtataaccaa tatgctctat    274440
     gctatcaaca cacacttgtg gaaaacaata aagtaaataa aaccgatttg aataaacatg    274500
     gaatatctga ggcaacatca atacataaag atgattctac accgaaaagg ttttagaatt    274560
     tgtttcatta gacaaagata aattagtatg gaatcagttt ttgctacacg aaggaacata    274620
     ccatactgca aataaaatat acaatatcct ttttaatact atatttctaa tgatattatc    274680
     cataaaatgt atgctataaa aatgaacata gcaattgttg taaaccatag ccatcaagaa    274740
     tggtagcaga aatagctttc tatggtcgtg gatatggaaa attggttcag aaacctataa    274800
     gcttatgtag taaagagatg ttgtagcagg agaagtatga aaagtagata tatgtttata    274860
     ggtaacagaa ttttaaaaag ctacatagaa cctataaatt caacaaagtg gcgtatcaaa    274920
     atggttatag ataataaaga ccgtccaata atattattta aaatatatac tataatgtgt    274980
     aatatttaat tgctacagac tgcctcatcg atagataaca attataaatt aataataaat    275040
     gaataataaa ttgttgaata tcattatata tttataattt atatgaaata tatattatat    275100
     taaggtataa aatctttatg tattaataat aatattaata atataaagga tatagtacat    275160
     atttagatat tagttttttt ggtaatccaa aagtaaatat tataattatt actggattgg    275220
     tattatttca catattgtat ctccttattc taaaaaccta gtacttggtg aaatctatat    275280
     gatgtatgct atggcatcta gtggcttatt aggagtcttg gcatgactac atcatatgta    275340
     tactccagga ttagatgctg atactagagc ttttttgaca tcagtcatta tgattattgc    275400
     tattcctaca ggaattaaaa aattcgcata attaatttat cccattagca aggataatgt    275460
     gttgaccata aataattatt ttaatttaat cattaatatt ctttattatc attataatta    275520
     ttataatgat attaataaaa ataaatatta tattagtaat aatattaata aaataaataa    275580
     tatattagta ataatattaa agatttagta atttacggtc tcaatttaga atctaatgtg    275640
     ggttagttga attttcttaa agatattaat agtataatta atataattaa tattcctaat    275700
     aatattttat atagcattgt aggtatttat taatagacgg tattatttat taatttatgt    275760
     ataataacta taaagatttt tattattaaa ttagatttca accataaata atatatttgt    275820
     actggcttag taaaaattga aaatatatat aattaacagt gatagtgata tttatattaa    275880
     tggaagtatg gattaagtta tatgtggtga aaaactgggc tgcaacatgc aatagatata    275940
     aatggaatga tacataaaat gctgctaggc ggaccaaaat taaggaagat aactataaat    276000
     ggaacaataa aaattatatc gttaaagaaa cattactgtg gtgaatacta taatcgagta    276060
     tatgccagaa agaacaaacc ggcatatcgc cttgaaataa agagggaagt gccaagtgtt    276120
     aataatgaag gtattattaa tttatagaca ctacatcaat aagcctatca ctgtcaaaca    276180
     gagctacaaa cagcgtgtat ataaagagcg tgtatatcaa cagcttgtat aaaaacagct    276240
     tgtataaaaa cagcttgcat aaatacagct ttcgcaagat acaaggtacg agtttgtcac    276300
     aggtattcag cgtgttatag atcggtatgt attacgtgat aaagttcgga tacaagtcag    276360
     taatataggt aggactttaa gttcacagaa gaggaaccta atgctatgtg acatatgact    276420
     ccttcgaaca gattctggtt tatcagactt ataactcctg gtacttagta ttgcgtgact    276480
     agatacaagc aagtatcaac actacaatca actgttaaca agtctaggaa gagtatccta    276540
     aagtttttgt ttggttgtga ccttctacta aaagaacaag agaggtataa tataccatgt    276600
     agatacaaga aaggtatagc aatatatcaa tatagcaatg ccatacaaga tacaaggcag    276660
     gtatagcaat atatcaatat agcaatatag taatgcaata cgatgtattg gcttgtacac    276720
     gtgaacacgt acaatataac aagatgactc atttaaatta tcactattca caagtcatgt    276780
     gatgcatgtc tctcagtcac agactgcttc cacactcgca actatataac tggctgccac    276840
     caactggatg gtattagtct tttaggatgg ggggaataag ctggagagag ctggccataa    276900
     atcataatac cgatatgtct agcgaggatg agctggtgca attgaccaag acgctgctgg    276960
     agcccgtgcc cacgctgact ccgaagcagt tgtacagggc gatggtgatc attctggagt    277020
     tgactgcgtc gcaggacatc gactcgctga tcgacacgct gacgctgtcg acgcacgtca    277080
     agattgccag tttcctgtcg tgcttgaagg cctcgcggct ggaccacaga gctgagtaca    277140
     ttgccgaggc agcgaaggcg gtgctcgggt tctcgcatgt ggtggaactg gaccttgtgg    277200
     agaagacgca ccgggagcac cgggaggaag tggtgctgga tattgtgggc accggtggcg    277260
     acgggcagaa cacgttcaat gtgtctactt ctgccgcgat cgtggctgct ggtatccccg    277320
     ggttgaaagt gtgcaagcac ggtgggaagg cctcgacgtc caacagcggg tccggggacc    277380
     tgatcaacac gctgggtgtg cagtccagca aggtcaccgc ggagaccgtg cccgcgctgt    277440
     gggaaaacaa gttcatgttc ctgctggcgc cttacttcca ctacgggttc ggtaagacct    277500
     ccaacctgcg gaaactgatg cacatcccca cgatcttcaa catcctgggc cccttgctgc    277560
     acccggtggc acacgtcgac aagcgcgtcc tcggcgtgta ctccaaggac ctcgcaccag    277620
     agtacgccaa ggcagcatcg atagtgtacc caaacagcga gactttcgtg gtttggggcc    277680
     atgtgggcct cgacgaagtg tcccccatcg gcaagacgac ggtctggcac gtcactacaa    277740
     cgggacaagt agatatattc gagctcgaac cagcaatgtt cggactgcag gagcacccat    277800
     tggacgtctg caagtcctac gggcccgaga gaaacgcaga gatactcaga gatgatatcc    277860
     tctccggcaa gtacaagctc ggcgacaacc acccggtcta cgactacatc cttctgaaca    277920
     ccgcagtgct atactgcctg agccaaggcc acagaaactg gaaacaaggt gtagaggtag    277980
     ctaacgagtc catccaatcg ggcaacgctg tgaaagccct ggaacacttc atcaaggacg    278040
     tccaggatct ataaaaccca ctaagaaaac ccactctctc tcgcactcat caccacaaac    278100
     tcatgcatat actcaaatgc aacaacagcc atgaaaatat agcatttatt taaaccactt    278160
     ctatacaaat aggcatctca tactactatc tactcatact tgtcacatga aacggtacgc    278220
     gaaatccgct cttcctgaac agcctttacg cgtcaaagca tcaaagcgtc aaaacgtcaa    278280
     agcgtcacac tgagcgccag ttttgtgttt acagaccact tataaagaga cttggctgtt    278340
     tgtggtcttt gcttacaata gcggaatcta ggactgttat aggctgtttg acggcgtttg    278400
     tattatagag atagtttttg cgcggggaaa gaaagagact gaactgctgg agaattcggg    278460
     tcccggatgt ctgatatcaa gaacttcgaa ttcacgccca ttgggtatat caagtccaag    278520
     agcggtgaga acgatgccaa ggagacgctg atgtcaccga ctggagccag tgtacgatct    278580
     cccgggagtg ttgggcatgt acggaaggcc cgcagaagga gtatcaacga taccgtgaac    278640
     tcttctcgag tggagaacga taatgatact ttcgatgaaa cgctgccaga attggagatg    278700
     cggaagttgc cgcagtatag gagagtacca gagtcgcgga cttcagctcg aaattctggg    278760
     gcggcaccac aagaggaaca aaataggaat gactactcag acatattgtc taagacatct    278820
     aacccaatca aggatcagga gcaaaagata aaggacttgg aacatgagaa tacagtgctg    278880
     aaggtcaaaa acgtttcgta caggtcgcta cttgccaact acagcggcgg gtcctctcag    278940
     aataatatca accttgtgga agaagtcagt atatggaaga caaaatatct ggaaactaat    279000
     gagaaattgt taaaagtgaa gcaagatttc gagagctatg tgcaaaagat ggaacaagaa    279060
     aaggaagtta atactgacca ggaaaagact aaagaaccag aagtcatccc aattgataac    279120
     ccagagtata ttaaagaacg tgaacatatt ctagaagagt tggaaagggt cactgaagat    279180
     ttcaagaatt taagagatag atataatgat ctagagataa aatttctatc aatccaaaac    279240
     gaactcgatg aaaagaaaca ggaattcgaa agctccaccg caagacttaa tgaagagatt    279300
     cacactctaa aatcaactat cgatgacaag gatgcaacaa taagcgaatt caagagaaaa    279360
     ctaggaaatg cagaggatca attggcctca atagatgacc aaaatggaaa ccagaatcag    279420
     aaactgttgc atgatctgaa ggaaagagaa gatgctattg acggtcttaa agaggatatc    279480
     attgaaaagg agaatgccat agtgcactat aaggaagaaa ttcaagataa acagaatcaa    279540
     ttaaaagaat cagagtctaa atatgcagaa gtgcaaaaag agtttgaaga tttcaagagg    279600
     gaattgaaaa aacaaacatt tgaatttgaa gatggtaaaa agtctacttc tagacaactt    279660
     caagaacttt ctgtagagaa aattcaattg gaaaagcaag tttgtaattt gagaggtcag    279720
     atcgagaaat tagagcaaca acataggttg acccagagtg aaaacgacgg tttaagaacc    279780
     aagttaaaac atatcgaatc tgatctaaag aacgagaaat cgagaactga agtgaagatc    279840
     aaagatctga catcagatct tgaagatgct agaaaaaatc taggtgaggc taataataca    279900
     atcaaggaac tccatcatga aataataaaa aatgcaacca aatcaaaaga ccaattatct    279960
     gaagaagtag ttgaaaagga caaagaaatt gatcaattga aacatagagt acaaagatta    280020
     gatgaagagc ttcgaacttc tcaagctgag cttgacaagg caaccaaaaa cagagaagtt    280080
     gatcatgaac ttgagattag gagattacaa aacaaacatg agatcgaaca agaaagcctc    280140
     aaacgagaac tggcacatat gactgacgag aaagagagac tagtcgacct ccatagactt    280200
     gatatagaaa cctgggagcg ccaaattgaa gcattaagga aagaaaacga aaacctcatc    280260
     agcagagaac acaaagagtc taacaatata gagataacat tacaggataa gaatatccaa    280320
     attagaagac tcgaggcgga cattgtacag ctcaatgaag aaagaaatga tatattgaat    280380
     aagttaagat cattggagca agccaaggat cgatacaaat ccgagatgaa ggatgccttg    280440
     gagacgatat cgaggttaag agttgatctg gagaacaaca agtccttgaa agactctaag    280500
     gattccttaa ttgaaaggaa atacgaaaag ttaaaggatg aatttaaact aatgaagaaa    280560
     ggttacttag atgaaatgat aaaattgcaa agtagaaaca gagaattgaa cagtgaccta    280620
     cagaagcgca tggatcccag tatatcgaca tctgcgaaca ctacactggc agataaactg    280680
     gattactata agctcaagta caacgacgaa gtcagacaca ataacgatct gcgtgtaatc    280740
     aacgagtact tgaacagggt tctacgggcc agtgcacagg atatccgatt aaatctgctg    280800
     aaagtagaaa atgatctaaa cattgacatc cataaagaga atgtgccact ctcggcgcca    280860
     ttgtcctcaa gtggcggcag gccatactca agttcataca ccagagagtt tgacaagtac    280920
     gattacagat accgccagaa gggcaagcgt ttcaagaccg tcgcgctcgc ggtattggca    280980
     gtgatacgca tgtacagggc cgcaaagaag cacaactgga acgaacaacg gatccgctac    281040
     ttacaacgca agataatagc aaaggaggac cgcatcacat ggtgagatcg tttctctcaa    281100
     tattcatatt acattattac ataggtatat cataaatagt cattttctaa tccggtatat    281160
     tcatttcaaa gcagccatcg cactgtcaag cctctccttg aagctgtcgg taatcatccc    281220
     aatctgctcc atcatagcaa agtactcctc aagctcatcc agaccacgca gaactccacg    281280
     aaaccgctcg atgttctcat caatcacacg ctcagacact tggcccacca gctcgttctg    281340
     ccgttgcacc aaccgggtgg cctccagctc caacgacttc acgcggtcgc tgatccggta    281400
     cacaaggtag tcatagtcaa cactcagctg gtcaatcccc agagactcgt cctgaagagc    281460
     catcgaccct ctctttatat cccaagttat ctgtgttgtg tgcccaccaa ggccctcttt    281520
     atctcccaaa cggcccagtg acaaaaattc ttgcaacttt gggattataa aagggtcgga    281580
     ctgacgattg ctctccggaa ttgggctgta agtaggagac cagtaacaag gaagtaatgc    281640
     ctactggaat atatttgact gaggggcctg ttcggaggtc gcaggtgagt gggaacccgc    281700
     tgctgcggaa gatccagcgt gcgtgccgga tgtctcttcc ggagcccgac ctggcgttga    281760
     acctggatgt tgctgattat atcaacgaga agcagggtgc tgctccccgg gatgctgtgt    281820
     ttgccattgt gaagctgatc aattgccatg atacgcacac cgcggtgttt gcgctggcgt    281880
     tgctggacgt tttggtgaag aactgtgggt atccggtgca cttgcaaatc tcccggaagg    281940
     agtttctgaa tgagctggtc aagcggttcc cggaaaggcc tcccatgcgc tactccaagg    282000
     tgcagaggct gattctgact gcgatcgagg agtggtacca gaccatatgc aagactgcga    282060
     gctacaagga cgacctgggc tacatcagag acatgcacag gttgttgaag tacaagggct    282120
     atgcgttccc taagatacag gacgagcact tagcggtgat gcgccctaac gaccagttga    282180
     agaccgccag tgagattcaa aaggaacaag agatcgccca ggcagccaaa ttggaggagc    282240
     taatcagacg cgggagacca gaagacttga gagaggccaa caagctgatg aaagtcatgg    282300
     ctggtttcaa ggaggacaac attatccagg ccaaacagac cattaaccat gagctgaaca    282360
     aattgagacg taaagcggac ctgttgaatg agatgttgag tcaagaacaa cctgacttgt    282420
     caagtgaaac tatggaagag ctatacagtg cactaaaagt ggcccagcca aaattccaga    282480
     agatcatcga agaagagcac gaggatgaca cgctagtgca gagtcttctt aaattcaacg    282540
     acactgttaa ccagttacta gagaaataca acttgttaaa gattggtaac aagcaagctg    282600
     cagcagccat taacccagag aatatcagtg aagtgcctgc aggtagcaat gcaggtgctt    282660
     tggctaatga aattaacttg atcgactttg atgatgagcc tgcaagagat agtagcaacg    282720
     atcaacaagg tgcttctaat ggtaacaaca catcacttga tgacttattt ggtgatctca    282780
     ctttgggcca agctgataca aacaataaca acaaccaatc cctagtcgga ggtggtattt    282840
     ctctaggtgc tggtaaacca tccgttgcta caactggtgc cagtgctggt ttgagtaatg    282900
     acagctctga tcttttggat tcagttttag cgtctccacc tccttcattg gttcaagcta    282960
     gcaacacccc agcttctact aatattagtg ccgcagatga cttgctaggt gacttcgtgt    283020
     caagcccatc tccagttgct aacgcatctg cttcacaaaa gctttcgctg tttaaatcag    283080
     gtgatataga gattgagctt gacctagcta gagagtctga ttctacattg aaattgaagg    283140
     tgtttttcaa taaccttacc ttccaaacca taaataattt ggtcttttct attgccacac    283200
     caaaatcagt tcagctgaga ttagaacctc agtctgggaa cctgttatta gcaaactcta    283260
     agggcggcat tactcaaaat gcatggatcg acaatgcacc aacaacattg accaaacctt    283320
     tgaaattgaa atggaaggtc tcctatactt acaactcaag caataaagag gaaactgctg    283380
     tttatacctt accaaaaatt tgaagtgttg taacctacgc ttaaaaaatt gaatataatc    283440
     tgtatgatat agtttatttc ttaataaaat gacattctat tagagaatta acttttattc    283500
     aaaccaatct tacccaatct ccaggtgatt catcgattgt aagtacagct gtgtttcaag    283560
     ttcggatatt ataaattagt tatatgctat gtatgttaga tttaatgagt gagaatttta    283620
     tgttatttat tcattatttt tggaatttct ttaatatctc ctgaggagtt ggtgacttca    283680
     ttgtctgtac agtttcaggt atcgtatcca cagtcgttac tggcttgccc ggtgcattcg    283740
     aggccctacc ggcatatatc tgccgcggat ccgtctgcac cggcgatggt acacctctgt    283800
     tcatgacaga catgccctgc tgtgacaggt taactgattc cccaggctgg ggaatgttct    283860
     taacttgagc accagaagct gaatttagct tgctgtcctt gaatcttttt tgtgcctgtt    283920
     gattcttcat agttgtcaaa tagctctgag ccgcttttag tgcaatttca ggggaaacac    283980
     caggattttg cttgataatt tttttcacat aactattgat taatttattc tccgctgcaa    284040
     tgcgctgttc attctgggct tgcattgccg gggtaatttg tttattcact acattagtgt    284100
     atgaggtatt agggaccttt tctggagcag cagctgaaga aacgatctta cctgcattac    284160
     cttgcattgc ctgtttttga acaaacctgg catcatactg tttttgctgt tgctgctgtt    284220
     gctgcatgtt atcaacccta aactgagatc caacaggcaa attaacagga cgctgtccat    284280
     taggaggaac cggatgctgt tgacgcgaca acgaaggaga gccttgtttt tgtgactgtt    284340
     tagattttga aacctgcgga ttttgcttaa cttgtaatct atttttggct gttctcctca    284400
     attgaatgtc tcttcttata gcctcatctc gttgagcttt caaagcggac atttctgcag    284460
     gtgtagggac cttcatattc ttactatcta acatctttcg tggttgagtc ggattaggac    284520
     gtggtgcatt ttcccgcttt tttattgtct tacgcatcgc ctcgaaaatg cttgcccatc    284580
     tcaatcttct atgacctctt tgaatcgact ctggaccaac acccaatggt gaaattcttc    284640
     tattttgtct ttgttggaac ttgtgagctt caatcaacca ttgttgcgct gcgtgtgccc    284700
     gtggaccttt caaatccgaa aagctaaatt tctcattgag ctgaacaaat ctctcaaaac    284760
     attgccaagg agttctcctt tcaatgtttg acaagtaact gttacttggc atccgagtca    284820
     tttgtgcact aattaaatcc caattgtagg cataagtact aatatttttc accaactctt    284880
     gatcatcctc tggtaaccaa attgtaggcg ttctattttg caaatatttc aaagatggca    284940
     ctgatggtgg tcttagatag tgatttctcc tgttaccata aaataaccct ctacgtttgc    285000
     tcaattgcag tagagtttgc tcttcatcta tgagctgctt ttcaactatc ttgtagtaat    285060
     gatcaaagtc aggaagtact aatgacttag aaacaggtat catttcaagt gtatctaaat    285120
     taatatgcga atcttcatcg tctatacctt tgtatactgg aaactctgag agtaatgtgc    285180
     tttgaaaccc actaagatcg ttttcggtaa ttgtcaattt aaatattttc gattttttat    285240
     ccgattgctt cattctctga tactcttcat cagaaatctc aggtagcttc ttaggtacta    285300
     tttcgtcctt tggattagct ctcctctgca ataaccacgt atcaatagca ttatcactgt    285360
     cattaccatt atcattatca ttaccattac cattatcatt atcattacca ttaccattat    285420
     cattatcatc agaaccatca ttcctatcga ttgcaatgtc attatcaaca tcctgttccg    285480
     tcacatcttt cataacatca tcaacatctt cgttagccac ctggctctcc ttttctgtct    285540
     ctttatttgc ttgcacattt ttagtatcat cacctttttc atcgttctct ataacagagt    285600
     cttgcacaat atcaacatca actggttcaa ccaaaggctc tactaataca gtttttgcta    285660
     aagtttcatc cacactttta tcactcctat catttgaatt aggagtgtct tctcctggga    285720
     catgaattgg cttacaccta acgcaacaaa cctttccgta cgtccaataa tcttgtacag    285780
     cttgtgccag agttgtacac acagcaatct tatacttctt cccttccaca aaatcttctc    285840
     tcatccactt cgcttctttt aatagagtac cacgatgagt attctcacgg ttccaaccat    285900
     cgacaaatcg ttttggttgc cttaatgacc acaaccccga tcttcgcagt tcttcaattc    285960
     tcgagcttac gacggttatc ctggactcat gcaatgcttg attaatcata tcggaagtca    286020
     aaaccttatg agcccttggt attaaactta taagtggcaa agtttgtgcc atatatctaa    286080
     gttctgccaa tggaatacca cctggaatca ttgatggtgc tatttctttc atcatcaaat    286140
     ataccgattc taaagaatct atactgcctt cattatacct ggagtctaac cgttcttcag    286200
     tgtcatagac ttcattcagc ttttcattca gtgttttgct aacagctgaa ggtttttcta    286260
     taggagtagg tttaggtggt aatttgctta tctgatactg atgaatgggc tcataacttc    286320
     tcttttgtcg cttgtaacta acatcttggg tttggtcttc ggcgagtttc ctcttccgag    286380
     tcacccattc aatagaaggt gagtatgggt tctcctctct gacatacaca atagcgttgt    286440
     ccttcgtcct tatgatatcg tgttcgctcc tcttaatacc cctaaacacc ttagaaccca    286500
     tgccaagcga tttcctaaac cgttgtatct tcaatggctt caacacatac cgctcttcag    286560
     ttttctggtt cagcttcgct atgctcttat ccacgtcgtt ctcctccaga aacctatgca    286620
     ggtcacgcac gaactcttcg cgcttaccct tcaccagcat aacgtcatcg agccgcgaaa    286680
     ggcagtacag ctggctaagc ttgctgcttc gctggctcag gatctccttc ttgccctctc    286740
     cagcagtcgt gggagtcaca gatcgcgacg acgataccga catagtctct ataatttgat    286800
     ctgtctgttc ctactaaact ttttcctttc ctgtgcacgt tacttctata tcaatccaat    286860
     ctgaacattg acgcgtgtct ctcaattatt ccacagggca cagctcaact gatgatccag    286920
     agatgcaaat aaaccaaact gttatccaaa tttcacgcaa aaaaaacgac acaaacgcca    286980
     gccaagaaga agacaaagag cagacacggg gggatcaaca gtaaaacctt atctgcagcc    287040
     aatatccaat accagaaccc tccaggaacg tccaatacct gccgattcgc accgttttgt    287100
     gcgtattttg gcagttttta ttgacccgga aaaggtcaaa agttcgccaa ttttcatcaa    287160
     ttttttcttt ccgcgaaaac atcaacaaag catgtgatgg ttacgtacag agctacgata    287220
     ataccggctt gggcatgtcg tctctttggc ttctatatgc tcatatatag ttaatatacg    287280
     cttatgtata gggtcgaaaa tctgcctgtg ataattccta ccaggtggat acttcctgtt    287340
     cgaattcgtt gatgctcttc accaggctgt cgtggtctat aatgatgtat gatgcgatga    287400
     ggcccttctt ggactcgcca tcgaagtgca ctttggcgtg cttctcgaag aacctgtcct    287460
     cctcgtggaa gtagtctacc tcgctcttgc ccctgactct cttcttcgac ctggcgctgg    287520
     cgtctccttc tgcctcgtcc atatcgaagt tgacctcgta cttcctgctc actatcacgt    287580
     agaagtcgaa cggtttgccc tcgtttgctg ctgccgcgtc ctccatggtg atgcggtaca    287640
     gcggcgtgac tacctctggt ggcatgttga tcagcctctc gctcatcacc agcgcacagc    287700
     tcttgttgcc cgtgttgtcc agcgtctgca ggaaagtctc aatcctagtg tccagcttcc    287760
     gcaagtactt cgcatagtcg ctgtccttgt tctccttgta gttgatgaag gacaggaaac    287820
     agtacgggtc agactcctta ccgtccgtct tgatggtagt ggttggcgag gaaagtatca    287880
     gatcagacag cgcactcagc tgaacacggt tgctctcctg cggacccaac aactggcgga    287940
     tcaagtgctt caccgcatga aagtctacat cggggttccc atcaaagaaa tcaaagtcta    288000
     tgttcactat ctcttgctcc tcatccccag cattctcctc ctcagagtcc gtgctgctga    288060
     tatcaatctc agactcctcg tcctcgttaa caggatcgtt cctacgcttc ctgttgccca    288120
     gttcactcag tttaatagcc tgcaccatct ctcaatacct tgccactact gaactaaact    288180
     cataccttct cccttgctcc ccccacacca tcagccatcc acaaacttgt acttccatct    288240
     tctcgatgct catcgccaaa atttttcaat tcgcaattcg aagtgaagtt gctgaaacgg    288300
     tgctggagct gcaaaacagg cgagttacaa tttgactctt atatattacg tacttgctat    288360
     ttacgacaca ctctacttct caccgattct ctctattgtt acaataccag cgctgatgga    288420
     gaagctgtag aacctgccgc actccgtgga ctcgttccac ttggtagcgg tgatggccac    288480
     ctgtggggcg tccagctcga tggtgctaat ctccccgccg ccggctttct ccacctcgta    288540
     gttaggatcc aggcggtact ggtccgcaga agggttgtag tcccacttcc acaaccgtag    288600
     agtccgcccg acgctggcga cgttcttaac acccgtcagc aaccgcctca cggcgtttgt    288660
     gatgtacagt ccgccggagc tgagcccact gagcaacatg gggtgtagtg tcgacgccga    288720
     cagtgctgtc actgtggtgg gcatggaccc cattgagtgc tgtgcgaacg aggcacgcgg    288780
     tgggaccgca cgaacgatgt tggcaccgtc tgtgcagaag aaactataca gcttcggcat    288840
     gtatactatc gggaactggt taccaccacg atacctactc gtcttcactt tagaggtgtg    288900
     tatgctggca gggtcaaata tgtagaaata cccgtctagc gaaaccgcac cgatggtgct    288960
     agcttcaaac tccgagtgcg ctgtgactat ggtcgatatg taggtggagc atacttgcaa    289020
     ataatacgag ggcctttgca acgcctgtgt atcgcaaagg tcaaactccg caacgtaacc    289080
     gttttggaac ccacatataa ctcggctcac gctaacaaaa tcaaacgtcg tcacacagtt    289140
     gcccttaacc cccagtgcaa tatttgtggc ttggcaaaga acaggctcct cactagctgt    289200
     tgtagggata ttcaaggacc tcactgtacc ctcttgacaa gcaaagaata aggcgccaat    289260
     cgtgtcttca gtctgatcaa gagcctcgtg ccacttcaaa tcccatactt ctccatacgg    289320
     atgtaagata tcatgtattt tctcaagcga gagagtgtgc ggatcaaatc taaacacctg    289380
     caagcacgca atatgctctt ctttaccaaa catccgcaaa tgcttatcat ctggctcctg    289440
     gccgtactga gaaagtgcca acactaggta ctgaacctgc tcgtcgcctc tcttggtggt    289500
     gtgccaggcc atgtcggtga caaaagcccc agcgttgtat actagcccgt agcgttgata    289560
     agtagggagc acagggagtt ctgctttctg acctgcagat agagagatac cagtttctcc    289620
     aatttgacaa tcaatgggct ctgctctcac tttaaagagg gcattgtact ctttctctga    289680
     aacagcacca aactgtgctg ggtgtgcatc catggatgcc caaatatgtg caatatcgtc    289740
     ctgtaaatct ctaccagcgt ttggcaactc gctgctgtgc tttgattcaa accagaaagg    289800
     cgatgtgggc tcaatggttt cctgtcttac gttgaacaaa tcgttctcga agcattcctt    289860
     gacaatggcc agcttcaaca gcttggcccg atccaggccg tagatcctct cgatcttgtc    289920
     cctggcggag gacaggtcct tcaaagtcct gatgatcctg cctttctgca gcagcgtaga    289980
     cgcgatgcct ctctttttcg ataaaatcct cactttcttc tgtttcttgg ccctgggctg    290040
     aaactcaacg tcaattgcat cgtctccatc tacatagtcg tcgccatcat cgccatcgtc    290100
     gccgtcgtca ccgtcgtctt cctggtgcac gtactcctcg tcgccgtcat cgtctttaag    290160
     cttggcgtct atcacagcgt cgtcaaccgc agcagcgcca gcggcgccag cagcagcagc    290220
     atcgtcaatt ggcgtcactg cagccgcttc cacaaccttc cgtggcctcc cacgcctcct    290280
     caacttacgc ccggcacctt catccttggc agtgccctta cccttggcag tgctggcgtt    290340
     ggcgaccgca ccttccatgc tcttcagcgc cgccacagct atactctcgc tggccgtctc    290400
     atcaatggca tgtttgcgag gcctgcctct gcccctcttc ttgtccatgg tcccttgtcc    290460
     tgtctgggct gtagtggtcg atggctgttt tgccagcttt tttgttttta aaagcaaaag    290520
     ctggtggtga atggcagatg gtaatgggag ctcgctgaga gctgggaggt gagagctcgc    290580
     tgagggtgaa tacgatggat ttcagcgacg aggactctga cgagttcttc atggggactt    290640
     ccgaggacgt ggaggagcgg ttgcagcagg cgatggcctc gcgggcgccg caagcaccga    290700
     atgcagaacc agcaccagta caagagccac atgcagaagc agaagcagaa ctagagccag    290760
     aagcagaagg accgtcacag gagcaagtgc gagggcagga tgtggtggtt atagaagggg    290820
     acacagaggg gagtggatcg gagggctcga gcgacagcga aggctcgagc gacagcggtg    290880
     cacaggacac ataccgcgga gataaagagt acgaggtgcg tacgcggtct gggatgaagc    290940
     gtgcacgcac ggtggaggac gagaacgacc tgttcttcca gagcattgcg aagcggagcc    291000
     agagtctgcc ggtgcaggac ggttctggtg cagtgcggca ggacaaggtg tactatgtgc    291060
     agtttatatc gcatgtggac ggcacgaagg ggaagtcagt gcaggtgaag gcgctgggga    291120
     gccacccgtt ctcgaagctt gtagctgcgg cgctgagcgg actcatgcgg gcgcacaggc    291180
     tgccctcggt gatgaggccg ctgtaccagc cggagagcgt cgtgagctac tggaaccggg    291240
     cgaaagtgct ggggttcatg acctgcgata cgctgcgggt gccgcagcgg tacggcagcg    291300
     actacctgga gatccagctg gtgcccgtga aggaggaagc gcagtacctg gagcaagaag    291360
     tattcgagga gccagagcgt gcgcccacgc cggaagagga cgccgaagag gagtttgaac    291420
     gggagctgcg cgacgccaag gaggtcaggg cacccgtggt ggacctcgag tccgaggaag    291480
     tgctccgggt ggcactgcaa ggccaagaca acaagaaagt gtacgtgaac gtgaagccca    291540
     cgaccacgtt cgcccgcatg atcgagtact accgcacgca gaaacagctg ccgcgaagca    291600
     cacagataac actggcactc gacgacgagc cactagaccc acacgccacg gtcaagtccc    291660
     aggatataga ggacgaggac atgctggagg taagattatc gtaagtccca gccgcaaaaa    291720
     cactccaaag actgggggca accttattac catcactacc gacgtccctc ttaagcaaat    291780
     ttcaggaagc gaagaatata aagagagctg ggagagctgg gagagctggg agagagagca    291840
     gagacacttt agctttgcca cgagtgccat ctacatatac agcgacaatg gacgagaaga    291900
     acgttgaaga gcggaggacg ctagaggagg acgacgagtt tgaggacttc cctgtggata    291960
     cgtgggggga caaggacaca gtggccagca ccagcgccac caatggcact agtgccacca    292020
     atggcactag tgccaccaac ggcattggtg gcaccagtgg caccaatggc aagcgcaaca    292080
     tcatatggga ggagaactgg gacgacgtgg aggcagacga cgacttcaca caggagctgc    292140
     gggcagagct gcagaagtaa taggccccaa aaaatgctgc aactgcggag cgaaaagaga    292200
     gtcggtgcta cggtagcact acgcctatga gacagccact aggatatata atacaccaat    292260
     agccacgcaa tatagctgta tgtatcgaat aatatgagta ttgctcttta agaaatggag    292320
     tttacccggt ttgccacaac cccttcaagc tggaaaaagt ataaaaaggc gggagttttg    292380
     ggcgagtgga tagcccattc ccttggaagg tccttggaag gagaagtagc agacggtaag    292440
     taacaggacg gggaattgga cacgctgaga tgagtacttt agaggaattg gatgttgaag    292500
     acgggctgga ccaggagatt ctggggcttt cggcgcagga gctgcagacg aggagcaagc    292560
     tgctggacaa cgagatccgt atcttccggt ctgagttgca gcggttgtcg cacgagaaca    292620
     atgtgatgct ggagaagatc aaggacaaca aggagaagat caagaacaac cggaagctgc    292680
     catacctggt ggcgaatatc gttgaggtca tggacatgga tgagattgag gacaaggaga    292740
     acagcgagtc tgcgacgcaa ggtggcaatg ttaacctgga caacacggcc aacgggaagg    292800
     ccgctgtgat aaagacctcc tcgaggcaga cggtgttcct gcccatggtt ggcctggtag    292860
     accccgacaa gctgaaaccg aacgatcttg tgggtgtgaa caaggactcg tacttgatcc    292920
     tggacacgct gccttcggag ttcgactcgc gtgtgaaggc catggaggtc gacgagaagc    292980
     ccacggagac ttactctgac gtcggtggtc tggacaagca gatcgaggag ctggtagagg    293040
     ccatcgtgct gccaatgaag cgtgccgaca aattcaaaga actgggtata agggcaccaa    293100
     agggtgcgct gatgtacggt ccaccaggta ccggtaagac cttgttagcc cgtgcctgtg    293160
     cggctcagac aaatgccact ttcttgaaac tggccgcccc acagctggtg cagatgttca    293220
     tcggtgaagg tgcaaaatta gtccgtgacg cgttcgccct ggcaaaggag aaggcgccag    293280
     ctatcatctt tatcgatgaa ctggacgcca tcggtacaaa acgtttcgat tctgaaaagt    293340
     cgggtgatag agaagtgcaa agaactatgt tggagctttt gaaccagctg gatggtttca    293400
     gttcggatga ccgtgtcaaa gtgctagcag ccacaaacag agtagacgtg ttggatccag    293460
     cgctgctgag atccggaaga ctggatagaa agatcgaatt cccattacca acagaggact    293520
     caagagccca aattctacag atccattcca gaaaaatgac tacagatgat gacatcaact    293580
     ggcaagaact agcaagatct acagacgaat tcaacggtgc tcaactgaaa gctgtcaccg    293640
     tcgaagccgg tatgctagca ttaagaaatg gtcaatcatc ggtgaaacat gaagactttg    293700
     tagaggcaat tggtgaagtt caagctagaa aatcaaagtc tgtttccttc tatgcctagt    293760
     gcatcaaaaa tatttgtcta taggaagtaa tcagaagctt aaaataaggt cgataaaatg    293820
     acaactttct tcattgcatg tgatataatt agtaatagtt atatttcaaa attaaataaa    293880
     tatacacctc tgtatctata ataatgatag taaactcaca cagatatgga tctagcttat    293940
     caataactgc ttaaatagaa tgctttcaat caagaacaaa tatacgacca tcaggcccag    294000
     agcatattac tttacttgtt tccttgggat gccaactaac ctgagtgata ggtgacttag    294060
     taggcagttt taggtcacaa agtttcctat ttgtattcca atcccagaga aacaattgac    294120
     ctctggcatc acctgagcac aaaaatcttc catccggtga gaatgtcagt ccaataccgt    294180
     atccagcgga attgtgacct ttgaacttct tatttgggtg cattttatac tttggcttca    294240
     tgctataaga gtaaattacg ctatccatac tttgcgttga gaagtaattg tgttctggat    294300
     gaatgccaat atatggcata gaatgctggg tggtatcact gatctgttta atcggaatat    294360
     taacttggtt gttccatata cgcaacgtct tatcttcgga ggaagaaata aacttagaac    294420
     catcaggaaa atactttatt gccaatatgc tgcttaagtg gtggtcataa acctgcacca    294480
     atccgtcctt ttctgatacc ctggtatcgt aatgcttaat cttactgcta gataagccga    294540
     caacaaactc atttccactc gtcggtctga attcggcact attcggtgta gagtatgtat    294600
     tcaatcgttt ggtcacttta ccagtctcag tatcccagat tttgacctgt tggtcatatg    294660
     aaccactcaa gaattgtgag gagtcgctag tgaagtccaa agtcttgata ggcttggaat    294720
     ggcctacaaa atcccgaaga catttccgat catggtaaaa atcccacaac ttaacagtat    294780
     tatcgtttcc tcccgataaa atgagatgtc cagtaccagg tagtagcctt aacgatgtag    294840
     taccattatg atgccctttg taacgataaa tcaccttctt tggcaaatag catttaaatt    294900
     gtgtgcgttt gaaatccaca tctacatccg caggtgggtg aaggtaagac ctaccttgat    294960
     agtcacgctc cttcctacca tagaaagtag acttttcatt cagcaatttt gtagggccgt    295020
     tagcagtttc ttggtcgtgg tcgctatcaa aaaggtcgtg cgccccacca tcatctatat    295080
     cctgtaccgt cttctggtcc acttcaacat cccatgaacc ccacggtcca tcacctttcc    295140
     tctgcttacg tctgcgtttc aactcagctt ttgagaactt gaactttctc tttccatttt    295200
     tgtcgaaact ttcctcagct accggcttag ccactacttc ttgatccgac aactcatcag    295260
     aactatcact ataatgcgct aataaatcca ttcctttgcc atagtcatgt atactgctca    295320
     aatgcaatat tgttgagctc actgttatta atgctcatcg catttttatt ttgccaaatt    295380
     tttcagtttt gtgaaaaaag ttcctttaag taaacataat agtagtcagc atggattgct    295440
     gatattgacc ctcatatagt ttagacattg gtgagaacta cgttgattat agcataactg    295500
     acttgtgaac tgtacgacta gtcgaaactt gcgatgagac tgaataaaat ctcttttcca    295560
     aaggtatgaa tcacattatt ttttttaggt gctagtggtg gtctaaacgt attgattggt    295620
     aaactacata ttgccaatat acaataaagg cctgaatttt taaagctttc aaaaaaatac    295680
     taacataatt atgtgcaaga cagattccct ttgttgggat actctattaa tgtatgtaca    295740
     ttggtaatag tcgttctttg gatttctacc actttacctt ggtgttgaga ttgtgcttgg    295800
     tatcacaata ttgaataaat gcagtggtgc gtatggtatt cttgctctat ttacggggca    295860
     tccgctggat tacatgcagt ggatctcgta cctgtggtcg gtgtttacct taatagtgtt    295920
     ttcgcagggc ttgttcatga tccacaagcc aaaacttata gtattttccc agattttggt    295980
     ttacttcacc gcagacactg tgctgacctg tttctttaca ctatggttct ctgcccagtg    296040
     gttccaaagc gctaacgagg agaaacacga aacgtctgct cctgttggtg tcagccagaa    296100
     ttacaggaga agcaccgacc ttgcgagcca aggtgcctcg gaaaggtatg agtacactgt    296160
     cacaatgctg ttcacactgg tgacgttgat gttccgtatg tacttcaact tcatcctggc    296220
     atcctttgtc caggaactac tgcgccatcc aaaatacatg gttgaccagg acgatgtcga    296280
     acaggacctc aagaacaagt ctgcaattaa gagatggtgg ataaaatccc agaaattttg    296340
     ctacaaactg tgcagacata ctctccagta aattaatcaa ccaggaaatc agtacaagat    296400
     tcattaggcc ttcaagaaat cccattggca ctcatgaaag caatatacca cattaatgac    296460
     cttataaatt ttttttattg tagtatagta aaaagtcata ttatatatat atatttgaaa    296520
     cccattggcc ctggtacgat agccaaggct ctcaactaca ttactcatag acattgcaac    296580
     aacatataca caatgagagg aactgtacaa tatcaatcaa tgctgttcca atggctaatt    296640
     agagaacaat ggaaagcttc agcatttgaa aatgaaaatg acgtcataat taaaattacg    296700
     caaatagagt tgcataatgc agcgagctag tctgctgaca gctggggcaa accatatata    296760
     aggagaggat gcacccaaga aatgctcaat tgcacttcca attactttta gaataaaatc    296820
     ccaacgctga catattacta gtatcacaac atgtctctga agaactctac tgccactttg    296880
     aagctaaaca ccggtgctga aatcccagtt gtcggactgg gtacctggag gtctgctgcc    296940
     aacgatggtt acgattctgt tctagctgcc ttgaagctgg gttacagaca tatcgatgct    297000
     gctgccatct atggtaacga ggaccaagtt gggagagcca ttaaggactc tggtgtgcca    297060
     agacaagaaa tatttatcac aacgaaacta tggggtaccg aacatagaaa cccagccaaa    297120
     gctctggact cctctttgaa aaggctgggg ttggactatg ttgatttgta tttgatgcat    297180
     tggccggttg ctcttaaggc ccatggctct gaggagaagg acttgctcaa cattccaaaa    297240
     aaaccagatg gcaagactga tattgacatc gaggattggg atttcatcaa gacttgggaa    297300
     ttaatgcagg agctaccaaa aactggtaaa accaaggcaa ttggtgtctc caacttttct    297360
     ataaataatc tgaaggcgtt gaaaaactct ccaaagttca acactgttcc agccgctaac    297420
     caggttgaaa ttcatccatt atttccacaa accgaattga tcgaatactg taagagtgaa    297480
     aatatcctga ttgaagccta ctctccattt ggtagtgcag atgccccagt tttaaaggaa    297540
     ccagaattac acaaacttgc tgagaaatac aatattagca ctgcccaact aatcatcagc    297600
     tggagtgtac aaaggggtta cgttgttctt ccaaaatctg tgcatgcaga gagaattgaa    297660
     gccaacttga aggtattaac cctgaaggat gaagacatgg aaaccattac caacttgtcc    297720
     aaagtcaaag gtgaaaagag attggtacaa ctggactggt cacctttccc tacatttgaa    297780
     tagaaactct atcctgacaa cataatttgt tcaatatata taccggctat acatactatt    297840
     agtagattta aaaaatgcta tcatgctgta tttaacgatg cctggaaaac ttgaaagtag    297900
     gttcgtcatc atcatcatca tcatcatcat cttcatttgt gaagcccttt acaaccgacc    297960
     tgactctgtt acctccattg gtaacagaaa ctttccctct atttctttta ttacgtactg    298020
     gagtggtact accagggcca tcgttcattg tgtcctcatg atcttgaagc tgttgtggcg    298080
     gttcagtggt atcagcttta tttagaagat gtccaacgtc ttgagagtcc tcaaaatcat    298140
     catcaactac aaacagttgt tggttactgt tattaatctc atttgcagaa ttattattgc    298200
     cattaccaat agctgtacga gtaaaggaaa acgagttctc attttcatct cctatttcag    298260
     gtaaaatttg atgcacaaac gaattggatt tattagcctg aggtgcagta ttaatctcat    298320
     caacaaaatc attttgatcg tgatgtgagt tgtaataatc cacaggtaca ttcttagttt    298380
     gcaagaattc cctcgtaaga atctcaccac tgccgcgtat atgccttgac attgactcaa    298440
     tactgctttg ctcgctctta tatttaggac aaattttcac aaattttttg aagttttttc    298500
     tatttttcca ttgctgttgt gtagtattgt ttgcagagat atccgattta gtccttatca    298560
     aatctgctac tggctcgacg agtactaagt cattaagttt attgatagct tcttccgtta    298620
     attcagaatc ctcaattttt acaatagtag aactcaaacg ctttacttcc gattctttcg    298680
     tagtttgaac taatttaact atatcaatgt ctcttttttg tagggttcgc ttagggtcat    298740
     tatcttccaa tgagtttaat gtttgagatt tcaagtttgg acgttgggca tctaaattct    298800
     tctccgttga cattatacct cccgcatttt ttttggataa ttccgtctta ttattactct    298860
     tttcatatcc catactttga agtaaattgc tttgagtaag agaattctct acaccgtata    298920
     aagatttatt accgttgtaa ctattattgt acattgtatt ttcatgaatg tccctcttct    298980
     tcctatccgg taaatgatgc tgatcctcaa caacctcatc attgccaatt aattgatctc    299040
     tatgactaat accttctgct attgagcgtt gaacgatcgt tggctctgaa ttatcatcag    299100
     ttaaagcatg ttccattcga gttgtggata tggtatgtga ttgtccaggt attttctgtt    299160
     ctctggttgt cgacgctgaa tccggagaaa tttcggaatc gagatgtcca ttaaccttag    299220
     attggttata ttcgttgtta gtaccaggca ctggagatat tccgccagca aaaaagctca    299280
     agctatttaa gggttcaact ttatgccgac gaaccctctt ttttttagtc gactcaagac    299340
     tagtatctgt tggctgtgat gtatttgcta gacttctttt ttgaggaata atcgcatttg    299400
     ttgtttcatc ctctaaatca taaattggct tacgttccat agactgatat cttattgcat    299460
     ttcggtagag gtcaccagac tcgataaact tatatatatc atcagaatga atctgtaaag    299520
     tgtcttcagg caagtatttt attttctcat tcgatatcac aatgggtatt tcatcagctt    299580
     gttttgaact tatcaatctt aataaatcat cattcttatg tatcgaatca tgaatttcaa    299640
     ctgacagttt cagcagaaaa ggcttcaaat aacttataat aaaccaatcg attttgtaca    299700
     acagaaaaaa aaactttcct ctaatcccac caaattgtga tagcaaaccc tccaagtcca    299760
     agttcctatg gtatgatgat tgcattgatc gccattcagc gtcaaagtta tcatggtcat    299820
     ttactaattt gttacagatc tcagttaata gaccgctaga atatatgtta atatcattac    299880
     aggcagcaaa tagttctcta taaccaaaat cacccactgt aatcaggctc gtagaattga    299940
     cattagcatt atctacactt atttgaatgc ccaatgtttc taaagtctct ctaaactggc    300000
     tgagtgaatt cggtatgtca aataattcat ctattctgga taatataatt ttcacaggtg    300060
     ctacacccaa aagcatttct atttgggttt catctgccga gtatgttatt aattcattag    300120
     atcctaggta cttttccgag ctctttgtaa gcttaccagt attcgtcagc tctatacaat    300180
     ttttagaact ggaccacttc aatgaaacat gctgtcgcga tatactcttg tcattcttga    300240
     tcactagatt attcttgctc gatctcccga tagtgtattg aacattttga cggatacaac    300300
     atgaaacttt cttaacttcc ccggtttctt caacataaga gtaccgaagc acccacatcc    300360
     tgaccttaat gctccactca agtgttgctt ccaagtgctg cttccaagta ttttggtatc    300420
     agaggataac tgcctctgcg tctttaaatc aataattaat actttccctt gaatttgctc    300480
     tttctacatg actttttctc gatgagctta taaagccgat gagatgaata gtgcgatgag    300540
     gtccggggat tgttttgtcg aaagacatgt tataaagata agttatactt ctattacgag    300600
     atattattag aagtcagtta tgctctacaa cagttaaaat caccatgtat taacaacaac    300660
     agcaagttgt aatgaatgta attatgctac tattaaagaa tatttacaaa cctatgcaat    300720
     atgaatcaac tcaaactaat ttgggttttg tctatgttct atcctaatat tacagttatt    300780
     gtctactttg atactgaata attgaggctc atctctacca aatttatcta gcaaggatgc    300840
     tatagttgtt gttaatgtat taattaaact tctataccat accacagaaa tggcaggatc    300900
     gtaattcagt tcgctgtcac acctgggtag acttttactg attaatttgt tgtataacag    300960
     atttctattg tagcatcgaa catcctgcaa acacccactt tcggtatctc taacaccaat    301020
     tactatgtca gttgtaggta ttactccagt ttgaatccat gattttaaca atttcctcct    301080
     atgatttggg ttcccaaagt tgtatttggc gtagcactta agttcggtat agtgtgaagt    301140
     aattgggttg tacgcatcaa tttcacacct cattaacaac ctagtatttg ctatttcatt    301200
     ttcgactatc agaaacgtag gattcctttc ctcatcgtta gcagattcag ttaatatatc    301260
     ttctagtgca aagccagaaa agcagatctt cttcaggatt gggttatctg tgttaacgcc    301320
     cactttatca tttgtgttat cagcaggatc ctgagatatt tccagcaaat taccaggtgt    301380
     gtatgcacac agcaaattta catttgtaaa ctgccttgaa aaagggagaa ttgccaaatc    301440
     aatcatatga tgtcttgctg taactataac aaaatctcgg tcttctccat atttttggcc    301500
     gtgactattt tcatattgat ctaaatatgt ggaacatgcc tcagtagtat ccagctcctt    301560
     agctgtcatt ggagagtatt tatcatgatt ttcatacagt gatataccca gaaatggcct    301620
     aactaactga gttttctctg caggtgttga ctttgctata tgagctatgg gatcttttaa    301680
     ttgtggaaac aaatccattc tattcatttc gtaaagtttg tgatcatgga atattcctaa    301740
     agttttagca gaatcataaa attgaggcat attcttatga tgcgacgtct tcaaacgctg    301800
     tttattacct cttatgacta cagtatggtc atctctcgct ctagagtttc catgcttctt    301860
     cttcttccct ttccgttgcc ctttaaccct cctcttgtca tttgagagac ttaaagcttc    301920
     caattgattc acgacttcct ccatccatca aaatagtata acaacatggg gcttctagac    301980
     cctgttacta attatattta catgttgcta taaattgaag cattaactat gatttgctaa    302040
     tataagcaga tctcgcatcg gaagaaccgc aatcgaattt tccgaaaaac cttgaataac    302100
     tgacaaactg tgaaacaaac aatataaggg gaattgagtg taataggcca tttgaatcat    302160
     taagtttgct tggttgcttt tcaaattgtg tcttaggatc tttagttata gcccagagag    302220
     tagcatattt aacttataac aaaaaataac tggagaaaga aatggttgag tggtgtgtta    302280
     ttgtttatga taagccaggc tctgacagaa gcacttgcag gccacaacat cttgcaggta    302340
     ttccaccgtt agtggaagct ggcaaattgg tttgtgcggg cgctatctac aacgaacctg    302400
     cacaagcagg tggagaacgc acttttgcag ggtctcattt gcaaattgtt gccgatacca    302460
     aggaggaagc ccttgaattg gttcataacg atgtatttgc caagaacggt atttgggact    302520
     tggaaaacat tatcatctat caatttggat gtgctgttcg tcaaccaaag gcctaaattt    302580
     agtttccttt acctgatctg agattgctag ggaaggttta gtgaagaggt aagagctgaa    302640
     ttagtgctgg cgttatttca gagaatgtta tatactccac tcagagatca aataggatct    302700
     gatgaggcag ttgaatgata ttttgaaatt aaaacagaga ttatccatat ttttgtgtca    302760
     aattcaatga ccgttcattg atgttgactg catatcaatt ttggaatact ttgtgctggc    302820
     taaccgactg agcagtacct aaaatctagt atataccaga tgtaaatact acaaacaaaa    302880
     aagatatatt cattttatct gtgtcttccg taaaacccat ttattattcc tcaggtgatg    302940
     cacatcggtc atcgcaaaag attgggcacc tttatagtta ttttgattac gagtctaatt    303000
     ttacaaatga gtctacatta caagatattt cagaaattaa aaaggagaag tcaatctgat    303060
     gactacagga tgcctgagtc agatgttttg agcaatacga gttatatagc tggcctatat    303120
     tactcaaatt ggtcacccta cgagccgaga ttacatttcc cacatgatat agacttcgag    303180
     aaagtgtcac atatatatta tgcatttctg ttgatagatc ctgagacagg taatttaact    303240
     agcagtgatg aatggtcgga tacacagttg aaccttgcaa agcaatgtcg agagtacatg    303300
     ttcaagaggt tcaccggaga tgagctgaaa gctgtaacaa atatacgagc accacctggc    303360
     tgtatcggtg aactaaacta tttaagatat atctacagta aaatcaagaa acggaatgta    303420
     aaactcatca tgtcagttgg aggatggtct aatagagaat cctttcctat aatggttcga    303480
     gatgaactga agtttaagaa ctttattaac tcatgtatcg agacaatggt gtactatgga    303540
     tttgatggaa ttgacctgga ttgggaattc ccagaagatg atagctatga accagacgca    303600
     tacttgagaa tggctagaga gttaaaatta cagctacaaa aactagaagc aaatatatta    303660
     ggtgatcaca gcaataaaac gtttcagctt tcaatggcta caccagcgtt taaagacaaa    303720
     ctctcgattc ttccaataca caagcttgac aaatatattg atctttggaa tttgatgact    303780
     tatgactatt atggtgaatg gtccgaaaga actggattac atgccaattt atataacgaa    303840
     aaaggcaagc ttttacattt acatcgtcat gacgaggatg ctggattgag tggagatgct    303900
     gccattaatt atatggtcaa tcggtgcaaa attgacccta gaaaagttat attaggtatg    303960
     gctgcgtatg gtaggggctt cactaatgta gatatgaagt caaccaaccc tcataatcca    304020
     tatggattga agtttagtgg cgttggtggt gcatctgaag gagagccggg tatgtggcta    304080
     tataatcaat taccaattcc aggctcaaat gagaagtatg attacagaca tgttggcgcc    304140
     tattgctatg atgataggac acatacttta gtaggatacg ataatccaac ctcagtaatc    304200
     gagaaggcaa actatatcat gagtaactca ttaggtggag ccttttggtg ggaatcttgc    304260
     ggagatacac ataaaaatcc aaaaagatca ctgttaaata catacattag agttatacga    304320
     aatgtcaaaa ataacaaaga gactatttac tcaaccacta agttgcatga ctattatttg    304380
     gaaaattatg atactaatgg atttctcact ggttttatta aagatattat acaagaaagt    304440
     tgaaactaat tatatattca tagcagtcct aaattttcat ttctacgatt catatgttga    304500
     caacattata ttattagaca ttaatgatgg cctgtttgtt tcatgatgaa taactagatc    304560
     gcaattgcta aagaataaaa gtatttaaat gcttctataa taaccatagc cgaaaaaaat    304620
     taaaaatgat ctggtcaatt attcctttta gcatgtagaa caattactat ctaagtaaat    304680
     taggactctg gtgtgttata tgttattctt tcaaacatta tgctaaactt ttgatttatt    304740
     tataaaatat tgtcttcata tcagctaatt caatgacaag aaaataatct ataatagcat    304800
     gtccattcta gagaaaactt caaatacacc agcaataact tcaagtttta aatcacttcc    304860
     tggattcgac tctaattctt cttgtaattc cttgttcaag ttaacggaga tcccatcttt    304920
     ggattctttc tgcaagtcaa atggatattg tgaaaattgt gccagaattt cttctgctcg    304980
     tgtgatggct ttatctctct tgtcgtattc tagtgaactt atgacatttt ccaatacgtt    305040
     agccccatat gcacccgcta tcaaggatac tgttctgatc aatttaaaat tggtagattc    305100
     cggaaaatag ctgttgtatg aaatttccat atttctggag actaagacgg atagtattct    305160
     gcgcttaatg gcttctttac aactcgaatc tgaaactggg tgtgtagcca tatcaaacaa    305220
     aaagaaattc ttcatttccg tccttaatac acctttatct accagtccct tggccaatct    305280
     ctctctaact tgtttcaatt gatagtttat cttcaacagg ttccaagtct caccacttag    305340
     caagtcaatc cagtttgcaa tagacaaagg ttcgtcgttc accatcaatt gtaaagtctc    305400
     atccagcaaa acttcacctg tcttactgct gtctatcacc tcgataagtc tttcagatat    305460
     atcaaatctc attctggccg gagcatccaa aatccgaatc ttatttctca aggccaattc    305520
     gatcaggata cagccacgaa gcgcataaga tatactgtcg ttccaaaagg acaagtaacc    305580
     ctcacgatct ctgagaccca tcagtaaaac ttcctccatc aatgtcaacg taggctgctt    305640
     ggaatcgttc tgtagcttag actcctccgg gtcataagca atcttaccac tgctagtacc    305700
     atcatcctct ctgtcctcaa tgccattgct agcattttca ctcttattca ccctacgacg    305760
     ctgtaaagtg gacatggttt atatgtcgtt gtcgttgttg ttttataagt aaattatttc    305820
     ggacctttac ttgagaaaga tagggcgtta caggtcgcaa aagaaaacaa aaaaaaagca    305880
     caattcttct gttacctcaa tggatacttc gtaatcttag caaagacaat acacaaccaa    305940
     acgtatcaaa gtcacaacaa gagtaccgct gattttattg ccaagaagtc agtgagtttg    306000
     tacttcttaa aagtttcaag gaaacatgga tcgacttgac ttcgcaacga ctttccaagc    306060
     ccgttctgag ttaattatgg cgtatgtagt gacaactgat ttccctggaa tataacccat    306120
     ccaaaaagga ctgaagtttc ttcgttaaga ctgttagcta acggtcctgt ttgtacttga    306180
     tgtttacatg gagcagtttt agaaagggga ttagtaaact gtttacctgt ctaggataag    306240
     tactcaagtc agaactggcg tggtgagctg gacattgagg gagttctttg ttgttttgag    306300
     acaggattga tatcagaaga agtttgtgaa gtgaaggtat aagatattca taatgggagc    306360
     taaagcatcc aagttatcga aggaggatct aacgagtttg aagcagtcga catattttga    306420
     ccgcagggag atacagcagt ggcacaaggg atttctgcga gactgcccca atgggtactt    306480
     gacccgtgat gacttcatca gaatatacaa gcaatttttc ccatttggat caccagagga    306540
     gtttgctggt catttgtttt ctgtgtttga taaagacaac aatggttata tcgacttcaa    306600
     ggagtttata acggttttaa gtaccacctc ccgtggaacc ttggaggaga agctagtttg    306660
     ggcgttccaa ctttacgatt tgaatcatga cgggttcata acatttgatg agatgctaac    306720
     cattgtggct agtgtatata agatgatggg gtcaatggtc aagcttgatg aggatgaagc    306780
     gacacctgag ttgcgagtac gaaaagtgtt caaaatcatg gacaaagatg aagacggata    306840
     tattacactg gaagagttca gagagggttc taaagtggat ccatcgatca ttagtgcatt    306900
     aaatatttac gacggtctcg tgtaacagtt atagattaag aaatatatga aataaaacaa    306960
     ttaataataa aatgcatgtt tcaagactga gtcattaaga agtggtttat tttcaataac    307020
     tagttattga tttttctatc acacactgta ctagtattga ttagagcatg tagtcgtagg    307080
     cggagaagaa actcagttaa tttcaattat agtcttgatc taggaaacat ttgatatttg    307140
     tgttgtcaga cttgaaaagc tgaagcactg cttgaccaat atagaaggga atctcctgcg    307200
     tatctctaga ttttgtaatt ggtttcattt cattttctgg tattagaaat ctcttcagat    307260
     gagcattctt aagatctttt acgaggaccc atcgtactct gaatgccgcc ccatatttgc    307320
     tgctgtcgtc ccataaggac gtatctagac aatcctgaag atcagatgac atctctgcta    307380
     caccacaaaa tctgccggat gcattgactg agaagaagag gaaaatcttt gcgcctgcct    307440
     ttagttcttt gtatgcctgt gacagctttc gattaccgaa atgtgtggat gaccaaatac    307500
     tgttataaaa agatttcttg atatgatcta agctgattga ttttataacg aaaaatctac    307560
     tgaattcagg tacattcacc caagcaggga caatagctaa tgactttttc cttttaacag    307620
     aagctttaag ctttgtcggc ttgttatagt actgatagtt gggtttagat tcagttaaaa    307680
     catcaactgt gggatttgtt ctaacattgg tagtcaaacc ttgtgttggt gtagacaatt    307740
     tgtaatttgt tataaaatca ctgttgatat cagccgaatg tgttgtatgt gtgactggaa    307800
     caactttata ggcattatca cgctggcgac ttgtatcgca gatctgttgc ctgggaacgt    307860
     ctgcgcttct ctgttcatag ttttcatatg acataattgt atacctgtga tccagatctg    307920
     gcagtctaag cacccgacca ccgtgcagca gcccttctag ctccttaaga gagtcctcaa    307980
     ttgttctcat ggcaaatttt ttttgtggag tctctgcagc aattagcttc atgtggccgt    308040
     aacaataata taagaaacag gaaattgaaa atagccgcca gtcccgccct tttatagtaa    308100
     gaatatatac cactatacgt aatgtgcata tgatatatca cttcttctct acaatgtgcc    308160
     tccgctgaag ctcatcgctt ctagcagcgc gtgatgaggc ccagatagca gttgacaaca    308220
     actaatgact acagacttat caatatccat gggtactgta atgcatatat gttagttata    308280
     tcaatccaca ctaatacaga ttatctgtgt gtagctgggt aaatggatac cgagcaattg    308340
     gctaagtatg ttctcaggac tcttgagcag agctcagagg cagggcgttt agcgatacct    308400
     tctgagggct ctaagctttt gcttgctagc gcaactagtg aactgattcg agatcttctt    308460
     ttgcgggcaa aagaacttgc ttcagtcgat aactctgaga ttttaccgca tcatcttgaa    308520
     tcagcactag atgaaatgct aaaatgatgg cagtaatctg ttggataatg ctatagcatg    308580
     cgaagtcaca tgctaacctt ttgtatttat ttacaagtat aatatatata tacatatatt    308640
     tttaaacctg attattaata gattgaactt tagtgcagtt ttatgtggtc atactacaaa    308700
     ttcttcgtta gtcttcattg tgtgcaccat cttgatagct gattctgggt catccttatt    308760
     cattacaaac agaccttgga gttgtgctgt actaactgat gaccccaaag actcaacagc    308820
     ttcgacaaat ttcttgcagt tattgacttc tccggggtag aacttcaaga acatcttctc    308880
     aatttggtat gaagttgcat tgccaataaa aaccttatag tctatacggc caggtctcat    308940
     tatggcttta tccaattttt cagggtggtt ggtagtcatg aaagtaatgg tctcctcact    309000
     ggaggtgaca ccatcaagcg cgttcaaaag accactgaaa gttacagcag aatggaatcc    309060
     ttgttcacct gtttgttctc ttttattaaa agcggcatca atgtcttcta atagtaagat    309120
     acttctctcg ggcatattgt tcatcaagtg attcaatcta tcatcagtta aattattttc    309180
     tgataagttc agtatgcaga tattgtagtc gagttcaccg gctaaggctt gaataaagct    309240
     agttttacca gagccaggtg gaccgtataa taagtaaccc ctacgatatg gaatacctct    309300
     atctgagtac catttaccgt tcttcataaa gtcatgaaca tcctctatga tatcctcctt    309360
     gataccctta tcgagaacta ctgatggcag cagacgtttc gcctttggtt gaccgaactt    309420
     cctccactca ggtccaaaag aagtgtatat tactgtctta cctgcagttg ttttcagagc    309480
     tatatctttg gcttcattca atatgtcttg aaataagtgt cggtcacggt acaaggtggt    309540
     caacgtcact gtttcaaaag gtgtaccatt ggagatatcc accattttcg ccgatctttc    309600
     tctcttgatg cgaataaatg cacctttata tctaatccag tggttaccgg gtcctgggac    309660
     tagactgaat ttggtactca cagaaccatt gtcgtgttgt atgtaacttg ttcttacgga    309720
     tagatgctta gaaattcgct gtgggtgctt ggacatccac gataagaacc atgagtatga    309780
     cttgtcccta gactggatct cgaggtcgac gatcatttgc ttatatgcta gtctactggc    309840
     cttcaccatc ccggatttcg ctaatgccag cccggtacca agaagcatta gcccaccacc    309900
     agcagcaaaa tatggattgt tctgcatagc cgagtctatt aaagacctga tggttccttt    309960
     ctcaccactt gccagggtgc ttgtcaattc attgcctatc gtgtcagcgc ccgttgtggg    310020
     ggcatccggt ggcagtgtgc tctgcccgtt gccactgttc atcggttata gcgcttctca    310080
     attatgctcg gtgagatgaa aagaaattgt agatatgttg gtataccagt atttactata    310140
     taccataact gtaacagctt ttcgatttct gtcaaaggga ctcatcgcag tcttacctga    310200
     aaaaaatccg cagcgatgag cttcctagaa atttgaagtc atcttgaatc attaataatc    310260
     atatagttta gccatgattg cagtccatat ggtttgtaga tcatcagtgt aagcaatata    310320
     agatgatatt tataaggcag ctcagtagcc aggttgaaag gaaatctgtc tcagtggtag    310380
     gatccggtcc gtctgggttc tacacggctt accatctatt atcgaagtcc ccaatcccct    310440
     tgcatgttac catatgggag aagttgccgg tgccgtttgg gcttagcaga tatggtgtgg    310500
     cgccagacca tcctgaggtg aagaattgtg aggatacgtt cactaactgt gcagagcaat    310560
     atatcagcgg cgagatcaat gacaagaatc ccctgggtca taagtttgat tttatcggtg    310620
     gtgtgaaaat aggtgaggat gtccctttga agacattgat agataatcag gacgcagtca    310680
     tactgagcta tgggtgtggt ggagataaac ggttaggtat accgggggag acagatactg    310740
     caggagttct atcaagcaga gaatttgtca gttggtataa cggacaccca gattttgcca    310800
     gtaaagagaa actaaattca tttgattggt ctcgagttaa gaatgtcgct atcattggta    310860
     atggtaatgt ggcacttgat atatcaagag tgctcttgag caacggaatc ccagagatat    310920
     gggacaagac ggatatctct aagcatgcac taaacatttt gaaacatgct ccgatagaga    310980
     ctgtaaagat gattgccaga agagatttta tccactcaaa atttaccaac aaggagttca    311040
     gagagctctg ggaactagag aagtatggta tcaagggaca catatcatct aaatacttca    311100
     gtgaggacat gtttgatttc gagaagcatc agggttcacc tctatatgat cgggcgttta    311160
     agagaagagt ggagatgtgc tctgaatatt tgaagccgtt tgatcaaagg ttgaagaaaa    311220
     actataagaa atttccacct gtgaatccca ttggtaaaga atgggagttg gattatttaa    311280
     agagtcccgt cgagatcatt aaggatgatt ccagtgggaa gattaagggt ttaaagctaa    311340
     cagaaaatga agtcacacag gataacaagg tcatctcgac tgggaagaca ttgcagtacg    311400
     aagttgattt attgattact tccttgggtt acggtggaat acctttacag gatttcaaaa    311460
     cattggacat tgggttccat gattctagag gccacataat aaacaacaac ggcaaagttc    311520
     tggataacaa aggacaagtc gtgccacatc tatacacatc tggatggata cggaagggca    311580
     gtcaaggtgt gatagccagt acaatgatgg atgccttcga agtgggcgac aacgtactgg    311640
     ctgatctata cgctacccgt gatacatata aacatacaga cttagcgcag ctgctcagaa    311700
     cgcacagaca cacaacatgg ttcgactggc aacggatcga caagcacgaa cgcgacgcag    311760
     ggtccgcaga agggagacct agagccaaga tagaggacaa agaggagatg ttagagtatg    311820
     ctcaatagaa accaaaagga agtatttatt ctgtcctgta tgtatatcta ttaatatatt    311880
     agaatgtgca gatgctcata tataagcata catgtgacaa atatcaagct acgaaccaat    311940
     gagatcaaag ggaaggtcac atgtattcaa acgtataaca ctatatacat tgaggtttca    312000
     acttcgaaag tttctgtttg attactgtga agggagaata gtagtgagag tagtagcgta    312060
     ttccatatag tttattcgaa gtgtatttaa aggaaatcct agaggtgcgc cattagggta    312120
     ggtacaagat aattatcaaa ctacaagcaa atacacatat acacacgata gcgatgatat    312180
     tcaagcgtgc tgtgtctaca ttgattccac caaaggttgt ttctgcacag caactggggg    312240
     ccgctccaaa tgctaagcgt attgccaatg ttgtgagttt ctacaagagt ctaccacagg    312300
     gaccagctac tgcagccaac aatgctggct acggcaggtt tttgggcaag tacaagagca    312360
     agtactatga tggcgagaat gccagcggta agccaatctg gcacttgtcc ctagcggtta    312420
     tcacttttgg atactcccta gagtactttt tccacttgag acaccacaag gaccattagt    312480
     gaagcctgtt gataccaaaa ggtcacacca taaatcaaac tgcacaaatt aacaaataca    312540
     ttcctacaca ataaaaaaaa atataaaaga gtacatattt tgtatatatt ctaggtaata    312600
     ataaacaaca aattcgtttc caaaaagaag taatatgaaa tatattgaat tctatgtatt    312660
     atacaagttt ttttttgtgt tatattcgtt tcgtaaatgt tacattggct aatcacactc    312720
     ttttcctcta ggcttcgctg atgtacatca cctgggtacc tctcagaaac acatcgctgg    312780
     cgtacttctt caataggttg ttgtttggat gctcgtagtg ctcacgggtc tcgctcaatg    312840
     cgacgttcat gaacccgtcg atgctctcca gcactccgct gtacagcata ccactgtaca    312900
     gcttcacatg cacgggcttg ccgataatgt tggacagaaa ctgcgtcgac acactctctt    312960
     cagccatggc tcgataaata tattctctgc tttgcttacc ctctcaattc tgcaacattc    313020
     aaagactata gttgtgctat atactggctt ctcttgaaat atttcagcgg tgcgggaatg    313080
     ccaaagtaaa ttcgtggcat gtgaggagta taaaaggcat tcagcgggat ctgcggttgc    313140
     gcacagtcta tttatatcta cgccgcatgt tacaaatgta catatagctt gtctggaagc    313200
     acgcagatac atatgcggtg tggattacac aaaaagtgta gataccaatt gctacataca    313260
     cggcacatct tatttgcttc acctctaggc actttgctcc aagtcgaata caagctactg    313320
     atactagtga acattgtact gtaccactat acaagcgcaa cgaaacgcta ggctaaaaat    313380
     aaaatgttga cacatgtccc cacaagataa cacatcacac tccgagacgc agtgcgctcc    313440
     agctcatccc aacgcaagat gtgtccaggc tggtcagtta gttgttgcgg cgcacggctc    313500
     atctgctggt ctggtgtggt caaagaaatg ctatacttac tgatcccgct tcgcacacta    313560
     catgccctct ggttagacta taaataccag gcaaccagac ctacctctca ttagacacca    313620
     atccggctga gaacccacca ccagaactac ccggtattac gatggctaaa ccaccagata    313680
     tacatgttcc gttgcacgac aatgatttac gcggaagagg cagagaatac tccgcacaca    313740
     ctccgtacat ctcgcagtca catgatcccc ctatgccagt gctgccggat catctgctga    313800
     tccttagcct gtacgggaag acagtggacg acgttctcga tgccactctg actgtagatg    313860
     agctcgacag cctcgagcaa tgggatatgc ccagtggggc tagtgcctct ggcagtgctt    313920
     ctgacagtgc tacagggtct ggttcagggt ctggcagttc ctcggggagt acttctggta    313980
     gatcccaaag tgacaagaat gaagaagatt cttataagaa tctgtggtca ccaagaatgt    314040
     tccaaccagg attgatccgc aagaacgcta acgacatgga cttcgacacg ccggggcttg    314100
     gtatctccca ctctagaacg cctagtgcgt ctcagagtca tacaagtcag acacatacga    314160
     atcagacgca aaccctggtc cagacgcctt catcaagctc aaattcgcac tctaggaagt    314220
     cctctaaccc caatccacag acaccaatgg ctcgcaagac ttccctggac gacaaggata    314280
     agcggattgc taggtcgctc tcgaggaagt ccaaagtgtt cctcggcaac ttgtcattca    314340
     agaagccctc caagactacc gagtccgata cgcactctgg ctggggtgtg gcctctgcac    314400
     agactaccga acctcggttg gagagtcctc gactgggagg cgccaccccg aatctgacac    314460
     cgaaggcatc cgataggaga ggcaagagtg acagcttgat ctttgcgcag caagcgtctc    314520
     ctagagttgg ttcttcccct gtgggccgac gcaacggaag cgtcacaaat acgcctacag    314580
     ttggttccag gaaagacagc attggtttta gtgcgaacac aacgccttcc atcggtatgg    314640
     cctttaatgt cactcagccg ctgacactgg aggagccaag accgcatgta gacgtgttgg    314700
     gacacagatc atccaacagt ctcggaagtg ccaatctggg aacccataat agcagcacaa    314760
     ttgcggcatc gatgtataga acaccgcctt tgacacatca cgataccttc gataaagtta    314820
     caagtccttc tacaacacta gggaactctg caagtgtttt atccaagaga accaacagct    314880
     acaccaacct agagggcagg aaaaggatgg gttccggcga cgctgcgctg atggttgaca    314940
     gcaatggggt aaacgatgag ctgtttgata gtgaattaaa acttagaaaa ctgcggcttg    315000
     agatcagaga actgaccttg tccaagaaac atctggttga tgaaatcgag catttgaccg    315060
     ttaccaggga aaacttgttg caagaagtgg aaagtctaaa gcacgataaa gagaagtcct    315120
     cgttgtcatc cttcgagata ttcgattcac atcaaggtga gaccaactct caaaccagcc    315180
     gaaaaagcag taacagtgct aacaagctct tggcagaagt tcgaaccgaa ccgaaaccga    315240
     aattctggag gatatttgga agtaaccgga gcggtgggtc aagtgaagac tcttatgtga    315300
     ttccatgtga atcaacacca gcgccaaacg tcagcttgac tagtgtctgt gaaagagatg    315360
     gcactgagat cccattggtg attaaagtct gtatcacata tctagaggtc gatgaggatc    315420
     tgttaaaagc ggaaggtcta tacagaaaat cggcttctaa tggactagta gaatctattg    315480
     aaagagagat tgtgaagcta tgtgactctc tcgaggtgac agacacagat ggtatcattg    315540
     agtgtctgcg agatacagag cttctgtctt taatgcaaag agacgaaaat gcagtggcca    315600
     gtgtgctgaa aaggtatcta cggagctttt ctgagcctgt atttacatat gaagtgtacg    315660
     atccgctgat caatttggtt aagaaagatg atctgatcaa cactttaccc ttgctaaacg    315720
     gcaaaccaaa ggacaagttt gaaaatgaag aagaggaaga gaacatgggt aaattgttta    315780
     gaaccaccct gggtagtgtt atccggattt tgcaactact accggaggca cattatgaga    315840
     cattgaaagt actgtgtggg catatctgtc tggtgagcca ctacagtgat acaaacttga    315900
     tgaacttaca taacctagcg atcgtgttca gtcccggttt gttacatgat caacatgggg    315960
     acaaagattt gtcagacatg agggaacgtt actacattgt ggagtttata cttggacatc    316020
     gcaaggaaat attcgactag ttcaaggaaa aaaaaaaatt ctgaatctat ttttaaaaca    316080
     ttggtcctaa aatttattgt aaatgtcttt ttctcatttt gttacgaaaa tcagataaat    316140
     gtttcctcga ttaccatgtc gatagtttgg actttcacca tggatcgcag agaatgttgt    316200
     ttttctattt gatgttggtt ataatataat atgcctattc tcttattgtt aatactaata    316260
     ttacgtttgt ggcagtaacc ctgacgttgt ttttactgag ttttttattt tattttattt    316320
     ttggttctaa aaacatttaa tggttgttgt aaaagaaccc tcactcgcta agtttatata    316380
     cagaacgcat tcaataccca caattctact aatttttttt ttattgaact attcacattt    316440
     atggttgttg tttttttttg gtctatacag ttctaagaaa gaaaatattc agttttggta    316500
     tcgtttataa gtaaattaat atgtaggaat gtaggaaaac tatttacatt aggaatagta    316560
     acacttttag tgtatatctt tcagttcggg ctgagagtac atcttcagcc ttctgttgcc    316620
     aacgcgcagc agatgctcta tcgtggtgaa atccttacga ggcaagtccc ggtacttgct    316680
     gaactccgcg tgtataaact gcaggaagtg tggttggttc tccaccggtt tggtatgagc    316740
     tactctaacc gcacttctgt acagatgtat aacttccctt tgcaacccac tcaacttcct    316800
     agccatagtg tttctcagat cagtgaggtt gtgaaagagt agcaatattt acaactggta    316860
     atagttgaaa cacatgtaac acttgtaaca catgtaatat tttacaacat gttacaatat    316920
     ttataagtat tacaaatcac taatgggatt gaagtgcatc gcgatgtcct tgctagagtc    316980
     tttttaaggg agacggggat caccgtggtt tgggggaaat ggttggagaa atagctgatg    317040
     tggtgaagtg atatcatcag ctgaccggaa ttttcatttt ttgtcaaatt tgtgaaaagt    317100
     gatctggaga gttatcgtac ataatatatg gaatgtgact gttcttcgtt aaatatctga    317160
     tatcaatatc ctgtcgtata tgttgatgcg atgctatgct gattcgatgc caggcgatat    317220
     cttggattaa accgtttcgt gaaaatgtat acacccgttc cgtgaatttc cgaggaacag    317280
     ttggtcaaag agaaggatgt cccgtgaatt tccgtgaatg tccgcgaatt tccgtgaatt    317340
     tccggttatc ctttcctcta gcgtaagaga atggtattta cgtattggtg tgggtactag    317400
     agaggtagat ttggcaactg aaaaggctac aaaacaatca gcaacattca gtcccaactg    317460
     tccccgaacg gcctcgtcta agaaacaaac ttacagcaaa gaggataaac cactcttaca    317520
     agctacaaat aagctagcca tcgatgcgaa ttacatcaac tacgcaccaa ctacagcaag    317580
     aacaaacacc caacaactgt aatgcaatac gtaataccca gtttctttac aataccactg    317640
     ataagcttca caaaggtata agcaaaccag acttcacggg aaagtgtata aacgttgtct    317700
     agttccttgg ataccctatg tgtgcctggg ataatacaat tgaagaagct aaaagacccc    317760
     aaaaaaaaga ggttatgatt atataccgca aaagccaaga tttgttgaca ctagtagaaa    317820
     tcggaggttc cgttcttggc atgttaaaaa catatataag gagcatgtta tctgtacatt    317880
     gcaagtgttc agacttgaaa caacatagta gttccccccc ttggaaaatt taacatagca    317940
     taaaaataaa gtaaaaagaa atggcaccag taactttaga ccctaaggtt accgctgaca    318000
     catcacgtta tagtggtgtc caaagcaatt ccggattcgc ctatggcgag atcaccttcg    318060
     gtgagtacgt gttccgcaga ttgctctcgt gtggtacaaa gtccgtgttc ggtgtgccag    318120
     gtgacttcaa cttggccttg ctggagcact tgtacgacga ctctgtcgcc gatgccctca    318180
     ggtgggtggg caactgtaac gagctgaacg ccgcctacgc cgctgacggt tactcccgct    318240
     acaccaacaa gataggctgc ttgattacca cttacggtgt cggagagctc agcgccttga    318300
     acggtgtcgc cggcagtttc gccgaggacg tcaaagtgct gcacatcgtc ggtgtcgcca    318360
     gctcgcagac ctcatgcaag aacaccgaca acaagaacgt ccaccacttg atcccagcat    318420
     tgaacgactc gaacttcgtg tccccaaacc acaagactta ctatgagatg gtcaaagacc    318480
     gcgtgtgctg cgccgccgag tacctggagg acatcgacgt ggcatgcgat atgctcgaca    318540
     aggtcataga ggacatgtac aggtactcca agccgggcta cctgttcatc ccagcggact    318600
     tcgcggacat gatggtgtcc actcgtaact tggtcgctag gcccaccatc acgctggagc    318660
     aagccatcgc gccattggtc ggctgcggcg agtcccagct ggaggccatc gtcgccaaag    318720
     tagcacagct catctacaac agctccaacc cttgtatcct gggtgacgtg ttgaccgaca    318780
     ggtacggggt ctcccagcag ctgaacagcc tgatcagcca ctgtcagatg tggaacttct    318840
     ccaccgtgat gggcaagtct gtgatagacg agagcaaccc ttactacaaa ggcctgtaca    318900
     acggtaggga gtgctcttcc tcggtcatcg aggacttcag caagtgcgac ttgatcctgc    318960
     acttcggtat cgagcgtaac gagatcaaca acggccatta cacaattgac tacaacgagc    319020
     acatcggtgc caacgtcgta gagttccaca gcgactacat cagattcttc aactcaaaga    319080
     ccaaagaaga agacatgatc cgcggtgtca acttcgtcca cgtcttgaac aggctgcaac    319140
     cagccatcca ggccgacaag ttgtccttca actaccaaga gtgctccaca accagcaacg    319200
     cggactctaa aattgactcc cagtcttcca atgagatcac ccaggagttc ttgcaagaca    319260
     tcatgccaca gtacttgaac cccggtgacg tccttgtctg tgagaccggc tccgttcaat    319320
     tcggtgtccg tgattacagg ttcccatcca acgtcaagta cgtctcccag ggattctacc    319380
     tgtccatcgg tatggctttg ccggcctccc tcggtgtcgg tatcggtatg caagactacc    319440
     ctatgtccca catccctaac cctgaggaga tcgaatatga accaaagttg atcctgttcg    319500
     aaggtgacgg ctctgcacaa atgaccatcc aggaattgag cacaatgttg cacaacaacg    319560
     tcaagatgga gatcttcctg tggaacaacg acggttacac catcgagaga gccatcaagg    319620
     gtccaaccag atcatacaat gacatcgccc catggaactg gaccaagatg ttcgaagcat    319680
     tcggagacgg actgggctct aagcacaaga ccagaaacca ggtatactcg accagagaag    319740
     agttcttgac tagattgagg gaaaagaaag acaccaaaca caatgaccca gcatgccaaa    319800
     tcgagctgtt ggaagtcaag atgggcgtgc tggacttccc agaacaactg aaatgcatgg    319860
     tcagcgctgc catgtacaac aagaagaagg aacaaagcat gagcaattag ttccttttcc    319920
     atcacacttc ctttcataag gggatagagt tccccttcta gcttgcatta tcatgattta    319980
     ttgttttaat tggaatttac cgttttgttc atttcacctt catttctatc ccaggttact    320040
     gttttttttc tcttcatttt cccacatata gaatgcacac aatgtttata ttatatagaa    320100
     tatcgatata taaaagataa catattgtca attgcttatt gaaagaaacc aggctaatct    320160
     tagtgcgtct cttcaaactc aaaggcagct ctatcatcta ggcaacatca tatcacatag    320220
     tacgtactaa acaaggaagc agcagagacg atttgctggg ctcgtagcct gagataacat    320280
     tacatgaagc tacatggatt tctagggaca caagtgaaag aacgaccctt ctgtgcggtg    320340
     gtttctaagg gtaaatgctg ggttgtcttt ttcatcggga ttgacgtggc ggacgggatt    320400
     cttggtgggg gggaaggaga gaaaccagcc aggagaaaaa agtataaata ggctgcaatc    320460
     tggaaaatct tttcctttcg tgttcatact tctgcaacga aggaaagcgt ggtaaacaaa    320520
     tcagtgttaa ctttgtatac aggtattggt ggtaactgta acaaaataaa ggaatttact    320580
     aattaacgca atttttttca gctataaaaa tagtatcgga ataaaattct gttaacaaat    320640
     acattcataa aaaaaaaaat attttcaaag atgtctgcta acttagataa gtcccttgac    320700
     gaaattattg gctccaagaa gactgccaga ccttctaaca gaactcgtgc tggacacgct    320760
     gctcgcccta agagagctgc caagcaaatt aacccacgtc gtcgtgtcgt tccaggtaga    320820
     cgtgctgttt ccaagcctgt tgccgcacca gcttccgctg ctgttgccag agctgctagt    320880
     ttgcttcacg gtactagaga agctagagta actgttgaag gtttgccaag agacatcaag    320940
     caagatgcag ttagagtatg ttcgaattag aagcaaaaat aatgactgtt aaaaaatttg    321000
     cagaatttgt tttcttagga aagggtgtcg aagagcttag agaaagtgtt atttctgtga    321060
     cgtcagcaca tgatgcggag aataatgaac acgatcttat caattttttt ttaaaaataa    321120
     attgaaaaat gcaaaaagac ttacttaaca ttgtcacttt ggattttcaa cttttccttt    321180
     acttcttatc attttttgat tgaagtcaaa ggattgcgac caaaactact gaaataaaag    321240
     tgacaaagct gggtttgttc ctaaattatt tttttaacga gattaaacca agtttgacgg    321300
     aaaactagac gctaaacata tgaattagca gttttttgct actattcgat acgatatcga    321360
     tctcaaataa ctacgaaagt aagtcccatg atatctgatc tcttcaaata caggttaaca    321420
     tggtagacat agaaaatagt tttgaagtct cttattggtt taatttccat tttattaaaa    321480
     tgaaaaaaat tggtagtacg acaatatgac ttgcattttt tatgcacata tgttttaccg    321540
     ggacccatat atcccctcaa ttgagtttta ccttttctaa ctgtaagtta aaaagttgat    321600
     aggactggga tctcatttgc atcaacagca gtttttatca gatggcatta agtcgctttt    321660
     cttgataaaa aacaatatct catatatcag tgttagtgtg aatgactttt gtggagttgc    321720
     tcatccggga gcaatactct tacatctagg gaccaaggtt ttggaagagc aattgatttt    321780
     gtgaactttc atttttcact tttctaaaag tggtgccatg gataaacccg agattctccg    321840
     caatagttct tcaaccagaa aataccacca atactaattt tctttacttt tatgactgat    321900
     atttgatatt cttttgctgt tctattagtc aaatgaacct aatgaaaccc ttattacttt    321960
     tacaattgtc gacttacttt gtcatttagt ggaaaccaaa ggaccaatgg gggtgtgtgt    322020
     gttacttgta tgctgattcc ctgtttctca gctttttcaa atatatcctt tccgatgcaa    322080
     atttaaacac aagagaatga ttatgactaa caaattttat ttttcaaaac gattatcaat    322140
     tggattgagc tacatgaaca aatttagttt tcttgagctt attggctctg gaagctatgt    322200
     gaatgtactt aattaatttc ctgatcggtt tgtaattttt ttttttttat aggaattctt    322260
     ccaatcccaa gtaggtggtg ttcaaagagt tttgttgagt tacaacgaga gaggtcaatc    322320
     cactggtatg gccaacgtta ccttcagaaa tggtgaactt gctaagaagg ctgttgctca    322380
     gttcagtggt gcaccaattg atggtggtaa gtctagacta agattgaaca tcgttgttga    322440
     cccaaccgtt caaccagcta gacctttgac cgaaagaatt agagctattt cccgtgagag    322500
     agttgttgcc caaaaggcta agcctgtcaa gggcccatcc aagaaggcag ctgctgtcaa    322560
     ggcccgtaag caaaagccaa aggccaagaa ggagaagcaa ccaaagaaga acttggaaga    322620
     cctagacaag gaaatggctg actactttgg tgaaggtaag aactaagagt gtttgataca    322680
     tttttaaatt ttttttacca acatgtcaac catttatttt tttttcatta ctcgttgttt    322740
     atgttaaatc ctaacttctt attcccatcc atatgttcgt tttcatgttt tatatggcat    322800
     aaatatacaa atgccatatt gttgtaatct cataatagta ccaatattta tcaaaaaaaa    322860
     taaaagtata tacacagttc ttagattaat gatatatatg aaattaataa attatttcaa    322920
     agaaaaaggg aacaactgtt agtcatgagt agtcaagtag atcatttgat ttatttacat    322980
     gtcgctaatt tgataagatt tcgtgagtat aaaacgcctc tgtgcagact cagtcattgt    323040
     tccgacggtc caggaacccg agtctatcac ctcttttcct cgtcacagca ctaacacccc    323100
     cggcttcgta cttgctcttc ctcgttgtcg cggcatccac tatactgaac tcctcgtctt    323160
     tgtcgagctt cttcggcagc gggaacccgg gcttcacctg cgccaagtta tcatagtagt    323220
     cctgtgcact gctggcctca tcgccaacca acgcgtgcgg cttaaacttg gcatccctgc    323280
     gcgccctcac tatactcttg acgatcacaa gcgagagcac acctacacca ctgatataca    323340
     gcaagttctt accgatgttc ttgaaaggat tagacatttt gtaacgtctt tatcgtatgc    323400
     tcatccacta tcccgcccca attactatta acttctggca gccagccact acagaagaca    323460
     tatataaagg gcattccatt caactatgtg gcatccaagc acacagctct tgaacccccc    323520
     gtataacctc tctgtgtctc agtactcaat aacgaaagcc aggaagtgcg atacatttgt    323580
     acgtaccagt cacgttctat ccatcccctt acacgtccat tccagtatat acgctgacac    323640
     taagcgtata tactggtact aaacgtagta tattacacag catatgcaca catacgtact    323700
     acacgatcac aacaaaaatt gtacatttcg aacggcagct ccacccgcac agactcaaat    323760
     cgccagcgac gaattgacgt tgaaaaaaaa aagtgaaaaa aaaaaaattt caaaaatttt    323820
     tttcacttgt cccagttagt ttaaatacca gctagtcttt aaaccttctc tctctctctc    323880
     tcttccgttt tgtagtttat aatatatttc tttcacttga aaacaccaag gaatagtctg    323940
     cgttttagta tttaaatacc gcttaaatcg attatttcat tcagaaccaa ctcaaacaaa    324000
     cagatataaa aaatgaagta cttggccgct tacctattgt tgacccaagg tggtaacgaa    324060
     tctccagctg ctgctgacat caagaaggtt atcgaatctg ttggtattga agctgacgaa    324120
     gctagaatca acgaattgtt gtctgctttg gaaggtaagt ccttggacga attgatcgct    324180
     gaaggtcaac aaaagttcgc ctctgttcca gttggtggtg ctgctgctgg tggtgcttcc    324240
     gctgctgctg gtggtgccgc tgccggtgaa gctgctgaag aaaaggaaga agaagctgct    324300
     gaagaatccg atgacgacat gggtttcggt ttgttcgact aagaagtttt ttgcaagaat    324360
     aatttaacct tatctttctc taaacttttt atatctaata aactcttctc tttgcttcac    324420
     tctcccagga gtttggctct aaaaaggaac aatatatgat atagttgtat atttttttaa    324480
     ctaaaaacag aaaactaatc aatattttgc attttttaat ttaaacagct aaaaaaaaag    324540
     atacttaatc tttaaagaag acttattctc tattataata ctacatatta tttattatat    324600
     ctgctagttt acctcgcatt atcggatcat tctccgattg cttgtaagcc tcttcaacca    324660
     ccaaggaaag ttccttgact acgctctcca gctgcccttg gtagtctata aaatactgtc    324720
     gtatgtcccc ctccgagcta tgcgggatcg ctttgagcaa gctccgcact ggctccaagt    324780
     ttatatccat atctctcagc tcttgtctgc tcgctacaat ctcattgcac ttatcgatga    324840
     catcgttctt gaggttgcgg tactctcgga gtaactgcgc gttatcatca tcctcatgtg    324900
     cggtatcggc cagttgcagc tgtggcaact tcagtatatc ctcgattaag tcgtcaatgg    324960
     ctgcgttgtg tgagtgtccc gctggatcct caatgctctc tctcaattca ctgcctatgg    325020
     aatgtttcgg tatgtcaccg attatgtcca tcatctcagt catcgtgcgt aacttccact    325080
     cgttctccaa ctcgtagaca ttcttcacca gtagatcagt ggaagtggtc cgcgtcttgc    325140
     ttctcagctt gttcctgtac cctaactcca ccagttcctg aacttcaacg ggcacggcat    325200
     cggagtcatc taggtactca ttgatgttag tcagctcgcg ctgctgttgc tcgatgaacc    325260
     cagtgatgtc cgcatacacc tgtgattctg ggacacttat atccattgct actgtaaact    325320
     ggtcttagcg cttcttgtgg cgtggttggt aactattcga tgttacctct cttaatttgc    325380
     ctttgttttt aatgttttgg gtcatttctt gtgacagagc ttgaaatttc atccgcgatc    325440
     gcgatgagct tcagttgtga aacaaaagga acataggcat tacattatta gaaactgtat    325500
     agtacatatg taaaaataag ttaagtcgtt aaagtattat tatttgaaaa gagcagatgc    325560
     tctttgtatg aattagagtt atagggctga taaataaaaa tcaaatcact agtgtgtgtg    325620
     tgtggggaaa tgcatattat tatcttggag tctgcaggtc atggaaagtg gaaccttttt    325680
     accaatgcgt gaagtaaaaa ttatgctatc ttgatgagcg cagagtctgg agatgtgtag    325740
     attttcggaa tataattaaa agggacgaga tgaagttagt tttggattta gtttggcatc    325800
     atgatggctc tcaatgggac gtaagagttc tcctttgagg agacacagca gtacagcatg    325860
     tagaaaccac atacacttgc cagaataccg aaataaccac ctgccatctt acagttgttg    325920
     tcgttgatga agttaccaat acaaagcatc aaaaaggtga agtctaggaa gaacagcagc    325980
     aggaacagac cccaagcgct ctttaggcag cacatcaaca tcaggaacgt gaacacacac    326040
     cacgcggcca agtagaaacc gatgacgttg ttcagcatgt tagggtcctt gtcgtactcc    326100
     gaaatggcgg ccatggaagg cacgaagtct aaaccgtaac tcagccagaa accaccgaag    326160
     gaagagaaga cggtcatgga gaaagtgtca ccgatgacaa aacatagcag acctgcgaac    326220
     aactcaatag caccaccgaa cagcatgtac atggaaataa cgaactggtt actggtgaca    326280
     ccgcggacgt tggcgttgat caaggacagc acaaggcaac agatggagaa ggacgctaga    326340
     cccaatggca cagggttggc aagcttcttc accactgggg tatgttgctc acggtgctcg    326400
     tcgataccca gcgcagtcag cagttgggtt cttctgtaag tgtaaccacc gagggtgacg    326460
     aattcagagt cagcgtaaat ttcttgaata ggttgtgatc tgctctcgga gacagtgaca    326520
     ccaggcaagg agacagcctt ctccatggtg acaggcgcct tttcaatatc tatctgtgag    326580
     gatgatgagc tcatgtgact tatatgatta gttattgtgt ttgtggctta tcggtaatat    326640
     tgtacacaat tttttacgag ttctacactg aatttacgag tgcacaaggg aattaataag    326700
     gaacagccat ctgatctaga tcaaaagatc atcggtataa atatgaatgg aaaaattttt    326760
     ttttgtctct ggtggttcct ggcgaaagaa attaatcata gactctaatt aagacaattc    326820
     cggtttatac cagttgaagc cattttctgg gatggaaaag caaatcctcc attgaaaggt    326880
     catccaacgc tgcaagggtc caacatccca aatgaccatt gttcaaactc tcaatggtgg    326940
     gaaggcaaag tgcgccatac aacgggaaaa aaagaaagaa atagcttttt cacaaggaag    327000
     tcgaaaaccg gaaaaactcg aagaactcga tggcagagaa ttgctttttt ttgtgtgtac    327060
     cttagataac gccgcacaaa tagggtccaa aagaagtaat ttacagctta atttatccgt    327120
     tctgtgcatc gctgagaaaa catggaacaa tgcgggatat gggaaagagc aaagtgaggg    327180
     gcagagagac aagcgtaggg cccttgctgg gaatccaaag ctcgaatatt gcgcgtggcg    327240
     gtgcgacgga attgaaagtg gggagccgtc aagtcagtaa gctccaggtc ttcttttcgt    327300
     cttctacatt tggatgttta gcaacttaca aaagagggtc actgctgtag aggcatcccc    327360
     cctccgtctt gtatctccgt tgctagagaa ggtcgaggga gggggggaga gagaagaagc    327420
     aaagaggtct ccgcatgccc ttggcctgca cggattatta cataggtagg tatatgggcg    327480
     caatgcgccc atatacctct actgcaaatc cacaacacat acacatacac ccaatttgga    327540
     tcaatccagt tcttatatat aagtatatca tctcatatca actctcttgc gcatacaaat    327600
     cttatatgtg ggaatgtgtc atgtgttagg gtagttatca tccccctcca atagccaaaa    327660
     agcaattcca gcgtaggtac cagaatgggt gctgttctgg tacctacgcc actcttctcc    327720
     ctttgcacat ccccccccca ggcagaagct ttctctctct ccccccgagc tccgtctaga    327780
     gctaggacag gtgtaattgc cagcagggca gcatcacgat tctaccgtcc gggttccccc    327840
     cccctccccc acgctctacg atggcaaccc aagacacgag aaggctaaga cacgcccgta    327900
     gaacatgtag aacatcagca tctgttgaag aaaaagagtg ggagaaggga tggaaaaaca    327960
     ggaatctctc agagacaccc gcacaactgt tccaagttgc aaatgcagcc tttctctcct    328020
     tccgcttcac agagactttt ttcacttgaa atttgcaaaa aaattattca tagaacaatc    328080
     aaaactgaca actatacaga taggaataga cactaaggac aattgtaccc tagggagttc    328140
     aggacaaaga ccagtgtagt acttgcaaga ctgtaagatt aaagtcaaaa aaactagtaa    328200
     gagtaaaagc acaaagcaca aagcacaaag cacaaagcac aaagctgaaa gctgaaagct    328260
     gaaagcaaag gtgaaagtga tgaagtaaaa agtaaagagc agtttgcaaa ttgaatgttc    328320
     aaaaaagttg tagaaagttg ttcaataagt gaatgggtac ctcctttgag actcttgtat    328380
     tcgtgttgtg taatgttaat gatattctaa cgttaaaatt ttttgtcctc taaaaatttt    328440
     tcttataaaa actttctact taagagttac ttctttagtt ctttatataa gaaaggcttt    328500
     tttttattaa tttcaggttt ttcttttgtt cacaattgaa actaaccaac accaacaaca    328560
     actactataa cacaagatgg ttgctttcac tgttgaccaa atgcgttccc tgatggacaa    328620
     ggttaccaat gtgcgtaaca tgtccgtcat tgcccatgtc gatcacggta agtctacttt    328680
     gaccgattct ttggtgcaaa aggctggtat tatctcagct gccaaggctg gtgaagcccg    328740
     tttcatggat accagaaagg atgaacaaga aagaggtatc accatcaagt ctaccgctat    328800
     ttctttgtac tctgacttgc cagaagaaga tgtcaaggaa atcccacaaa agtctgacgg    328860
     taactctttc ttgattaact tgatcgactc cccaggtcac gttgacttct cctctgaagt    328920
     taccgctgcc ttgcgtgtta ctgatggtgc tttggtcgtc gtcgacactg ttgaaggtgt    328980
     ctgtgtccaa accgaaaccg tcttgagaca agctttgggt gaaagaatca agcctgttgt    329040
     ctgtatcaac aaggtcgaca gagctttgct agaattgcaa gtctccaagg aagatttgta    329100
     ccaatctttc tccagaaccg ttgaatccgt caacgttatc atctccactt actctgacga    329160
     agtcttgggt gacgttcaag tctacccatc caagggtacc gtggctttcg gttccggttt    329220
     gcacggttgg gctttcacca tccgtcaatt cgccaccaga tacgctaaga agttcggtgt    329280
     cgacaagcaa aagatgatgg aaagattgtg gggtgactct ttcttcaacc caaagaccaa    329340
     gaagtggact aacaaggaaa ccgacactga cggtaagcca ttggaaagag ctttcaacat    329400
     gttcgtcttg gacccaatct tcagattgtt tgctgctatc atgaacttca agaaggacga    329460
     aatcccaacc ttgttggaaa agttggaaat caacttgaag tccgatgaaa aggacttgga    329520
     aggtaaggct ttgctaaagg ttgtcatgag aaagttcttg ccagctgctg acgctttgct    329580
     agaaatgatc gtcatgcact tgccatctcc agtcaccgct caaaactaca gagctgaaca    329640
     attgtacgaa ggtccagctg acgatgctaa ctgtatcgcc atcaagaagt gtgacccaac    329700
     cgctgatttg atgttgtacg tctccaagat ggttccaacc tccgataagg gtagattcta    329760
     cgccttcggt agagtcttcg ccggtaccgt caagtccggt caaaagatca gaatccaagg    329820
     tccaaactac gtcccaggta agaaggacga tttgttccta aaggccgtcc aaagagtcgt    329880
     cctaatgatg ggttccagag ttgaaccaat cgatgactgt ccagccggta acattgtcgg    329940
     tttggtcggt atcgatcaat tcttgttgaa gactggtact ttgaccactt ccgaaaccgc    330000
     ttacaacatg aaggtcatga agttctctgt ctctccagtt gtccaagttg ccgtcgacgt    330060
     caagaacgct aacgatttgc caaagttggt cgaaggtttg aagagattgt ccaagtctga    330120
     cccatgtgtc ttgactcaaa tgtccgaatc cggtgaacac attgtcgctg gtaccggtga    330180
     attgcatttg gaaatttgtt tgcaagattt ggaaaacgaa cacgctggta ttccattgaa    330240
     gatctcccca ccagttgtcg cctacagaga aactgtcgaa gctgaatctt ctcaagttgc    330300
     tttgtccaag tctccaaaca agcataacag aatctacttg aaggctgaac caatggacga    330360
     agaagtctcc ttggctatcg aacaaggtaa gatcaaccca agagacgatt tcaaggccag    330420
     agctagagtt atggctgacg aatacggctg ggatgtcact gacgccagaa agatctggtg    330480
     tttcggtcca gacggtaacg gtccaaactt ggttgttgac caaactaagg ctgtccaata    330540
     cttgaacgaa atcaaggact ccgtcgtctc tgccttccaa tgggctacca aggaaggtcc    330600
     aatcttgggt gaaaccatga gatccgtcag agttaacatc ttggatgtta ccttgcacgc    330660
     tgatgctatc cacagaggtg ctggtcaaat catgccaacc atgagaagag ctacttacgc    330720
     tggtttcttg ttggctgaac caaagattca agaacctgtt ttcttggtcg aaattcaatg    330780
     tccagaacaa gctgtcggtg gtatctactc cgtcttgaac aagaagagag gtcaagttgt    330840
     ctctgaagaa caaagaccag gtactccatt gttcaccgtc aaggcttact tgccagttaa    330900
     cgaatctttc ggtttcactg gtgaactaag acaagctact ggtggtcaag ctttcccaca    330960
     aatggtcttc gaccactggg ctactctaaa ctccgaccca ttggacccaa cttccaaggc    331020
     tggtgaaatt gtcactgctg cccgtaagag acacggtatg aaggaagaag ttccaggctg    331080
     gcaagaatac tacgacaaat tgtaagaagg ataaaaaaag agtagaaata tgtggagttg    331140
     ctctcggtgt gctccaattt aatgaaattt gttttctctt ttattaatac acatacttag    331200
     tatatctcca tacttggatt tttcttttcg actttttgtt tgtagtttat ataattcata    331260
     ttatttaaaa atatatttta aaaaataagt gtcatcttta atatttgtct gtttagaata    331320
     cttgatagag tattgcagga aattgaattt attatacact atgcttgttc ttttgtagtc    331380
     ctagtcagga cttattgaac tttgggtgac tttgggcatc gcgacttttt caagtgatgc    331440
     gatgctttct gtggatcatt gattttttca ctcttgatag aagagaaaca cttgtgaagt    331500
     gagctattat aactttgctg gaagttaaag acaggaactt gactgatcat cattacagtt    331560
     caaggacatt gtcagcaaat gctaccagat aatttaaagg acctctatgt acaatggctg    331620
     caagaactga tagatagttt atccgagaag caagaacaac tgataaacac ttactcaaag    331680
     gcaaagaaga atctaatcga tcatgacggt gttttttatt atccaaaaga tttgctgaaa    331740
     gttaaaggaa ttggtgctac cattgcgaaa agactagagg ctcgtcttgt taagcattgt    331800
     gaggaaattg gagttgatgt tcccagaaaa caactgccaa ttgataatgg aacacaagga    331860
     agcaagtcac tcaaaagagt acgaacacaa ctgcgtattg atggtataaa tactaatgat    331920
     actgatatta ataaacctgt aaggaaaaag cggaaatata ttccaaagaa aaggtctggt    331980
     gcatatgcaa tattgttagc attgcttgaa cttggagctc agaacaaagg tgtgataaag    332040
     ccggacatca tagaagcagc tcaaaagtat actgatcata gtatgacacc aaattatact    332100
     acaaaggaat tttacagtgc atggtcgtca attgcccaac taaaaaagca tgagcttgtc    332160
     ctaattgagg gtcgaccgca acaatatact ttaaccgagg aggggttaca gttagcagat    332220
     actttacggc tggccgatgg tattgatatt gatggaaaat caatagcaag tagtatggat    332280
     acaaataatg cttattatag tgatgagcat acagcagatt tttctgcatt aaaacatgat    332340
     ctgtcaggtt tgacatgcgc tccaattaaa gatggtacca attcatcagg gaactattct    332400
     attcttgaga aaacatttgg aagtcaagat tttaatgtaa gacatcatga aattggcatg    332460
     gttcagcgat cgcatacttt tggtaatggt gactctaata actctattga accactccct    332520
     agagatactt ctgaattcac aacacagcct tcattaatac aaagaagaag attcgagagt    332580
     gtaagttatg agctgtggca accaggaacg tatgaaatat atcctgtaat agatcacaga    332640
     gaagtacgtt cacattctga tagagagttc ttctttaatg cattcaaagc tagagacatg    332700
     aaatcagaga taaggcagtt gtctttgggt gatattattt gggtagcaaa aaataaaact    332760
     acgggtcagc aatgcattct aaacacaatt attgagcgga agcgactaga tgatttagct    332820
     atgagtataa gagataatag attcatggaa caaaaaaaca gacttgaaaa gtcaggttgt    332880
     aagcacaaat actatctaat tgaggaaact attggttcat caattggtaa tatggcagat    332940
     gcattgaaaa ctactttatg gatcatatta gtttactaca gattttcaat gattcgcaca    333000
     gttaatgctg aggacagtgt ggataaattg catgctcttc atacagttat ttgtgagagc    333060
     tataaacaca aagctcttgt tgtactatat ccgaccgatt tgaaaagtca agatcattac    333120
     agaggcatac taagcatatt ccaaaatgaa tttgaaagat caggtaacct agaatgttgt    333180
     catacttttg acacatttca agatattatg ggaaaacgag agttgaagac aatcaaggag    333240
     ataactattc atattctaat gttagtcaga ggagtgtcgc ttgagaaagc tgtgtttata    333300
     caaaggcatt tcccaaccct gaatcatctt cttaatgcct acagaaaatg taatagccaa    333360
     atggaggcta aattaatgat gtttcaaaag tttggaaatg cgccaggtgc caaaaaaata    333420
     acgaagcaac tatctgaaaa gctagctgaa acatttgctt tttgatttaa tacgtttcat    333480
     tttccctttg ctgctccggt tgcgcaattt gatacactac tgcataagtc atttatttct    333540
     atatttttac aattatatgg tgcattgatt cacatattca ttgaacataa gtgctacccc    333600
     atggagcttc tcacaattac tgaagtgacc tattcacttt ctcgaaaatg cagagcagtc    333660
     ttttggaaaa cgcaataata taaaattata gtttatatat ataatttttt agtacataaa    333720
     aaattattga aaaataatgg gttcattttt aaatgatgaa gtattttctt ttttgagtgt    333780
     gtattaggat ttatgtaaaa aatatgccaa aactaattga tttaagcaga ttccttcaac    333840
     aaagcttctc tcttttcagc gactctttgg gctcttctct cacgagcagc tctgttcttc    333900
     attcttctag cttcagcttg ttcgctcaaa gccttttcac gttgagcatc agccttagct    333960
     tggataatgt gttcaaccaa agctctcttg tgcttgaagg cgttaccctt agcttccttg    334020
     tacaaaacgt ggtacaagtg cttgtcgatc ttaccagcgt cacggtactt agcaagcaat    334080
     cttctcaaga cacgtagtct tctgatccag acgacttggg atggaagacg agcttcctta    334140
     gtaccctttc tcttaccgta accagtgtga cgaccgtttc tcttagatag agcatgttct    334200
     ctagttctgg atctagagtg aacggtaaca gccttcttga caatggtacc gttcttgacc    334260
     aactttctga tggcgtttct ggagttggct tgagcaatct cagaggtttc gtttgggtcc    334320
     aaccaaacct ttctcttacc agcaccaatg acagaagcgg caagtctctt ttgagtacgt    334380
     aagttagccc tgtaaaaatt tgcatgtttt tcgtcactct cacaaagttg gaataaaaca    334440
     atactatccc aattacttat cccaatatat gatttctctt tccaagttat ttaatgcaca    334500
     ctgcataaac aaactctaac attcataatg tgatatcatc atatttttaa ttctgagttt    334560
     agcacataaa tagcacacaa aaccattgga aagattgtca gagaaatggt tctcctatcc    334620
     cataatagtt tgtacatgtc atcataatat ttgaataaac catagtcata ttgtaaggag    334680
     atatcaatat aggaatataa ttggagatag taattatttt caaaagtttg aaaaaacaat    334740
     aatgaatgtt agtatattag aacttataat aatcaaagcg ttcccagctt gcaaatagat    334800
     gcttgaccta ttgatcgata tcctaactta aattcagtac gcttattttc gtaattacag    334860
     ttgtggcgag tccaataaaa gcatttgata tattcctcta ctatcattgt accatacgca    334920
     aaagcgctac tgtctcatta tcaggcatat tattaattta taggtgactt tcactgtctt    334980
     aaccattttt ttcatcaaag caacaatttg gcatatgttc gctggcggga ttcctagctt    335040
     atatcttcat atctcttggt aacatacatt ttcgctctag ggttttagtt cgtttccttc    335100
     tatgttctaa aagtacggta aatttcacta cgtaaaatac acaaatctac ccaagtttct    335160
     tatatatcaa attgactatc ttttcacata ttgagcatcc catccagttt ctttgcacag    335220
     tggagaaagt gaaagaaatt gcccggaatc aaaatttcca ctgttgctcc gctagctgct    335280
     gggagtcagc gaactctact gtcactacta tcagtgcaca gacactctct ctcactatgc    335340
     agtccctgtc ttcccaccat tcccagccta gacgtgtggc tccaggcaag tatcctcctt    335400
     ctggcagcgt ggagtctcgc taggctaggc tcagactatc gttcccctac cgttagtgcc    335460
     tcccaactgt ctcaagccag aatcccccag taagtgtaat ctagcatggc attccagcat    335520
     aagcagggcg aggtagggct gtctgacact ccaacagggg agatttggtc tcttaccccc    335580
     ctggcccagc atctcggctt aggctctggg ttgttcagca agaatgggct cagcaggaat    335640
     aggaagaggg ggaggtattg tccagtcccc caccaaagtg acgatcccac aacaacggca    335700
     ctacatgctc tcacaaggga aagctaggca gaaggacgtt ggccgggcct gcctacggtt    335760
     ctgcctacta agaagaaacg ctcccccctc ccatcactgt gcaactatac tacatcgttt    335820
     ttttttaaaa tatatctaat tatgtatggg tgttatgtaa agtgtgtggg tgtttgtcgt    335880
     cacaattttc tttcttcttt atttatctgg tcttctgttc tccgtacaaa tgtatacaaa    335940
     tgcataattg agagctgtat tcagtgtaaa gagtatgtac agcttgcttc tcaacgttac    336000
     agatgaatct taaataacta ttctatttct tacatggatc gtttaattgt ttgacgtgat    336060
     tacttttgtg cgtgttttgt gtacccattt ggaataatta agtttaattt tgtgcactac    336120
     gttgattttt tgttagccaa ttcttgaatg agtagacggt tcttaatttc gggatcgatg    336180
     acatgtgtac cttccaattg attccctatc gttatccacc ctggacgtaa attatggact    336240
     cttccaaata tctctaattt acgtgattta gagcccacca atctctccac aattccataa    336300
     acttcatctg gtttcctcga tgtctcgcgt gtgggtgata caatgatgtc aaggtcaatg    336360
     ttgcgattta gccactcagg atcgcccttt aaaccaagaa ggagatgctc ctttgagtga    336420
     ttcagccagt gaccagttct acctgtgaca atagttctgc ccagctggtt tgtcttaacc    336480
     catgaaattt cgtttatgac tttgtaaccc catttcttca gcgattcctt accgagctca    336540
     atggcacggc cggtgaccca aagtaatagt ataccttcat cttgtaagat attcaacggc    336600
     aaattgagca attcagtgtc gttacatgta ccgtatggta aatgcatatg gatgttccat    336660
     gctgggtcag caataactgc agagaacttt cctaatagtg ataaatcgaa tttcctgaca    336720
     tcgcattgta tccattgcgg gggcgctaca ttacgtgata aattggaaca gcattctccc    336780
     cttgtataca aagatatcca tgagttctta gatcttgcta tattctcatc tgccaaccat    336840
     gaattatact ttgtttccaa gatttgaggg gtaaattgta aatagtgtac ataccggcaa    336900
     cagtgcattt tatggcatgt gtccaaatat gaacaatctc ctaagttggg gtcagtctta    336960
     ggtttcatat ttggtacaaa gtgtatcttg ttctgaacac attgtatgaa ctcttgtttt    337020
     tgatttatga agattggcca ttttaaggag attattttgt tatttgagat cattgtgcat    337080
     ttggaaagca actctctgtg ctctaagcta ttacaacgtg gaattactgg ctcgacaggt    337140
     tctagttgtt ttgccctttc tatacctaat tgtgtagcct gagtacgtgt agtcaaaatg    337200
     gcttcaattc ttttctgaaa atcggaactc ttgtcctcaa ttaggcgcct aaatttttcc    337260
     tcctgtttta agccattcaa cttgagctca tctcccttgg ggtgttgtct ctttctgttt    337320
     ttcaatatac aatggaactc gtgtaatata gcacaatcaa tgtaagttat aatgggctct    337380
     tcattcagat cgccgatttt caactcaatc ccatgtgaga tctcatgaat ggcatttatg    337440
     attctcttga atgcttctat tttgacatta gtagccttat agatcacaaa cacttgggaa    337500
     agctcaccag aaattggtgg actcatgatc tcaatgtgat tgtccataag gaatttcacc    337560
     acttccactg tgtcgcagtg catttttctt ttgatctcag tttgttgggc tacccatcta    337620
     ggaatcacat acaatagaaa atatctccca gaaatttctt ggacatgggc ctccatttat    337680
     atatcctgga caggttgcac cagtttgtct tatgtttcat gttcagatct ggcgcgtgct    337740
     gttaacgcga tttaattttt tacatttttt aaaggcggac tggcgcttac agttaggcag    337800
     cattattgga atacaaacaa aagggcaagt tcatacgggc aaagagctac tctgatcttc    337860
     tttagaaatt atgaaacgga catggtccta gtatctacag ttagtaattt agtattggaa    337920
     ggagactcat cagattaatt gtcatttatg gaatatgtga catcgacaaa acggagggaa    337980
     aaagatttta agactgaaag gttgcttgaa tagtttaatt ccggataggt tttaagctgt    338040
     tgaacagatt attatttttg attgtatgct ttcttcagtt taaatgctgt caggattgcc    338100
     tcgcattcga taggacacat ctctcatcac gtgctttgtg cactgacacg acatgctcat    338160
     agagtgggca cacactgcga gaatattcta aaacatacaa gagacatttg acatttactg    338220
     gtttacatca tcgcagtttc aaaacactat tgttgataag gtgttaaaag gatccattaa    338280
     ccgttcttca ttggtactgg tgtatttgtt tagcaagcgt cacagaactt gaactgatat    338340
     cagttaactt cctttgcatt ggaatagaga gtggatttaa aggtagatta tctaatatta    338400
     tagcgactaa gttaaggagt tgggtatcaa gattaattaa gcaatcaaga agtgttcatc    338460
     tagtgattat aagccgtttt gcatccagtt gaatttatca ttttctggtt atactatgtc    338520
     agggactttt agtgtggata gcaaaactaa agagtttcag cctttgtatg aattcggctc    338580
     taactatgcc cctcgagtat cttatcacat aaatcctgaa gtatcacatt accactatgg    338640
     agtacgacat cctatgaaac cctttcgctt gatgctgacg gatcatttag tctcggggta    338700
     tggactacac aaaatcatgg atctatacaa gactagaaaa gccactgcag aagaaatgga    338760
     agaatttcat tcggaagact acgttaattt cctttcaaaa gtaacaccag agaatttgag    338820
     taaacttccg agaggtacct tagagaaatt taacattggt gatgattgtc cgattttccc    338880
     aaatatattc cagtacagtt cattgtacac aggggcatct cttgatgctt ctagaaagtt    338940
     gataaataac caatcagata ttgcaatcaa ttggtcaggt gggttacatc acgccaaaaa    339000
     gaatagccct tctggtttct gttatattaa tgatattgtc ctggcaatat taaacctgct    339060
     gcggtatcat cctagagtct tgtacattga catcgatttg catcatggtg acggtgtcca    339120
     ggaagccttt tacaccactg atcgtgtata tactatttca tttcacaaat ataatggaga    339180
     gttttttcca ggaacgggta aaaacgatga aacaggttgt gcagatggta agcattttgc    339240
     tatgaatgtg cctttagaag atggtatcga tgacgactcg tatatcaatc ttttcaaatc    339300
     cataatagat ccactaatca ctacatttaa gccaactgtt atcttgcaac aatgtggtgc    339360
     cgactctttg ggacacgata ggctgggatg tttcaatctt aatattaaag ctcacggtga    339420
     atgtgttaaa tttgtaagaa gttttggtat tcccatgtta gtagttggtg gtggtggtta    339480
     cacaccgaga aacgtctcca gattgtggac ttacgaaaca ggtattctga ataatgttct    339540
     cttaccggaa gaactaccag ataatttacc atttaaggaa agttttgggc cagactactc    339600
     gttatatcca gttctagata acttatacga gaatagaaac agcaaaaagt tcctggaaga    339660
     cataaggatt agatgcttgg agaacatcag gtttttgcaa ggtgcaccga gtgtacgtat    339720
     ggatgcagag aatataccta cacaggatat ctcgggtctt acagaagaag aagaagagct    339780
     gataaaagag atgaacgagg aggatgagga ctggagactc caagagattg agaaagagaa    339840
     cgcaaagatg atggaactca tatattagca gctacatact atttacgata atgagaagca    339900
     actaagcaat ttggctgctg gataaccaaa ttgagtattt aaatagatga gaacacatct    339960
     caaaaacatg aaaattgtat cactattacc ataattatag atatagatag caactgttca    340020
     ggcacaccgg catttggtat gtgagccttt taatggtgtc atatgagacg atctgggaat    340080
     atatgagtcc gcactagaat tcaacgattt ttgtgagttg gctcccctga aactggttcc    340140
     aacgacttct cttcgcttag tctgtggggc atcttgtgaa ggcctgccac aactgatttt    340200
     tgacaaggtt catatattaa ctaatgagct catcgcttct gtatttgctt gattttaaag    340260
     gtccttatag ctagtttcaa gtatttgtga tagcaactgg ctgtggaatt ggtgtatgta    340320
     cttttgtcct gccaaaggaa agacatctga ttcactccta tttggttatt ttatttcaaa    340380
     gttgatttca acaagtgatt gcggtttcaa tattgttaac ttgagctcta tccgctgttt    340440
     ctattggaga acaaaaggaa tactttgggg aactttgcat tttgactaga cgtgaataca    340500
     atggccatat tctcaggtgt tacggtagac ctgtcggtga tattcaccaa tgtctacatc    340560
     atggcatacc tggtttcgcg gataatatcc aatattctga taagaatatg ttctatgcgg    340620
     acacgtatga cccctatcaa gcttcctgtt tggtcaagga taatgtttca tggtataagt    340680
     gcagtttatg cagtcatgct tctggtacga attgagcatc tgctaggaaa catagatata    340740
     gggatgaatg ttacgttaga ggatctatgt gttcaagtgt atttgtgtgt tttgatgttt    340800
     ggctgtgttg aggaattcac agcaaccacc accaacagga aagttatcaa agccactttt    340860
     tctagtccaa tcttgttggc ggcagatatg gtccaggcta ttaacggtac aacaagtttg    340920
     aaattggatt tactaagagt aacactccgt tattgtgttg tcgaaaatct tttagtacaa    340980
     cttatagagt tgatagacaa gagaaactta cgttttttaa gttctttact agtggaattc    341040
     tttaggacgt ttacaatttt gaagatcatg attagagaag aaaatgggta tgagtttggt    341100
     tctacttttg catatggcca gtttttaaac ttcttctggc cagctacact gtttatatta    341160
     acatacattc catatcaagt ggctaagtta gtcaggtggg acccgtttga aaataacagt    341220
     aagattaaaa cacaaagaaa tgccagtaaa cttcaatatt atatgttttt cgaaggtcta    341280
     aaatcgacct taaattttac cggttcagaa tcagtggaag agttgcttgt aacttacctg    341340
     aacaggcttt gtaacatttt tttctttgac aagcaatctg ttcaaaatga aatggaggaa    341400
     ttacaattac caaataagat cagtcatagc tatgttatta gtggctactt gaatccaatc    341460
     aagggggcac cagaagatgt tataaaagga gatgtcacag acaatgatgg taaggcacca    341520
     gtatctggtg tcgagaaagc attttctatc ttgccctttt acagcccatt actctttgca    341580
     aacgtgaaaa caatcaaatc ggtcatatca tggatattta tgaaagttag atctttctat    341640
     aaaactaccg aagatatcga aagtacagaa gagaaaagga agaatgacct caataaagta    341700
     gattttaact cttacatcac tgagaaaaac tactataagt tccttactaa acccattaca    341760
     aacgctatcc cacaaccgaa caagaatgtg gaaaatattc tgcctttgtt gttacctgaa    341820
     gaggataact cagaggatta cgtcccagat aatgacgaat tagatgatga tgattatgat    341880
     gaaaatatta cagatgataa tgaacatgat gacagtaacg aagacaaaga aaagagtaac    341940
     agctccagaa tctcgaataa tgacttacag aaggaacttg ttagtttgat aacaccactt    342000
     ccggaggaag tcgaaacatt ggatggcatg acatggaata cctcggtatg gacaagatat    342060
     aaatatagag actcgttaaa tcaatgtcta acaagaaaca agtatagtga acttaatccc    342120
     gatggtgtgt tgacagaggc atttattgag agggtcagcc ataatgcaaa taagatacat    342180
     acacacgagg atcttgaagg cgaattagat ttatcttgtg tgatatgtaa ggtgaacacc    342240
     agaaagattg tgctgtggcc atgtagatgt ctagcaattt gtgatgaatg tagagtctct    342300
     ttgggaacgc ggggcttcaa gaaatgtgca tgttgtaaca cgaatattga ggcttacagt    342360
     aaacttaata ttgtgtgact tataaacttc tacatcgtat tttagcccaa ttattctctc    342420
     acattttttt atttgcaatt tataagaatc aaatgatgtg tcatttcaca ttactggagg    342480
     atctcgttgc attcagatag cagaacttac attttttata acaatgcttt actttcagtc    342540
     tcgaagaatt atgctatgtt gttgttcatc atggctaagt tttgcaaact tttaaataaa    342600
     attttttgat agatagttac tattctggct agttaaaact tataaccatt tgcattattg    342660
     aaaccctata actgctattg atttgtcgtg ctgcggtacc tcatcgcatt tcactatgca    342720
     aaaaaatttt aatgtatcag aatgtctgga aaaaaagtat ataaagagct aacatcctga    342780
     atattctact gtttcagttt ttaatactag ttaaatctat tcttattttg aagttttaaa    342840
     aaataaccat agtcccgcgt tgggaaaaat ctaataggta agaggaatag tatggctatc    342900
     tcttttgaga tcccatatga tgtccttgct attgctgctt aacttatcta ccaatttccc    342960
     aacactttca gcgctcgaga ggcagagtct caaggaaccc aagacgtaat tgatttagtt    343020
     tcctgtctat ttatttaggt gggaggtcct ttggttattt acttctcctc tacgggcttc    343080
     gtgctcgtgg ggttttgagt cgtttttggc catcggattt gaattgatta ttgttttcga    343140
     ggttgttgcc attacgtata tggatgagac agaagtagcc ccgctgacgg gtcaccaatt    343200
     gttagatcaa gtaggacgca tgatcttgaa ttctcctttt gtggaaaatt gagaggtttc    343260
     aaaatctagg atttatccca ttttttgttt tcactctttt ggaatcttta ggattgagtt    343320
     cgatcgtctt tgttgtcgtt ctacagcggt atattcctga acactatgta gacccttgct    343380
     ggtcgatgat catttgggta aaaccatact gcatacattc aatttcattt atagattttt    343440
     attttttgta gagctttctt gttattgtta ttaagacatc gttattgtag cttactaaaa    343500
     tactagttat tgtaagtgca aatattcaag tggaaatctc ttgcatttat ttcaagtttt    343560
     ggtaggagtt caagtgtatc ttggcgaaca tatatttatt tataaaagag tttgaacata    343620
     taaaaaacca taaggggaat taaaaaatac aggcatgaaa gtacatagta gcttggattg    343680
     tattcatgac agcttatcct taaacatcga aattgctttt caaacacatc tatagttatt    343740
     atattaataa aggagtggaa tgtcctcttt catctgacat caaagattgt gaattattac    343800
     agattgtgat ttaattcaca attattatta cagatccatg ttgaaaatgt ttatatgagg    343860
     cggatggtta ttttgaatac cgcaaactga ttatgtggag aaataaagat atatgactgt    343920
     ctttgttatc ctgaagcact tttttatcga aatttattta tttagttgac ataaggcact    343980
     tttgtttcaa tgatggaaca gacgaattgg attttcaaca tagactaagt caaaagaatc    344040
     agcagcagca aacacagcct tgtcttgaac agatccagat ggagcagcaa tgtacttaac    344100
     acctgatttg acagctctgt aaacattgtc tgggaatggg aagaatgcat ctgaggataa    344160
     ggagacatta ttcaacttag agagccactc ctttctttcc tccggtgtta gcggagttgg    344220
     aatttcagcg aacttagatt catattcgga cttttctgga tcctcttcag gaatttgacc    344280
     agtaacatat aagtcgattg cattggactt atctggtctc ttaacaccct tggcccactt    344340
     aaaggcaaga acctttggat gttgtctcaa ccaccaattg tcagctttat cacctgctag    344400
     tcttgtacag tggattctgg attgctggcc agctccaaga ccgattacca taccgttctt    344460
     tgcataacag acggagttag attgtgtgta ttttagagct aatgatgcaa cagttagatc    344520
     aatcacggcc tgttcagtca agttcttatt ggcagacaca atttctttga aagaagattg    344580
     gttgatgatg gcgtcatttc tcttttgttg caaagtgata ccgtagacat ctctcgattc    344640
     catggcatct gggatgtagt ttggatctat ttgcaagata cagtacttac cattcttctt    344700
     cttttttagg atctccaatg cctcgggttc aaagcctgga gcaattacac catcagacac    344760
     ctccttggag ataatggttg cagttgggac atcgacgata ttcgataggg caatccaatc    344820
     accgaaggag gacattctgt cggcaccacg ggcccttgcg taggcacatg ctaatggaga    344880
     taggttctcg atatcggata caaagtatat ttgtttttca acatcggaaa gtgggatacc    344940
     aacagcggca ccagctggtg aaacgtgttt gaaggatgct gctgctggta agtttagcga    345000
     tgctgatagc tccttaacca aaggccagga atttagagca tccaaaaggt taatgtaacc    345060
     tggggagcca ctcaagacct tgaatggcag ctcctccaat tgtgtgacga aagcctgtgc    345120
     aggtctttgg tgtgggttag caccgtaacg cagaggcaat tgggctctgt tttcggagta    345180
     ttgttttctg aagaagtcag agatggcggc atcgtagtca gcagtgtgtt caaaagcctt    345240
     tagtgccagt ctgtttctca gctcctgaga aacttcgccg tgctctttca gttcgtgcaa    345300
     gaaaatagcg tagtcgttag ggtcggacag gattgtgact ctcgagtggt tcttggcggc    345360
     ggctctcaac aaggtaacac caccgatatc gatctcttcg actgcttctg gtactgtgac    345420
     accgaccttt gcgacggtct ccttgaaagg gtacaagttg cacacaacaa agtccacttt    345480
     gtcaatgtgc tggtccttca agtccttctc atcgctctcc aagttcctgg ctagaatacc    345540
     accgtgcacc gcagggtgca gcgtcttcac tctgccaccc agcatctctg gcgcatgtgt    345600
     gatcgaggac acgtcgtcca caggaaaccc ggcctcgcgc accatgttcg cagtaccgcc    345660
     tgaggccaga atcctcacat cgttctcaat caaccccttc gccaagtcca gcagcccagt    345720
     cttgtcgtaa acagacagaa tagccgtctt cttgtacatg ttaatgttcc tatcgttgtt    345780
     ttttttcagt tatcagtcac cctcaacagt atttgtgtct atcccttctc ctaggtatgc    345840
     caccccagta cacgcccatc ctattagaaa tttttaattg gccctattta tactttttgc    345900
     ccaaattgcg caccaacttc agaccataga agaacccctt tggccgggag aggactctga    345960
     aaaggttttg cgccctacac agaaactccc ctagagcttc gtcatctgcg tatgcgttcc    346020
     ctttatatta cccttctcag ctttaactct gtcccccctc ccccaccagc tcgaatccca    346080
     gctcagaaac tcccgcacaa gaaactactt cccagttttc ggtttaccca tttttaactc    346140
     ctgctaattt tcaataattt cacttggaac tgcacagaca ctgccgcagc cagacactgc    346200
     cataaccatc tgggaaatcg ggcctgctgt gacttccttt tggctcactg tggtggtccc    346260
     tgtgggctgt gttaattgcg acgtttgtga ggatgtgggg tcgggtgact cttttcagta    346320
     tggtgggaaa tgattcgtac atgggtatga taataccaat agtacagtta tattagtggt    346380
     attattagat atctcttttt tattaaatta caagtagtta tgggtaaaaa gcttgactcc    346440
     tactgttaag tatgtatata tggacttttc taaagtaatt gatatacttg atattaccac    346500
     attgtttttt aatattatat aaatttgtat atgtattttt tagcctttta acgtaataaa    346560
     tcaaccaatt gactatgtaa acattaataa atttatacta atattactct gtctcttttt    346620
     ttaaaaaaaa gtggaaagtt ttgtttttat tttacaaaat acctatgtat aggaatactt    346680
     atactataaa aacaaaaaaa gtcccatata gaaagaaaaa tcggaaaaag cgagacgagg    346740
     cttacgatta ctttctgtat ctccacaagg acaaggtgtt gtgtctcttc caggtctttc    346800
     ttctgccggc cttggtgttg gtgtatctgt gacccttgtt gatacctctg gacttcttac    346860
     cagtggcagt caaacctcta gcctcacggt gcttgtggac tgggttacag atccagttgt    346920
     aacgagcatc tcttctgata gccttgtggg atgggtcgac aaggataact tcgaagtact    346980
     tgtaagtaga gtcttggtta acccagtagg agtttagaac tctcaagttg gaagcacgac    347040
     gaccaactct ctcttcggca gtagctctca aggatctttg gtacttcaac tcgttgacac    347100
     cttggttggt tggcttaccg taagtagcac cctttggaac aggtctcttt ctgttaccac    347160
     gtctaactct gacacggtag atgacgaaac cttgcttggc cttgtaaccc attcttctag    347220
     ccttgtctgg tctagatggt ctggaggctc tgtggataac gttcttttgt ctgtattccc    347280
     agactctgac tctttgcaag aatcttagaa catcagattg cttctttctt tgaagctctt    347340
     ccaaatactt gtaggcaccc attgtagtgt tgttgttaaa atagttggtc gtaccgatat    347400
     gtcaaaagag agaataaaaa attaagtgaa ttaactaata aatatacatt caaagaaaaa    347460
     aaatatacgt ttctcttttc ctgttagtgc acactatata tactaattga aaaatttttt    347520
     ttcgtagttg caggccccat cgacaaaatt ccaattgctt gcgggaagtg aaaaactttt    347580
     tcacaagcac caaaaaaaaa actctgaaat ccacagaaac ccccgtaaaa caagaaaaaa    347640
     ccaaaggtct ctttttggga attaagaagt aaacctgtct cgtatcaaac gctttttttc    347700
     cagattatat catcttatac gtcttgtgat tgagggttgg gttctcgttc aaggtgaggt    347760
     gtcatactca ataaaagccc taaacttcgt aattggtgcc atatattttc ttttcccttt    347820
     tgtctcggcg gctaacgtta atatttcctt tggcagcaaa aatcttgcat catcggcggg    347880
     tgtcgaaggt atggttctat atttggaagg ttgcactccc ccctctcccc gaccactatt    347940
     ttaagaacac tttgtctgcc gtaatggtga cgtcagtttt ccagatctat gtatccgcgg    348000
     ctaatctaac tgttgttgtt ttttttctta cctggggata tgtcaaaaat agcatatctg    348060
     tcttagaatt gcacgtacca aattggtttg tgtttttatt tctcggcggc taattcccag    348120
     atctctattt cccctcgatt tctctcctct ttttttttct tggtgcagaa gtgcagtggc    348180
     agatactatc tccgcgggat ctccgctttt caagttttta tttttagcag ttctgttact    348240
     ttgatacgtt tttactcaca aaactacgca gaggcgccac taagtttttt ttgccttccc    348300
     aggttcactg ccgcggacct ttggattcaa tcctcgcctg tcttcccctc cccccaaaaa    348360
     aaaagtataa aagggcaccg ggtttctcca aaaacaaaat ttcctgattc ttgcgccgcc    348420
     tgcgaattaa taaaaaaatt tttctttgtg tcaaacacta cctcttttta caccctttta    348480
     tgctaattga tacccattaa aaaaaaaaat tccactgtta ttaaagtatg tcaacccttt    348540
     tcatataaag atagcttaga aaatttgaaa cagttacagc taattttttt ttgattcttt    348600
     ttgattttat tattacctaa atgctctacg tcagaggatt tttgttctgt catagtcaca    348660
     ggtagaaaga ctacttgcat ccaagggaat tgaagaaact ggaacggatg actacagaaa    348720
     gtttcaagtt tcaaaaagtc tctgttaaga agatatgttt gccagagccc ttgcaatggg    348780
     aaccagacac agcaatcgtc gaagaacaga agagttactt gagaacacca aggacagcta    348840
     atgatgatga tcaaagcata ttggcgtcta tcctttcaaa gtggagtcaa atgataagaa    348900
     aaagcataag aaactacaaa caacggaaaa ggaataggtt gaaattttgt cataatttga    348960
     acggtaaata tttgggactt aataatacca agctgagtac aaattttatt ttgccagata    349020
     tcccagtaac aatgtcaact aatgaaagag aatggttacc acagattgaa ccaataatgg    349080
     ttagggatat ggtaattgaa tttcctacaa ttgaaagcat cacatacagc gaagcagata    349140
     taaccacatt atccaacgat gttcctcaaa taattgattt ctatctggat aatgacattg    349200
     atgatataga atcattgaaa catcgcaaaa acatgatctc tataaagaag agacttgtgg    349260
     aacagaaaat aaccgatcta accaatttac ttcaaagaaa gacacccgaa cattgttacc    349320
     gtcaaaggac cagtagggac aaagttatat ctatgatgaa tgatttacaa agactgaact    349380
     ttgaagtaga aacgaaaaaa agaactatag agctactaaa gtcgcaaaat cttagaatgc    349440
     caaaatattg aatgacatgc caaaaaactg agcaagtttt gtctttatct tcatcaattt    349500
     ttttgaaaga gggattgcat tatacaaacg cgatggcatc atcgcgtgaa taaatttact    349560
     attttgtttt cttttttaga aattaatgaa ttagagtttc gctcttctcc ccacaaaaat    349620
     gacaacacta cgtgatgtaa tataataaat gaagaaaaaa aaaaaattgg taaatattat    349680
     tagaagagtt aatataatta ttacagacta ttgtccaaca tatacaactt agcagacatt    349740
     tcaaaaggac taatactata taaaaaaagt taatagttgt tcaaactaaa gacatctgaa    349800
     gttttttaca atccatagaa gggaggccta ttagatagat actatatctt gaatacaaag    349860
     taagagccaa tggtacttta gtaatggatc agaatgcaaa ccagaagaaa cgattcttta    349920
     aagatgaact cgagtcgtct atcgaaacca ctttgactga taaatcatct tttctatttg    349980
     aaccgcaggt agatgcgatt caggaagaaa atgcaaatga tccagaagag caaattgcac    350040
     aaggtacaca ggaatcaccc tttatagagc agctaagagc agtgttgccc actatccggt    350100
     tagaagtggc cttagcactt gaagaaaaat atagggatat tgacgacggg ttggatctgg    350160
     ctatctcaga gtattttgac caatatcaaa ccggaaatga cgatgcacca ccatcgtctt    350220
     tggaactgca acattcccaa gaagtgttga cggtgcctga taatgaagag aaggatacag    350280
     atcttcaact agtaagtgtg aagaggaaac gtgaggacga tttcatgcag tctagtcaat    350340
     caaaaaagcc ccaaagggca aacagtagtt ggaaaaagtt tgttggatca ctacaagtta    350400
     cagtgatggt tacgagacct acaatgagac ctgtcccata cgggacacca cttatcttta    350460
     aaagatccaa taataatgtg cctttaaaga aaatttacga acaattgaac aagaaaaaga    350520
     caggtcttgc tgcatttgtt aagatttata gtgccaatga tgaaagggaa attggtagag    350580
     ttcccgaaga tatagctcga attgtttttc ctcttcttca tcgaaacgaa gtccatttta    350640
     aactaacaat gatctatcct ggtgataaga gactaagcat aggtgataat ataattatcc    350700
     aaatggactc atttctaacc tccacactgt ttaatcgcaa agaaaatcct acgttttcga    350760
     ctcaaaatgg aaatgggcgt gaaagatttg gagcaatagt ggaaactgaa caggaactgg    350820
     aagaaagaaa tataagaatg ggtttaatca tgttattcga taagataaaa ttaaggccag    350880
     ttaaagatga ggccaaattt ttagaaaagt tgaaacaaga tggcgatgac aacgaaatag    350940
     ttgatctgga agacgatgag agttttggga atttcttatc acaagaacct ttaaacgatg    351000
     agttaccaac tcagcatcaa gaagatacga tgaatatcaa tcaattgacc tccttttata    351060
     aagcaacgca atcttctaaa caactaaata gcttaatacc gacaacgcct ccaccagagc    351120
     tagttaaagt ggaacttcgc aagtatcaaa agcaaggttt aacttggatg ttgagaagag    351180
     agggtatttc cataggccat gataatgaag ataaatccga agatgatact acacttctta    351240
     accccttgtg gcgacaattt cagtggccca ggaatatgtc atggcataat caatctacag    351300
     ggagtgaaaa tgacaattca aatcctaagc tgattttctt ttatgggaat cttcatactg    351360
     gtgaattttc tcttgagagg ccaacgatga attctttcaa gaatggtggt atattgtccg    351420
     atgagatggg tttaggtaaa actatttcag ctctatcatt agtactgatg agaccaaagg    351480
     acgaacatac taccagtcag tcactgtttc accaagagag ttctaattta tcaagtgatg    351540
     atgtaataga aatcaaagaa ccggaaagat catatgctta caaaacaacg ctaatcattg    351600
     tgccgatgtc attattaacc cagtggcgtg atgagtttga caaagtcaat aataatgctg    351660
     gattaacgtg tgagttatat tatggaggta atgtgagtag tctcaaaagc ttactgatca    351720
     aaagaaagaa cccaccaact gttgttctaa ctacttatgg tattgttcag aatgaatgga    351780
     caaagttaag taaagatgga acaaatatca ggtctctggg acgaacttct ggtatttttt    351840
     ctatcgagtt ttttaggata attctagatg agggccatac tataagaaat aaatctacaa    351900
     ttacttctaa agcggtatta gaactatctt caaaatatag atggatactg actggtaccc    351960
     caattatcaa tagactggat gatttatatt ctttggtaaa atttttgaag ttagaacctt    352020
     ggtctcagat cggttattgg aaacaattca ttacaaatcc tttcgaggaa cgaaatttta    352080
     agcaagcatt tgatgttgtt aatgctatta tggaacccgt attactaaga agaacaaagc    352140
     agatgaaaga tactgatgga aatcctcttg ttcagctacc tccaaaggaa attgttattg    352200
     agaaattaca attatctaag aaacagaaat taatatatga agagtttttg caaagggcag    352260
     agaaaacatt cagatcaggt ctacaatcag gtgatctctt gaaaaaatat tcaactatcc    352320
     tggttcatat attaagactt cgccaagttt gttgtgattc aaatctaatt ggaaccttag    352380
     atgaaaatga tgaagatttg tcttcaggta ataacaagct aataactgaa tcagttgatg    352440
     taaaaaccct aataccagat acagaggagg aggaagatga ggtacctcca tttgaaaatg    352500
     acgaacttga caaattgatt gaatctgtag aggcaaaatt tattgattca aaccaactga    352560
     tacctgttga gtgttctata tgtacagcgg aacctattga gagctcgtct gcggttgtta    352620
     cagaatgtga gcatgttttt tgtaaggagt gtctggagga atatggtaac ttccaaaaag    352680
     agaaaagctt gcaacaaaag tgtcctaact gtaggaggga catcaattta aatagatgcc    352740
     tagcctttga aaaaggctct gatggaattc taaagctgat ccattttgac cgtaaggaac    352800
     ggcctgcgaa gcttaatgcc ttaataaggc acttacaaca gctacaagat agttctgccg    352860
     gtgagcaagt agtagtattt tcacaattct cctcatattt agatatattg gagtcacaac    352920
     taaacgaggt ctattcatca aataagttga aagtttacaa atttgatggt cgcctgtcct    352980
     taaaagagcg tactgcggtg ctagaagatt tcaaagtcaa agattatgca gtacagaagg    353040
     ttttgcttct atcattaaaa gctggtggtg ttgggttgaa cttgacctgt gcgtcttatg    353100
     catttatgat ggacccgtgg tggtcgccca gtatggagga tcaagcaatc gatagaattc    353160
     ataggatagg gcagactaac agtgtgaaag tcatcagatt tgtaatagat ggctctattg    353220
     aagaaaaaat gttaaggatc caggaccgta aaagaacgct aggtgaagcc atggatactg    353280
     atgaggatga gagacgtaaa cgtcgcatag aagaaattca aatgctattt gaatcttaac    353340
     gaatatagaa aaactgcatg aatgactttc gactaatgta atatatatat ttaaagtact    353400
     gcatcttaat aaataattat agaacacatc tctttcattt gttgggtgat ttatctctta    353460
     tagttataca tcaccagtat tgtgatcatc ttagacgtca aaaactgtcc tcgatgaaga    353520
     gttcgcagaa actcaaattg acgcgaccag aatgagaaag ttgaaaagta tcacaataat    353580
     accaatacat gcaaacttat agtatgcaaa attcgactgg agttgccttt taactacaga    353640
     ggatatacaa agcacctccg ttaaacgcaa aatattagac actttatttc tgattatcac    353700
     ttttcctggg acgtgaactg tacttgaatt ggttggtaat taggtacata aatacaatca    353760
     ttgttaaaac atcgcaagtt atccccataa cggaatagat aaattgagat aataattctg    353820
     aatcactttt aatttgtctc tctataataa cacgtttaca ctggtgagta acaaatacta    353880
     agcatgtcgc aaactgctga aaagggtatt gcggatttga taaataatct gtttcggata    353940
     tttcgagttg ctggagccaa atgcagggtg ttagatgaac catttccttc aaagtttcat    354000
     gaatcagacc cactaaaaat ttatgaatcc tataacaggt ttttgaaaag taaaaccgat    354060
     catgatggct ctatcaaaaa tgaggataag cttccattga caacaataac cgaaagaaac    354120
     gataagaaag agtataatgt tagtcatggt gggttataca agctgtatca tgatattaaa    354180
     ttggtatgca taatgcttat caattatttc ccccaaggtt ccaagaaata tcaaatggtg    354240
     gataaattct ataaatttgc tactgaattg atgctacgag aagcctataa gatcggcgct    354300
     caattagtat acgagacaaa tttggatgat gatgaaagag agacggactc cagcagaaca    354360
     gaacttgaaa aggccataag tgctgacttc attaaaattg ctactaatta tactgttcct    354420
     gttaccgaga cttatcacat tactactaaa gatctggaat tattttcttc tactatcgag    354480
     agatctgaaa ttgattatag accgcatgaa ttaccaaact ctaattttga aatcaataaa    354540
     gttattccac aaaccagcct tttagatgaa gcacctaaat tgggcttttt ggcagcaaac    354600
     acaagcggta tcccagatcc aactctgcca cctaccgaaa tgatgaccag atttttgcat    354660
     ccaaattggt atgctctacc aactacggta tggctaaaat acaatggatt tagctcatgg    354720
     gcaccttctt ttaatgaaaa tggaacagtt atagattcaa caacaaaagg tacgatatgg    354780
     ttgaatagag ttggatatat gcaagaactt atcaaaaagg aaaaggaatt acatgaagat    354840
     ttatcaaaag agcaggaaac cactaaggat gaggagaaga agacagatat gcttgatgat    354900
     gctgacctgg atcaaacgaa aaaaaatgaa aaaactgcaa atgaagctga agtgaaaact    354960
     gaagaagaaa atcttcgaaa tgatagtaat aataatataa aaattgagaa tctttttgct    355020
     tggacacctt ctaatcagtt aaccgatagc gatattgccc ttctcaaaga tggtaagggc    355080
     gaacagcttg ttaatgacac tttatcaaga atagcaaggt tgagaaagtc aagaatagcg    355140
     aaaaggctaa gagagcctac agatgatgag agaaatctat atttcaaagc tcgccttttg    355200
     ttaaaagaaa taatgctctc aaaaactgat cagccactca aattatcgaa tcacacttct    355260
     tttccaatag ttcaagtgaa ttataatggt actataccag ttgttaggac acaacctgtt    355320
     aaaaagaaaa agtatagaag ataaaattaa taaaacttat actagtttag agtagctatt    355380
     tctttgttac tcatataact taatagagga agcatttgta atattataaa acatcacata    355440
     ttcaagttag cattttatgt agattgatga tatttctatg atgctttcat aattgatgat    355500
     acgaatgtta aaaatgcaaa tatttatata ttattaaact cagtagtatt gactgtagaa    355560
     cccggataga tactttgttc atggtatgta tctaaccgtt gaactaccta taacgtagtt    355620
     tagaagtgta cgtctgcacc gttcagccaa gagccaacca aatagcagtt caagccacca    355680
     attaaagccc aaacaaagac agctgctcca gttaataatt tagaattggt aaaatctttt    355740
     ttctttcttt gtgcactgga atttaaaggt gtgctctcgt caacatcatt tatatcagcc    355800
     acatgtaagt gatgatcctc tactgtcata attgacctat tagcagtgaa atagataagt    355860
     ggcgctgaaa caattggtag aattagggac aaaacaactt gagagaaatt caggatattt    355920
     gatatgccac gctctccaag tgttagtgta acaaacaaac aagggatgat agcgatcaat    355980
     cttgtacata gtcttgtagc ccatgggggt agagaccatt ctaagaaacc ttctgaaaca    356040
     atttgaccgg ctaaagtaca gataatacct gcagactgcc ctgagaacaa cattgcagca    356100
     gcaaagatga ggcccgccgc tggtgagatg tagtggacta gcaagttata aatagacaat    356160
     aaatcagcat cttcagcttc aggctgacca gctagtgttg caccagcaac aattagaata    356220
     gctgagttaa caaatgtggc tattaggaac aaggaaataa ttaattcagc gtaagagtag    356280
     ttcaaagagt atttgatagc acttagactt ggtgaagatc cgactttacc atatttcttg    356340
     atgtcgtagt cgtaaagtct tggtttaacc aaggaggatc ccaagtaaag agaatgtggc    356400
     ataacggtag cacctaatat acctagagat atgtataaag cttgcttttc tttgaaaatt    356460
     attgatgttg gcataaagcc ctcgaataat tctctcttgt ttgggatatt gattttgaac    356520
     aactcaagta caaagcataa cactgtgcag atgaccagaa cacccacaaa caattcaaac    356580
     atccttactt tcttcatgga ctggccatct ggtctgtaga acatcaatat tagcagcaca    356640
     tcaagcacag tcaggatcac acctaatgtt aggggtatat tgaacaatat ctgtagagca    356700
     atagccgtac ccaccacttc ggccagatct gttgcaatga tagcgatctc agcaaagaaa    356760
     tatagcacat agttcacctt ctttggaagg tttctgcgac aattctccgc taagtcatag    356820
     cctgtcacag tccctaactt aacacaaagg cattgtagaa gaactgcaaa gatattagac    356880
     acaaatatgg agaacagtag cttatatttg tactgagcac caccagagac actggtagag    356940
     taattaccgg gatccatgta ggccacactg accatgatgc cgggacccac gaacgtggcg    357000
     aacttcttaa gtatatctat agtccttgga agcatgttgc agttcggcca tatattgaaa    357060
     tatatgctaa aaacaccagt atgtatatta taaatccggg gtttaagaat atattaagct    357120
     caacaaccaa tgcgtattaa tatatatatg ccaaactagc acaataagaa aaaggtgtct    357180
     gagaaagccc acctggaggg gtgtctggac tcatctcgtc tacaagagca aatataaaat    357240
     tctaacctgt gtggacttag taaaaatacg tcaatccaaa aagcaaatga gaagaactca    357300
     agagctcatc tctcccagca aagttctttt gacaaaatgt catgtaatag atcaaaagat    357360
     attgatgaga aaaaaaagaa atgaatttgg aaaaaaattt tagtgtgatt gcaactgcaa    357420
     gatcacactg atcaccaagc atgaactaag aacttcagaa cccaatattt acgggtggcc    357480
     cattaagctt gcgcattgcc cttatctgct ttctatgttt atattccggt ttatacagga    357540
     acgggtgtgt cctgtcctta ggtatggttc tgtgagaatc gaaaagtaca tgggattcca    357600
     tatacatgtt ttcttgttta tgtcaataaa gagcaggttt atttaccttt tacaagcttt    357660
     tgccagcctt gcgaagtttc ttcgagatcg acttcttcaa actgtttgga ttttatatac    357720
     tgtaagactc tgtctttgaa tggtgcttga tcaaaatctg acatagttgg ttgtggattt    357780
     ggtttatata ttgcatttgt tgttaatcgt gtggtgtact cagaaaacat ccttagtttc    357840
     ctcttggctt cattggtctt aacccgcttg tgaacaggtg ctatattcat tgatgtatgc    357900
     ggtctcttca catgcatgtc ttgcggtctt atggtttgat tactgatgtc gtgtacattt    357960
     gatgccccta aatcactcaa tccggacttg tgtgtattat aaggatattc aaaagtattc    358020
     tccttgtctt tatcgatagt ggctaagttc gagctgattg gttcatgcgg ttcctcttta    358080
     acttgcacta cagtatcttt tacgttactc gccaattctg agttatatgg tttcggtttc    358140
     gtattttctc gcctagcatc gtattcatgc cccacatgtg tcattgagtt tctgaatgtg    358200
     ttctgttgag tgttgacttg atcggatgaa tttaaattat cttgattaat tccatgagac    358260
     aattttgtcg tattatcaaa atgagagttt gaactatcat tgggcaaatt atgtatctga    358320
     ctattcgaaa ttccagttct gtttacttct gagattgatt tgaaacccat attagtagag    358380
     tccgcttcat aagtgattct gggctcagaa ttatttccgt tctccgattc aataatggct    358440
     tcagttatgt tcttactagt tggagttaaa atcggcatgg ttgattgatc tacaggttca    358500
     tcacaagatt cgttatgctc cagcataact gatgtattag ctgcaaattg tttgaatgat    358560
     ggactgtttg taatggatac tgttggatta atgttgagtt tctctcgtaa atatagttca    358620
     attatgttat ccattttctg aatcactttg gtttcgtctt tcagtaatat atcatccttt    358680
     tcaggctcaa tgttcacatc aatcaattgt ggttcgctga taatgttcac ataccataca    358740
     ttgggttcta gtaattgtag tctcctgtat attgaggata acattctatc aaactcttta    358800
     ccaaaagcta attttctaga taatgccctg ttatttacag atagaaattt atagcttttc    358860
     tttacgttga cagcatctga ttgggggatc atagttggca gaatgagttg gatatctatc    358920
     ttgtctgtaa tttccagtga tgcgttctcg acaaagttaa tatttgtagg ttttcttaaa    358980
     tttgctatca gagacaaaag cctcggtctt gttagattag gtgctactga taattgtaat    359040
     tgtttttgag ctatggagcc atttttattt aatgagacca attcaaaact aaaccttata    359100
     tttctgaagt taagcgcata gtggtataaa atagtcttca aatcctctat cgttttcctg    359160
     gctttacttg attgatcaat ttctcttgac ttgaaccctc ccaacagctt acgcagtgta    359220
     acaactgttc ccgttgtggc aggtgctttt ctgacactct taggttttat agagccattt    359280
     ttctggatat accatttttc accaacactc tcatccttac atttcgtaat tatctccaat    359340
     gtgcccactt cacaacataa attggctatt aaaaataatg cttctcctct gaaacccaag    359400
     gtacttatct tgtctaaatc gtcaaggctg tttatctttg acgttgtatt gttgagacac    359460
     atcagctttc tatctggctg tggcacccca ggaccatcat ctctaacact aatgtattca    359520
     catcctcctg tcttagaatc aattgaaaca taaatattct ggcacccgga atctatacta    359580
     ttatcaataa gttctcgtac agcggctttg ggctcgacta taaatgaact ggcaaaaatc    359640
     ttccatttct catcggctat tattccctta attggcatct tccaacttcc ttaatgaacc    359700
     ttgtccagtc gttcctgatt tgatccaatt atataacaac tatcacatgt gaagaatgct    359760
     cgaggatatt gcaagaatat tgcaacagtt agatagtggg atcaattcct ctaacactat    359820
     cagatcatat aaactatgcc tgtttcttat gtttctgctt agttaactta aactttgttt    359880
     atttacaatt ttatatacag gcccttttct tgttcaatag ctcatcgcta cctgaaacct    359940
     tcggacgtgc tgcgtaaaat aaatatctag taccaaaata taaaatcctc aaaggtaaca    360000
     caaaaaaata gacataccta caatataata gcattgtaat aaattctcag caacgatatt    360060
     agtcaactat aataatgaat aacacctatg gtttcatcat gttattaatt gttttaattt    360120
     aattttggca aaaaaaataa tggacgcaac cggaatcgaa ccgatgacct cttccttgca    360180
     agggaagcgc gctaccaact gcgccatgtg cccagataaa ctgtgaaatc ttttaccggc    360240
     aaagtcagta catattgtag tattccccag gtcgtttgtg aacagccacc ataacaatgc    360300
     tatacttatt ggaactaata gtcatctggt gttactgcct agcaatcaac caactattat    360360
     tattattaaa attgtaccag ttggtgtgta ttgttctttg tttgaaagca taatcgaaac    360420
     gaattcaaga tgaccaacca tgtgccatca ttactttaat gagaataata tatattatat    360480
     taatatgaat ataagaataa aaaataagtt aaaaaagtat gtcagtgtat gtttttgttt    360540
     atgtgaccgt aatatgcacc aactacatcc ctataattgg aacatttccc ttattagtca    360600
     agggaatttc aataaaaaca cagagttggt agtgaaatga aatgaataat atcaatcttt    360660
     ttgatttgct tgttatattt agccaacaac attcattttt tatgttcatt agacgaatca    360720
     taacttttga taaatagaat aaaaagaagt ggtataaaat caaactatta ccaatcttct    360780
     atttgctctc ttctggacta atgtcaccgg caaagatacc tttctctctt tggtcatccc    360840
     atttctcaac ccattcgaca ggacatagag aagagtacgt cttccagaac actttgcatg    360900
     gtgcgaaatc ttcacccttc aggttgatac acttgtggta atccacatat gcttgccagc    360960
     agtgtctagt ttggttttgg tttgggaatc ttgggtcgaa accaacagtg tgcaatggtg    361020
     agtcagacat tttcctttag tatgttttat agttgttatt tggtttgttt ccgaaaagta    361080
     ataaactgcc accgaagaaa ttaggcctga atggcaaact gcaacttatg ttttttcttt    361140
     atataaaaat aacactatat aatatctttg ctgcttttcc caaagtccaa agaagagtgt    361200
     gttcgaccta ctaagaagct aaaatcttct gtctgtcatt ggctctcatc ggaactacga    361260
     aaccactatc ccccttcctc gagccaattg tattccaact tttttgcttt gtttgcccat    361320
     tattcccact ctacaatagt aacttccctc tcatcaccga agagaaatgt gaagaagggg    361380
     gtgggggaag ccaacgcagg atcagtaaca atctcttgtc tacagaaagc accaagtaaa    361440
     ttctgtagat tatcattcca tatcgcaagg gaatatcggt atatgaagtc ttccttctat    361500
     ggtttctgca taacacaatc ttttaaaggg tttctcgaac actattggcc gaaagtcacg    361560
     tgtaactatt aacattgtta gttctttcag tcgtatgctg cactgctgca cctatccaat    361620
     tgttaataga ttgctaatag cttgccaatt accataccat acatatatta cttaaccata    361680
     tattaatcaa actaaatggc atattaaaca gatgttatgt cacagactta cttaggatta    361740
     cttttttttt ctatgtatta ctgtaatttc atgatcttta tattttaaca aacgcattaa    361800
     ttatttttta tgtattgaat gtttttaata atcagctctt cagaatgatc tgagtggcct    361860
     tttccattag gtttgtattg ttttctttat ccaaagcctt taacagtctt accaactgaa    361920
     gacataattc ccactcttct gatgctttaa tagcgttact tgagcttgct gaagactcta    361980
     ccaggtgttt taggacttta aacatcagct cttcatcctt taacacatca tccattgtcg    362040
     ggttatgtag ctcaacaggt ttctcttctt gtatgtcacc tagtacttca gtctcaccgt    362100
     aatttaagaa cactaataat aagaccccaa gcattttcga ctccctgtta tcaatacata    362160
     atgccaacag ctctcttgga gacatgctta aatcatcgaa taaagttttc cagttcttca    362220
     tttcactctt tctgagacaa ttagatataa tttctagcat gtcactgtat cttgatattt    362280
     taccatgacc ggtaggttta tcattaagaa gtttaatcag ttctaatgtt tttgtgatag    362340
     actctccttc catcagtttt atggaaagat tcttctccaa ggcaaattta taatgcttta    362400
     agtttgaaaa ttgcctgcta atatcgtaaa gatcgtctcc tctatcaatc ttcaccgata    362460
     tcagtttatc taggtaacta gaattcttca taatgagttt cgagaggttc ttattaaaca    362520
     cacaatatag cgactgtact atggctgcgt ctgacgagat acatataggg taatgctctt    362580
     catctaattt aatagatagt ataggttttc ggtcttccca aagtccattg atatcataaa    362640
     ttgtaaattt atcttcttga accatatata tatggtgctt cacaacatcg actatctttt    362700
     caacattatc aagtaattga gtggtgtgaa tagtaccatc tgataatttt tctaatctga    362760
     ataacatgtc agatgcatat attatgaaac catccttcca agtactaacc cattccaaag    362820
     ttcttgtagg tagtgagttc gctatttcaa gtgatgagta ttgatggata ttaacaatag    362880
     tatttaaacc tgttaattga accttggaaa ttacatcaaa aactacaata gatgatgaag    362940
     tagaaaggat aatttccgct gttttgaaaa acctgtctga tgaggatagc tctgagctat    363000
     ccagcttttg atttttcatc ttgagatatt tatatttgtg atgggtattt acccagaatt    363060
     tcaatatatc aacattttct ggtatctcat aagcccatat ctctagatct tctaactcat    363120
     aattttcaag tcccttcaaa ggtaagttat agcatttgac actaactgta tctgagttat    363180
     attctttcaa gtggcatact agatagttgt tggcaatcca gtgcatatca ataatgtgta    363240
     catctgtaaa ttgataccat agactagttt ctaaattctg tatcaataac gagttcttat    363300
     tagatatgtt aattgctacc aacttaagat ttgagtttaa tttgatatgt gaaatgttat    363360
     tgttcagtga tttagttggg agttttaatg attgtaattg aatgcgattt agtggcgaat    363420
     ctccagatga agagtagaat ttgatatcat tgttgttatt agcaatagct gacacctttg    363480
     ggactcggaa gtcaaatgta gattgtggaa actcttgcca aaagttccat atttgataat    363540
     atcctgattc acaggttgtg atcaatgttt tgtcaatata gactaacgcc gtgtaattta    363600
     atgtgtcgtt atgaatctta ttagaggagc tatcatcctc ggatattgtt gaaaaaagct    363660
     tattaccaaa cttactacaa atttcaagtc tatcattttc agttattatg acaaaacatt    363720
     catctgtcaa tttttctgca agctttatac tgaaatcaaa tttgcgatgg tatgtaaatt    363780
     gattcttttc tgtacaaaag aaattaactg aatcttttgt agatacaagc atcctagagc    363840
     ctattgaaaa tgcattaact aattcagaat tgcaatcatg ctcagttttc tcgagcactt    363900
     tttgttcatt gagatcgatt agatgaatta tcagtttttt agtttcttta tcctgagaga    363960
     taacgtagag tttattatcg catatacata tcttctttga atttgcaatt tctaccactt    364020
     gagaactatt aaatttaaaa tcctgtagct tcaataattg aattttatcc gcaaagagca    364080
     ctaaaagatt ttcttcaaac ttcccatcat cttcatcaga gaatctcttg aacccaataa    364140
     aatcaattat gtcatactca aatttgaaga caactttcag cctcaactcc aatttcttga    364200
     tcggtatttc gtttggatcc tctgatttcg ccgaaagaaa ttgcaatata cctctatcct    364260
     tatttaaaac atatccgttt tgtatcactt ttgatgattt gactttgtcg aacactgtta    364320
     aaacatcgtc atctaagttt gcatcgtatg ctgcagattc aaattcgtta atttgtgaca    364380
     cctcgattat cggcaaacca taatctttga atatagattc actagttgaa tttcttaaaa    364440
     cttggtaagc taaaacataa ttcttagtag ttgttgtata aaagactaat ttgccttggt    364500
     accatgacat ataagttggt ggtttgctat cagttacacc agatacctta tctctgaatg    364560
     caatggatgg cacaagcccc ttattatctc caaattctgc tagagactct gaagttcttt    364620
     catgagctgc tactaacgca aaaggcttaa aattgtacac caatactctg gtttttgtaa    364680
     ttataatgac aacattcgag tgagtaagtg gtattgttgc caaaatatcc aagtcatcat    364740
     caattttatc tctctcagaa cacctaggtg gtatgcagaa gtgattgggt ggggatactg    364800
     gccacaattg catttctacc tgttatgtag tttgaacaat ttcaacgctc aaaattagaa    364860
     tataacacca aaagatacca ggaatttcac gcactaatta acggtactag tgcaatacaa    364920
     taagtttata ccaatcaaat aaggtctacc aaaaggctac taataggatc tccagaatac    364980
     ttaaaacctt cttaccttta acgttacaaa agaatatatc agttgttgtt tcctaattga    365040
     agcccttaaa ttttcacaca atttaaagct gagcgatgag ctgttctagt gagctaaaag    365100
     aaagtggttg tgagattgtc cagtaactat agagttaaaa agcctattaa atcaaaaacc    365160
     atacataata atagtatcca catgtaatta gataccaggt aagtgctggc tgccgctttt    365220
     gctgccttgg ttatgtcttt attggacaac gtaacacttg aaactacaga ggttagaagc    365280
     gatacagtag gtgcgtctgt ggtagatgtg tagaggtcta atgtcggagt acttaagaaa    365340
     tcaccaggca ataccatatc agtaatacca ccctcagaca acaaagatga gtaccaggga    365400
     aagactgtta tgaaggattt gaatatcgta aacgggaatt ggttaatgat gtctgatttt    365460
     aagtcatatt catctacacc gtttaagtgg tagtagtaat tagcaacttc ctgaggtaat    365520
     gtatgatgtt cccttatcat ataagaagtg tattctgtat atcgttcatt aaaatcatct    365580
     aaaaacgcca ggaagaaact catgtcagca tcagcagcca tggactttgc atcttcaaca    365640
     acagcaaaaa ctcctattgt taacgtaact acattagcga ataaagcata tctcattttg    365700
     gtatgatgat ttatcgcttt cgctatatca ttatcatgct tctaaaaagg aactctattc    365760
     aagtaattaa agcgaaacca attgggatta gacaagagta agacttcatt actgattacc    365820
     cattatatat attttaaacc tttcttggta acgccaagcc tcaaatggat gcaacttgaa    365880
     tcatcattaa aagcacctaa tagtatttgc ctaatttggt caacaatgag gtctaacctc    365940
     aatagttatt tttcaatgag ctgtattttt atttatacag tatattagtt tacaatgcag    366000
     ttatttatgg ggaatattac cttggaagtg agtgtgatgg agttcatcta atactttttt    366060
     tgtctatgca gcttaattaa cgataatact tgacagtttc cctaattgtc atgtaataat    366120
     aagattcaga gttgataaaa gatgcgcctc atttgataga tatgatcatg ctgataatta    366180
     ttgaattcat taatagatat ttgtctgtga gaggaataca tcaaaagtca cctgtgattt    366240
     aatatcgaca aagcatgcag aaagtttggt aaaagttttg tatgcagaat taagtcaata    366300
     gtgatacaag agccgataga agaatagaga ttcctggcgc tagtgcagat ccagcaccct    366360
     tgtaagtgct tcctctagcc aatgacttgc tgacagcgct gatctgctta ctgtattccg    366420
     gatcattagg catgctagag gtagaagaag aagatgccga ggttacacta gactgagatg    366480
     ttgttatgct tgtagaggat gaaggaacca ccgaggttgt agaaagagta gtttctagtt    366540
     ctttttgtct atcagaagag tatgcttctt ctagcacaac tgaggtggcg gcacttccaa    366600
     aaaggtcatc agttccagtt gtagttttct gtagtgccgt ttgcaacccc ccaccattca    366660
     aaaattgcga tagatcagag gactcatctc cagtgttata ttgagattcc gtgtctgcgg    366720
     tgtagcttga aatcaaggag gaaggtaaga acagaacact accgcttaca gcagcggagc    366780
     cggcagttgc cacatcgcta ccatcattgt tgttattgtt attgttcaag gcgagcaaac    366840
     cattgtttac gttattcgga cggtatggta cattaccact tcttgctaga gttcctgtga    366900
     taaaaagtag aatttgaaag atgcaaataa acatgatcag atgttagtat ttggttgtct    366960
     ctactaactg aagaaatacg atcacctctg aacaatacgg agcgaccgat atcaaaaaca    367020
     gagtttgagg gagtaaactt ttaatattga atacacttca ggaaatggtt gaaagtgtgt    367080
     ggatagtagg aattcaggaa aatcaatgct agccaacttg aatatcagaa gcttttatag    367140
     gaaatttttt tgaaatctgc cgatggaatt gtaacagccg caataataca acaatgacag    367200
     gagaaaacta aaaaagatag acaactatat aaaaatagag aagtccagac aatatagttt    367260
     tcatactatg aagataaatt tttgcaaact acattgcatg caccacaaag atagagctcc    367320
     aacaattagg attttgaagt ttgattcgag gacatactca aaacataaga tcccaccgga    367380
     acactaaggg aaagaatact aaagtaccct acaatgatgt gcaacagaag tcactggatc    367440
     agtatttgtt cctcatcgcc aaaatttttt caagaaaaat tctgtgctat aaaagtggaa    367500
     gttgactttc cactttcaac agtctgaaag ggaaaaagaa aaaagataac tctcatgaac    367560
     ttctatgtat gtaacaacag ttctacaata acaacagaca taggagcaga gtcctataag    367620
     aaggtctcga cacattcaga gatccgatat aaaagcagta ctatcagttt cacatatgac    367680
     gtcttctcag caattagata ctatattatg tctttgactc atactgataa caactcttct    367740
     cacacatttc ttgtaaacta tgccgaggca tctgagtact aatcgttgag cccttaggaa    367800
     agcattcgtg ctccctcgga ccaaatattc aaatggtaga gcacctacac ttttccacta    367860
     ctcttttcga gtttagagac cctctcgcag gtgataccat cactatcgcc tccacacaaa    367920
     tttagtatct tgtagcaaac tcatcatcaa ttctcctata ggcgatgagc tggtctttgc    367980
     cagttggcca atattctttc cactacgaag tgatatttta tttcatctaa ggtgcaatgc    368040
     cgctaataaa ctgcagtaca aaaaaccgta tatctgttta caagatttat tttcgcattt    368100
     ttccgggtcg tactgaggag ctccactacc acttctagtg cagctcagga acatccgtac    368160
     gcgggctctt cgcctttgtt atgaactcaa tctgaaatgg aaaaagctac ttctcgatcg    368220
     atatctaagg agaattacgc caagaaggag ccgcacagaa tatgttacaa caatataaaa    368280
     atcgggatta aaaacgcacg gaagatctca ccagccatac gtttctttct ttttcttatt    368340
     tgttttgcat tcattgtttc agttgtgcag atgtttctaa gtaacacgct tgatatatta    368400
     gttcgtttct tttttttgct ttttgttgtt gttgttttcc ttcaattcat tactctccta    368460
     ggggacatat actccggaaa aaccaagaat cgctgatacc aatcccgttt taattaatga    368520
     tgaaccacta ttgatctgtt caaaaccttg ttcaggtaat acagtataag cgctgtagta    368580
     aatggaactt agtttcctta ctgccatttg tgcgcttgtt actgagcgtt ttgttttttc    368640
     cttttatttt tttcgcttcg cttagatctt tgctgagagt tcgatgctct tcccattgca    368700
     agtggtaaaa gagaagaatg ccgtagcaac aatagtctgg tacattagtt tctatggatc    368760
     tacagttcct ttacccacca ccattaattt gaacaatgac gtagtccttc acttttatct    368820
     acagccctga acgatcctcg tcggtgggct aagcatcgct gtttctaaat ataacctgtt    368880
     agtaataacc agtcaagagc ttgcttacgg tgttatgcaa gggattcact cgtaatgacc    368940
     cggccaccca ggtactggaa tttacctctc atatacttga catggatgga agtaacaaat    369000
     atatcgaatt cgagactcaa tttctcccaa agtccgacag cgaatgacgt tgtttcctcg    369060
     aatagttgtc taatgaatct atatttagat gagtcgcgcg cgcccccttt aaattgtatg    369120
     ccattttatg catttcgcat ggtttcgcag aaaatgaaag gtaacttaca ccaacgcgaa    369180
     atcagtctat gataagactt taccctatta aaaaaaaggc agagcgtttc tttgaacatc    369240
     ggctataaaa catctttatt tgaaactgta aataactaaa cagaaaacta gagtagctaa    369300
     gataaatgct aaaaatactt atctctaaca caagaaaagt aacgaaatga atttttgaaa    369360
     agttaatcct catctacaaa attgcttata gggtgcgaat agtttacacg gacaagtact    369420
     tctccattat actatttgct agctccaagt taccactttc ctggtatatt aacattgaat    369480
     tataagctgc atgcttcttc aaagcaccgt cctcgtaact gtccagcacc ttcttgtagt    369540
     attctatagc ttttgaaaca agaccaatca tgtggtaagc gcgacccatg ttatagtccg    369600
     cttcctgtct ttcaattctg gtatacatag attgccttat gctatagtat ttcttcaggt    369660
     agcgcaaccc gtgcattaat tggaaatgtc tattagcagt caacctctgc attgacctgt    369720
     gcatatgtgc tagccccatc attaaattaa ccatcggatc atcaggcata tctttctcca    369780
     agaatgacag atactgtaag gcagataaga aacctctgct actatacagc aatacagcat    369840
     agatataata cagataagga gatggcctcc tctccggatt ttcaacttct ttgttggtta    369900
     atgaagcctg tccagtaaca tgagtgtcat atcttatgct atcgaaggct ttcaattgtc    369960
     ttagaaaaaa cttttgctgg actgttgaac ttaaaatgtt caatgcatcc tgaccatgtg    370020
     ccaaagaata catgaaaact tgtaacactt tcctattaaa ttgaaattga tttaataaac    370080
     cacgcaatga ctctgtcagt tccgattcgt ctttattctc caaaagaatt cccagtttta    370140
     caaatctcat tatcttggca cgaataggat cttgaaagaa tacgttaact tcctgagcag    370200
     tatcgataac actgagccca tcttctacgc tttgatgttt tgttattaca agagaaagtt    370260
     ccataaacaa ttcaaaccac tgatcgtatg ttaaacctct cagctcagta gtagaagata    370320
     agatgactct ttcttccagt actggtaaat cattgacaaa tgattctccc tctactaact    370380
     tagaaagttg ttctacttta taatcaatag gcgtggtaaa ttttttcgtc ctttttataa    370440
     taccaacaaa tttctttgat ctacttttag caaaaaagtt tttgacacta gaaaatatat    370500
     caattagttc cgaaacaata tcaatccatt ttttagtgtc ttgatctgat cccattaaca    370560
     taccttcctt atactcatgt accttttcat atttctttat aacttttgat ctcatcttct    370620
     tttcacgatc aagcctttca cgctctgcat ccaaaggtgt tctctttttc tttgtattaa    370680
     aaactctgta tttactgtct tccagaagtg gcttttctga tgtatcctta tctaccctct    370740
     gttcatgctc tgattcatgc tctggctctg gttctggttc cgtctcactg acaaattctt    370800
     ctatacgtgg ctttttagtt gggccttgat catatataga ctctgcctga cgttttcttt    370860
     cttcaataac atcaactagc aactggcgaa aggtagtttt gtcacccaaa tagtaattga    370920
     tttctgcaac attcaatttt gcgtccatcg acttgggatc catttccaga actttatcac    370980
     catactcttt agctttttcg tagtcttcta tctctttata acatttagtg agcggctcgt    371040
     acaactcgat tgtacaccac tcaggaattg acagtaatgg agtaaaaaag tcaatggcct    371100
     ctttatactt ctctgacttc gtcagtgcca gcccaacttc aaagtataaa tctgatacat    371160
     cagaaaacgg ctcgtcataa agaaattgaa agtgattaag agcttccatg acattctcat    371220
     ttcgtaggtg caaaagacct aaacgaatcc taatatcaat tggcattgag tatgactttg    371280
     tcttctccga ttctggtaat gcatcatatc taccattctt tgctctccta tcatcaaatt    371340
     cagagtcatc gtgtacatca tcccaaaaag tctgaccctc tctatgctga atccacctag    371400
     cacaccgttt aatcaatgat atactatcaa gctttttctg attgcttttt agacaaagtt    371460
     ctgctaaaat attcaaactc gaccactcaa agaacacgca attatatttc ttgttaattt    371520
     ttttaaaatc aacagttgga tacatattca gttcctctgg attttgtata tcataatcgt    371580
     cctcatctcc ttggtcttca tccgagtttt tagaatttgg atcatcatcg tcatcgtcat    371640
     ctgaagactc aaacactgct tctgatgctc taattattgc ctgtcgcctt ttaatattct    371700
     tttcaaaact ttcaagatag agctcaatag ctttctcaac cttgttatag tctacatata    371760
     aaatagcaag ttctctcaaa atattagcat ctgacggact cttagtgtac atcttctgga    371820
     agccatccaa cgctcttgca atttgaccag tttgcttgta aagcaaagct ctcctataaa    371880
     tacattccca ttcttctttg tttaagtgga ttacccttga gaaacaataa attgcctgtc    371940
     tgatgtgtcc aagatctgaa gataagatag ctacaatttt ccaaaactcc caatcagaag    372000
     cattcaagtg tgctgctaaa aaccatgaat tacagcaatc attcattctt ccttgtagct    372060
     ggtaaatatc acccagtgtc tcgtatgctg cgaaatttct agggtctttt ttgatcactt    372120
     cattgaagag gcgctctgcc tcaggcagat cctgtttaac aaaagcttca ttggcttgag    372180
     aaataagctg agcaacttcc ggatcattaa tggctttgac acgagccatt ggccttttct    372240
     tactactttt cttattgtta cttttattgt tcttcttccg cttgacttta aaattatttg    372300
     cttctctaat tgcatccata aaattatctt cctcgtcttc ctcatcttct tcaaagtcct    372360
     caacatcggt aaagatcgcc aacaaagagt catctccttc tttgctacca tcatacactt    372420
     cgccatcatt gattctataa gcaccgtccc ggtcgtgatc ataatcaatt atattcctca    372480
     gcccttcaat attttcataa aactgacctt cttcatcggg actcatatca acttcttcat    372540
     gcatgtcacc atttgataca gaatcctcag gatcactctc actcctgatc atttgtaacc    372600
     tttttaagta tatattattt gaatcacaaa agttgacgcg cttcaaatgc cttccttgga    372660
     gaccaacagc aaagtacaaa cttacgcaga atttcaaaaa acagaaatag agtataacga    372720
     acaaactata gccagactgg ttactgatag ctgcaactca attggcttta gaatatattt    372780
     caaagtagta tttaacctaa gttcaagatc tagtagatta tagttgcgtt ttttggtctc    372840
     cagctgggtt cgaatggcga atgaagaaga gatatgatgt cacatgacta tatagtataa    372900
     gtactggtat tgcagcttat catatggtat tggcaaagga atagaaagtg ttaatcgtct    372960
     agtagtgtac tctctaatgt atacttctct tcagttctcg cttcactgag gaatttcctg    373020
     tagtaggtcc ttggaaacat atactctggt acaaaatgag gggagaccat ttgctatata    373080
     tatatattgc tagacaggac tacttagttt tctgcttctt gttcgattta cctttcttta    373140
     gtacattcaa ggcatcagtc ttttcatgac cgataatgtt gtgatgccct cttttcttaa    373200
     ctagactgtc tgctaggttt acaagaccac ctgttaagta acttcttctc atatcttttc    373260
     tgataggaat tttcaataga tgtgtcaatt cagctttcat tgatttcagc tcgttcttat    373320
     ccaaagtctt attcattttc ttgttcttgt ttttagctaa aataatatcc ttgtcttctt    373380
     catccgaatc catatctatt cctagctcgt cagctgcctg cttcagccaa ttactgtcct    373440
     tcctcaatga tctagacgcc agctcatgct cggcaatgtc attagccaat gaacttctct    373500
     ccctcaactg ttgtaaaata tctatttcaa ttggaagaag tgggacagtt tgctgccatt    373560
     ttttgttctt agtactcttg cttatttgtt ctttagaagc taacaatctt cttagtttac    373620
     gtaatggtcc catggcttcc tgtggggaac atatcataac cgcaacacct tcgttatcac    373680
     ctcttgctgt tctaccagat ctatggatgt acgtgtctgc agaatgtggc aagtggtagt    373740
     gaacgacatg cttaataccc ttaatatcta aacctctggc agcaacatca ctggcaataa    373800
     gcacagtggg tttgcctaaa tggttgtttt tcgaagccat tgcttcaaat ttctctaagt    373860
     tctttaaacg attcttctga gtcatagaag aatgtatttg gaaagagttg attcctaggt    373920
     taatcaggta tgcatttaat ttcttgacag attcaataga gttacagaat ataagtgttg    373980
     taccaggata cagtgtaaca aaatagtaac agtataagtc tcgctctagt ggtgcacact    374040
     cgatcaagga ctccttgatc tgtgcactta tcttatcttc tgggttagca tctatcatca    374100
     ttggcttaga cttgaagtta atcttcgtca ttagatgttt caagactgac tccatctctg    374160
     attcatcctt gctgttattt ttcttcttcc atgaactgtt cgccaattta tcgaatagat    374220
     cagttgagaa tgtggcggag tatatcagag tttgccaata ctccatattt ttcaaggact    374280
     tacgtattct tcccaaatgc tttaagattt tctcaaattc atcaaagtga ccatcctgta    374340
     acaacctatc agcttcatca agtacaagaa cgtcaatctt cgcaaacctt ttcatgagct    374400
     cctcattctt ctcaatcagt tctaagaatc gaccaggcgt agccaccacg atcctggcac    374460
     tgccatcgta tttcagtaat ctttcctgct tctgtatgga taaaccaccg gttagcgata    374520
     atatcatgta tggattcttc tttagtagca tgctgcaaac gttttgtaag tgcttagtca    374580
     cttgttgagc cagttctcta gtaggagtaa agataatacc attagttctt aaattgtcct    374640
     ttgatttgat catcttctcg atgatgggta taccgtacgc aagagtttta ccggaacccg    374700
     tcgaggcttt acccatgata tccttacctt ctaaggcagc tggtatactg agcttttgaa    374760
     ttggagtcat ctctgtaaag cctaggttgg ataaaccgtt tatggtagtc attgacagat    374820
     caacagtatc agtccaccct ggtaattccc cagacccaac atctgaaaga tcgacatcga    374880
     tatcaaatac attagtagcc aagtcatctt ctggagtctc cttctcatct tcatgttttt    374940
     cactgtccac tcctttatct atttgttcca ctctagcttg ttcttgtttt tgtttcactt    375000
     ccggttcatc tgcctctgca acatcttctt cttcttcttc ctcttcttct gcttcctcta    375060
     catcgccatc gtcttcttgt tccatggcat caaagtctgg aaagtcgctc tctgagctct    375120
     cctcctcctc cttcacctgt gcttcagaag caatgaactg cacttgccca ttgaccacct    375180
     tgacgtcaac accatcgatc tcttccagcc cgtagaaccc accaaagtca tccagagtgt    375240
     ctggaatatc aactttcttc cacttcagct ccttatccgt agcaactacc cgcttaccca    375300
     tcgtaaatca gcttgctgtt ctgatcctct cgaccccaaa aagacctatc ctaaagtaat    375360
     cacaccgcta tatacaagct catcgcaagc tcatcgcaaa ttttttgaaa tttttcagaa    375420
     atttttcagt ttctccttct ccgtacgaca gtttctgagg aaatttcatc aaatctccag    375480
     aacattttgc ccaaatagcc caagttgcga tgagctagca tattcagctc agtatattgc    375540
     cattgtgcta tctctctaac tcataagcta tgtggcacaa ctccagagga aataactctt    375600
     gctggtaaga tgttgtctag gaagagggta agcattagtg gtaagaaacc gttgaaggag    375660
     gtgcggatca agcccagcaa agcgaggaga atcatcagga ggttccattt cctgactagt    375720
     aagcgggccc ttatatgtga gttgttggag ctagagcggc tgcgagacaa tgatgaggag    375780
     tataactcgc gtgtgataga tgcctatttg ggcggcaagt tgctgcggaa gcggtatgaa    375840
     gaagggcagg ccgttgcagc tcaggacgga atgatggagt cccgactgtt gcagataagg    375900
     tcacactctg ataagcctgc gaaggaggag ctgttgcgct gtttggggta tatccagcgg    375960
     gagatacggg atggtgggtt gaagaactat cagatggcta gcaaaatcgg gcaagataag    376020
     gatcgcggcg gtgattcttc gaagctgctg gtgaaatggc tcaaagagtt gaattatgat    376080
     cagcacaccg agctacgtgc attggagatc ggctccctga gtgtatcgaa tcacatatcc    376140
     cgttgtaaga tatttgagga agttgaaagg atagacctca atagtaatga tcctaaggga    376200
     ataaaaagac aagacttcat gaagaggccg ctaccgagga cgggtgagga gaagttccat    376260
     ctgatatcat gttccttagt gctaaacttt gtgaatacac ctgcggaacg tggacaaatg    376320
     tgccaacggt tctccgaatt cctgttccct cccactagcg atgtaccttc gtatgtattt    376380
     gtggtgttgc ccctcccatg cgtgaataac tcacggtata tgacaatcga ccacttcact    376440
     atgattatgg actccctagg ctatgaattg atacgttcac atacatcaca caagctcttc    376500
     tactgcctgt tgagactatc gcatcgagag tccaagcgca agttccagaa gaaagagata    376560
     aacccagggc ctggacgcaa caacttcgcg attgtcatat aacattcaac cccagcactg    376620
     tacacaggta gcatcagact ttcaccagaa gcattggcca tatccatcat gatttatagc    376680
     caactgaaag tatatagtat atatatataa caaaagagat acacgtgatc atttaacttg    376740
     atgtaactac tatagtcgtc aatgtaatac aatacgacta aggggaatcc acctccagca    376800
     tatgcgtgcg aacaagcagg aaatttggca gcgaaaactg gcaaattggc caacgctctg    376860
     gggaatcaag cataataaga acgagacacg tctagttaat agtcattgtg tgggtagcag    376920
     ccgcccatct gagtcattag ccgctgaagt acgcactacg gaccgacagg gatttccttg    376980
     aagacgagag atacgtggag aaacttcatt tggttgttga aaggataaga actgagtgat    377040
     aaaattgaat aatttctacc ccccaggatc taataatttt tggtttggga cgctatttct    377100
     gatccttcag tgaatctaga aaattaagct tacctattgt aaagggtata ttcttaaagt    377160
     gcacaagata agtccttgca ccgctttact tttttggata gggctgctat cacaccatcc    377220
     gtaagcgaaa ggaagatatc tggaataggt cgcaatggct gaaaatagaa gtggtagtaa    377280
     tagggatgcg tccatgcttg atgtgtctga tgcaagtcat caggatttga ataacaaatc    377340
     tgattcgcta agttacagct tttcgcaaat gaacgtggac agtcccaacg agttggaacc    377400
     acagctaaac acaaggagta gatcgaggtc tacgttgata tttgatgatg atgatgaaat    377460
     acctccatac tcaaagcacc aggagcacta ctctggtact ttgtctgatt tcgaaggcga    377520
     gaatagtagt gtagcaagta gcatagatag cgcagagaat acttcagagt ctaatactgt    377580
     ctttaacaac gccactagta cggataacac agataacaca gcaagttcac aatcaggtac    377640
     agcctctcaa caatcacagt ctgcaatgaa ccaatcaggt caattcgatt ccgattctag    377700
     tggctctagg gatccaagag cttctaatat ggtcccagtc gatataacct ggcagcaagg    377760
     tggtaacaaa gtatatgtca ctggttcttt cacaggttgg aggaaaatga taggtttagt    377820
     accaatgcct gatcaaccaa atgtactgca cgtcaaatta cagttacctc caggtacgca    377880
     cagatttagg tttattgtcg ataatgagtt gaggtttagt gatttccttc caacggctac    377940
     agaccaaatg ggtaactttg tcaactatct ggagattgcg cccgttgcag gtactgatga    378000
     aaaaccacct ccattaaccc cacaagtgtc aggtaagtca ggtgatgaaa ggaaagagcc    378060
     tatgagtgct agatcaagga ttgcgcttga aatagaaaga gaaccagatg atttaggtaa    378120
     tgggtatagt cgtttccatg atacctcgcc actggagaca aagtatgaat atactcagga    378180
     tattcctgct gtcttcacgg atcctaatgt catggagcag tactacctga ctctagatca    378240
     acaaaagaac aaccaccaaa acatggcctg gctaactcca ccacagttac ccccacatct    378300
     cgagaatgtt attctgaata gctactctaa tgcgcaaggt gaatctaacg aaaataactc    378360
     aggtgctttg cctataccaa atcatgtgat attaaatcat ttagccacca gtagtattaa    378420
     gcacaacact ctttgtgttg cttcgattgt taggtataaa agaaaatatg ttacacaaat    378480
     actgtatgcg cctctacagt aagagtggat gacaacttcg agacacttat gccattaaga    378540
     cactgtttta caattagaaa tgaggtgaac attatagatc gcttgagata tgtgtattat    378600
     cattacatta gaacctcttt tatagattca ataattttaa tgttttttca tgaatagatc    378660
     tttttttacc ctgcgggtat acaaaatctg caaaatagcg ctaatcttac caatatgtcg    378720
     aacagcctca aatgcttcca gatatttata atgtttagtt ttttcttgtt tatatattta    378780
     tttatacata caaatttatt gttaaggtga atattttaca taattgcaca accaaaaaga    378840
     ttgacaaacg ttcatgacag catcgaatgc tgtttagaag ccagttgctt gagggtgcat    378900
     tgaagagttc atcaacatta gtggctgacc ttccctatca tccgatgtgt tgttcttctt    378960
     agcaaattcc tccgaaagct tttcaacagc tgcattttgt tctttcttca cagagatctc    379020
     gtatggctta atgaaatctt ctagagaatt caaccaggaa acttccaaaa caaaatcata    379080
     ctttatcaaa ttgtaggcag tgtacaacaa tgcaacaaat gcttcacgat tacctgtatc    379140
     gacaaagtag gacaataaat catggacgac cttagtatcc tgggaaatag cagcagtctc    379200
     aatggcctcc ttccatagtc tttgttcctt taggatatct aatgcctttg accacttctt    379260
     atttctacgg tacaatagcg cagcaatctt cttgaagtat atcaagtcgt gtttttccaa    379320
     tctgccagca agttctaatt gatcgaactt gtcataggag tcgacagcat tttgcaaggc    379380
     ttgatgatct tcttcttcga tcatcaaatc atgataagcc ttattaacca cagagttgtt    379440
     cttttgtaga acattgatca agaatggctt gattaaaggt aagttatctg attgtgagaa    379500
     aatcttaaca gtccttggaa tatcaagcct tggagttaaa acggacaata gatcgactaa    379560
     tagagatggg tgctcgttga cgtaaaagtt aattgctttg tagtaaattt caagatttgc    379620
     aaccttaaca ataacttcct tgaagtaagg atgatcaaag ttatcagcag atttttcgat    379680
     catagtcaaa gcagcattgt cccattcatc ataatgagca tacaagaaaa ccaattctct    379740
     ccataggtga gcgtcttcag cagccttgat aacctttgga atgttaattc ttgaccagaa    379800
     taatttaatg tgatcatagg tctttgaagt atcgtacttg gcatacaaaa tagctagctc    379860
     tgtgaacata cccatatggg ctctttccaa acctagacct gcttcgaata aagaaattaa    379920
     ttcttcaaag taaccattcg actcatactt ttcgacaagc tcgtcaagct cttcagcgtg    379980
     aattattaag tttagaccac aaatttgggc aagtctgaat tccttcttgt caatacatgc    380040
     gttgttcact aatttccaga ccttgatgtt ggatgccttt ctagcagtgt ctacagcagt    380100
     ttggtagtca cccaagtaaa ccaaagttga ggccaatttg gagtagttag aaacactaga    380160
     gtaacacaat ttagctgcct tgtagttctt gctgtcaagc aatttatcac cgacttcttc    380220
     caagttggcg gagtttgaac cagccagcaa gttctcaatt tcatgaagct tattcaattg    380280
     agcataagac agaaccaaag cattatcaat ctttgaagcc ttcaaagtat ctcttgccat    380340
     caacaagtat ggaatcaatt cttcgaactt ttcagcttgt tctgctaaat cgataacatt    380400
     ctcatagtta gatgggtcat ttgctttgat gtaggaatca atagcatcag gaatacgaag    380460
     accatccaat tgcgcagtac ccaattgaga ccatagttct gaagagttaa tcttgtcagc    380520
     atatgtgtag cctctgtcca aagacatgat atcttcaatc aaaaccttta gtgctttaga    380580
     gttcatctca tgcttgtcat agatttcgaa ggcttcttca ttcaaaccat gttcaacaca    380640
     taactgtgcg atctcatcag cgtcataatt ttctagcttt tcgatatatc cagaaacttt    380700
     ggttggctcg tacttgatgg ctgatagcat caacagacct tgcaaagcag tattttcatt    380760
     aaatggagat ggttccaata taattttttc aagcaactcg atcaattcca atttcaatcc    380820
     gttggtcata aaagcttgga cggtcaaaga cactggttct gggtccttta gttctgggat    380880
     accaacagaa atgacagagt caattagttg acgtctatga atgttttcag aatctaacac    380940
     cttgttccac aattcaggat cagaacgctt tagtaggtat ctagcctggt acttgtacat    381000
     agtgttctcg ttagtgattc taatcaaatc gtcatcgttg gaacccttgt cgtaagcaat    381060
     gtaagctaag tatggatctc tcttctcaca gtaacgaccg acatccaaag tatcgtattg    381120
     atcattctcc ttcaagaact tctctggagc gttgttggag tcaatgtaga tcttagccaa    381180
     ggcattgtaa acagcctgtt cctgggtacc ttgagataaa gtttgttcca agtatggcaa    381240
     cagaagcttc aatctgtttc tcttttcgac ttcttcagtc aaatcgttga ttggaacttg    381300
     gccaataaca gattgcaaca agttttgaat gaacttttcg tcgcaatcca tgtcaagcaa    381360
     agcaccaaca acttgtgggg ttttgcttgg gttgacttga gtaacgtaag tttcaatgta    381420
     gttcatgttt tgtgccttgt atagatacaa gatcaactca tgaacaaaat tgtgacgatc    381480
     acacacgata atcagaggta gttgatcttc caagttagct tctttcaaga aattcttaac    381540
     tctttcagca tcataaacat tgttgtctct gacaattctt tcaatctcct tgtattgttt    381600
     catcttagca gcagcctcga tgtatttgta aacaacgtcc ttgtcttcag ttaagttaac    381660
     taaggaagcc aagtagtaat acagaccttc agtagctctg tactcctcga atagcttaat    381720
     tagagtactg gatccgatta gatcggagta ctttgttgca acttgaatga cgatttgaat    381780
     gttgccttgt aagttgtcgt ccattagggc tctcaaacaa gccaaagatt gttcgacgtt    381840
     caacttacca aagtaactga tcaaccagtc aactggtagg ctgcttgtgt ggacaataca    381900
     tctcttggta tccttaagat cggtgtagtt ttccagagct ctctggtaca gaccagcttt    381960
     ttctgctaaa gaagcaatcg ttggcttgtc atagtgagag aagatgttat tgcccaagat    382020
     tgcgtcagca acttgagggg cattcatcaa gttaacttcc aggacacgag tttgcaagtg    382080
     accttggtct ggagtatcac ctttcaaagc atctaacaat agggaagtac cttgctggat    382140
     gtggttttga gagaagaata ggtcagccaa cttttcgatg tcaacttggc tggcagtttc    382200
     tgggttttgc aatagggaga ttgcaaattc agaagctctg tctggggaag ttctaattag    382260
     ttgagaaagc aataccaaaa agtttggttg gtagcttacc ttttgacaat atggaatgat    382320
     cttttcaaat tgttgtagct cagctaagca agagatgacc tttgcatgag cattggctct    382380
     caagtaacaa gccaaagcca aggtggtatc aaatggtttg acaatgtcac caagttcttc    382440
     tgagcactcc aatttgtcct ctttcaacca tttttcaaat agttgctttc tgtcctgttg    382500
     tagcactggt ctggccaact cgatggtttc ttctttgttc aacttaccct tgtctagaag    382560
     agtggagaag taaagcaata taggtgagat ggcacctggt gctgcttgta agttcttcaa    382620
     tctattgatg gtattttggt ttctcagaga agttgaggat gctgcgacct ttgcagcgtt    382680
     ttggtaatcg ccttggttca agagggactc gaattgctta gagaacaggt cgtctgcacc    382740
     tggaaggcca cctctagtgg caactgttag cgctagggag acgttagcca atttgtttag    382800
     gatgtatggc actatctgag tggtgtcgat ctctactgct agcacttggc ctttcttgtt    382860
     tatacaggcg ataccgttct tttggttgta agaagtggaa gtgaagacgg actcggcggt    382920
     aattctgttg acgaacaagt ttgtgcctgt ctccagttca tataagtgaa tgaacccgta    382980
     tttcgttagg atgtagatga taccgtattt ctcggagacc tggacggaca atgggaagtc    383040
     atttgtagcg tctggtggga agaagatatc tgtggttttc ttttggtatt gtacagccaa    383100
     ggaggcatcg tgatctatct caatgattct caattcaccg ttacccgttt gtacgtttct    383160
     gttaccggtg acgaagactt gtactggtgc ggagccgtta ccttctagca gtatcttggt    383220
     gaagatggcg acgtggccgt ctactgcctg ggagatgtta cgttgtttcg agtaaagttg    383280
     gatcttaccg gcgattcttc cgttttcctg caagataccg atgactgcga accagtcctc    383340
     cttctcgttt gagatgaagt tgatgatctg ggtgttgttc aatgactggt gtctctgggt    383400
     caacacctgt ggctttgcag agacgttgcc gtcgaagacg ttacaggtga gtatggagcg    383460
     cgcggtgacg aaacccaagg tgttctcggt gagccacttc cagaagatca ctggctcgtc    383520
     caaggtgaag gacttcagct tggatttggt ctccaagttg aagatctgga cgatggtgcc    383580
     gttggcacgc acagagatca cgttctggga agggtgcatg atcgcggagt caccgcccat    383640
     gttcttcctg gtgacctggt tcccgttcgc caagtcgacg atggccacgg agttcgcgcc    383700
     atcgacagtc tccctaacgg tcacgtagtg gtcactttcg aatgtagttg atctgaagtc    383760
     cagcgactgc ggggagatac ccagcgcggt cagatccgtg agctcggtga actcaattgg    383820
     caaatcactc atatccagtt ggtttctcaa taacaagtgt tcaatgctcc ttcttcctgt    383880
     tctacccttt gcatataaat ctctcaaggc caaacaaaag gggtattttt ttctgatttc    383940
     tttctaaaaa gctctttgct tatgtatatg gactttgttg tggaatagaa tggattgtag    384000
     ggggggaata gacaagtcag ggagtagtgt aatctttcag cggctaagag ttccctcctt    384060
     gcagttttat caatttgcag cccaccactt taaaggtcga ctcgattcga ttcctcgaaa    384120
     ctttttggct cgtcccccct cctcccccct cgtccgtttc gaagaaaagg tctggttgta    384180
     cgtgtatcat gtgtcttagt gatgtgtgat gttatttatt cttatatacg tatatcatat    384240
     gatatacgta taactagata tattgatata ttacagtacg gcataaccac atggtatacg    384300
     tttgcacgta taccccgaga gaaagagagt cattcacttg gaagtgcccc cccccctctt    384360
     tccccacaca gcacatacgt tagtgtgatt tacgtgtttt atttggtcgt acccagtgaa    384420
     tggtctgcac aagcacaagc acaagcacaa gcaagtagtt gtgtacttag acaacaccgt    384480
     acgaaatccc aacacatcct ctcccctccc cccttcatcc ggacacccag aaggggagac    384540
     aagggaaacc ccaaaactcc agccctgagg tgtcacatcc agcgtattac agcgtattac    384600
     agcgtattac agccgtcgct cccccatccc cttagatcgg agttaagaag attggaataa    384660
     cccgggtgga tgaaataatc accgatctct ctcaagtcca aagctcatcg catcgcatta    384720
     caacttcttg acatataaat acggatggca attgtaaccg gggtagtgct ttaccagtaa    384780
     gagaataatc tcaacccaaa acaaaaccaa aaaccataaa tgactaagct atctacagtt    384840
     gaccctaatg cttctgtgct aaacccgcag aggtttatcc agcgggagcg ggagaactgc    384900
     tccattgaca tcgaccaagt gaacactttc ttggagtcgg accccaggtc tagggacctg    384960
     acgcacttga tcgttgacca gctggtcaac gacccgatca tcaaggccga tagcgccact    385020
     tatgaccaga caaagctcac acagagggag gtcacggtca agaagatcgc ccgtatggcg    385080
     ctgtacatgg aacaggacat caagacggtg cgcaagcact tcagagacac agacctgttg    385140
     aagtccctgc aggacttcgg ggacaccacc accccaccgc tgaccaacaa ggacctcgcc    385200
     atcttcgaca agagactctc cttggtcgca aacatggacc cgcagctgtc caccagaata    385260
     ggtgtgcacc tggggctgtt cggaaactgt atcaagggta acggtaccga cgagcagatc    385320
     aagtactggc tgcagaccag gggcgctatc ttgatcaaag gaatctacgg gtgcttcgcc    385380
     atgaccgagc tcggccacgg ctcaaacgtc gcccagctgc agaccaccgc tacgtacgac    385440
     caggagtccg acaccttcat catcaacacc ccagacttgg cagctaccaa gtggtggatc    385500
     ggcggtgccg ctcactccgc aacccacacc gcgtgctacg ctagactact ggtcaacggg    385560
     aaggactacg gtgtcaagac gttcgtcgtg cccctgcgtg acccttcctc attgcaacta    385620
     atgccaggca tcgccatcgg cgacataggc gccaaaatgg gccgtgacgg tatcgacaac    385680
     ggctggatcc agtttagaaa cgtcgtcatc ccaagggagt tcatgctaag cagattcact    385740
     aaagtgcaca gaaacccagg cgcaactcca actgtggagg tagaccctca gcttgaccaa    385800
     atctcaggtt attcagcttt gctaagtggt agagttaaca tggtcatgga ctccttcaga    385860
     ttcggctcaa agttcgctac catcgcaaca cgttacgctg taggcagaca acagttcgct    385920
     gacaaaccag gccaaccaga aaaacaattg atcgactacc cattgcacca ataccgtgtc    385980
     ttacctcaga tcgtgatccc ttacattatt tctccagcgg ccttctcctt gttgaacttc    386040
     tactactcca ctctggatga attgtacgca gcttcttcaa agaatgacaa gagggcattg    386100
     gtcgtggtta gccaaaagct aaagaacttg ttcatcgaca gtgcaagctt gaaagctact    386160
     aacacttggt tagtggccca gttgatcgat gaattaagac aaacttgtgg tggtcacggc    386220
     tactccggtt acaatgcctt cggtaaaggt tacaacgact gggtagtcca atgtacttgg    386280
     gaaggtgaca acaacatctt gtccttgacc tctgcaaagt ctatcttgaa gaagtttgtt    386340
     gattccgcta ctaagggtaa gtacaacaag gaattggaca agagatcctt cagatacttg    386400
     gacccacaat tcatccggaa agtgttcacc tcttcttccg agaacaagtt ggatgacttg    386460
     tacgactaca ccaacatttg ggcagtcgct ctattgaagc ttttgagaca cattgctaag    386520
     caagttgact caaccaagga tctggacggc gcttccaagc tgttagtttt ggtctctaag    386580
     ttccatgctt tatatgtcat gttaaatacc tactatgaaa agttgaactc tccaactgac    386640
     tcatatgtta cttgtccaaa gacgaaggag caattatgga atgtttacaa gttgttctct    386700
     ctatatttca tcgacaagca tgccggtgaa ttccaacaat tcaagatttt gtctccagat    386760
     caaatatctc aagttgttca gccaagacta ttgaaattac taccagagat cagaaaggag    386820
     tgtatctctt taactgactc attcaaatgg ccagacggaa tgttgaacgc tccaattggt    386880
     tattacgatg gtgatatcta tcataactat ttcaatgaag tcgttaagaa taacccagtg    386940
     gagaaagatg gagctggtat cccaccttat cacgagttat tggcaaacat gctaactaga    387000
     ggcgatgaat ttgctaggtt gggtggtgct aataacgctg agatattgtc aaagttgact    387060
     aagtaagcct tgatgtgaag tgagtgaaac tgctgttctt aaccttgtat gcatacttcc    387120
     tcctgggaat tatcccaaaa aaaattggaa attatacttc tattacttcc ctgtttttaa    387180
     atattctatt taaagctgtt tttatagcac tatgtcgtgt catgattaat gataatattc    387240
     gaatacactg aaaatatcta attgcccttt atatttgtac ttatgtataa tatccccaat    387300
     gtctagtcat tctaattagt gattcatgtg ttagataata aaaaagatat aactcctacc    387360
     tttacgaaaa tatcaatatt gctataattt accttgtatg cctgatccta atgattgcaa    387420
     caaaaatgaa caactattag ttctttgctt gatcagatcg tgacctaaac ataaataaag    387480
     taaaaaaaaa aaggaaaaaa aaattgccat ttcctagaat cgaaccaggg tttcatcggc    387540
     cacaacgatg tgtactaacc actatactaa aatggcatat taaatgaact tgttaaggat    387600
     aattgagatc ttgtccatat tctcttgttc attactttaa gagattcaag ccattgggct    387660
     gattatatca gtctattctt tacaatttta gcaaagtaaa gttagttgtt ggaattatta    387720
     gaccaagcac ttcagattga ctctagagaa gtgatataaa tcaaataata aaaaaatgca    387780
     attttgaaat aagctacata aagcagttta tattatctac atggttgaaa tgatgctagt    387840
     attgatttac tttatctatt ttctgaaaaa aatctgtgaa tcgtcctcag accatagctt    387900
     tctgactaga tctaccacac cgttattgct ggtctctaat tcatatatac caaatagacc    387960
     gaacccagtg gcactataca acaaatatat ggccaatttg tgaagtctct tgaacttttc    388020
     cttcggtata taatcaagga ttaggcttgt gaaatggtag tgagtggaga ataggaatag    388080
     tgaactaata gtaaagtcta gcattgggtg cacttcacca gtgtaaatca cagatccaaa    388140
     tgttcccaca gtaagcggta gcaaagtgta gttgatgtat ttatgataat cattttggaa    388200
     cgagtcttca ggttgtgtgg gttgttcaca cttatacatt tgtggacctt tcatctctgc    388260
     gctcaattcc ttatcatggg tctctgtagt gcgaggcgca tctttggcag acgaaacaac    388320
     agaattaaac ctcacatgcg aaatacaacg ccgtaggtaa acgttggcat tgcgtggccc    388380
     catcaaacct aatctcatca tagttctttc tctcttgttg tgtattatat ttcttccaga    388440
     ataaaagtca cgatctccta gacgatcgtg taacagacag ttaagatagc ttgttgagga    388500
     tacctgccac ttgacaattg tatcgtcgcc tcccattcta tacctacaat atactcctga    388560
     ctcacactac cactaattga ttcttctcat cggtacttca tctgatcatt gcgcatatca    388620
     ctatatacaa ataacataat cacatgatat aaccgtataa gagaatcact cgtgttttga    388680
     ctgttgccag atcggcggtt aaattctgtt cttgtttgaa gaagatatgt cattgcgttc    388740
     atagctagaa tatagaataa aaattatatt attagggtaa tagtattgct gagcaaagta    388800
     gagctgggca aattagagct gggcaaagta gagctgcgaa taggggattt ttagaccatg    388860
     ggtttcgtta cctttgtgga gagttacgtc gttgggtctt ctcaggacat cagcacatgg    388920
     tggtatactg attggatagt tgttggctgg aaggctgcta ttattggtgc gtacttagga    388980
     atacatactc tattgaccat gaccaggttg gtgcttcaga ccataatact tacaccacta    389040
     ttcctgaggt gttattcaat ataccggcgg ttttggtggc atgttccctt ttttggaccg    389100
     atactgcttg aggctggctc ctattgtctt actagcatac ccagagtgat taatccgaca    389160
     ttgagtctga tttgcgaaat aattgagatt atattccaaa tacatgtcac tgaactgatg    389220
     tttggacacg agaaggaatc agtaaggatt gtttatggag aagattgcgc tgaggtggat    389280
     ctctttgacg aggagaatca acttatgaca acacttgtac tgagtaatca cagatcatta    389340
     gtcgattatc ttttgattca acatttgttg atgaaaggtg ctaaacagca cactacactt    389400
     agaaagaaag atgtcattta taattacttt aaacaacgga ttcttaaggg aatgcaagta    389460
     caatttctta gttggggtca aatagttaag ttcccgaccc ttttgtttgg cttcaatgtc    389520
     ataaactcag atgagaattg ctttgtaccc agtgatgact tagagacgtt cttgaaatct    389580
     actaatcagt gtatggtcca cttccccgaa accaacatac taacgacgga acttttttta    389640
     gtacagagaa gtataaattc gagcaaaaca tttgctgtaa aatataacaa cttattgaat    389700
     ccaagattca aaacattcgt taatgtgatt gattgctttg caaaatgtac tgagattccc    389760
     aggttaccac atatacctat cgttactgaa acaaaaaagt tcatcaataa aaaattggat    389820
     gatattataa caaattcaaa tggtgatgtt caacaaaacg ctgttgttac gcatataatt    389880
     gcgcattcag atgtgaagtc taatcaagaa tcaaaacccc acaaaaccaa gaaacaacat    389940
     cgagtaagga taaattcaca catctatgat atcaccattg tgtatttaag agttaagtat    390000
     gtgaccaatg ttcatgatca tatagatgga agcatagtac ctcgaagcgg ctaccagctt    390060
     gacgaaatag ctccatcatt actagaattt cttagaccag actctaaagt tgatagagat    390120
     cctattatca cctacgtgaa tatcaaaagg tttgacacag atgctatact atgtttgaaa    390180
     gatcgacatc tcgaaaaatg gttagaagac atttggaagc agaaggatct cgaaatttca    390240
     aaagtcatag aaaaaataac ggtaaattaa caaaaacact ttactgataa aaaattaacg    390300
     tggtccaaaa atttagcctt atcatagcac ttgattcagt catatgtaag gtaaatcata    390360
     tatgattcaa gtaccatgac cttcttggtt ttcatggtga aattttcatt tcgcgatgac    390420
     cgaagacctg aaaccggaaa aattgtaaac aaacgcaaaa atatgaataa gatgagacag    390480
     ttaaccaaga agaatgtagc tataattgaa atacacacgt cctctttaaa gaacaaagtt    390540
     ttagagtaaa ttacacatta gaaatatttt aacctgttaa aaatatttaa atcgaccttt    390600
     ctcacataac atatctttac taatattgat agctgacggt cagattgaag tactcgagaa    390660
     accgaatcgc gcacaggcaa gcaatcatgc cctcaactgc aattgatttt gaccaaatac    390720
     aacatcaacg tctacctaca ttatatgagg tatttatact gaagacagag ccccctgtgg    390780
     atttgtggtc tttttacaca tacctctctc aattcccata tgcaattaac tacttagact    390840
     tttggattga tcttatggca cacatcagac tctgtaaaga ttatgtctct acagtaaggc    390900
     aatcagtagt tcaggggtct gctttggaag aattccggaa cttagatgaa agaagtaatg    390960
     ttaacagaca tatgaacaac gatgaagatg catcagtgac aacctcaatc ctaatgaata    391020
     cgttattatc agagggatat ttagattttg agaaccctga aaaggtttct cagtttttgc    391080
     aagggaatac tcacacatcc ccgatggtaa ctcggatgat acaagattgg aaattacata    391140
     atgaaagaaa ctctgttgca gcgacaagtc acctacagtc aactcaagct ggtatagaca    391200
     tttcaagaaa agaaagtatg caaagtgtat cagctattgt tgatgaattt ttgaaaagac    391260
     aatctcagct aggagaaaag ggaaatatta ctacaaagca actatacaac aatgcccagc    391320
     aaatatgtaa cacctaccta atgtctcagc aacatagtcc aagatactta gctaacatcc    391380
     ccgacgatct taaaaaccag gttatccaca actttaaggc taataggcga catgacccag    391440
     aggtgtttag agagcttaag gaagtgacat accaattttt ggagacagat tgtttcccca    391500
     agtttctaaa agaggtagca ttgcataata tccatgatga gctttctgat tggagattcc    391560
     atccctcgaa taaaaaccca cacagaacat cttcaccttc tggtagtaaa gaaaatctca    391620
     acggtcacaa acaattgatg caaaatcaca tatcttggtc accattttca acatacactt    391680
     cgttaagtag agttctattt ggatgcatgt ggatgggcat aggattttgg attggttatg    391740
     tgctcatatt tctacactac agcagagcaa ttagagtcac cactgtagta ccatttggac    391800
     tgggctgtta ctatatagtc tgtggcattt atcaagttga tatcatatat tcctggtttg    391860
     ggctgaccca aagattaatg tacagtcata aaaaaggcaa tatagaagaa ggaagacaag    391920
     tctatggagc aacatataat gacgatgttc ctctcatatt caccttactt ggtggtaaat    391980
     ctagactgat acatatagaa catccattta tcaaaaaaat cctctataaa agaggtctct    392040
     ggtgtctaac attggtagtt atctttacgg caatattcac tgtaatattt tgctgcgttc    392100
     ctggccgtag attataaaaa ccgatacata actaaataat taataaagac atcatgcatt    392160
     tccatcaatt aaaaatcaaa aagtttgaca aaggagccta ttattcctta gtatgatact    392220
     ccatgaatca ttatgagatg taggcaaata caaaaaaaaa aataaatctc cgcgacgggg    392280
     aattgaaccc cgatctggca cgcgacaagc gcccattctg accattaaac tatcgcggat    392340
     tggtgatttg ttgaaaaagt tacaacattg tgacatcatg ttatttagaa tatgtcagat    392400
     gatataccag catacgttcg attacgtagc aaatagcaat cgattgtgtg tacatattat    392460
     atacattgtt atatgcaatg agcactttct taccagcagt tcaaactata aatgaatact    392520
     agagtgtaat ttcatattga gaaaatcatg tagactgtat attcatcatt atcatgcaac    392580
     ccgctatatc aggaatatca tcaaagcata caatatcaaa gttctggatc tcgattttga    392640
     aatatagtta tatctctgta tgatcttttg gagataaagt taaatagtat gaaagctgct    392700
     cgaaaaatga taatatttcc ggaactattt aagttaaatt tcaaatacag tagatgtcat    392760
     attaattttt agaagagact tcttgttaca aaaattattg ttcgtatatg tctgataagt    392820
     caataaagta gttggtatat gatacaatgc ctgcagataa cagttggatt tcaaaaaaac    392880
     tcatttacag aagctccact agaatgatca gtagagaaca tctacaagtc tatcaaactg    392940
     acaccttgat ctggtgtagc aaattgttgc tgttgttgct gttgatattg ttgtggttgc    393000
     tgctgatact ggtagttttg ttgttgatta taattgtaat tctgttgtgg ctgctgctgc    393060
     tgctgctgtt gttgttgttg ctgctgttgt tgctgctgtt gctgattacc gaatccataa    393120
     ccagtatgtg atggtacaat attggtgctg ggtagaccag tgtattgact agataagaat    393180
     ggattattct taggttcatt ggtaacttgc ttataaccag taccttgaga attgatgaaa    393240
     gtgcctgttt tagtgtgttg cgctggaata cgagcctcac ctgtgttacc aaaagtatct    393300
     atacctgtac cggatgctag taagttgttc aattcgctat acttatctga gatggattgg    393360
     ttgcctgtcc tagttttctg taatggttgc tgctgaggtt gctgctgttg tggttgtggt    393420
     gaaggagcag gctttggttg taaatctggc aacagtgcgt tatttgcact ggtgttatta    393480
     ttgttgctta tgttatctct ggaaaatgga ttgttagacc cagtagccaa agttggttgt    393540
     tgcaattgta actgttgcat ttgatcgtag taaagctgtt gttgctgctg ttgcaataat    393600
     gctgcttgtt gctgttgttg ggccagtagc acagcttgtt gttgttgggc caataatgca    393660
     gcctgttgtt cctggtattg ataatactct tctggagata tagggttgcc aaagatgtcg    393720
     taatacacat tttgctgttg ctgctgtgcc tgcaactctt gcattctctg catgtcctgc    393780
     aattttttca attcctcttc ctctttgctc agttgcaaag ctgccaagag atcggggtcc    393840
     tggttctcgt actgggcttg ctctcttctg cgggcctctt cttcctccgc ggtcatccga    393900
     gactcctcca gagccttctg caagtcatcg tcgtaggcgt tacggtaaga ggtggatcta    393960
     gagcgtgatc tgcgtcttct ccgcttggca tcgccgttac gtctgttggc cctattcaaa    394020
     gcccgctcct ccctgagtct ctcgtcatcg gtcagcaagg aggtcagctc cttggccttc    394080
     actctgatga tctggccctc gtcggaaccg ctcacttcgt cctcatgtct gaactccctc    394140
     agcgtcttga tgatgtacag gttctccttg caccacagca cacagttctc cgacccaaac    394200
     cgcaccaggt agtccagcac cgtcagcgac ttcgcaacgt gcctccagta cttacccttg    394260
     tcgttcaacc gcttgtccag catgtccatg atctcaaaga actcaacagt gtcatacgtc    394320
     ttgtccgcaa ggtcctccaa caccccgacg ctcggagacg tagaatcatt cgccgtagca    394380
     tcccgcacca tcacctgcgt gctggagtaa cccttcacca tgttcttcgc agaacgaacc    394440
     aactgacttg gcatctttat cttaatctta atcttagtct tggtcttggt cttggtcttg    394500
     gtcttgctct tggtattagt ccaaggtctt gaagtatgat catgctcttt tatactcccc    394560
     ccctttagca aattttcatt tccaacgacc gaaagtataa aaggccctcg aaatgcagaa    394620
     gttgaagctc aagttgatgc tgaactgctc aagcatagct acaactacaa gcgcaaggat    394680
     gtctttgttg cggatggtga ggccgttcat ggctgtggtg ccgggcgtgc gtcgtgtctc    394740
     cagtgtacca gtcgccggcg tgcgagtgtc aatgcctatg ccatttggga agatgccact    394800
     gccgttacga gcatctatac aaacaacagt acaagcaaca gtgcaagcaa cagtgcaaac    394860
     catgcaacca accgtgcaac cactacctgt gacgccgcag gcgctggaca aagaggtgta    394920
     tgtcgactct gtgatgcgga agcggaggaa gaagatgaag aagcacaagc tgaggaagcg    394980
     caggcggaag gagaaggcag agcggaggaa gctgtcccaa ggccgctagt ccccccggaa    395040
     gagcagtgcc cccccgacag tttcagatca agcaaaccca cttgccctcc agggcagcgg    395100
     tacgtcaata ttcccacagt tccaggcatg ggttcattcc aaaacaaaac atgtacatat    395160
     caattctcta tgcaagtata taagtcaaat acaaaaacaa ttacaacgag cgagttagct    395220
     atctgtatac aatgcggtag agcacgagca atgcgaggag cacgagcact gcgtagacga    395280
     gctgctggtg gctcctgtcc ttgttgtaga acttgagctc ctcgaagaca tactgcagca    395340
     ggtcgagctt gttgttggtg agggcctctt tgttcagctg gccgatctcc tggatgatgt    395400
     ccatgttcct ctcgaagatg cgcttggcga cgtcgatgat ctcgagcttg tcgttctccg    395460
     ccagtgcctc gcgggtggcc agctcgtagt tcttcttgta ctgccacttc agctggttct    395520
     cgacgtctac gcctgcgtcg ctgaaggtga agaagttggt gcccttgcgg gcgagctcct    395580
     tcgaggacaa gtgctcgaac tttgggaaca agccagtgtt cctgtagaga gtggacctca    395640
     tgactttacc gcctgcgaat aaagcgaggt acatgacgtg gcagtaggcc agcactgtga    395700
     cggggttctg gcgcacagtc gcgtgcacca tgtccacgaa cccttgcagc tgcggtggca    395760
     gctggtggtc cacgagcatg gcgtcgagct ccgtggacgt cgggtactcc ggcgagtata    395820
     gcagcagcag gtccttgtat agctgctctg tgcgcctgaa ctccggcatc cagaactgct    395880
     tgacgatctt gctggcgagc agcttctggt cggatacatc agtggcacca gtggcaccag    395940
     tggcagtgtc tatgcttagc agtgcgtcta tctcttgctc gatggcctgg aagacgtagt    396000
     agaaggcgag gatcccctgg cggtacagct tgccgtgtct cagcgccact gcgaaccgca    396060
     cggacatgaa cgcatcgatc ttgttgtggg catctctggt gttgaagttg atcctgttgg    396120
     ctagggcacc gatatcggcg ggggcgggta cagacattgg tatttgtatt tgtatttgta    396180
     tttctattgc agttttgtag cttacggtct acagcttacg gtctacaact cacacactac    396240
     tcaccactca ctttatatat acagttcata tttggttttg gctatatgta tgcttattgc    396300
     acctccggac ataccgggac ctaatatgca ccttcgtgca cccggtaact ccacccccgt    396360
     agatcatcca cacaatgcag ttggagatgg gtgcaagaca gcacgttatg gtgtagtata    396420
     gtagagcata atatagtata gtatggtatg gtttaccata ccataccata ctatactaca    396480
     ctagactaga ctacaccaca cacaccacac acacaacaca caacacacac aacacaatat    396540
     ggtgtattcc gattcactgc tatactccct gatggggtgg atactggtgc agtctatagc    396600
     tatgggacac gcaagatagg gtgtgagtct agtgagctgg taccaccttt cgaaatacca    396660
     gtgtagagtt atctcagtgt agagttacat acctcaatac agagctaccc cggtgtataa    396720
     catacacctc aatgtagaat cacctcaatg cagagttccc gagttgaatg gcaaaaccgt    396780
     cgatgcagcc gtatccctgg gggttaccgc tctgatagta tacgacagca gacgtgatca    396840
     ccgttccgtc atgagttata atattattta atgtcataat aaacgacaat tcggacttga    396900
     atttacccgg acttgtattt acccggctat atatatatgt gttacccggc tatatatata    396960
     tgttacccgg acttgtactt acccggctat ataacatcac cacgcacgtt acaggtccgg    397020
     gtaaaccacc cccccctcac tcaattccct ggaaagcttc ctgccttcta ataacaattc    397080
     ccgccgtatc tgggcaagtt atacttaaga agggacctta cctttgggaa gggagcagta    397140
     ggaagaagca caaggagaac aactagcagc tgatacaaat gataaggact aggactaggg    397200
     cggtgcagaa taccggaaag ttctacgcgt gcgtctcgaa gagacagctc atggggtttg    397260
     tgcgcaacgc gctagggttg gacccgcctc cgtcgccaga cgagcccact gaacagaaca    397320
     gattccaccc gtgggaccag tccccagcgg tagacctgag agagcgcgcc gcaaggataa    397380
     agacgctggc caagtgcccc gtgacacaca aacccatcca gtacacatgc cccatctctg    397440
     gtatcccgac acaccactcc cgcgaggcct gggagcagga caaggagtac cacgcatcga    397500
     agaagtacga gatcctgaag aaagtcaaca tctatgagca cgacctgaga agcggcagac    397560
     cgttcccaga gttcgacttc ccaagagacc aaggccccga caggaccgtc aacttgacca    397620
     attgggacct gttcctgtac accaggtcct tctactccat ggacacagag ttccagctcg    397680
     ccgcagtgac caagatgctg agctacccga tcaccatcgg gtctgtgctc caccagttct    397740
     ccccttactc tttgaacccg aaggggccca tcactttgga gggcctgaag tccctggccg    397800
     cactccgcta caccttgtac ccgctccaga acagagcagt cactacaacc gcaaagaaca    397860
     agcccatgcg tatcttcata ctcggagccc gtgccgaggc ccagctgccc ggccacgtct    397920
     ggaaacaact gcagttcctg ttcccacaac agaacttcga aatccacttc atcggaccag    397980
     agtccctgta cgacagagag cgcaacgaat acatcagatc tgccaccgcg aacggagaga    398040
     ccgccgccga cggcaccact tcctccatcc cggtcactaa acgtatcgac gaaaccatga    398100
     agttcttcta ccacacagac tacttccaca ccttgcacac cgcccaggac ttcttcccat    398160
     acgacccata ccaggacgtg ttcttcatgt tccaccctgg cctggcctcc cctgagtcca    398220
     aggacacctg gatgaaggac accgtcaagg gcctgctgga cacaaaatgt gccatattca    398280
     caacagggtt caacaagaag gatatggccg acgacatcca gatcctccag gacacgtacg    398340
     gcaaggaaat ggacatgctg atgaacccag taaaaaacgt cttcggatca accaaatggg    398400
     aactcgacga cagcgaccct cactcagtgt accagttcaa catgtacata gcaggtttca    398460
     gaggtaagag ataccatcca atcaaagtat agacagaaaa cccataacaa tctaatattt    398520
     ttacttaaat tatgacaagt gatagataat tggtttagat atcaaaacga actcttatat    398580
     tgcagaggtt aactttcaat atttatttca cacccatcaa tgttcatgga attttcttcc    398640
     accaaccttt agcctgcctt tccctaagta cttcccacgc aaaaaaaagg acgcaatggg    398700
     aagtataacg attttattat tctattatta cattttttca ttactccaaa ctcttcaaga    398760
     gccagcctaa tagttttcta gaccggatgt ttagcgtcaa agcacgcatt cattacatat    398820
     ctgggttgaa aaagcattgc aaaaagatag caccagaaga gccaacacaa ctgtaaatag    398880
     tatcaatact ttatgttgac ataaatatga aatataaact gaaacttaaa gatcacgata    398940
     gacattctct ccgctcgttt ggctgtcacc caaggacatc gtccccataa gcaccgcttt    399000
     tcctacgtaa tcatccaagc aattttgcca aataatgaca cccagcgtaa tctatcaatc    399060
     atcccgcata gtgagaaagc catctatatt agcatagagc tccttggata gcatcaattg    399120
     cacttgtaac ccacagtttc actaacttgg gacatttcca gtacaaccag agcattcaag    399180
     ggcgaactag acagatagag aaaggtaacc gtacaaataa tgagcttata caacaatcta    399240
     agactagtca ccagacagaa gcaagtgtcc ggactgcttt ccgcagtaag acgttaccat    399300
     ccaacttcta atgagtatgt caacccaaag gtctgggagc cattgactta cacacccgag    399360
     tctcccgagt tcaagctgct atcgcatacc atggagaatt ccgttccaca acatggtttc    399420
     actgaaaagg ccatcgttaa ctctctaaat gcgatgaaga tgccaagtgg tatgctaact    399480
     actatcggtg cttccaattc tgccactttc ctgcactctt caccagcagt tatggaattg    399540
     ataaagttcc aactggtgga aaaaagacat cgtatggttg agggaataac tgagatcgct    399600
     gaagcatcta aattgccaag tctggaaagc ctgctactaa agagattgaa aatggatgta    399660
     ccaattgctt ctcatttgac tcagatgacc gcacaattga tggttccaag ctcttttatg    399720
     actaatgtct cacttccaga actagagaga ttagcagacg acatgattta ttactctaac    399780
     gagaaggatc accacgattt tgcctggtac accaagagag ctgctttggc cactacatat    399840
     ttggccagta aagctttcat ggctcaggac aagtctcaca atttcatgga aactatggaa    399900
     tttgcccaag ataaattgca taaagtcatg actttgggtg actactacaa caatgttgaa    399960
     gagtttggct ggttcacatt gatgtctgca gtaaacttga ctaagtctca aatggcaaga    400020
     gtctagatta taaacactct gcttcaaaat acttctgtca ctttccaaat tatagtaaca    400080
     taagaaatac actaacgacc ttcaaatacg aatatgacaa ctatatttat gaactctatg    400140
     aaaacccact ggccattaac actaaagttg ttatagttgt aatgtatata tttaccactc    400200
     gcccaattac aacttttcga aatttctgat cttatttttt tacttctatt attattttta    400260
     ttgaatctat tatgtattta aaagtatagt ctatttctgt tgactaatca actggcctct    400320
     aatcgtctct agttcttgct gctttgatct tatgttatct tcacagcgtt tgatctcctc    400380
     accgatgaac tccaacctct tatcgacgtt gttcttggca tcatcgtgct caaccggaag    400440
     aagtacgtta cctgtaagct tatacaccac tgtatcttct ttcaacgtgg caaactcctc    400500
     attgacaatc ttgttctctt gcaattgcgt ttccagcttc tgtctcgccg ttaccaactc    400560
     ttctaactca ttctgtaagc tctgatactt ggctcctaat tcagcagaca ttgtatatat    400620
     tacctgattg ttgatttata tagtgtgtta tgactagcac tccattcaat tctttcaata    400680
     ctatcaacta tcccagctca tctcttctct tgtacaactt tcaatatttt ttcactttaa    400740
     gaaatttaaa gttaaaaagg caattgatcc atcgggatat tattgaaggg accagtaata    400800
     ccatagttca gcgatactga cgatctaaaa caattcaaca atgctagtac gttaataaca    400860
     tatttgattt cccttttgag cccatctttt aatcttttcc agaagttatt ttactaacaa    400920
     accattgcta ttcgatatga tttcccttat tggttgtgat tactagtggg atttcgactg    400980
     caacaacaca gtttaaacaa tggaatgaac tttcagagcc acgtaaccat ttggatgcac    401040
     caaacttagt caataatact gaatcattgc agttgttgcc gctgcccgac gtgcatatcc    401100
     ccgatgagct atttgaaggt ggcaatgtga aaagggttat tttgactaca aagaccatgg    401160
     atactttctt tctgttagac aaaactatga aggtcaaaaa gttggctgat attacctgta    401220
     gtctggaaat accaaagaac ttacaaaccc atgaagctac acatacttgg gattttggtg    401280
     agaactttcc aaatgaggtt gaaccattac aagacgagga acaaaggaca tttagcttgc    401340
     gtttcccaat ttatttgctt gaagatcaaa cactgtatgt atcaatcgat gagaattttc    401400
     tgaccgtatc tcctatattt acagcccaaa ttagtgatgt aatatcgaag aagttaaatc    401460
     gcggtcacga aattgtaata ttaggatgtt cagaccgcat agaggatact aagatctgta    401520
     caaataataa ctgttcattg gtacctcctg aatttgtaac tggatttcta ggaagtttaa    401580
     tgagtgattt aacaaagaca aatgaccaat tgttcactgc cgccatattt ccaagtgaag    401640
     gtccgcaggg attcgaaaag ttatcgtcta caactgttga tagtataatt gatttctgct    401700
     ctcaattggt tagtacggac aagagcagat atacagagga atgctacaag agatggaagc    401760
     gcaatgctag ttccaatggt gcgcagtccg gactttactt ataaatagtt ataataatag    401820
     ttataacaag tgcattttta agacatccaa tgactcacca atggaaacaa tgggagtttt    401880
     acataccagt ttaattaaca ctaatatttt ttaaagctct ttctaaatat acagtacata    401940
     atggctctat tatgaatgat gtgatgaaaa taataaaata aaaatgatga tggaaataaa    402000
     atttgccttc aatccgtttg atttttgatc tggttgtgta ataggttatt tgtagtttaa    402060
     gtgtattgtt tatttcttgg acttcttctc cttcttctcc ttcttatctt tcttttcctt    402120
     cttctctttc ttttccttct tttccttctt ttctttcttc tccttcttct ccttcttggc    402180
     cttcttttcc ttcttttcct tcttctcttc ctcttcttca gattcagatt cagattcttc    402240
     tagttttctc ttcttagagt cagcctttgg ttcttctgat actggcttgt ccttgttgaa    402300
     caattccata gcctcgtgga tggctaattc gttcttcaaa gttggcttac cggtagcata    402360
     gaattcaagt ctttgttcaa cttgcttctt caagacggaa ccgaagacgt ttgttggctc    402420
     atcggagtag ttatctattc tagaagccat agaacacttg ttcgctaggt atctggagat    402480
     tctacccttg ttcttagcag aggccttggc aatgaaacca ctgtggtaga tcaaaccgta    402540
     ctttggagtg ttacccttgg tcttcaaagc tctgaataaa gccttctcag cacccaagat    402600
     ttgcacagtg gaagcggctt gcttggaaag actggtcaaa gaaccagcgt gggagatcag    402660
     tctagcaccg atgacttcac caatcaatcc agacaagttt ggagccacag tgtgcatctt    402720
     ctcgcataag tagtcgtata gttgctttct gtaatcgacc aaagaaacaa ctctctgggc    402780
     aaagacacaa acgttttcca tatcggtctc ggaaaggtct tgacccatgg agattctggc    402840
     gttgtcaatg attctctcgg caataccagc atcttcgttg acaacagcgg ccaagtcgtg    402900
     tagggattcc tcattcagag aggccttatc cttgatgaac aagaccaact tagcgaaggt    402960
     gtagttgtct ggaaccagct tggccagttc cgggaagtgc caaccgtacc attccttaac    403020
     tctcatggcg aatgtgttga tgtccttgtc caattggtcc aaaagagcga tagcttgtat    403080
     gatgtggttg tcgttctttt gaacagagaa cttcaccttg gctctggagt aagcgtgacc    403140
     caaacccaat tgagctctct ccaagtcacc ggattgcaaa cctttcagca acttttcacc    403200
     atgcaatcta acaccacgga tcaagtcctg ggccaactcg ttggcaatac agtcgacgta    403260
     tgggaaagct tccttgatgg atggacccaa gttcttgtca gagatggcca atgtcacagt    403320
     ggacttggcg gaaccctttg gcaagttcaa ctccaaaacg ttctttagac tctcggagac    403380
     aagaccctca gagatgtcgt tagcgttctc caaggcctca gcggcaccct tgaaaggagc    403440
     aaacgacaca agctcaacca gcttggtgaa cccaccgaag tcattgatct gctcttgcac    403500
     ttccttcagc ttagaaccaa tgttgtcctg gttcaacttc accttgaaca ccgcataccc    403560
     agtaggctcc tcaaacaaca gatactcaat agccatgttt atcctgacag ttatccttgc    403620
     tgtcctacct cccccccaaa ccagataata gctatgtgcc agccataata tctttataaa    403680
     gtagatgctc atcgcatcgc atcgcaaatt ttttgtgaaa aaaaaatttt tcagatgcaa    403740
     ctgtacgtgt gtcacatggt tcatgggggg tggagcatag ggaagagcat agaggagcat    403800
     agtgagtaga tattttatag atatttgtag ccgggtgggt atccagcctc gagactgctt    403860
     ccaatggttt ggactatgac gctgataagg gttcatattg ctggagctgt tcttgtcgaa    403920
     acgggtttcg agtctctata ttggattaaa aaatgatgtt gatatgagag tgcgtgtata    403980
     tattgtacag tagttgattt atatatctga gggggaaatg caaacaattg ggaaagggga    404040
     gggtggtggg aggcactgcc gcttactctt cgtcctcgtc ttcccagtct tcttcgcctt    404100
     catcgtcctc gtcctcgtcc tcgttcttgt cctcgattgt aagcacggtg tccgggttgt    404160
     cgttcttgat gtatttcctg gcaatcctgg agcttctgcc caatgacttg gcctcggcct    404220
     tggcggcttc ttgcacctgc tgcagctcgt cctggaacac tctacgtacg gaacggttgg    404280
     agaacacatc ccacagcttg aggcccttgc tgacaccacc gatgactatg ttaccggcaa    404340
     cttcgatgtc tggtgcaaag ctggaggtca gcacgttgcc aacatcgaag tctcgggaca    404400
     gcaccatgcc gggaccgctg gagcccgcgg tggcttcagt aggaaacttc cacagcttga    404460
     cctgcttctc acccatggca ccagtggcca tcataccgga gatgaatctg ttacaactca    404520
     acgacgatat accggcatcg tgtgccttca aagtccatac cggtttggag ccctcgttgt    404580
     ttctaatatc gaaggagtaa acgttaccgg catcggtacc acacagtatt atgttctcgc    404640
     tggcaaaagt ggcggtttcg atctcttcgc caggtagtac ggaccaatac ttggacatct    404700
     gagcctcgtc tgatattcta acatcggtca acgcagcacg ggaatcgtaa cctgcagtca    404760
     gcaagattga agcgttctgc atgtgccact gagacgagga gacgttcttg ttgctgtgga    404820
     tgttggccat ggaacgtgca gcagtagcgt tgttcaagtc ccatagctta acggtgtgat    404880
     cagcagatgt agaggcaagc acggtacgga attgtctgtt gtgggccagc gacaaaacgg    404940
     cgtcagtgtg gtgtgttgtg acatggccct tcttcttacc tttcttcttc ttgctcttgc    405000
     ccagactggc ggccgagttc tcttcaggct catcgagaat caggtctggg aaagccttgt    405060
     ccactgagtc caggttccag atctcgattt gagggtcgaa agtaccgatg gccgcgaagt    405120
     tgcctggctc ctcggagctg gagccgactt tgtagtcgat ccactccacg cacaatggga    405180
     aagcaggcag catgaggtcg tggtgcacat acaatgcgga gtcacggacc ataccacggg    405240
     ccacatccgg gtcgtactcg tcgccttctt caacaggtat ctcgtcactg tggaaaccag    405300
     caccatcatc gtagacatag acgtctaagt aagagatatc gtcctcggtt ctggtggcca    405360
     ggatcatgtt gtccgttggg tagacttgca actcctcctt gtcctcctcg gtctccttct    405420
     cgtgcggcat tgagatgtat gcgtcctcgt cgccctcacc cgcatggaac ttcacctcat    405480
     cggacagccc agggaacatc gacatctcag caccttcagc accgtcctcg tcatcgtagt    405540
     gctccatgtc gaactccttc aagtcgtcgt caacctccgc ctggtccttc aacctgtcag    405600
     tgttgggctg ggcaacatca cctgcctctt cacccgcctc ttcgctctca gcaccagcct    405660
     gcgcatcctg cgcatcggca agatcctcct tggcatcttc caggttcaat tgagccatct    405720
     ggttgatccg ctccatctcc tcatcatcca acacatactt ctcggggaac tgcgacggaa    405780
     acccccttgg cacccacgcg gtagctgaaa tcatcgtcta tactggcctc tcctgctcca    405840
     acgcacacac actactcact tatgcgatga gcttcctttt catacttgcg atgagctcgc    405900
     agctgaagct catcgctttg aaaaattttt agtttcccgc acagaaactc acacagaacg    405960
     agtttagttt gggataagat agtgccccgg tgctagttct gacaagtact tctgtcagtt    406020
     agtcctgtca agtagccctg tcaagtagcc ctgtcaagta gccctgtcaa gtagttctga    406080
     gagttgcttg ctgaagttgc cgtctatccc tggaagtgct ggcctttgag agatgagtga    406140
     gaagaagatc gaggagcttt tgaagcttct gagcatgaac aatggggaca tgtcgaagtt    406200
     gacagcgaac cagcggaagg agatgaagga gtacaagttc tggaagacgc agcctgtgac    406260
     gaagtttgac gaggaagtga aggaggaagg gcccatccac gaggagaaga cgcctgcgga    406320
     tatacctgac gagccgctgc ccctgttgcc agacttcgag tggtgtgcca ttgatgtcga    406380
     cgacgagaag cagttggagg acgtgtttgt gctgctgaat gagaactacg tggaggaccg    406440
     cgatgcgtcg ttcaggttca attacacccg cgagttcttc aactgggcgc tcaagagccc    406500
     cggctggacc cccgactggc acatcggtgt gcgtgtgaag gcctccaaga agctgattgc    406560
     gttcatctcc gccatcccag tgaggctcag agtgagagcc aaggttatcg acagcgtcga    406620
     gatcaacttc ctatgtgtgc acaagcaact gagatcaaag aggttgactc ccgtgctgat    406680
     caaagagatc accagacgtg tcaacaagcg caacatatgg cacgcactgt acacagccgg    406740
     tgtggtgttg cctgctccgg tgagcacctg caggtacgca cacagaccgt tgaactggga    406800
     caagctatat gaggtccagt tcactgacct gcctccgaac gccacgaagg cggagatggt    406860
     ggccaagtac acgcttccaa aggcaacgaa gaccgccggt ctgagagagt tgagactcga    406920
     ggatgtagac caggccctgg cactgttcaa caggtaccag tcccggtttg atatcgtcca    406980
     ggagttcacc aaggaagagt tcatacattg gtttattaac gacaagaacg ttgtggaaca    407040
     ggacaagagg gttgtattct cctatgttgt tgagagcgag ggcaaggtaa cagacttctt    407100
     ctctttctac tcactgccat tcacaatctt gaacaactcc cgctacaagg acctgggtat    407160
     cggttactta tactactacg cctcggatgc cgacttcaag ttcgaggaca ggttcgacaa    407220
     agaaggtaca tcactcctaa agcaaagact ctccacgttg gtgcaggacg catgtatcat    407280
     cgcggcacag aacaagatgg acgtcttcaa cgctttgtcc tcccaggata acacactgtt    407340
     cctggaagac ctgaagtttg gtccaggtga cgggttcttg aacttctacc tgttcaacta    407400
     cagaacattc ccaatcaccg gtggcctgac tgaggaccag cacttcgaca ccgagcaccg    407460
     cagtaacgtc ggcgttgtca tgctgtaaaa gccaccattg ccctgtgtat agaacatatg    407520
     tacccagtat ttatgtaaga gaatatccca ttcacatctc gctatgcatc gctatggctt    407580
     atgacaaaga gatggctggg cttttcccca cagaaaatcc cgcagcaaga aagaaaacgc    407640
     atcaaagtga taagagactc gccatggctt tgaagacaat ggtggagtgg tataatgggg    407700
     actggaaatc tggaatgtag aactagtatc gagcataaga tctattatgt cattctcatt    407760
     tgtaatgatc tatcggtagt ggggtccttt gaatggaccc tgggtgctca gccattttaa    407820
     aacgccattt ctttgtgagc catggcttct gatgtgatac ctatttttgg tagaacctgt    407880
     atggtgcaag gcttgtagat cttggcgtgg cttgcagatc tctagcatgg ctagttttca    407940
     actgaatttg atgttctgat ctgaggtata taaagtggtg gcatagcact gatagattgc    408000
     cattactctc tcataaaacc taagtcaaca agtaaagaaa atactacaat tccaaataca    408060
     aaaatgaaac tcacacaagt cgctctaatc tgctcaattg catctgttaa cgcttccact    408120
     ggtggtcttg atgacaactt tggtggtaag gccgacagtt ccaaggagag cccatctggc    408180
     tctcaggccg ctgactctga ttcgccaagc tcgcaagttg aagcacaagt gccaagtgcc    408240
     aacgctgcag ctcagcttcc aagctccaag gctgtctccc aagtgcctac tcaaagtgtt    408300
     gtgcaaaact ccaacgttgt ctccagtgcc aagggcaaag acggttttgc cgttgaacca    408360
     agcaccacca ttactaccac agatgccaac ggtaacccaa ccacaaaata tctgtggtgg    408420
     atcccagaag ctactccatc tgtttccgct aagtctgccc ctacttcagt agaagactct    408480
     gaatccagct cgtccagtgc cgttgtctct agcactgtct ctcctagcgc tgtttccagt    408540
     gccagtgtcg ttagctcatc tcacaaatcc attgtctctg actctgcctt gctgcaaaac    408600
     tctgatttct ccagtgttgt ttccagctct gtttccagtt ctgcttccag ttctgcttcc    408660
     agttctgctt cgaagggcaa gaagggcaag gactccgacg ccagctcctc tgtgtcctcc    408720
     cactcgagaa gaccagatga gcccatcact gtactaacat acttggactc cgagggccac    408780
     actgtgacct cgaaggtgtg gtggacccct acaggagtca catcgagcaa caccgcctcg    408840
     gtgtcggtat cctcatcgat agagagcaaa gagaacaagg cagtgagctc agtgcatggc    408900
     aagaaggaca agaagagcaa gcaccagaag tcccactcca gcactacagt ggagaccact    408960
     actgcctcgt catcaaagga acacacatcc aagcacaagg gcaagggcaa gtccaagtcc    409020
     accgtggaga ccgtgcacac cagcgtctcc cacagtgcct cccacagtac ctcacagagt    409080
     gtcagcgaag tagccaagag agcagtccat ttcgaaaacg caggcgtagt cgacaagtac    409140
     cctctcgtgc tagcagcagg ttccctagcc atcgcactac tattatagtt tccaaacccg    409200
     ttttatagaa tttctgtaca ctagatagct cacataggcg ccataaaata aaagtttcaa    409260
     gcattagaat aaaaccagaa gctgcactca acagcattgc aaagatactc aagcgttaat    409320
     gcaccatgac taccagatat tagcctcaat gtgattcatg aagtgtatac cactacatca    409380
     catgaccata ccccacacga catccccccc cccctgtgag gtgaagactc gctggttata    409440
     aagccaaagg ctattggtta gtgagtcctt gcttcgatgg gcgatgggca gtgcgccaag    409500
     ggagcaaaga tagttatatt ggatggtttt ggttcatagg agtgtgcatg tgtttgagaa    409560
     tgactttgcg tctgtgtcct gtgcgttctt caaccggtac ccgaacccat actcgcggac    409620
     agtgaagtcg atagacacgt tgaaccagca ggtgctggac ggcaagctgc acacgacgcg    409680
     gttgctgcgg aagaccggga acatgcctgt gtgggctcgt cctttcctcg ggaggatatc    409740
     tgagtcctgg gtgatagagg tgtctgtggt ggacccgcag cgcgggagga tggagacgtt    409800
     caccaagaac ctggaccaca ccaggatcat gcaggtggag gagtacagca catacgacta    409860
     caacttcgag acgcggaaga ccagcgtggt gagccgagtg aagttttcca gtgggttcac    409920
     cacggggctg cgtgagcgtc tggagaactg gtcgaggtcc atattcgacg agaacgtcaa    409980
     gtacagcagg caaggtatgc tgtttgtgat gaagaagatc gaagagaaga ggaacaagag    410040
     gtccttgctg cagcaaatcc agaacatcga gccttgaacc caaggatatt tatgtgtggg    410100
     aaatcaattt tccgattaac gacttttatt ttctttgcca tacaagagag tttgcgtcgc    410160
     tactcagcga tgcaaaggca atatctctct tggagtgact ataaaaactg ctctttatta    410220
     ttttgttatc ttccagggaa ttatttattc gatcgtgatc gcccggtttt ttttactttc    410280
     ccttctctac agcttttatc tttcttgttg ttttttttgt acatagatga cacctccact    410340
     acactatata aacttattta ttcgtattga ccctatagat agccaaagac tattacgttt    410400
     ctagcctgac agccaagcac aacggactat acttgctcac ctcctcatgg cagacacgct    410460
     attatggtct catgccacga tacacctgga attctcactt ctttgaaaaa aaatgaagaa    410520
     aatagtcgat gagctgacat attagatgga taagctattg taaatttatt tcatttggtc    410580
     ttagaatcag catcagacgc tagaaactat atacagattg cgaagatgtc ttgggatgat    410640
     gctggaaacg acgatgctgt cctgatggac tcctgggatg ccgaggttga ttttgccggc    410700
     gatgagccta ttctggactc atgggatgag gagccaaagg ccaagaagga ggctgccaag    410760
     cctaagccta agccaaaggc tggtggtaag aagaatgcca agggtgagga gaagaaagag    410820
     caagtgctgg ccattgatga gctagatcct cagacgcgga aggagctgat gaagaaggcc    410880
     gagctagagt ccgacttgaa caacgctgct gatcttcttg gagacttgga gatggccgag    410940
     gagcacccaa gagctcgtgc tatgcagaag gagcaagaat tggcagcaca agccgcactt    411000
     ttgagacctg cgatgactaa agacacacca attgaagacc acccattatt caaggcagag    411060
     accaagaagg aataccagga cctaagaaag gcattggcta ctgccattgt cactatgcat    411120
     gaaaaatctt ctctaaacta ctcatcctcc ttggccattg atttgatcag agacgtatcg    411180
     aagccaatgt ccatcgaaaa tattagacag actgtcgcca ccctaaatat cctaatcaag    411240
     gacaaggaga aggctgaaag acaggctcgt ttggctcgtg tcaagggtgg taccgctact    411300
     ggtggtgctg gtaagaagaa ggctaaggcc aagaccaatt tgggtggtgc tttcaagaaa    411360
     gatcaagatt tcgacgtgga tgacatcaac tatgatgact tcggtgctga cgattttatg    411420
     taaagttgat attaaataag gtagtaataa ctacattagt gtagtggtat agaatttttt    411480
     attcaaactt atgagtttaa tttttgaatg ataaatgaaa catagataaa tcatgcaaga    411540
     tggtaaatat cacagaatta cgatagtagt ttaatgttag tgctgcttaa agactaaaaa    411600
     ctatgcaaat attatttaca ataatagggg acaatctatc tggcgatttt caatacgctg    411660
     ttatttgatc acgctatgca ggaggggttt tactttcttg ttttttgact cttttgatta    411720
     tctcaagata attatatggc gcgtatccat tctgtccagc tctgtttcgt actttccacc    411780
     agtctgaact gcggcctaga ggatctgctt tgcttataat agccactaaa tctcccttct    411840
     ttaatgtaat ttcaatttga ggattttcag gcgtgaaatc atataacgcc ctggcaaatt    411900
     caagtttaga aggatctata gtaccatctc catcttttcc cattgcaatg ctatttctct    411960
     gttgaacttc ctgtagtttc tggataaact tattgagcaa atacgggaaa ccaaaaactg    412020
     cagataaaaa gaatagcaaa ggcttcaatg ttatcttcct cgcaggtgct ttatcattgt    412080
     taagtccaaa acggctaaat tcctctaata ggcgtgaatt accagaatta ccacctcctt    412140
     gtatacgttt tggtgcgctg cctagcctcc catttgtgac aaaatacagt aaccttttca    412200
     aaaacttcat tatggcaaat atgccgaatg ctgatcctaa tacttccttt aaatagttaa    412260
     attgttctgc aacagaaatc atagtaaaga aagagttatg agttgccatg taagtggatt    412320
     ccaacatctg tgcaaacccg gtaactgctc caataaggct ctctataagt tggaacgttg    412380
     ctctagtaga ttctccaatc tgttctaaac catttcctcc catgtcacca tacgctcctc    412440
     cgtagttata accattattg taaaatgatc cgtagttccc gtaaccacct ccatacatgc    412500
     ctccatatct attcatagca ccgctataca tggatccaaa cattccgcca ttgttgccat    412560
     acattccacc accgtaaata ccgctgtcat aaccatatcc tccactgttg tacataccag    412620
     ttccaacacc accattcata gtgttagtca atcccggtgg tcggggcacc acttccggtg    412680
     gttctgaacc ctccctagta ccctgctcat gagattcctg tgttgtagtg tctctggtag    412740
     acattaggga gttattagcc tcattctcta tatcgaacgc ccggtctacc gctgcggttg    412800
     tgcctccatt agtctcccaa ggcttcggcc tcgtctctgt ataggtcatc acgctagtaa    412860
     tacctgagtt gtttagcaaa atgggtgttg agctactgtt gagaacgtgt cttaccttta    412920
     tagtgttcca aggaatcttg cttttaagat aatattttga tcaaatgatg tctattgctg    412980
     agatgatccc tttgctagtc atgatttggg catcttctgc tcttctccgg agtttatttt    413040
     gacgttccgg gataacatag caagaccgtt aactatgcac taaataataa ataattagta    413100
     taaaaacatc aagaattata gtgtcattgg gaagtatcac attgcgtagc tttacctcct    413160
     ttaatattat taacattatt ttttgataat cgtacatctc acagctctaa aaatcttatc    413220
     ggcataaaga tttattatta ataaatttat aaagtattgt acaatagctc aaacattgaa    413280
     ttatctgaga tagtataaaa aagaggattg caaagaaata aaaattaatg tagtttatca    413340
     tatccgcctt gtctggcaat gtagtgtatc ctggtagtaa aaagaagaaa aaataaaata    413400
     agaagtaatg aaacaaacat aaaagcaact ttagttgttg aacaatgaaa aaaatagaat    413460
     gaagagaacg gaagtctgca gatctaaatg gaagaggaaa tgagttatac gtcgagtgca    413520
     gtttccatat gcattaaaac tttaaaggtt atcataaaaa gctgaattgt actatctcag    413580
     ctattaatta taactctgga gatggagtct ttggaatttt ttccatgtca tctaattgaa    413640
     cttgaaagtt taattgaaaa cctttcttag agcttgtggc acttgcaact gacgatgcag    413700
     cattctgtct cttcttaaca ataatctttt cctcggttgg atcttccaaa tcaatttgct    413760
     caatttcatc ctctgcaata acagatgtac ttgagggaga gtctgaaaaa gaggatggcg    413820
     aagatgatga agagtcctgt tgttcatcta gttttctcag ctctgtactt gaaatacgta    413880
     gaatccgccc tctgttgtcg gttaattgaa tattatcaca tgattttctg tggccatgag    413940
     aatgacgatg gccatgtttt gaattagatt tctttggtgg cggagagttg cttataactt    414000
     ttaactgttt caacactttc tggtaactgt caaacctctt ttcaagttgc ttgactttct    414060
     tctccatgtc cctttgctgc gtcggttttg caattggggc attttcgttg ttaccaatga    414120
     aatccatgag aagtctatcc tccactattc tattggttgt gatggagtgg atcaatttct    414180
     cattttgcaa tttaagctca ctgatctcaa gttcaagctg tttaatcttc aagtcaagtt    414240
     tttgggcctc atatgacgtc gaactctggc ttgactgact ctctagatta acttggttcc    414300
     taagatcgtc ctgaatcaca gacatcatcc tattagaaga taaatgccca tggcggtgac    414360
     tgtttgcgtg tttggctata ttattttggc tctcgtacca ttccatatcg tagtctgtgg    414420
     aagttgcgga gatgaaacta tatctgttgg tgttgatatt cttatgatca atttgtacaa    414480
     atccgtttct gtcagttggc aacgcttcga catccaaacc gtctctcaat tgttgggagt    414540
     cgacgtcctt agcagaggtt gctgtttcag tagagaaaat cctagaagaa cccacttctt    414600
     ttgagtgaga agctggaacc tgcttcctca ggtgttgttc ttcatacaga gtcttttcac    414660
     tgttggcatc cgacaccttc cttgcatctt tgtcatccga cacagctaaa gtttcatcct    414720
     ttgttgtagt ggctctgtcg cgtcttgtgc tagtagagtc acggttcttg ttcctcttag    414780
     gaactatgac ttcttgccgt agctgatcca gagactcctt gatcattgac acttgctcaa    414840
     agcccgacat actggtggtc tggctgttgt tttcattaga agcagagccc tgctgctgag    414900
     agcccgcctt accattgcca gtcttcatca gaagcgcgga tagcaaaggc agagttgatg    414960
     ttgaagtaga gcttttctgc aagaactcgg gcttcagcat ctttggagca cccatgctga    415020
     agttaggacc cgggttggca ccgcctgtgt tctggaactg cagccgcagc ggcgagaggg    415080
     acctcagcgt gtccgagtcc ctcctggacc gctgctggga cctcccggtc ctcgagagct    415140
     cgctcagctt ggacagtgat gtcgggtaca acagcgagtt catcggtgcg tgctggtcta    415200
     gcttcagctt cgtcggcgag agcagcgtct tgtcgtcaaa cccaaacgct atgggagaca    415260
     tgctgggcga cagctcgttg aaatgtggcg agttcatatc cgacgtccac ttatgtttga    415320
     gtgtttttag cctgtgtcct ttgtcgttgt cgttgtcgtt gtcgttgtcg ttgtcgtcgt    415380
     tgtcttggct ctcttagcaa tcgaggaact attccatgga ttcgcttgtt ctcttttttg    415440
     tggtcaagcg taatatatag aaaacctgaa ctctgttccc aaccgatccc ccacacacag    415500
     gcagctccca aatccaattg gaccacttga atggaccact tgaatggacc acttgaatgg    415560
     atccccaggg agagactggc tattgttgat tcgatgcgat gagctttcat tgtttacaag    415620
     tttcccatta ttttttgggc caatccgtgc ggcgatctct gtggctacac gcaactcctt    415680
     gccttttgtt tactatttaa cccgattggg acgttcccac ttcgtccatg tcatcaccga    415740
     caacagaaat cacatgatca ctatatcatc tgaagggcag ttagtggtct cagttgtatc    415800
     gattaattct tagtcatata tatgtatgtg agtaagctat acactcctgt atggtacatt    415860
     tatattatgg taggtgggtg gtaggtggta ggtggtaggg ggggtcgtgg cattctcgtt    415920
     tgtgcattgt tttcagaaca cttggccggt catcttggcg acgaagtgca tggacatcac    415980
     ggtgaagatg aaaccggcgg ccaggaacag cactacgagc gggtccacac gcagtccgtc    416040
     ggcctcgtcg gtgaaaatct tcaggatgct gctgctggag cccccgaacc cagcagcacg    416100
     cgcagaggta ggcgtctgcg tctgctgctt ctccttcacg gcctgcgcct gtctccttct    416160
     ctgcaacgta cggtgacctc ccggtggtgg tggagtagac attttttgta attggtgttc    416220
     aatagctatt gcttctgctt cttataacca gcaacaccgc tagcaagaga ggaagagaga    416280
     gtccctcttt tcatccagtt tcccaacttg agaatccaaa aagtccaaaa gtctaaagat    416340
     cccccaccaa gaaaatactc ttctgcgggt tgaaaagagc acttaattac gtgagagacg    416400
     ataccacgaa gaaaaaacgt gattcatata tcaatatacg tatacatcac atgatacacg    416460
     taccgaatga gatatagatc actgtataca agtcacatga tgtccacgta tagtgagata    416520
     taaaacacgt gatggatacg tataagtaga taaggttgtc ttttgcttct ttccgcctct    416580
     ccacacacca aaagccctta gaagtggccg taggatccac ctatttcaaa aacccaaaca    416640
     ctttcccagc ccacacatag acatatctac atgtacatgt atatatatct acatgtatat    416700
     atctacatat acatctacat ctacatgtat acatatacat tgagcccatt gctgcttacc    416760
     ccacacatca cgtgagttct gtggaaatga aaaaaatttc tgaaaaattc cgcttgcggg    416820
     atcctcatcg ctgaaaaatt tgtctttcaa cacatataaa gagcatcctg ctggtagggc    416880
     atctcttctc gcttccagga caccaacgca ataccacagc caggacacat ggacaccgac    416940
     agtaatcctg aggcgggggt caataacggg gccgctaacg gtgccgccaa cgctgcaagt    417000
     ctcacaaacg acacagccac acctccaaca acaacaacaa caacagcaac aacaaataat    417060
     gattacgagg ccaacgatga ggacgttata cctaacgcga tagttatcaa gaacatcccg    417120
     tttgcgatca agaaggagca gctgctggac atcatccagg agatggggct gcccttgccg    417180
     tacgcgttca actaccactt cgataacggt atcttcagag ggctggcgtt tgcgaacttc    417240
     tccactccag aggacacaag cagggtgatc tccgacttga atggcaagga gatcaacggg    417300
     cggaagctga aggtggagta caaaaagatg ctgccacagg cggaaagaga gcgcatcgaa    417360
     agagagaaaa gagaaaagag aggccagctg gaagaacaac acagatccat gtcaaacttg    417420
     tctctgtcat ctatgaacag aaacagcaac aatacaaaca acagcaatgt aaccccagcg    417480
     gcaaatacca ccaacttgct gtctcagcag ctcttctctc caaacttggg atctttatcc    417540
     actatgcaaa acagcaacat tgtacaacca atggccaacc agagcacttc gggatcgatg    417600
     tacagcgccc gtaacagcgc ataccagaac gatcctaaca caagcgcgaa catggtccag    417660
     caacagtctg ccgtgactga aagatactat gccccattac cagcagctta ctcgttgcca    417720
     ttgcctccac agcagttgga cctaaacgat cctgatactt tggaaattta ctcccaacta    417780
     ttattgttca aggatagaga gaagacgtac tacgagctgg cttaccctgt cggcgtttct    417840
     gccaaccaca aacgtattat aaatgtgcta tgctcttact taaacctagt tgaggtgtac    417900
     gatcctaggt tcatcattat aagaaggaaa gtcttgaacc aaaatgactt gcaatctcac    417960
     atcttacaaa atcaacagtc tcctcaagtt gggacgaccg agaataatgc aatgatgcac    418020
     ccattgcaag ctagctctac tggaggatcg atgaacagat ctcactctta cacaaatctt    418080
     ctacaaacgc atgccgctgc cgctgccgtt ggaacaacaa ctgccagcta tggattgggc    418140
     gttacagccg cctcctccac tggtactccc aagattacac agctagctca acaaatggtt    418200
     gccaatcaac aaagccaaca gcagaatgca agcgcacaag gtcatgtagc ttctacctct    418260
     tcaccagtta ttagtgttca atccaatcct ctattcagtg gagaacaaca acaatcactt    418320
     ctaagacaaa caagtggctt aacagcatct tccagaattc cttccgggta ctcttccaat    418380
     caaatgtaca ataatgtgaa cccattgcta agaaataacg gtatttcccc accagctggc    418440
     caaacagctt taaatatgac ctcaatccat aacaaccaga gaatcccaca aggtttccca    418500
     gcatctgcat ctcagttaca acaacagcaa caacagcaac aacaaacata cggtcaaaac    418560
     tcaaatcctt taataccgca gcacactaat gaatcggctc actctaacta ttctttgcag    418620
     tccctacatg atgacttaat gaatcagcag tccaatacct ctgttttagg caacagtatc    418680
     tctgctacaa atactgctaa cgcctccgat atgatctaca gaacattgag ccaatctaga    418740
     tatgaggacg gtcttgaaca aggccttaac agatccttga gcgcattgga cctgactggt    418800
     aaggaccagg aaaattcttc aaacgataag aatgcaggct ggccttaatt atgaaaagaa    418860
     atataccagt aacgaaaacg aactcatgct aatgaaatga cttacgtaca gaatcctgat    418920
     gattttcacg attttttttt tttacatcta attctctttt ttctaaaatt aatgaacagg    418980
     cttttaacaa cccactactt tatagataat atttggtaaa ttcacgtcgt ggttgtcccc    419040
     atacaagaaa attgtcacct tctatctttt cttcatctca attgcatgct taaacacgcg    419100
     ttcagaatat tgtccaaact caaatctcaa tgtgatatat gcctcacttg caaaatttat    419160
     tccttaccat ttaaaccaat caatttttgc aacaccttga cttttttacg tcacgcacag    419220
     gggggacaat ctcaacaatc tcataacata gctatgaaaa atgagttagc tacctactcc    419280
     ctattgcaac aactattttg cctaccaact cgacgttaat gatattattc tgcggaatca    419340
     taagcattct atacatggtt tcaacttttt cagcgaaaca ttggcttctt gattctcgca    419400
     ataccctcca tttcaaaatg tattttaaaa aaaacaacta atatgtactt tcttatgtat    419460
     tattctaact aaattcatat cacactactc atagttggta cagcatgcaa gaggcatgat    419520
     acgattaagt cagagcttat tgttgcagtt cagtcacatc actgaatacg ctgcatttct    419580
     tcattgagcc tgaattgatc acaaggtaaa caagtggatt acaccttaac tatgatgtat    419640
     attgggtaga ggacataata gttagcgtat gcatacaccg tgccaccgaa tctgcactac    419700
     aatcataagc tatatcaaat tatagcgcta cagttccata ggaaggaatt gcaaaagaga    419760
     accaacagat aattaaactt aaagtttaat aaaagatatt aacaccacaa agctagacag    419820
     taaagatttt aatgacctat caaaacgata atcggagtcc actataggaa gcaattacga    419880
     tactttacca gcaaaacaac aggaaatcta acagttataa gcgatacgaa gttgcctata    419940
     acttctataa atgaatcgag ccacacgaag tcgaaaacca gatcaactcc cgtcacaacc    420000
     gcaacgatat gattacaata ccattaatga tctgggtgca acccatatga caaatggtgg    420060
     aaccaatgtt gcatccataa caaccaatct atcgacaaat ccgaatgttg aaattcatga    420120
     agaagttttc gagaacaatg cgagaaaact aggtccctta aaaattagat atgattcgaa    420180
     aaaacttttg aattttaaga gattattgga ggttagatca gaaaatgcta tcaaagactc    420240
     tgaggcatct atccgagagt ttgatccgaa cggtgatagt gatgcactcc aaataccgga    420300
     ggtagacgac gatatcccat acagaggagt tgttgtaggc aaaaagaatt acagcactca    420360
     tcgaacaatc ccttcatcaa ctgatcgtga gttcttcagg agattattcc tagaatcatc    420420
     tacagctgca ttttacaatg gtaatgttct tttagggaat catgatataa atgataacga    420480
     taccagtcaa ccaccgaata agaaattaaa gaacgtgaaa gctgtaaaag aaaatccaaa    420540
     gacaatagaa tatgtataca taagagattc agaagtcaag acatggtaca cagccccata    420600
     tcccgaggaa ttcaataaaa ataaaatact ttacgtctgt gaatattgcc tgaagtacat    420660
     gaattcacgt tttgtatatt atagacacac actgaaatgc aaggaccata gacccccagg    420720
     taatgaaatt tacagagatg agaatgtctc cgtctgggaa atagatggca gagaaaacgt    420780
     tgtctactgc caaaatttat gtctactagc taaattgttc cttaattcca agactcttta    420840
     ctatgatgta gagccatttg tgttttatgt gttgactgaa cgagaagtat ctgaggatgg    420900
     aagaacagtg aaaaatcact tcgttggcta ttttagcaaa gaaaaactaa actcatctgg    420960
     gtacaattta agttgtatta ttactttacc tctctatcag agacgtggat atggccattt    421020
     cttgatggat ttttcatatt tactctctaa aagagaattt tcacagggca ctcctgagaa    421080
     accgttatct gatctaggcc ttattactta tagaaatttc tggaagttaa aatgtgctga    421140
     aacacttctt tatttgaaga atgaacttaa tttggaagat agtgagagtg atgataaatt    421200
     tcctctggtc tctatagagg atctagcaaa tctaaccgga atgcttccaa ctgatgttat    421260
     acttggcctt gaagagttag gcgtatttta caggtgtccg gatcctaatc aaaataccac    421320
     atcgtactgt attaaaatcg attcttggaa tagaatcaag gccattcgtg aaaactggct    421380
     aagaaagggc tatcagtcat taaaaccaga aaacttaatt tggaagccac taatatatgg    421440
     cccatcaggt ggtgtaaatg cgttaggaat ggtagaaccc cccagtttgc cagaagatcg    421500
     taaaacaagt atatccagtg agccgaattt ccagaacaat ccagttgact tctttggtag    421560
     ccatataacc atggtgaaga agtttatgac tgatgatatc gaagatccaa gggacttaga    421620
     aattctgaca atagacaata ttaagaagag aaaactatct gttggcaaaa acaacatgtt    421680
     gcaacagagt tgggagattg catatcaaga tccaaggcct gttgataaaa aggatactac    421740
     tgcacgtaaa gctccctctc ttctttcttc aaaaactact cgaaaggaat ccttgatgtc    421800
     tgctgagacc gaagatgtac tcccttatga aaaccaagaa atggatgata cttcagtagt    421860
     attagaaact gaagaaagcg accctgacga caatgattac gatgaggagg atattaacga    421920
     gaaagtcata tcttctgatt catcatcttt agtggtgtct tctgaggagg aaaatacaga    421980
     tgagacaata ccagtcagaa gatttccgcg aaggcatgct tctgggttag atgatgcatt    422040
     ggatgacgat agagacgaat tgatagatct tactacctca agacagaaaa gacaactgag    422100
     gaggatgtga tatgaacatc aaaactgtta atagtatata aaagttttta ttccatctaa    422160
     ttattcataa aaagtacatt tgtgcatcat gcaattaact tttgcacaga aactataaaa    422220
     aactataaac tcatgacatg aaacatttaa tgattgatta ataataacca tgatatacga    422280
     tatatgcaat aatgtaagct atctagccag ccagactttg ttattttctc ttgttaaatc    422340
     ctcaaaccgt gttgtcacag gtaattacgc gagaatgtat ctaaacgcca tttgatttca    422400
     ttttctgatc tattcggtag tagaatagat aattccatga gtgatagatt cctgagtttg    422460
     ttttctgtca ataattggtc ttcttccaaa gaccaaggca tgaatctgga attattacca    422520
     ctattattac tacaactagt aacaccttcg tccttaggtt ccatcccatc taaagaatga    422580
     gaagcatagt ccatagcttt cttttgaaag gcagaactat gaccaactgg attatccatg    422640
     tattgaacct tgaaagtgtt atatgagttc tcatatgtcc cattctctgt agaagtctta    422700
     ccattaggtg agctaattgt gttaagagac tgtgaacttg tggcttctct tttcacgttt    422760
     gagtttttcc gttgcatctt tggggctgca tgtaaattac tggcggagtt actatgattt    422820
     ataacaaaat tattcgttat agagttcggt gccgatatta tagaaggcct tctagagttt    422880
     gaagtactag aaatgttgaa tgacgacctt ctagagttta ctgaaaatga atttttcctg    422940
     gacttcgaag taatcaatgt tgtattcaaa gcattggcta agttcgaaga aaaggatgca    423000
     ttttgaaggt actgcccacc agagccaccg ttaaaagttg atggtggaga aattgataag    423060
     cctgaaggac cagggttgta ttttgtattt gctgagctat ttgtgctatt ccctacaggc    423120
     ataggtgggt gtgtaaacga gttccttcta gattttacta ttatctttgg aatgaaaccg    423180
     aagttttcgt tctcaatatc atcattaatt gcgctaccat gtgattctct ggtcttcgtc    423240
     tctttaaatt tgataccttt caatgaatgt aactgtggtg atggtcccaa cgtatgagag    423300
     taagaccttg cctttgggaa cttatttttc gctaacgatg tatgacttct ctgagtggaa    423360
     ccgggcgtca cagagcctgt aatagactgc gtggaacccg atatggcgtt actaggaatg    423420
     gtagccactg atgttcttct cgagagagga ataatgggga agtgcaagct tgcccttttc    423480
     cccttttgag tgccgttagt gccgtttggg gtcaccgacc cgtggctaga agaagtcaac    423540
     atagcagtag cagcaacagg agcagggctg gcgcccgata ctactttgtt cagcttcgta    423600
     tccatctcgg aacccaaggg agttccgttt ccgttagcag acccgggata acttacagga    423660
     atgttattgg ccagcttatc gttattatcc actgggggtc taaatggctg ctctgaggcg    423720
     cttctgctga gctgagcgtt ctcgatctcg gagagtctct tcaccaccac gttgtactcc    423780
     gagatgtcca ccgtcgcagt cttgttagac ttcaggtttc ctgacttcag ccgcctccag    423840
     cggaactggc acgcgttggg cgtcctgttc tcgaagtaca gcgcgatctc cttccagccc    423900
     aggttcttaa tctctttcaa gtgtctcagc agtatatcgt cctcggggtc ccacgacgac    423960
     gggttcttgg cattcgcatt atcctgcgac gcggacgccg agttcgatga gtttgacaca    424020
     gaatttgaca ccgagtttga cacagaatct gacaccgagt ttgacaccga gtttgacacc    424080
     gagtttgaca ctgagttcgg ctcaggcacg ccatcggaac ctactttatc cagctcgggc    424140
     gatccaacat cagagttgtt gttgctgcta agcggcgtcg atatcgacgc cgcagcagca    424200
     ctcttgtctc tgatcgcagc aaccccatcg ctctcgctct cgctctcccc gtgcttctcg    424260
     ccgacatcca tcatcagcgc cgaaatcatt tagtcatgcc actgttccgt agtcacccca    424320
     gctcccaagc aaaacagcaa tcccgctctc ttatactatt tttttccttt cccatagcga    424380
     tgcgatgagc atcatttttt ttttttttca cttttcgctt gtcaacctca tcgcaaaata    424440
     ttttttcact tctagaggac gcaagataag gacttacgtc cgcagtaacc ctcccaagag    424500
     cctggtcctc ctagccttta gccctcttag cctgccagac agcactggca cacagctctg    424560
     cactgcactc tctgtgcttc tcgacacacc tttcctaatc gggacacccc tgtcaaagcc    424620
     cctgcgcctc tatctctgtc cctctgcccc ccctccaact tgtcacttag gagggccggt    424680
     gggggggggg gggagccacg tcttctcgct ttcggagctc cgcggggtat gtgcgttttg    424740
     tacgtgtgga ggtcaggtgt ttgtacgtct tgtacgtgtg ggggtcaggt gtttgtacgt    424800
     cttgtacgtg tgggggtcag gtggttgtat ttgtaatgtg tgatatggat cacgtgatgt    424860
     atacatcacg tgatcatatc tatactcccc aggatgtacc tctctctctc tctcttcttt    424920
     ctctgtgcgg tgctgctgcg gagggcacct ccgccgttat tcatctgctg gataaaggtt    424980
     cctctgccca tagataaagg tttctctgct catacacaaa gcactaaccc ttggtctgca    425040
     actcccctac ccacacgatg tcaattgcca ggaggatgcg gttctatgac atcgcgctga    425100
     acctcactga ccccatgttc tttggggtct acagaggcaa gcagaagcac gaaccagata    425160
     cgtacgagct cttgcacagg gcttacgacg ctggagtgca cgcctctatg gttacggggt    425220
     cctccatcga gggctcaatc gacgccatca gcctggtgaa acggctctca cacaaggacc    425280
     acatacagat gaaactgttc tacaccgtag gcgtgcaccc atgcacggtc aatgagttca    425340
     tggcgcatac catggacggt gcattcaaca tacacgaggc ctcaaacgac tcagaccaca    425400
     acgaccgcct gtacagacag gttatagaga acccgcaact ggcggtgccg aaactcagag    425460
     agctgcacct cttgcaagag aaggccatgc acgacccgca ctttcgagca gtcggcgaaa    425520
     tagggctcga ctacgacaga ctcaactaca gctcaaagga gatgcagatg ctcttcttcg    425580
     aggaacaact gaagatcgca tgcatggccg ccccatctaa accactcttc ctgcacatgc    425640
     gcaactgcgc cgctgacttc atcagcatcc taaggaaatt catcaacggg ttcaccgaca    425700
     ccgaggacac tttcaactgg atccaaatcg ccccacatag aaacataaag cacggcagca    425760
     cttactacaa actggacccg acggtgaaat tcgtagtgca ctcgttcact gactccctcg    425820
     aagacatgaa agaactcctg gccctctccc caaattgcta cataggcatc aacggctgct    425880
     ccttgagaga ccaaacaaac attgagtccg tgagacaact gcctctcgag agactgttgc    425940
     tggagactga cgcaccatgg tgtgaaatca gaccttctca cgcatcaagc gcttacctcc    426000
     aaggctatga tggctcacgg tacaagcatg tcaagaagga gaaactagac gaatgcttga    426060
     ggaaggacga aactaacgtg ctcgtaaaat cgagaaacga accttgcaac atggaacaag    426120
     tagctgtagt gatagctaat ataaaggagc tccctgtgga agaagtagct gaacgagcat    426180
     gggaaaactc ttgtgacata tatggattgt aataatatat atggactgta aagatagaca    426240
     tatagactgt aaaatatata caaggattgt aaatctgatt tgaaattgtt tgaacatagg    426300
     atccatgctt aaactagaag tattttctta aaattcatat atagattgtg cttatggatt    426360
     gtaatatcat taaagacagc tcgcttatat ttacacaagg cttgccgtcc tcaataaaat    426420
     aatattaatt atattacagg atttgaaagg caatggtaac gattttcaaa atcgatcaga    426480
     ctatgtagtt tcctttccag aaaggaaaca tcaatattac aggatggaat aatgcattga    426540
     tttttattat tgacacatag atcggtaaga ttagtggcca attgattctt cagggttggc    426600
     atgtgtgctt tccgtaaact caatatcatc gttcttttca cttggactgg tttctccagc    426660
     agcagcttcg ctcaacgatg ctaacatatc cgcaagtgca gagccttgaa aatgctgaac    426720
     attatttgga ctttggctga ttttgatacc tgcctcgagt aacgattcca gcgaggtaaa    426780
     gtctatgact ccaggtgact tgccattttt tgacgtatcc actggtccct tagctgttac    426840
     ccctctctct tggtttccat tcaattttga accaggtgct gatctaggag ccgtaatagc    426900
     aaaaacatct tcatcacctg tttcttgatt ctttgcgaaa ttatagaatg agaaaacctc    426960
     ctttctcttt tgttcaaaag tagtcgaata agagtaattc tttgcccgca tgcgctcaaa    427020
     ccattgctcc aatgtttcag agtctttcaa taaagctaca acaataatac tcatattgtc    427080
     acaaccaata ccagagcctt ctgtgcttgg cgcacaacaa atgtcgacga ttcgcgatgt    427140
     aatctctagc aaggataact ccgttttttg aataccatag tgtaccatat cgacacactc    427200
     ttgagaggac agacaatccc agataccatc acaagccaaa ataacgaact catcattctc    427260
     aaagtctagc ttgtgttcaa ttacatctgg gacacatgtg accatttgct catgaggtaa    427320
     aagctttgga ttggacttgt attcaaagtc accaatggca cgcgataatg ccaagttacc    427380
     gtttactcta ctcatttgaa cgaaaccatt agctgctgta attcttgcag tttcacccgg    427440
     aagagtaggt ttgtgatcaa atgataatgc ttttgcaaga ccaccagacg ataacactgt    427500
     tctactgtca ccagcattac cgcagataat tacacccttt tcctttgaga ttagaacaga    427560
     ggtggcggta cagccactat ggtcatcact aatggaagac tgcgttgcca gctgttcatc    427620
     agcagccaag taggcatccg ttaaaacctg agcaagatca ccagtttcat agctcttctg    427680
     agacttgact atcttctcca tacgttcacc gcagaagtta gccacgtagg aacccccatg    427740
     gccgtcaaac acactgtata gagccacatg gccagatgat tcatcggcgt tcaagtttaa    427800
     ttgggcgata tgcgtatcct ccatcgacat acgccatcct tgcatagcac agacagcata    427860
     tgctgtccat ttgtcgctac cagactctgt ctctttatca atgactgggt tcgaaagaat    427920
     ttgccccatg acttactgta aatagtttct ttgcaatgaa tttggtctat cagataatat    427980
     agcgtaacct tataatagac ttgaaataac acaccgagtc tttataatta atccaattgg    428040
     gcgaagaata gttgggagtt ctttatgggg gtgacaacaa cttgtttcgg ggtttagcac    428100
     cttttccagc tagagtctat gcgaggccta atactattcg aagcaaaaaa tcaaaaggac    428160
     tagctagggt tgccagataa tatacaaata ggcgtctgta gatcctaatc tcaatctatt    428220
     ccgcagttat ctaatagcaa tgctcagtag ttgatgaaat gccctttgaa atttcagagc    428280
     aattaaatca acaaattagt agaggttata aataaggaca acgtctgctg tgactctaga    428340
     aggttgcctc gagagaagtg atttacagaa agcttctcta gtgcaagata agcacacaag    428400
     gcagacccac accccatctg gacttcacat gggaaccatc tctgcccaac ccctcaggca    428460
     attgcacact ctccctactc cctcctcccc cgaagaaatg taattggcat ctcttttctt    428520
     tgtgtaaaac ctttctgccc atcagtttat gttggagcac tctgctatgc gttcgttatc    428580
     catacgtgtg tgtgtagtac accttacaga ggctctacag gatttataat agaggcgatc    428640
     ccaaggttaa tgggctggac ctcttcctgt actatcacca actgtgtata tcactaggat    428700
     gttgggcacc taacaactaa catatatggt aggttttgtt gcacacctat cttgactcta    428760
     ctgctgtttt tgttaccaag aatgatgtaa tagttatggt tacagataag atcgatgtca    428820
     agtagaacaa catcaagatc gagatcagga atatgagccc cacaccactg tgaacccaca    428880
     tacaccattt ataaagtaga aatgtatact ctttaacaca gtactagtgt tgctcccatg    428940
     actcttcttc acaatctttt tttgcaaggc agagaagcga tgcgatgagc tttgccaaaa    429000
     taattgccaa aaataataca aacgagtaca gttaacagac actttttatg tttgatctgc    429060
     gtactatagt ccctgtgctt ttcttaaggg caacaccaga gtgaataatt ggtgcgaatc    429120
     atggggagca atataatacc atcatttttc ggcattgctg tagcttcttt ggcgactggt    429180
     tactatttag gcaccttgag caatggcgac ttactaagtc gcaagaagaa agagaacaga    429240
     aaaccaacta aggatgagat attgaagaaa tgtaaagaaa ctgctgaggc aactgcaaat    429300
     gctgaaagcg aagacgagga agagactgac gatgaggatt acgacgaagg cgagctaagt    429360
     gacgaggaaa tcgagtctct ttccctaaac gatataccag gtgaagtaag aatggctctt    429420
     gtaatccgtc aagatcttgg tatgcaaaag ggtaaagttg ccgctcaatg tgcccacgca    429480
     gcgctatcat gcttccgttt gatagctact gatccaaaca aaatgtcata caacccagaa    429540
     ctaacaaaga ggtggctaag acacggtcaa gccaagatta cattgaaatg ccctgacaag    429600
     gagaaaatgg atgaactata cgcaatggcc atttccttgg gtgttaatgc tgctgtcatc    429660
     cacgatgctg gtagaactca aattgcagca ggaagcgcca ccgtactagg tcttggccct    429720
     gctcctaaag cagtcttgga tcagatcact ggtgagttga aactgtacta aagtacctag    429780
     tctcatttta taaaatagaa gcttgtgatt tgttcttctg taattaatat atcttttaaa    429840
     agtaaagaaa taacaatatt tactatttgt gcaaatcgag tttacaatta taccattttt    429900
     ttggactata aaaaaggtaa agtgcctatc atgcattatt tccatctttg gacaacgaca    429960
     gcattcacca ggccagcctc ctcgacagag atatcagaat tctcaatcgg cttgactggg    430020
     aaagcatggt ttaatgtgaa ttgtcttgat ttgtcggtag tgttgcttga aacatattca    430080
     tatagagatc tcacactgtc ggttgcatta caacggaaaa tttccctttt cccactagca    430140
     taccttattt gaatagaaga gtcacctttt ggtacttcct ctgttttttc tgctttagtc    430200
     tctgtctttg gaacagcctg tgttgcagtt gccacagcgg gttctggagc atcaccaggc    430260
     acaggagatc ctaatctctg tcctctacca tggaatccct ctatcttcct ctttggaggc    430320
     ttatatgatt catcaagttt cttatgaaca ttaacatcga cctcttgtcc aaactctaca    430380
     ttcaataatt tcaaaggtgc cctaccttgg ttcaattcat tcaagtaaaa actgttggca    430440
     gggtcgtcat acctgtacaa ttcaccttcg ccaacttgaa aaccttcctt ccagaatgtt    430500
     atatctctgg ttacacgctc aggtgtcctt ctgccacttt cagtgttatc ttcaacaact    430560
     tggttcgttt cgcctacgga agaccccaat ctgtatcctt tacctatgaa atgctgtgcg    430620
     cttctcttgt tctctgattc ttcttgcgaa agactctcac cacctctctt ggctttctcc    430680
     aacaggtcct tgataatgtt gtttgagtcg ttaggatcag ttacctccag tccagatact    430740
     tcaccaccgg cgaaggtatt tctcttatca tcatcgtcat cgtcgtcacc actcccaccg    430800
     ttgctcttta ccatttggga gaaactcatg aatttactgt tcttcttact atcatattta    430860
     actggctcgg aagattgaga aagtgctcta ctgctggtcc cttccgctga gcttggtctt    430920
     ggcgattcac gtgtaggacc ccatctctca tcgttctccc tttgctcctc ctcagattcc    430980
     atctgcgaag catagtaagc attcaatgca ccacccaaat cgttgtcgta ctgctccaga    431040
     tactctctgg cgacatcaat agacctatcg gtcaatgtca tgaactgctg aatgacttta    431100
     tcagaatcgg acatggtttc ttctacaggc taatttcctg tgtcgccttg actgggagtt    431160
     ctttggtatt cttttttttt gatgcaatgc cactgatata gcaattgatc tggttatact    431220
     cagcaataat agcgactgat ccatcaatgc taccggctca caaagttata gttagggagg    431280
     caacttcttt atccccagcc caattgcacg aagagtcccc ggtgcaagta aaagccgatg    431340
     agtgtcacgt gagggtatag gcaatgagca acttataatc aactagtccc ttacaatgag    431400
     atggttactg ttatgctgat ggctattgat atatatttat agtacagtat tcttgagagt    431460
     tattatatac atgctatgga atgatttacc taccgcagtg ggtttttttt cgtccttttt    431520
     aatcattaag gtattcctta tcgagtctaa accgttctct aaactcatca accgtggtta    431580
     tatcgttatt ccaacaggaa ccagttatac ccatggagat cagccctgtt atcatacctg    431640
     tggtgtagag cagtcccatc gatatgtctt tccctgtttt ctcgcttgtg gtcccagtga    431700
     aaggtttatg attgctcata aaattagtcc gtcttaacaa agagctatca actttcttgg    431760
     gggctacttt acccatcaac aaccgacagc tcacaagcgt caccattgtg gccccgaaga    431820
     aacggagcat ttccgttttc cttctgtctt gataccgcag cggtacctgc tgttcaacca    431880
     ttgttgttac aaagttcagg aacagatatt gtcacttatc tctttggtca ctgtaatagt    431940
     gtatatatcg ctatgagctg atgtagttat cggccatagc gtgactctac ttcactatgt    432000
     cacttataat cgtcaacatt cgcacttttt tcatcaccga ggagctcatc tcagggattt    432060
     aaaggaagga cagtcatcga gaaactatag agcacaatat agctggggac cctaaagttt    432120
     gacacgcaga cacagtgtac tcaagtattg acctaacatg catccacaac tagaggctca    432180
     gaggtttcat tgtatgtaca ggagttgcct atttatttca gattcggaag ttccagtgca    432240
     gattttacta acaacacaga taaataagct tttcttttgg atactgccaa tggtgtaact    432300
     catacgttcc atgtggtatt tatcaaggga gctgatcatt tcatctaaaa cagcatgcct    432360
     agactatatt gaagctcttg acaaatgtca tcagaaggag tactacaagc gtatgcttgg    432420
     actatgtaat aatgagaagg atgccctaac acagtgtttg aagcaggcca gtgccgagac    432480
     caaaaagaag gctatccagg agaacaagtt gaaaagagac aagctcgaat ccaaatggag    432540
     gaagatcgag gaagaagaat acggtgagga cgctatcctg aagatgatcc tggacagaga    432600
     gttaaagaaa agagaaggta aataaatgtg aaaaaaaaca gtagccataa ctgatggaat    432660
     caaacgctct acctgtaaat aataacattc caatgaattt cacaaattat atgtattacc    432720
     aattcataat aaaaatacta aaataaaacc tatgatacaa cttcggacgt aaagcactag    432780
     caacagacaa ttcaaaatca ataccaagcc aacagaacaa accgataaca acagattgaa    432840
     acactaacaa aagaaatata cagatagcac aatatcaaaa cgctattacc agattcatac    432900
     ccaccgctgc aaaccatatg tatacgtcat gtgatgtatc actttacaca aagaaacgcg    432960
     aaagttcaag atgggaagaa ccttcatttg tgctggtgga ctgcggcctt gtctgtggga    433020
     tgggtgagaa gataagaagt tagtgctacg tggccttctg tgcaagaaaa aaaagtagat    433080
     aaatatatta atagctttta cgcgtctgga agtttatata tagcatagaa tgtaaaaatt    433140
     atccatattg cctgccagta caataccaag agcatagtct ctggtgtcct cccagtatta    433200
     gcccacctgg gggtaatccc gtaagggccc ttaggttttg ctcgcgagcc tgtgatttca    433260
     cccacaatct cactctgctg acacacaaca caagctcatc gctctattct cttgccgtat    433320
     actaataaga ttatacttcg agttatattc agtatatcta ttgcctctat aacttatcta    433380
     ccaacagacc ataaaaagat attattgaac tttgtgtctt tgagagagtg ttaacagga