(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_3

ID   CAGLA1_3; SV 1; linear; genomic DNA; GRV; FUN; 502101 BP.
XX
AC   CR380948_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome B, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380948.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..502101
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome B"
FT                   /db_xref="taxon:284593"
FT   tRNA            join(complement(8842..8880),complement(8762..8806))
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        complement(10582..11136)
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_family="HOG000184835" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445489"
FT                   /gene_name="MTL1ALPHA1"
FT                   /gene_synonym="ALPHA1"
FT                   /locus_tag="CAGL0B01243g"
FT                   /product="Mating-type-like protein ALPHA1 "
FT                   /function="mating pheromone activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="positive regulation of transcription,
FT                   mating-type specific"
FT                   /biological_process="regulation of gene-specific
FT                   transcription"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57879.2"
FT                   /db_xref="EMBL:AAO25591.1"
FT                   /db_xref="EMBL:AAP06781.1"
FT                   /db_xref="EMBL:AAP06783.1"
FT                   /db_xref="EMBL:AAP06785.1"
FT                   /db_xref="GO:0000772"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0032583"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045895"
FT                   /db_xref="HOGENOM:HBG124301"
FT                   /db_xref="InterPro:IPR006856"
FT                   /db_xref="InterPro:IPR016325"
FT                   /db_xref="InterPro:IPR017931"
FT                   /db_xref="UniParc:UPI000018F3E7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q874P0"
FT                   /transl_table=1
FT                   /translation="MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSFGLNMLLT
FT                   KPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSIGNV
FT                   LKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQF
FT                   NFASPRCGFVNYIMAHASSAP"
FT   CDS_pept        11470..12102
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503091"
FT                   /gene_name="MTL3alpha2"
FT                   /locus_tag="CAGL0B00264g"
FT                   /product="Mating-type-like protein ALPHA2, silenced copy at
FT                   MTL3"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57881.1"
FT                   /db_xref="EMBL:AAP06786.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124304"
FT                   /db_xref="HOGENOM:HBG204049"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI000018F466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q870I4"
FT                   /transl_table=1
FT                   /translation="MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSL
FT                   PGPSSDILRFLSRNNLDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPN
FT                   HYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRR
FT                   RKQKSIYISLFDIHNIESGEYAYIEKVCYIIIIICHLFLVFSLSCLT"
FT   CDS_pept        complement(12803..13885)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445490"
FT                   /locus_tag="CAGL0B00286g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG57882.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG386563"
FT                   /db_xref="HOGENOM:HBG714501"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI00003B5F0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX72"
FT                   /transl_table=1
FT                   /translation="MSVYNKTPLIRQIFPSIPQMYLKHECFQPSGSFKSRGIGHLISKQ
FT                   SQRILGNGLGKKPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGA
FT                   NVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDF
FT                   KNKMIPLNKIKAIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMN
FT                   KVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIE
FT                   PACGAAVHLAYHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNI
FT                   NIPNVAENIIVRMPEVSVLA"
FT   CDS_pept        16533..17825
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446585"
FT                   /locus_tag="CAGL0B00308g"
FT                   /product="Similar to uniprot|P25591 Saccharomyces
FT                   cerevisiae YCL063w"
FT                   /protein_id="CAG57883.1"
FT                   /db_xref="HOGENOM:HBG124312"
FT                   /db_xref="HOGENOM:HBG204102"
FT                   /db_xref="UniParc:UPI00003B5F0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX71"
FT                   /transl_table=1
FT                   /translation="MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSI
FT                   ERLDDKYTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEIT
FT                   LSLNEIAQQDDETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNI
FT                   SFCPIHENLSVTEYESLPSSPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQLDK
FT                   YFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCN
FT                   SHESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSR
FT                   FSREQDREMTQLGSKTSKDLLTSVMTATPITTQRNNKLTFFDKFNSMFNFSTISEEQKT
FT                   TVEKNRSAESPRNDFVSIEELNEALTTNMVM"
FT   CDS_pept        complement(18031..21441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446586"
FT                   /locus_tag="CAGL0B00330g"
FT                   /product="Similar to uniprot|P25588 Saccharomyces
FT                   cerevisiae YCL061c"
FT                   /protein_id="CAG57884.1"
FT                   /db_xref="HOGENOM:HBG124316"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniParc:UPI00003B5F0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX70"
FT                   /transl_table=1
FT                   /translation="MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPN
FT                   NASTSSDSERLLNNVNKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKE
FT                   KTFSSEQNNIVVNQSDDISTQIINEYYDGGEDLDATDIIKNSTQVIYEKRKKNSIWINP
FT                   RNSKPKKINPTYDTSRLRNRSSYKTVSDDDIDDDLDDNDGVEETQATQIVSTEKDNSVT
FT                   TVNLNEEHETSSFLFSNIGVGKSLLFDSEPLIPTQKIAASQNDRSVEINKDDDDYRQTM
FT                   DASTQIIGATQHVPIETQNSYLQTIKDHEDKTVGSSKDLHTPNFNPNTSILPLFKNNSS
FT                   EEAQSETQIDVVHEEVHKTKENDTQMDDTQITEVLAITKIEQELENDERAITDKQTEYI
FT                   PKRSPNVLPAKSQFTKEKLLQNFDSSSSDEEDTILGEKQKDQNLSDSESLENNDIMTDQ
FT                   KTSVTPSSEYNGSDNEHSASISLRSSPISKPRWKSSSMILPAYVNNLKQKVENKKLQLS
FT                   SDSDDEVDSAVIYKLSNKSKATLLNLKVRLSKKKPVKKVHNEKDSTNLLFNNLRKATKQ
FT                   QIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQEI
FT                   MESDYEYSGDESDISNSDIVDNSSISSQQINYTEEITYGLKNSNESDKGDNSPAVINGP
FT                   IELELDNVDDEGDIEIKRSHRTSKKPFLFSDTESDFQNDDIITDASSSAERLPIDESQE
FT                   TSPENEDHDSSEDIDTEQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAE
FT                   ESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNK
FT                   ILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPK
FT                   SKAFFESMIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDF
FT                   VQKTLSFLHNDESTQEFQPSFIMSKEKGIGDMNALKSNSSLSFCSKLSTSRKIINDEED
FT                   VIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKL
FT                   VPPKNGPTVRKRNSNNTSRLFNIQNDPFD"
FT   CDS_pept        complement(22171..23184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351117"
FT                   /locus_tag="CAGL0B00352g"
FT                   /product="Similar to uniprot|P25586 Saccharomyces
FT                   cerevisiae YCL059c KRR1"
FT                   /function="RNA binding"
FT                   /protein_id="CAG57885.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG023192"
FT                   /db_xref="HOGENOM:HBG330750"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI00003B5F0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX69"
FT                   /transl_table=1
FT                   /translation="MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLF
FT                   PKYREAYLKSIWNDVTRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLL
FT                   ARSVPFPQAVKILQDDIACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCY
FT                   ILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSR
FT                   FLPMFKKRNVARKKPSKVKAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLH
FT                   EQREKQAEKQILKDEERRKDYIAPKEDEYKSSHKSTKKRTSNEDKGDKDSKKRKRE"
FT   CDS_pept        23693..24058
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351118"
FT                   /locus_tag="CAGL0B00374g"
FT                   /product="Similar to CA0039|IPF3998 Candida albicans and
FT                   KLLA0C00528g Kluyveromyces lactis "
FT                   /protein_id="CAG57886.1"
FT                   /db_xref="HOGENOM:HBG124259"
FT                   /db_xref="UniParc:UPI00003B5F0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX68"
FT                   /transl_table=1
FT                   /translation="MSKKQSTKTSKTSKTFSSRSKSSVPKKTGVNKISASERKKSKILT
FT                   ARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDKKVREHIEKINSE
FT                   TNSDMLKQLELMSGFSL"
FT   CDS_pept        complement(24498..24764)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503336"
FT                   /locus_tag="CAGL0B00396g"
FT                   /product="Similar to uniprot|Q96VH5 Saccharomyces
FT                   cerevisiae YCL057ca"
FT                   /protein_id="CAG57887.2"
FT                   /db_xref="HOGENOM:HBG059732"
FT                   /db_xref="HOGENOM:HBG323822"
FT                   /db_xref="InterPro:IPR007512"
FT                   /db_xref="UniParc:UPI00017BD8A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX67"
FT                   /transl_table=1
FT                   /translation="MSNKEETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVV
FT                   TSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIFRSTAGLRSVKV"
FT   CDS_pept        26584..28815
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046804"
FT                   /locus_tag="CAGL0B00418g"
FT                   /product="Similar to uniprot|P25375 Saccharomyces
FT                   cerevisiae YCL057w PRD1 proteinase yscD "
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG57888.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG058255"
FT                   /db_xref="HOGENOM:HBG678447"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00003B5F10"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX66"
FT                   /transl_table=1
FT                   /translation="MFSRSLSIIGRRVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTY
FT                   TSSIRNYSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAID
FT                   NPTIENLIVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRV
FT                   DLFKQFDLIWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIA
FT                   DNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPV
FT                   LKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKN
FT                   ADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYL
FT                   KENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLD
FT                   TPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDK
FT                   PSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKE
FT                   LLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLD
FT                   IKKLWNDLREKICLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFK
FT                   ADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH"
FT   CDS_pept        31504..32313
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446587"
FT                   /locus_tag="CAGL0B00440g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57889.1"
FT                   /db_xref="HOGENOM:HBG124273"
FT                   /db_xref="UniParc:UPI00003B5F11"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX65"
FT                   /transl_table=1
FT                   /translation="MAFSINNSTCHFTINKKTHGTVRFLEQESDDEDYHYATGLLKKRK
FT                   SVSTPRTVDMLINSNSNGASHISSTITPCPTPDPFKKRVEDEVFFQDIPQSPVSMASST
FT                   PEVPRDDIVARERCFDFIVQSIDEVWARYVDSSSTAETKTYYLRSGGNNLNSADSSFQS
FT                   TSDDSSCFEDDVEVSEEDGYNSEVTSCTEFDESNIKSLQSLKYRLTNAKNDLELNYDSP
FT                   DLTDSMEFWRRWDMIKYSAVELMEDDDDDELIESVIEELERGRSVGL"
FT   CDS_pept        33144..34118
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503337"
FT                   /locus_tag="CAGL0B00462g"
FT                   /product="Similar to uniprot|P25583 Saccharomyces
FT                   cerevisiae YCL055w KAR4"
FT                   /function="methyltransferase activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="CAG57890.1"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG059726"
FT                   /db_xref="HOGENOM:HBG587058"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniParc:UPI00003B5F12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX64"
FT                   /transl_table=1
FT                   /translation="MIEDELYNNKDNFSEPKPTMYNQIDFKPVRSPFSNNYSSNYVHTS
FT                   VVPHKFVSNVENPVEGYPKLQKLFKLKEQQIAKISSKAYGYRVDIEKMIPTLNDWINKE
FT                   ALVFDVIMLGCLTDNQFIYPLLTQLPLDKLISKPGFLFIWGSARKIQELANLLNNEKWE
FT                   KKFRRSEELVFVPIDKNSPFFPGIEQEDTTLIERMQWHCWMCITGTVRRSTDGHLIHCN
FT                   IDTDMTIETQDTKNNAVPDHLYRVVENFSSSTRRLHIIPARTGSNIPVRTRPGWVIMSP
FT                   DILLNNFNATTYKHDIEQIGTNIPTTEEIENLRPKSPITRNAE"
FT   CDS_pept        35991..38504
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046805"
FT                   /gene_name="SPB1"
FT                   /locus_tag="CAGL0B00484g"
FT                   /product="AdoMet-dependent rRNA methyltransferase SPB1 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA methylation"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG57891.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0031167"
FT                   /db_xref="HOGENOM:HBG200891"
FT                   /db_xref="HOGENOM:HBG410779"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012920"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI00003B5F13"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FX63"
FT                   /transl_table=1
FT                   /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLE
FT                   KSKVVIDLCAAPGSWCQVASKLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSRL
FT                   RGYMKTWKADTVLHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRS
FT                   KDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDPKEVFEEL
FT                   PDGPQNMEAKIYNPEKKVRKRQGYEEGDHLLYHECSVLDFVKSEDPITVLGEMNKFTVE
FT                   QDDPEWKILKRLKQTTNEFMACIEDLKVLGKKDFKMLLKWRKASRDILGLDKDEDKGDI
FT                   EIEPLNEEEQIEKELRDLQEKQKQKQKREKRRKNEEKQKELTRMQMNMLTPTDIGIEAA
FT                   NIGRDSLFNLKTAEKTGILDKLAKGKKRVIFTEDEIAQDNDLHIDENIVIRDRHDMNEV
FT                   DDLEGELNAMYQDYKNRKAERDANFRAKQARGGDVEDEWTGFEGTKDSEDENNEPKDYI
FT                   ESDDSELSDEDDDEAINQLISKLKSQNNGSKLSSQAKALFSNPLFENVQPILQSKTDDV
FT                   VDSESVGDATKISNKRSYNEMKKEDLSDSSDEDSSSESDFEIVANDESDGDIDSDYDSD
FT                   EERKRTTKEKYDKDIDIATVEAMTLAHQLALGQRSKHDLVDEGFNRYAFRDTENLPEWF
FT                   LEEEKQHSKVNRPITKEAVMALKEKMKALNARPIKKVAEARARKKMRAVKRLEKIKKKA
FT                   GLINDDSDKSEKDKAEEIAKLMRKVTKKQKTKPKVTLVVAHGKNKGLSGRPKGIKGKYK
FT                   MVDGVLKNEQRALKRIAKKHHKKKK"
FT   CDS_pept        complement(38644..39894)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446588"
FT                   /gene_name="PBN1"
FT                   /locus_tag="CAGL0B00506g"
FT                   /product="Protein PBN1"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57892.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124278"
FT                   /db_xref="HOGENOM:HBG204076"
FT                   /db_xref="InterPro:IPR013233"
FT                   /db_xref="UniParc:UPI00003B5F14"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FX62"
FT                   /transl_table=1
FT                   /translation="MESVRHRIALLFANEADIQDVETVEDGVIVFPNSNITIQDRWTYA
FT                   IDYELDSIRRISWRNPSSTRQFSVIESRLAPGFNIYSNDKEARLNLFGIQPVYSPMYKS
FT                   LHSETWKSINEILPGGKNLNIPWNPELCDYDILITANTVQVFSYCSLVEKKKFVKDAGK
FT                   VEIGLFHVDTEDEEDINLSGLRCTWEDTSNNIGKCEKTTLFYKPFHLYVDDSSDIAPIT
FT                   IENTNGLHPKMKIDLSGIRKDKDCRHFVFSQLPSEIFVDKFQSPGSIVFGLDDLELPDY
FT                   KVNSLSWGSESIVTLKEGQINEITYFSRYLEPKERASNKTVGFEPILFKACQVGKEEDL
FT                   SNPFYSRSLGYEAYFSENTKFYHINSTSVHVNIPYPNKNDIGNIEYTTFGIVVLAICYL
FT                   IYKLLRPSRKLSTVKRD"
FT   CDS_pept        42677..44698
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503338"
FT                   /locus_tag="CAGL0B00528g"
FT                   /product="Similarities with uniprot|P25579 Saccharomyces
FT                   cerevisiae YCL051w LRE1"
FT                   /protein_id="CAG57893.1"
FT                   /db_xref="HOGENOM:HBG124282"
FT                   /db_xref="UniParc:UPI00003B5F15"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX61"
FT                   /transl_table=1
FT                   /translation="MTDTQQLKISVPPPPIVSAPGGSTPTQSNFSTPSKRGHRHKRSFA
FT                   ISGDFEFLKQPPATAPKPSIHTMSPEPHILSTPPPKHEQFRPNTQPAVSFVTQQHEKSD
FT                   YELSYSGSGTGMNEVSQRNLSPFKVPPTVAKGTNLLTPSPRFFVSEEPRFSSPCKGVPD
FT                   AIINLDDVLSTTKPRSFKSHRRTESAPAFLEIVLNGNNGSAYNDAGLMIKEEDDISENN
FT                   DADEEKRSVSENLSKLPTRARSQNDRTKDSSDYLPSVLLSPLRPNSPLKQYSTKYARGA
FT                   NDNEIAEKTLDDGDDTTLQNEATNKYNSLKIKRQKQRYSHYTRQLPTKVAGNAIQSQTL
FT                   KEQNSSTSLSSSNNSKSPLSVALTPSKNGNTPVTPASFSESNPNCNSGHNNYNNSTHIT
FT                   GSHSKGLDAPRFPMSPFRPYGSSTTAHYLDKGHQNYSKYRRNSAGCVSSSQTFAYQPQV
FT                   YDMPENLRDCGVKLTEDEGSKRTSSPTLEDNEGEEKSISQTISNTTFDHQTDQIMDNGS
FT                   RNPLSQVSSNSTTNLRSGTDSRQLSSEILLGEPGEAVDLSSLNSRTREALFGLVSLTFD
FT                   DNSPSPLIAEKTGSSYASSKRYDHPQFHDNRPVTPDPNTRENRHISDGAIESKSNFSIK
FT                   STPRSSSLNKDEIHRQDPGKMRKHRSKFDKFMNMFSKK"
FT   CDS_pept        complement(45168..46124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197928"
FT                   /locus_tag="CAGL0B00550g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="ATP adenylyltransferase activity"
FT                   /function="ATP binding"
FT                   /protein_id="CAG57894.1"
FT                   /db_xref="GO:0003877"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG059723"
FT                   /db_xref="HOGENOM:HBG397523"
FT                   /db_xref="InterPro:IPR009163"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019200"
FT                   /db_xref="UniParc:UPI00003B5F16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX60"
FT                   /transl_table=1
FT                   /translation="MIPETVGSLIAQKYKSAKENDHLHFIETESKAIKDDDSGMNFVIS
FT                   YTPSLLKKPERADAQKDGTDPFEKPEPELTILEDLNEDGQFKLLLNKFPVIANHTLLVT
FT                   KEFKHQNTALTPPELMVAYKLLCTLDKTESKRHMVFYNSGPQSGSSQDHKHLQMLALPE
FT                   DFVPFQDNLCAGKPHFLPDFKTEPLQDDKVSFAHYVLPMPEDSDSVDEDLMAMCYISLL
FT                   QRALTFFQDWTNEKPNMEKSYNFLLTKKWICLIPRFRTQAESLEIGFNAVGYAGLVLVK
FT                   KEDVFQKITEKPELINDVLLECGFPNTAGTKPTEYHY"
FT   CDS_pept        complement(48898..49506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446589"
FT                   /locus_tag="CAGL0B00572g"
FT                   /product="Similarity"
FT                   /protein_id="CAG57895.1"
FT                   /db_xref="HOGENOM:HBG124287"
FT                   /db_xref="UniParc:UPI00003B5F17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX59"
FT                   /transl_table=1
FT                   /translation="MPVNCCRDLKKGPISRVYGMACSVTSSASCNEGESRSFSPTAIHE
FT                   NKERNWDPNKKKKISRVSRTGSQDASTPLPPLPPTFHCCTIETSTLLGVGGELSESDIR
FT                   SWSIRNLVQGSEFYVEHFEIHAKITRLFFSPPKSILGAFGCDVFTDEHFLYGFLCWKDA
FT                   PQVVTNNTKFRVLPFVLKWPNENASNSNILERGVTIRKV"
FT   CDS_pept        51485..51682
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046806"
FT                   /locus_tag="CAGL0B00594g"
FT                   /product="Similar to uniprot|Q3E6R4 Saccharomyces
FT                   cerevisiae YDR524C-B"
FT                   /protein_id="CAG57896.1"
FT                   /db_xref="HOGENOM:HBG124291"
FT                   /db_xref="UniParc:UPI00003B5F18"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX58"
FT                   /transl_table=1
FT                   /translation="MQFKNIVAAAIALGVASAANASNMSNKSNHSNVTTTKISTGAANS
FT                   NALSAGVFGAAVAAGVAFLF"
FT   CDS_pept        52916..54166
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046807"
FT                   /locus_tag="CAGL0B00616g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57897.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124294"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="UniParc:UPI00003B5F19"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX57"
FT                   /transl_table=1
FT                   /translation="MKLIFVATLLLTSISARVIDNYEELLTLPAIVHEDLIIRSCPTSL
FT                   QLENLAQVDGDLIIENCSQLAEINLQNLDYVQGDLKLQKLTSLVILDLPKLNHVRSFEL
FT                   RILPILNLMTLNPNMMVEKNLIISDTSLTNIDQGEFSNVKDLDILSINNNRFLEVFKFK
FT                   SIKKIAQQLAIHANAKEIEIDLPVLHSSRNITIRDTSAVSLPSLEFVKTSLELIENQFS
FT                   SLDFSKLRYVGGTLGIINNLNLERVDLNNLTEISGGLMISHNDKLRKVNFLSNLKQIGG
FT                   AIHFDGRFDDISFQNLKLVKGSAFIKSTSALLDCQKWINPIRGKSVVRGGKIECVNGKS
FT                   LHGNQAIPVGNPILPEKVNHENKNPGNKGFKNAKTATEYNQAKPLMNSLIESENSSNKK
FT                   RLSLLTNFLLMSSALFF"
FT   CDS_pept        complement(54266..55093)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446590"
FT                   /locus_tag="CAGL0B00638g"
FT                   /product="Similar to uniprot|P25576 Saccharomyces
FT                   cerevisiae YCL047c"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAG57898.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG124295"
FT                   /db_xref="HOGENOM:HBG395484"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019450"
FT                   /db_xref="UniParc:UPI00003B5F1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX56"
FT                   /transl_table=1
FT                   /translation="MDYYQQYTEFVAKNGQFCLFDGSLGVKPINSGTKVLVLDSSYNPP
FT                   HLAHFTLVKNAIEFYGHRGFSNFHVLLLLATNNADKRPKPATFDKRMAMMKRFADFISI
FT                   QNWNGMQVGVSCALTTHGKFVDKLVDISKLINFGIEMPVITFLVGFDTLIRIFNPVYYE
FT                   PVSVAEALRSFMESVEFCCLRREDGKYTLDFQEDYINKIINGEEEPQIPSNWGEKIHIL
FT                   SFNESVKNISSSMVRDVVNNKGSDAIDLKDSIPMVIVEYIKQNPSLFKNDIEE"
FT   CDS_pept        complement(55441..57681)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046808"
FT                   /locus_tag="CAGL0B00660g"
FT                   /product="Similar to uniprot|P25574 Saccharomyces
FT                   cerevisiae YCL045c"
FT                   /protein_id="CAG57899.1"
FT                   /db_xref="HOGENOM:HBG059716"
FT                   /db_xref="HOGENOM:HBG204082"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="UniParc:UPI00003B5F1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX97"
FT                   /transl_table=1
FT                   /translation="MADIIGYLFFLLALIKPLNAVFSDEAYIVDWQLQNLGSAYKCVMA
FT                   DEESNHLAIVSEWRDQSLLSFLDKNSGSIIFRELLPYHIQDVMHIGDEIYLLNEDGIVD
FT                   VYDSQHGFKKEVGVEVKEFQSSCNPNLKNVKVEKSEVRIVDEKSSMDVFKFELDENFEK
FT                   ILFFNSDYATKMEVLVKYSGNRFAFYNYLNDTISKRWTRDESLSTIVDQVILDVADESL
FT                   EPTEHEISVETSIPQVWKAYLYRLSTNSERFIKYLERFNYNPGKIITNLLGMDADAEDL
FT                   ATIQDQNMRFGYLKQLIVITDNGALQALDMLNKGAVKWSITTGINNPIRIFFSDAFRDL
FT                   TVFGKDGSYKIYKVDNSLHIKESISGSIGSPIESVQPFLVDNSTDKFVVKFTNGSKKVI
FT                   STTEKRISLDGNPVFITDHTKFTVEGFAVDKDGNAKSTWKYKVQPDEEIVSFRQRESKR
FT                   TVNVGTVLGSRDVLYKYLYPNLAAFAIVNKQSQKLTTNLMDTVTGQILHSQFHDDKMDT
FT                   DFPVNIIFGENWYIYSYFSMAPLPEQKIGVVELYESLTPNQKFSNNTGLTEAMAGVHKP
FT                   AAIANTFYFPDIIKRLELSETKYDITTKAVIIVLENGQITYVPKFLLNARRVEESKMSD
FT                   DDKKEFMATPYVPGIPLTDNLILSHYRDVILGEEIKIVSSATNLESTSNVCAIGLDVFC
FT                   TRITPSGQFDVMSPGFEKGTLLTTIGVLFLICVALRPYGASKKLKAIWTVRD"
FT   CDS_pept        complement(58189..59640)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446591"
FT                   /gene_name="MGR1"
FT                   /locus_tag="CAGL0B00682g"
FT                   /product="Mitochondrial inner membrane i-AAA protease
FT                   complex subunit MGR1"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG57900.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059715"
FT                   /db_xref="HOGENOM:HBG204083"
FT                   /db_xref="InterPro:IPR013911"
FT                   /db_xref="UniParc:UPI00003B5F1C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FX96"
FT                   /transl_table=1
FT                   /translation="MGIFTPPGKSDKRDANEEKPTLLGSNSKDETDVEKFWVRPSLGLK
FT                   LWGPLVPASDNKTGLWTLVAVQSMVGLLCFYRFKSLRIIDRNGALNSVGKSGIRPTSVL
FT                   VNEPKLYNSAFTQQEAVSGKPLVKKDIADFPTLNRFSTTHGDMFVNTTNVNRNTPSLSA
FT                   APVVASPVLSSAGHQSEIMAKSEAKNNWKSFFKSDNWLIFKKVFYLLAGSIILSQSMLE
FT                   ACRLTILRYDPWCEEAKTVREKKFFNNIVKFYHEGIDPTKVKVKDAVSGNIMPTNVPEV
FT                   RQSVALVRAQTEAENPIISWFGPIEYKPMTFSEFLDRLEYHLDMFEYFQGKRAANETAL
FT                   GFLTGIKTETSNLRDQNAQNRSRILKELKSEDQLSNDLSIKTGNAKIPKGTQRHGFSAA
FT                   ANRSIILEEDVAVPEDIDLNEIWTLYDPWLNLALETSLSIKFIPTVLINQDGITENSMM
FT                   DTEATIGDKAGVIPENSNKPEEPRQ"
FT   CDS_pept        complement(60373..61944)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446592"
FT                   /locus_tag="CAGL0B00704g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="isomerase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAG57901.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG347446"
FT                   /db_xref="HOGENOM:HBG627841"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR005792"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00003B5F1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX95"
FT                   /transl_table=1
FT                   /translation="MLFNKGLLALAATAALGVSAQDAVAPADSAVVKLEQDNFQDFLKE
FT                   NSLVMAEFFAPWCGHCKKLAPEYVKAAEELKSKNVSLVQIDCDDNRDLCMQLQIPGFPS
FT                   IKLIKDGDIAHAKDYNGARTAEAIVKFMIKQTQPAVQVVEDKAALDALVANSTVPVVVD
FT                   FGVNDFNATFYQFAHALSDDYVFISLPSKENKISVFLPVEGSSAEEIVFKGDHKTLAKD
FT                   RSVFEEWLKVESLPFFGEINGEVFNAYLESGLPLAYFFFNEPSEVEENRKFFTDLAKKY
FT                   RGKMAFVSLDAKQFGRHAENLNMKQQFPLFAIHNMTSNQKFGLPQMAEEEFAKLNKAIK
FT                   LKTKDITKLVENVLSGKAEAIVKSEEVPSVQESNVFKIVGKTHDKIVADPKKDVLVKYY
FT                   APWCGHCKKMAPTYEELADTYASDSSSKDKVVIAEVDATANDIFNVEIAGYPTILLYPA
FT                   GKNAEPVVYEGDRSLDSFLTFIKENGANGIDGSSLHKKFLETKKAAEQAEIEDDNEDED
FT                   GFDDEL"
FT   CDS_pept        63903..65153
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503339"
FT                   /locus_tag="CAGL0B00726g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG57902.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG124296"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI00003B5F1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX94"
FT                   /transl_table=1
FT                   /translation="MAFHEFHSQQQLKLDKEVQSIIDKFEINQVKLIKLCNEYTDSLQT
FT                   FKVNHLFGTGQEAGDVVLAYLQRPFFKICLVRVNFNNSQILHQQCNKISQELFNSEHQL
FT                   AERMCAYTLMFLRLYLPHLYDTPFILPFIVQDYPVRYYSLPVKYQRLLQLAGIYNVQVK
FT                   VTSESLASLNYTNYSTYFMGASKNINLIASCFIGETYCSCIRVTNSKAGLLDFRIPLTK
FT                   LPKTDFDFHTIDRFDKLITSDHISETVRNCLIFLHSRRQILSKYHSLCDLPNCIKSHFK
FT                   LDTDTMAHIVLDESEKLSIANLVMLQQWELETNTNDRQVIKKIVKAVIKRSATLSAIPI
FT                   VVEIMNHIKHLKEQNETFQSATIGCNGSLIEIFPDYNKYFSETLANSPLGPDIAKKINV
FT                   TTNMEAIEIGGACLVYQ"
FT   CDS_pept        65727..68165
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057092" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351119"
FT                   /locus_tag="CAGL0B00748g"
FT                   /product="Similar to uniprot|P25569 Saccharomyces
FT                   cerevisiae YCL039w"
FT                   /protein_id="CAG57903.1"
FT                   /db_xref="HOGENOM:HBG059713"
FT                   /db_xref="HOGENOM:HBG204085"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B5F1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX93"
FT                   /transl_table=1
FT                   /translation="MTASASVPNERSFSNDVTDPMQNINMFDKVQLTKLLIHTLRELGY
FT                   DESAIKLQEESGGIQVESSIVQNLLKWIRAGSYHYISFVELAQLPLQNGRLTDDQRMAE
FT                   LVAHYQSFESNDAGYSEAKNSMKIENVITTPINTSRTIDRMSTNLEQFNDAIAQIQTLN
FT                   LSSINIERIRAVLEISILICRQVFLELIFENKDFHTALILLRGTIRRYTEVWDSIDPKI
FT                   EGLQDEQQTFAPEIILKDMSSLITCPNESIITGLWPNSLTKSRENLIQTISNYINPNDL
FT                   VPKGRLLTLLRQAVKYQRSKDVFNFSDQEVSNGIEMEDISASKELNKYNLLQDNTSNFQ
FT                   KIAFENEKTLTQHSDEVWYLQFSPDGRYLASVSADATTDRKIYIYDVQNDFQVYKILSG
FT                   NSQCILYLSFSPDSKLLVSCPFNAIVNIYSIHAEGEPIDINPESDNKIVAEVIKPIDSF
FT                   YVLPGKEFKRNRSDSNNSMDGASRDVPSNQNRPQDLMATMESGSPLEPRSRSDSPSRHS
FT                   INPVRIWCCDWFHTERHSGKFVVGSPDREVAIYDTNSSSVVFCFSQNTVIPSSIALQQN
FT                   ILGSSPISGGNALNNITRRDSTFSNNEIFPRVHDIKISNDDNSLILMTHQGKIDVYDIS
FT                   RLPSNNDNYFDIMAEYEKTIIPLASRLNVEKNMTCISIPKPGSFYDPALDSLLLVNLQS
FT                   SEIQLWNYRENILIQKYFGQKQEQFIIRSCFGFENKLVASGSEDGKVYIWDRVRGNILG
FT                   VLKAHVNDKPAQSNGNINSNNNKKNGKNCNTVVWNPADHNMFASGGDDGFIKVWKLVKD
FT                   "
FT   CDS_pept        complement(68287..69912)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046809"
FT                   /gene_name="ATG22"
FT                   /locus_tag="CAGL0B00770g"
FT                   /product="Autophagy-related protein 22 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG57904.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052257"
FT                   /db_xref="HOGENOM:HBG330612"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B5F20"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FX92"
FT                   /transl_table=1
FT                   /translation="MAYESLASEPNDGVTDHNDDALYVGIDTLKAARDNIKGWYLYSFS
FT                   SEPFVVSAVATYVPLLLEQFARINGVQLDDHNAPCSTSSSDKCVLGLFNNRVFVDSSSF
FT                   ALYVFSLSVLFQTVVVISVSGMVDRWKTISFRKNVLVTFGMVGAFATVLISLLNETQYY
FT                   SLVVYYIVANSCYGVINVVGNSLLPLFVDDLVRLQPDHTVPAAEELSLDTDDKDGLTTV
FT                   ISGRGASIGYSAALVVQLMSILLVRLSPSKQDIQYAVFFVGLWWAVWQFPMYWLLSDSI
FT                   IPDQQSNQAIANGRYYDIDGSIFTFVNLSSLKYGWKLLGEALKHATLLRDVVIFLIGWF
FT                   ILSDSLTTINSTAIIFAKTELHMSTINLISLSIITMISAMVGAFAIPQIVSTSLHVPPQ
FT                   RTILLIICWASIIPLYGMLGFIFQSFGLKHQFEMFILGVWYGISMGSVAAVSRSLFTII
FT                   IPKGRESTFFSLFSITDKGSSIVGPFIIGIVTDKTHNIRYSFFILFILLVFSLPIFKML
FT                   NVERGKREAEEISKLHVNIDPIQD"
FT   CDS_pept        complement(70860..72197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446593"
FT                   /locus_tag="CAGL0B00792g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57905.1"
FT                   /db_xref="HOGENOM:HBG124298"
FT                   /db_xref="HOGENOM:HBG204087"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B5F21"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX91"
FT                   /transl_table=1
FT                   /translation="MSAEVVTEVPQETKKEVKKELIPAPAPVTSPWKSTATAESMPELK
FT                   VAELLEETRKRKNKSPQPAIKSSANTKWVPIQVSITVSNNVNSNNNRKNNNRKTRQTPK
FT                   RAPSGPSNSNQQAKQSTPNSESKQNQQQQEAPQQTQNEKPVAPSMAEAKKTEEIASEQP
FT                   QSQQSQTTQKPYTNQRRRYNNSPNTHTTKQFRPSSNNSNSTFNNGEAPRHPQHNNRYNK
FT                   HSNRAQYSGYRSHNHHYNNRYQNRQMVKIDQSFYPLQPAMMAINNVARQIEYYFSADNM
FT                   NKDEFLKTKLSKDGYAPLELISKFYRLVNMSFGGDQNIILAALREIVNNAEATVEVAIA
FT                   GEQSSETEQAESLLTKYYIRSKEFSQWVPETVTNEFVAETILTEGSLERFMAQVITPPP
FT                   RSYNHHKTTPENQTEDESSKESNEGETEKSDESVVQQPESSSTEEQ"
FT   CDS_pept        73366..74454
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503340"
FT                   /locus_tag="CAGL0B00814g"
FT                   /product="Similar to uniprot|P25369 Saccharomyces
FT                   cerevisiae YCL034w"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG57906.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG059710"
FT                   /db_xref="HOGENOM:HBG204089"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI00003B5F22"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX90"
FT                   /transl_table=1
FT                   /translation="MGFLTDHPYTAVTANIDRVVSNREYSLEVELAEIVDLIGFRNTVN
FT                   QEEAARALRKKLKYGSKVQQSRSLDLLDLLLSQELKFGVIYNDDKLLDRLEVIALNRDT
FT                   DGNGVKYNPAIVSKAAKYEIQWYEHIASIGKKRSKTFGRLAELGSRVKREYRHKQSSSP
FT                   RRRADRRNAFLDDEADPFESLEDDNVTTERNRGNASTDADRLYRIPQIDIRKHAPKIKL
FT                   IISDALAASVALKHSLLTLPADKYSTDDMEATDNFIKARKIRKKVLAYLQVVTEGEFLG
FT                   SLIQANDELVASLTEYDEKSDKAEHDTREDRNDGNDSDDVNESVDYEYSDDDADEVSRA
FT                   DHSIYSVPQSTASNPFGDQNHL"
FT   CDS_pept        complement(74765..75256)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351120"
FT                   /locus_tag="CAGL0B00836g"
FT                   /product="Similar to uniprot|P25566 Saccharomyces
FT                   cerevisiae YCL033c"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG57907.1"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG352748"
FT                   /db_xref="HOGENOM:HBG715255"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI00003B5F23"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX89"
FT                   /transl_table=1
FT                   /translation="MFALVGRGARYTYLTTNKTTYNKTIKMLFQSKTDKKEWNPELTSE
FT                   QLHVLKDKGTEAPGTGKYLYNDRTGVYTCANCDAPLYRSETKFDSGCGWPAFNGEIKGA
FT                   LKYKKDFSHGMMRTEIMCAKCGGHLGHEFKGEGWNKRLNLPNDSRHCVNSLSLNFKKEE
FT                   "
FT   CDS_pept        75930..76898
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446594"
FT                   /locus_tag="CAGL0B00858g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /biological_process="signal transduction"
FT                   /protein_id="CAG57908.1"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG059708"
FT                   /db_xref="HOGENOM:HBG204090"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015316"
FT                   /db_xref="UniParc:UPI00003B5F24"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX88"
FT                   /transl_table=1
FT                   /translation="MDDSQKTLRQGTLLKDNFDKWTTDEVVQWCGTVLGKDEQEPLFTR
FT                   IRDNNIDGSVLQELTLQDCKELTDNDLKEAIKLKLWLNKLIDSQLGEDDVPTEDIVVVL
FT                   KNLHTTVSQKLLDFQSQYSGLRADVVEIMKRSKTAEHGMSSPQLTPSTASSKPSGARTD
FT                   YFDHGQLRQSPRAKEVRPTLLYNKSTPNSNSNSNSKYHDQIIHANSSLTIPNIKSNLSP
FT                   IEPLKQLKASKEDSCEKILKNAMVRHNLADQDWKQYVLVISYGDQERILDLAEKPVVIF
FT                   KNLKRQGLHPSIMLRRRGDFEEVDMSMNGLSSADVTPGGRL"
FT   CDS_pept        complement(77088..78005)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503341"
FT                   /locus_tag="CAGL0B00880g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57909.1"
FT                   /db_xref="HOGENOM:HBG183391"
FT                   /db_xref="HOGENOM:HBG717393"
FT                   /db_xref="UniParc:UPI00003B5F25"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX87"
FT                   /transl_table=1
FT                   /translation="MSTEKKSAKNVSSIDAMKNGFIVLPFKLPEESSLKGIAERSFHYI
FT                   FARKHQTKLDEEKNCLFLVNLPLLANLDSLKKAFNNILERDNSVAHIEQLLHNDEFGLR
FT                   EVDLSPLTSDLMSSEDSNKERFTPRNTALLKFVDEASLNNCWSSIKKYSTNSHKKSNYI
FT                   TWEYSSPSISTFTNFYKPLSIDYLKEDIHSYMSVFEERERQAQGDIQTSIVDEDGFTLV
FT                   VGKNTKSLNSIKKKILNRNPLSKHENKVKPPSAVDKKAKQDFYRFQVRERKKQEINELL
FT                   SKFKEDQAKIKVMKDKKKFNPYAQ"
FT   CDS_pept        complement(78387..80795)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000243914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446595"
FT                   /locus_tag="CAGL0B00902g"
FT                   /product="Similar to uniprot|P00815 Saccharomyces
FT                   cerevisiae YCL030c HIS4"
FT                   /function="NAD or NADH binding"
FT                   /function="histidinol dehydrogenase activity"
FT                   /function="phosphoribosyl-AMP cyclohydrolase activity "
FT                   /function="phosphoribosyl-ATP diphosphatase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="histidine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG57910.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004399"
FT                   /db_xref="GO:0004635"
FT                   /db_xref="GO:0004636"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051095"
FT                   /db_xref="HOGENOM:HBG329596"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016298"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniParc:UPI00003B5F26"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX86"
FT                   /transl_table=1
FT                   /translation="MVFPILPVFGKDLNLASRPYIKLVNQAVLDYTVSKEDIIKFVKDS
FT                   QLLFVGTLLSSGKFKDDEVIEILNNGVAVLFIEDHSYAGYLVTEVGIPQERISVLNENV
FT                   YETHFVIVNKFNAKTQLVPVEEITSSTLSQTLIDSLKTDRADGLYTTLVVDSQERCLGL
FT                   VYSSKESIQMAINEESGIYYSRSRDEIWVKGATSGNTQKLLSISVDCDGDALKFVVDQQ
FT                   GKDRSFCHLNTESCFGGFTHGLASLEQLLRDRFESAPEGSYTKRLFNDPELLNAKIKEE
FT                   AEELTEAEDKNEISWEAADLFYFALTKLVANNVSLKDVESNLNMKHLKITRRKGDAKDK
FT                   FIKKQEPQAQNDEELSSKPIHLNVVKTSNKKEVEAALTRPIQKTSEIMHLVNPIIEGVR
FT                   SKGDKALIEFTAKFDGVQLQSPVLEAPFPPEYFEGLTEEMKESLDLSIENVRKFHAAQL
FT                   QTEDLEVETQPGVLCSRFPRPIEKVGLYIPGGTAVLPSTALMLGVPAKVAGCKEIVFAS
FT                   PPRKSDGRVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTESVPKVDKILGPGNQFVT
FT                   AAKMYVQNDTQALCSIDMPAGPSEVLVIADNNADVDFVASDLLSQAEHGIDSQVILVGV
FT                   ELTDDKIQQIQDAVHRQALELPRVDIVRKCIAHSSIIVCDSYQSAFDMSNRYAPEHLIL
FT                   QIENAKDYVKLVDHAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGANTSTFQKF
FT                   ITAQSITPEGLDNIGRAVMCVAKVEGLDGHRNAVKIRMSKLGLLPKDFN"
FT   CDS_pept        complement(81492..82808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057099" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446596"
FT                   /locus_tag="CAGL0B00924g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG57911.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059707"
FT                   /db_xref="HOGENOM:HBG204091"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniParc:UPI00003B5F27"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX85"
FT                   /transl_table=1
FT                   /translation="MSAYSDKIGCYIQIPNLGRGQLKYVGPVESKPGVFAGVDLLANIG
FT                   KNDGSFQGRRYFQAEYSQSGLFIQLQKIEHLLENATTESRRESLGNTTFNLDKYNAHED
FT                   DNLMSDGVHMSENRVSSNGSTIIRKPLEQNEVHSPTPIRSFRITSRNNNRTPTQGERMD
FT                   IDSRASDSQTESIIKDYELRIEKQEREILQYRKLLEDQRIVLEEIQPTIDEYENNERRL
FT                   RSRVQELETELDKQREKFKSQKEFFEAEHEQLLAVVSQLQVAIEENEQKAISRKESLRE
FT                   DTTEITKTIQDLTDEHERARAKWEKEKMQLKMHNDSLSQEYQSLNKELMNMQGQKSNPP
FT                   TDELNSELTELRTRVRTLESQLQEKSSADTNIQSGAQASQSPSQPESSGSSSSLPVYKP
FT                   PVKVDPAAGRELWCYLCEKPGHRTTDCPHELKSTNDEFF"
FT   CDS_pept        83143..84327
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446597"
FT                   /locus_tag="CAGL0B00946g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57912.1"
FT                   /db_xref="HOGENOM:HBG124299"
FT                   /db_xref="UniParc:UPI00003B5F28"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX84"
FT                   /transl_table=1
FT                   /translation="MSSVDELIGQAERDIENGEHGNAISNLTRAAQSDPDERQMSMIER
FT                   LLGMLVDYVRSRDGNGGDGSRDGSRDIGSGSGERGMGDSMMSALMSSSGGSSQAQLGKL
FT                   ALLGTMMGSGSGKQQSQGQGFNWGSALSLFSGQSGKQSAANAGTGALLASLASSYFKGS
FT                   GSKPQQQQQQQGGSYGQQYGGNYQQHQPQQQESSTFSSIASMASNYFNKPQQGQGNGYG
FT                   NQNQNAGSNQGHQNYGQNQGYNNQGQGSHGYGQNEYSNDGYGQSRPPQQQNQESGTFSS
FT                   IMNMASSYMHKNDGQGQGRPPSNQYSNNGGGYGHGDGAYSNQSQNYGSNQNYGSNQNYG
FT                   SNQNYSQPNHNQGYGNQEYGYNQGNDNYGRPQQQRPNNDNGEGFNFQGHFSNRY"
FT   CDS_pept        84713..85951
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446598"
FT                   /locus_tag="CAGL0B00968g"
FT                   /product="Similarities with uniprot|P11710 Saccharomyces
FT                   cerevisiae YCL027w FUS1"
FT                   /protein_id="CAG57913.1"
FT                   /db_xref="HOGENOM:HBG124300"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniParc:UPI00003B5F29"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX83"
FT                   /transl_table=1
FT                   /translation="MKGKGKSLSAGLNNLFKAAAVLLNPNKNNRSLRLILGLSIGLPIG
FT                   VGVLFAIMLYFFVRNKLSRTNFSKAIGRSETHTDNFSSLDQAWIDLEGITKHTDHNFSA
FT                   TKSSSGTVSNAITQDSHIRTPQMAHCPLATADNNLPRNGSNLFADADNYLYSHPPNIYS
FT                   IDSSISMLNAEPEIRPNYFKDQKKKNSWKYNSPLSKWFLRSSLYLQCSSENLTNISSLP
FT                   NVKCSNILTSVVESCVDKPEITEQYVEETYLGSLTESSINTLSVNDVKSKEANKLNEIT
FT                   GTCLKKPAITLSGLELPINPNYKKNRKKAQMRLRTHLDYLAKTKPLPLTPTSSAIVKLK
FT                   AGIQYRVREEYVPSLSDEIHVTVGETVRVLASHNDGWALVERIEASDGKRLVSSGSYIN
FT                   ENRGIIPNKCLLS"
FT   CDS_pept        complement(86229..86810)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000089187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503342"
FT                   /locus_tag="CAGL0B00990g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG57914.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053494"
FT                   /db_xref="HOGENOM:HBG289260"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniParc:UPI00003B5F2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX82"
FT                   /transl_table=1
FT                   /translation="MSAVAPYLKTIASRRTIYALKPELPSGVTINDVQSTIQAIVKETP
FT                   TAFNSQVNRAVILTGETHKKVWDSVANAIADPAGKKRPESVRDEAYGSVIFFTDDKTTE
FT                   KLQADFPAWSAAFPQFADHASGAAQINSWAALEALGLGGHLQHYNGYVKAALPSKIPAS
FT                   WSVHSQLVFGAPGAAPGEKTYIDNEVEIFN"
FT   CDS_pept        91330..93201
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446599"
FT                   /locus_tag="CAGL0B01012g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57915.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B5F2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX81"
FT                   /transl_table=1
FT                   /translation="MSDFKDNSADFNDKVSDKEVEYMSPREVSVTPETSATPNTPAPSQ
FT                   FRRFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNK
FT                   ELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAG
FT                   ELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTV
FT                   NADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGY
FT                   IGDRYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAA
FT                   KKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFIN
FT                   AVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISF
FT                   CAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVW
FT                   GSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWS
FT                   LFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKNGGYLKRIAAFWC"
FT   tRNA            join(93733..93771,93807..93851)
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        96302..98530
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142001" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446600"
FT                   /locus_tag="CAGL0B01078g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57916.1"
FT                   /db_xref="HOGENOM:HBG059702"
FT                   /db_xref="HOGENOM:HBG203332"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniParc:UPI00003B5F2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX80"
FT                   /transl_table=1
FT                   /translation="MELPSINSTTSISDNTDLRNYYDKLLFTNASGKSLNDLPRKAHAA
FT                   QQINKKVNETIHEEDTERAPRIDFIEGFGHSPRANVPLSPPQEHARRRSIFFENSLPHH
FT                   NNSSNDRNENRSLGGNMTLSPDMMLTPLNSGFGSAFGSANIFNEARRSSYIADSLIHNQ
FT                   NIHEGQNLEKNGTIQDTYSRYAVNADMKSPTFNNHQQHFDNPTRMELFGTGDYVSRRNS
FT                   QPAGANQFQQSQNANQFTDGNYYKNTNGNNFQAQYPYDYYAYNQQPQQTAYKPTYDYNY
FT                   GVRQQPQQNPNYYPNTQVGGNDSGDNGLVVIDSKQLASSDKLYDLYQECGSKYFSAKEV
FT                   FEFMDYLKPMLEATSNENELSNVTKSRLYKFLGFLKSCNLNYNPQSEAFVTANMNNRRG
FT                   KGTASSYLHYKPLVLGALKNGKLELLSIPQNSNLALKKGDLVIVDGDRGKDLILVVEPI
FT                   VDLNLALIINFLKKKIHFDSLITNKNQHYPIEKFVKALIDSTNGVGDELNPKLYDIIEL
FT                   TQLVVPSKQVLRFANSWEVTTNLHNKFQDELKALHIAQLKLRSLNSGLNHNHRNNSGNS
FT                   TESNSSSGTPPNESTDTSGDKADEMSQKVINKQSCTPRLNIKILNAEFQFDRKKLTFYY
FT                   VCEERNDFRELIKELFKFYKTRIWLCAIPNNLEIDRKYYDPNRKEMEMYQKMMQQYSAD
FT                   DYNNGNDNNSNGVKDGLVVAPPLKSIELDNFQIGVYTELVEHLFNTPV"
FT   CDS_pept        complement(99050..99682)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503343"
FT                   /locus_tag="CAGL0B01100g"
FT                   /product="Similar to uniprot|P14306 Saccharomyces
FT                   cerevisiae YLR178c TFS1"
FT                   /protein_id="CAG57917.1"
FT                   /db_xref="HOGENOM:HBG053459"
FT                   /db_xref="HOGENOM:HBG588979"
FT                   /db_xref="InterPro:IPR001858"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI00003B5F2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX79"
FT                   /transl_table=1
FT                   /translation="MNYSVNTTQAIVDPLKKHEVIPDVVPDFEPQGFLTIEYPHSNSVT
FT                   LGNDISVPMASSLPEITYTSTSGVSDPDNDRFIVVLTDPDAPSRTDHKWSEYCHYVRTD
FT                   IQLVPNNKLASAAGAAGGVSREFVCADLNANGNTLVEYMGPAPPKGTGKHRYVFLLYRQ
FT                   NAPSSQLTKIKDRANWGYGEPAVGADKWAKENKLELLAANFFFAENA"
FT   CDS_pept        100472..101620
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446601"
FT                   /locus_tag="CAGL0B01122g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="methionine adenosyltransferase activity "
FT                   /biological_process="one-carbon metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG57918.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004478"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="HOGENOM:HBG443662"
FT                   /db_xref="HOGENOM:HBG444146"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniParc:UPI00003B5F2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX78"
FT                   /transl_table=1
FT                   /translation="MAGTFLFTSESVGEGHPDKICDQVSDAILDACLAVDPHSKVACET
FT                   AAKTGMIMVFGEITTKAVLDYQKIVRDTIKKIGYDASDKGFDYKTCNVLVAIEQQSPDI
FT                   AQGVHEEKDLENIGAGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLAWL
FT                   RPDTKTQVTVEYKDESGRWVPQRIDTVVVSAQHADEISTEDLRSKIKTEIIDKVIPADM
FT                   LDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASSVGGGAFSGKDYSKVDRSA
FT                   AYAARWVAKSLVAAGLCKRVQVQFSYAIGIAEPLSLHVETYGTATRPDDEIIEIIKKNF
FT                   DLRPGILVKELDLARPIYLPTASYGHFTNQEYPWEQPKKLVI"
FT   CDS_pept        complement(102067..103242)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351121"
FT                   /locus_tag="CAGL0B01144g"
FT                   /product="Similar to uniprot|Q06263 Saccharomyces
FT                   cerevisiae YLR181c"
FT                   /protein_id="CAG57919.1"
FT                   /db_xref="HOGENOM:HBG124302"
FT                   /db_xref="HOGENOM:HBG202488"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniParc:UPI00003B5F2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX77"
FT                   /transl_table=1
FT                   /translation="MDSGSVRLVATAQDMERAGLAVVAYYLRLYAVEKLLQLSERSDEV
FT                   TEAATMLLDQIETFKQEVTGSEDSEADGVKVLLQDSKKAMVYMLNFAMSLYNDKLKQVQ
FT                   DGPWDLTLKRGLWCCIDLFTCVIHLWQSDLQDLSKVAERVKYCKIYLSKMAKGELQKQE
FT                   AEPNDEELDKELDNLVTDTAKEESGEEKPQELDYADFLGGDDESNDVPLDKSEEEEVNK
FT                   LVGDSQDNAVTEDDVDDLINKLKMADEDSENEPDDLYRSQADENGGSEEPSNLGLPDTP
FT                   ANIPSRKLDTPAFVDSSDEDQGSDADVEEKDDAVEPVVHTSSTPMEQELEELETSKPTY
FT                   TKNDLANMMDKADKIEKIQRFAKYAISALNYEDISTARDELTKALELLNTM"
FT   CDS_pept        103561..105987
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503344"
FT                   /locus_tag="CAGL0B01166g"
FT                   /product="Similar to uniprot|P09959 Saccharomyces
FT                   cerevisiae YLR182w SWI6 transcription factor "
FT                   /protein_id="CAG57920.1"
FT                   /db_xref="HOGENOM:HBG059699"
FT                   /db_xref="HOGENOM:HBG202489"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B5F30"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX76"
FT                   /transl_table=1
FT                   /translation="MIELSRPVAKLGLNPFSLHCDAAGGVSVDDIVVMLRWIEESNFGE
FT                   VSSERVAQLREHVESQSSEDKAEVLAKNNVMASEDGYVSKDTSLQVMQKLGILEEFQQD
FT                   LDSFGKDHTIEDNHETQQKQEDIESSSHDTERSINVTSDLKQEDTEQLADAKVDGHVEN
FT                   GADADVTINEEGNDDTMKVDQDMTDSSVKKRGNGLSNMDLDFDSQRELGSPLKKMKLKP
FT                   TSTSQNSSLDTLHEDDTEEIKNLADQPIVITTHDLEKVNDTPITLRTADHPSDAVDNDQ
FT                   KLKLETFLQRLLFPEAHESPSKLGSKNGNTNPSHTFENALYEVDLSMPQVPLNLNIPAD
FT                   EHGNTPLHWLTSIANIDLVKELVKHGASRLLGDNAGESALVKAVKSVNNYDAGTFEELL
FT                   DYLYPCLILKDSMNRTILHHIVITSGMSRCAIAAKYYLDILMGWVVKKQTRKLDGTPDS
FT                   IFQSIDLKWFINNLLNAQDSNGDTCLNIAARLGNVSIIDALLDYGADPVISNKSGLRPV
FT                   DFGAGTSKLRGQKGEMSQPKIMSPAAGNKQVTELSSVDTGNLIRELETLLNKVKTNYED
FT                   EVYQYKNKLEKLHSQLNSQRELLATSRDRLAHTKQLRDDYALLKEQLMNIKQGIAEEEE
FT                   NFRKESEFLGFSSEEASKIDWNSSEFDADEPFRIDIIYDLVEHKLNSTYKGNLEELLSQ
FT                   ESVESIKKSLIANAGSEDKLKEQLASSLPPAPLLKARLEAYRKNDDHLQDVLVGIKEKR
FT                   TDLENKFRRVLSLCLKIEEGKVDDMLDGLLQAISSEDPQEIDTEEMQDFLKKHSD"
FT   CDS_pept        complement(106216..107802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503345"
FT                   /gene_name="TOS4"
FT                   /locus_tag="CAGL0B01188g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57921.1"
FT                   /db_xref="EMBL:AAO25588.1"
FT                   /db_xref="HOGENOM:HBG191422"
FT                   /db_xref="HOGENOM:HBG395637"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI0000005C78"
FT                   /db_xref="UniProtKB/TrEMBL:Q874N8"
FT                   /transl_table=1
FT                   /translation="MFEQFPPSSPVRSTTEKNPFFHSEGDYTEKGFKVTPLPPKKPELQ
FT                   SHDYPTPFPSSSTGRSSPVRHTRDITDSPPLHTSPPRIADSSLSGTTTSPSSATSTATT
FT                   LVPVYAPPKRRTLIKLSTDRPEPLTIGRKASCDVVLPSKLKISRKHALVNYLPKTKQIK
FT                   LKCLGSNGLVVLLPKKLQCKLVKYNTENKGVIRDSEGAEYLLLKDNSATVPYFSEKLVI
FT                   DVELTSFTLLQNESVIIPYVKGTVIDFRGAEGIIYVVKRRKTHSYIIKKPVLKETKQST
FT                   SDLTEFSSSSSESQQALSKVEPSSPISLHHFGNTKPFGIPKPKFATPSSSFKLSAFSPK
FT                   APRKDNSKANVFSLPESPIAHHDKSKSALSKKSINKRPIEQSENSAVLNKPKKAKKEQK
FT                   KLSKEEVIEQLKVKGIDIENVKNVLVNHLAFANIQQTPLFQLQSVNSKTAELSRNELRV
FT                   LLGDIKCVGIIYREGKDAAGKPLDEEYFYDLENDSDNDRRGLVMSLKGGRSNLRSCRKT
FT                   HKQYFWKKPAK"
FT   CDS_pept        join(108965..108971,109633..109892)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446602"
FT                   /gene_name="RPL37A"
FT                   /locus_tag="CAGL0B01203g"
FT                   /product="Ribosomal protein L37A"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57922.1"
FT                   /db_xref="EMBL:AAO25594.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG028539"
FT                   /db_xref="HOGENOM:HBG460460"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniParc:UPI0000005C77"
FT                   /db_xref="UniProtKB/TrEMBL:Q874N9"
FT                   /transl_table=1
FT                   /translation="MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCASCGYPSAKTR
FT                   SYNWGQKAKRRHTTGTGRMRYLKHVARRFKNGFQSGTASKASA"
FT   CDS_pept        112175..112864
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446603"
FT                   /gene_name="NEP1"
FT                   /gene_synonym="EMG1"
FT                   /locus_tag="CAGL0B01232g"
FT                   /product="Nucleolar essential protein 1 "
FT                   /function="rRNA (pseudouridine) methyltransferase activity "
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG57923.1"
FT                   /db_xref="EMBL:AAK61538.1"
FT                   /db_xref="EMBL:AAO25590.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0070037"
FT                   /db_xref="HOGENOM:HBG008042"
FT                   /db_xref="HOGENOM:HBG521224"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="UniParc:UPI0000005C76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96UP2"
FT                   /transl_table=1
FT                   /translation="MVEDSKARIGGPNNSSVTKKQEPRLYVVLCEASLETYTSNDHRTS
FT                   LLNCDDHQGILRKMGRDIAEARPDITHQCLLTLLDSPINKAGLLQVYILTKKNVLIEVN
FT                   PSVRIPRTFKRFSGLMVQLLHKLSIRSMESSNTHLLRVVKNPVTKYLPADCRKVTLSFD
FT                   AEVMRPQEYLGDKQSVCVFVGAMARGHDSFADEYVDDKIAISNYPLSASVACSKFCHGA
FT                   EDAWAII"
FT   CDS_pept        complement(112831..113262)
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_family="HOG000184835" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503346"
FT                   /gene_name="MTL3ALPHA1"
FT                   /locus_tag="CAGL0B00242g"
FT                   /product="Mating-type-like protein ALPHA1 "
FT                   /function="mating pheromone activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="positive regulation of transcription,
FT                   mating-type specific"
FT                   /biological_process="regulation of gene-specific
FT                   transcription"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57924.2"
FT                   /db_xref="EMBL:AAO25591.1"
FT                   /db_xref="EMBL:AAP06781.1"
FT                   /db_xref="EMBL:AAP06783.1"
FT                   /db_xref="EMBL:AAP06785.1"
FT                   /db_xref="GO:0000772"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0032583"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045895"
FT                   /db_xref="HOGENOM:HBG124301"
FT                   /db_xref="InterPro:IPR006856"
FT                   /db_xref="InterPro:IPR016325"
FT                   /db_xref="InterPro:IPR017931"
FT                   /db_xref="UniParc:UPI00017BD58E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q874P0"
FT                   /transl_table=1
FT                   /translation="MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETS
FT                   WEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEA
FT                   WNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHASSAP"
FT   CDS_pept        113719..114279
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_family="HOG000000902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446604"
FT                   /gene_name="MTL1ALPHA2"
FT                   /gene_synonym="ALPHA2"
FT                   /locus_tag="CAGL0B01265g"
FT                   /product="Mating-type-like protein ALPHA2 "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57925.1"
FT                   /db_xref="EMBL:AAO25592.1"
FT                   /db_xref="EMBL:AAP06782.1"
FT                   /db_xref="EMBL:AAP06784.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124304"
FT                   /db_xref="HOGENOM:HBG204049"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI0000005C74"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q86Z42"
FT                   /transl_table=1
FT                   /translation="MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSL
FT                   PGPSSDILRFLSRNNLDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPN
FT                   HYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRR
FT                   RKQKSIYISPFRPTLMAQNSLDT"
FT   CDS_pept        114832..118575
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446605"
FT                   /locus_tag="CAGL0B01287g"
FT                   /product="Similar to KLLA0C03410g Kluyveromyces lactis "
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG57926.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059670"
FT                   /db_xref="HOGENOM:HBG103639"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="UniParc:UPI00003B5F31"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXB3"
FT                   /transl_table=1
FT                   /translation="MDSPTSQYDNGASPTLPLDTSFQTASFHTATSSPTPSQQLDAQDI
FT                   SKEIEQLRLYQDNKRISFTTPVVNTSPLHLPPDITPRADQVQPENQQGFVSHGLGISLP
FT                   QPTDNTNIDDTITSIDPDITTKLQPDSPDRTNNSVKSKPDDFSLSHLFIIANHEFDPSS
FT                   LQNKEDASICLPFKKNDVAFVHVVDESGWGEVTLIKNNERGWVPFNYFQDTVHPTTAAY
FT                   PAPQYLKSRLPLESLLSACAQFLTQQDGSEKFKHKYFNDIRDGVKTLLELTKCVSRSDE
FT                   LVKSVSLIRRARKALLADWYDLMMKADHYKKTSPSAENITTLIQLTNKVTNKAFTFYNA
FT                   WSTHLSTDSSKHDSRYHILNNPSDKKEELISQNNSIEASSKSTVSNNHANQPTENQISE
FT                   KANSTTLLEPPFAIARLTEIHNLIFQYIGLILGRLQMVTNNPAGYETLESVIHQIIIIL
FT                   RELLYISKTCAYIMQQKFQKVDQDPFNEDLDQLLSMVSDMVSTIKVLVTMSLNTSIHKE
FT                   DTATIEAQQHKLISIVASMTPLINNTVLQCHNYLRLIGDFKLETSRSYMDFQKIRINPQ
FT                   HLINRSQTTSNNDVFKSDFQRKSIDLFANDKERYKRVTRYSTITPLREDFFDDHNLIEG
FT                   SPEKKSFARDSVFLKYQPTDSEAESSALVTNSSDKLSEEDLIYDSNNELITATCRGLVF
FT                   KLTDELDHPSSFFVSTFLLNFRSFMKSYELVTELINRFDLADMENKLRDNKPKGKYSTT
FT                   ASKLKNRRRLICSVFNEWMESYWDYNTDFECISTMINFFNEGMADYLPRESKMLIQTAA
FT                   KLILKFNELKKNRQLTTTYSQLCPINVLKNNGGSMISQISTVTTATNKSILTMDERLID
FT                   EYELTHIPHQTEDDLALPLPVLNLGTFSLISKENTEQIHNLVYKYRNYLNEKNYDDFTD
FT                   KTSDEILKIWFELKNHHFSNSDLSTAAEFSLVILNPLEVAKQLTILESLLFMRLTPFDI
FT                   VNYKANSTITSSNVAAITSFTNQLSQYVMNGILTPRINDATRTTILKAWLRIALSALYL
FT                   RNFNSVASIMTAIQNHSITRLTGVWQQLSRKDTLLYEYLSRIIHPNHNFKVYRQKLKKI
FT                   IDDSSQGSIIPVKSHVPVVPFFNLFLQDITFIHEGNSTFRNPDSFRPNKPINVDKFYRI
FT                   TKIVTTMQFFQVGYNTNSSEDAPKRESFFRLTEEMGLDTKNIASVPLLQELIVYELWKV
FT                   NNVFSIDSDRAYQLSLQIQPRN"
FT   tRNA            complement(118728..118800)
FT                   /gene_name="tRNA-Thr (AGT)"
FT   CDS_pept        119648..120268
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446606"
FT                   /locus_tag="CAGL0B01331g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57927.1"
FT                   /db_xref="HOGENOM:HBG060104"
FT                   /db_xref="HOGENOM:HBG395959"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="UniParc:UPI00003B5F32"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXB2"
FT                   /transl_table=1
FT                   /translation="MSVSNGNDDAEQALEFYRKALNFNVIGRYDPKIKQLLFHTPHASV
FT                   YKWDIERDEWAKLEYQGVLAIYLRDIGNGQDFLPPQDSTMDASVLAGSMTQGNENYGQG
FT                   LMLSGRDIYNYGLIILNRLNPDNFSMGIVPNNVVNKRKVFDSIEDAENPLECMGVEVKD
FT                   ELVIIKNLKHEVYGIWIHTVEDRKNVYELIKYLLENEPKTSFA"
FT   CDS_pept        complement(120462..122519)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046810"
FT                   /locus_tag="CAGL0B01353g"
FT                   /product="Similar to uniprot|P50875 Saccharomyces
FT                   cerevisiae YOL148c SPT20"
FT                   /protein_id="CAG57928.1"
FT                   /db_xref="HOGENOM:HBG060103"
FT                   /db_xref="HOGENOM:HBG202805"
FT                   /db_xref="InterPro:IPR021950"
FT                   /db_xref="UniParc:UPI00003B5F33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXB1"
FT                   /transl_table=1
FT                   /translation="MNGSPNYGQDKSMLGVAVNGVGSPGSPVNMASPGSGVGSGATPSS
FT                   MATGPANGPGNYTGGQGQQMPRMPGGPAGTGIPTGMNGQALNQRQILQQKMLLRQQQVQ
FT                   QAQHQRQIALQNYENQFNQLLMMHNPRPKRNYAFVETPNELLKKYEQYRPSFEFHIYEN
FT                   NYKICAPANTRLQQQQKNPELTSDGLILNKSNETLREFLEYVARGRIPYAIMEVLRDCN
FT                   IQFYEGNLILQVYDHTNTVDVTIRSDTKGQDHSNGSPHKSPNAVTSAGHSGNPGNLGQA
FT                   GAVSIKMESPKPVTGSPAASNLKNQIGAVGNMKEDAEKSGNTTLTQTPGQSKPGENQNT
FT                   KLDSNQTYKRPRVYRTLLRPNDLSQYYDLMSYADHSRFSDTVYQQLESELLTLTKRNLD
FT                   LSVPMNPYEHKDKLEDELFTAPYWDENVKGIIHQHRDESTAARTKGVVHHIPEHEDNEQ
FT                   KTSEYEQLMLIMNERTTTSTGATFAAIVAMNAMQKMKRSNENAEDDDAVGGIENGLKGS
FT                   NNNSTGSKVAMAAAAAAASLGGTMNSETNQFRRLKFIEQWKINKEKRKQQALANNMLPT
FT                   AYNARISMTTPQNGGSSNGMPQGGNSTEGTGKGKAAAKGAKGGTKRGGSTAAGDKAPKP
FT                   KKPRKTKAKTADGDAAPKRKKAPTKKKQPSGSEGGTPNVPQTPGTAGSPS"
FT   CDS_pept        complement(123330..126662)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248464" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503347"
FT                   /locus_tag="CAGL0B01375g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG57929.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG060102"
FT                   /db_xref="HOGENOM:HBG397811"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B5F34"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXB0"
FT                   /transl_table=1
FT                   /translation="MSSVANEMYPKMEWSSSLDIPLKASEELVSIDLETDLPDDAADLK
FT                   TLLVEESSDKEHWLTIAIAYCNQGRTSQGIRLIELALDVFEGAGKASLHTFLTWAHLKL
FT                   AKESTTSAETREHELTQAEVHLRDAIGYDPTWVGNMLATVDLYYERGNYDKALETCDLF
FT                   VKSIYAEDKRTGRISKPNAMFILLRAKLMYQKKNYVASLKLFQELLVINPVLKPDPRIG
FT                   IGMCFWQLKDYKLAIQAWERALQLDPNNKQASILVLLGKFHNSLTEAENDEDFKEKYAA
FT                   ALADLNTVYTNSKESPVLLVLLQTFFFFKGDYEKVITIHDQKISKLSFLAPESVYSESL
FT                   FWCGRASYAMGDYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILTFESLYK
FT                   ANENVQELNYILGMLYTAKCIADPAKNNDSTGNKQKNLTGAELVKMIGKALHFLDRYIK
FT                   LTAAKKNQMTVPRVHLVMSQLYELQSQYHLALESLEKAIENIKFFDGENGVPLEVLNNL
FT                   SCLYFITGDYEKAQKYLALADGRLSQSSNDGAEKLVLNYNDARILEASDANTALTRYGS
FT                   ILGKHPGHVAAKVRELYLTLEKTGVDNSDEYKRLSEEVENLVESEKDNLEVRAFYSWFL
FT                   KRSELTGRAVAENNAKESAFNRDTLVKYDSHDKYALISLANLYVTLARDARHSKSSKDQ
FT                   EKSKQSFLKATQLYQKVLQLDPLNVFAAQGIAIMFAESKRMGPALEILRKVRDSLENED
FT                   VHVNIAHCLLDMREYVKAIEAYEFVLKKFCTDNSSMNKSRVLNLLARAWYSRGMRERSV
FT                   QFFQNALEKASAALETESTSNFKNLRFLGVLKYNVALLHFQIAETLRRTGPMLRTSAGM
FT                   KDALVGLSEALVLLKELLESDNFKTVSKEELEQRIQLGETTMKSALERAVIEQEAFEED
FT                   QNKKIEEARIQQAKAGEEEEAKRKKAEEEARAAEEKKNEEFRKLQEEARKLMEERESYM
FT                   VDEKDVNDLSEEDGDFGGDEPGASPQKKDKKKKAGTKKRKRSESKPGKKASAAGELGSE
FT                   DEDEAQVTSGRKRKKPALSEEFIADSDEELSSAKMSEDEEAKMSDEEEAKMSAGDDEDD
FT                   GLF"
FT   CDS_pept        127374..128918
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446607"
FT                   /locus_tag="CAGL0B01397g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG57930.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG060101"
FT                   /db_xref="HOGENOM:HBG202828"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B5F35"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA9"
FT                   /transl_table=1
FT                   /translation="MVEKRLFIGNLKHGVEECLADLEQRFKAFGEYVGSGQDVFERHNG
FT                   FAFVTMRFEDAEALQRLKSRFHKVKFKGNQLIVDYARPAWSQERESQQREEQKQSRVLE
FT                   KRQRKNDWEHYKKMEHINASWRDLKEVVPGRMRESPRSRQGLRNITFRLNVGGALKVYK
FT                   CYKTKLWGYERDKDTRDLVHKFSNHRFWKDGSDHVVERLDYSRSRGALRWANMDEEWRP
FT                   YLELRNRRRPATAAGLAGEALDSSGSTLATSTVDDLVDADESDIEQEKERTNNILAQMM
FT                   DSFDFAKPMALDDEDAGKLLDAEQNRSSAKDNRNYKSETAPENADYYQEEETVAEEAAQ
FT                   ADGDDSEEFIPTFGASTSNNDNDQDTRKVIEGTISNTDTLRTLFNPEVTGEASGTEAAG
FT                   ATFKLINDGDQDIDQSKNPELAVEDVQVQEEVPVAETHTKQRRNLFFPHFESPFLQGQT
FT                   QLSKIQAGQQADLLQTWSDDFWANRGLWMKEMKQKKRDALRKLRKRKGGDHNVFLL"
FT   CDS_pept        complement(129208..129714)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446608"
FT                   /locus_tag="CAGL0B01419g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="riboflavin synthase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /cellular_component="riboflavin synthase complex "
FT                   /protein_id="CAG57931.1"
FT                   /db_xref="GO:0004746"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0009349"
FT                   /db_xref="HOGENOM:HBG311126"
FT                   /db_xref="HOGENOM:HBG408416"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniParc:UPI00003B5F36"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA8"
FT                   /transl_table=1
FT                   /translation="MAVKGLGQLDQNYDGSKLRVGIIHARWNRVIIDALVKGAIDRMLS
FT                   LGVKEENIIVETVPGSFELPYGSKRFAEKQAKKGEPLDVVIPIGVLIKGSTMHFEYISD
FT                   STTQAIMNLQDKINIPVIFGLLTCLTEEQALARAGIDEGKTMHNHGEDWGAAAVEMATK
FT                   FGANA"
FT   CDS_pept        complement(130216..131517)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446609"
FT                   /locus_tag="CAGL0B01441g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="CAG57932.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="HOGENOM:HBG460465"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI00003B5F37"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA7"
FT                   /transl_table=1
FT                   /translation="MVYESKPFDPITVKPNDKKRVAYFYDADVGNYAYGAGHPMKPHRI
FT                   RMTHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKF
FT                   NVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYL
FT                   NDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELR
FT                   DIGVGKGKYYAVNVPLRDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL
FT                   GCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDQELPY
FT                   NEYYEYYGPDYKLDVRPSNMYNVNTPEYLDKILLGIFQNLENTKYAPSVQLNNVPNDPE
FT                   DKGDEEEDTNEAKDTKGGSQYARDNMVQNDTEFY"
FT   CDS_pept        131812..132516
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446610"
FT                   /locus_tag="CAGL0B01463g"
FT                   /product="Similar to uniprot|Q08285 Saccharomyces
FT                   cerevisiae YOL142w RRP40"
FT                   /protein_id="CAG57933.1"
FT                   /db_xref="HOGENOM:HBG352200"
FT                   /db_xref="HOGENOM:HBG738075"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B5F38"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA6"
FT                   /transl_table=1
FT                   /translation="MVVMPGDELALDQGKPVVLGPGVYCDPQTQTVVPVNAGVPVVKES
FT                   AKRQTVYVEYNSKRYIPSVGDLVIGVITSTFSDSYRVSLSSFSNSVSLSYMAFPNASKK
FT                   NRPTLKVGDLVYARVSSAEKELEAEIECLDSTTGESAGFGLLEGGMVIDVTLAFARRLL
FT                   FNDNFPLLLLLSKRTQFEVAIGVNGKVWIKCDEVKYTMACFRSIMKCQDQPVSQYKDII
FT                   KQEFDSLPKEED"
FT   CDS_pept        132868..134892
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446611"
FT                   /gene_name="PPM2"
FT                   /gene_synonym="TYW4"
FT                   /locus_tag="CAGL0B01485g"
FT                   /product="Leucine carboxyl methyltransferase 2 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAG57934.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058588"
FT                   /db_xref="HOGENOM:HBG395489"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR021121"
FT                   /db_xref="UniParc:UPI00003B5F39"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXA5"
FT                   /transl_table=1
FT                   /translation="MSTQIKREKPIKKQFQKKKFADLAVQGTNNSSIASKRSVELTYLP
FT                   KLGVGSNAEKLQPGKPYFRYFVPKKIKRSPCINRGYWLRLHAVRSHIESILDSCQENIT
FT                   IINLGCGYDPLPFEMLDPQNPQYSRYSNRLNFIDIDYPDLLNIKSGVIKETPELLSIIG
FT                   GIDPTETNMIISERYKTIPCDLYDMPAFEALLKSENLGHPNTIKIFIAEVSLAYMKHEK
FT                   ADDIIASCSKFPNSHFIMLEQIIPVGEYEPFSGRMLKHFSKNESPLQTVTKYQTIESQI
FT                   ERFRRYNFTNVNAGDMFQLWNSLSSNVHSKIENIEPFDELEEFHLFCHHYMICHATNNE
FT                   QFKFNESIKFREPEVLPSLPISGLRIDSIDKIGFSKRFGSSVISKDSIIYTGGASPYRS
FT                   DEADVINLEECTIETLSNMKLPDARVCHSYDSLMDGKLDILIGGRKAPHQPFNDVFIFE
FT                   KQTASWEKVATLDYPIYRHATSSLSNDKLLLFGGNFCLKEPFLTITVKSETQIVVRSIN
FT                   CPDSIKSSIGAAMCYNEASNDVIILGGSSNGTEVSDKLIIMSYDDKSETLTVKKEVTND
FT                   LFKRYGSKIIHLTDDEYLVVGGTSPDRLFDASNSIITYNSRSDEIKSVRIPDHIWQGDE
FT                   LMLVGFELQKLNGKIIIFGGGATCYGFGSVNNSIYSIEK"
FT   CDS_pept        135422..136705
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503348"
FT                   /gene_name="ARG8"
FT                   /locus_tag="CAGL0B01507g"
FT                   /product="Acetylornithine aminotransferase, mitochondrial "
FT                   /EC_number="2.6.1.11"
FT                   /function="N2-acetyl-L-ornithine:2-oxoglutarate 5-
FT                   aminotransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG57935.1"
FT                   /db_xref="GO:0003992"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B5F3A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXA4"
FT                   /transl_table=1
FT                   /translation="MYKRYFSTSLKTNQQALKKILEEKTYQVTTYARPSDLCITRGLNA
FT                   KLFDDFNNKEYIDFTAGIAVTALGHANPKVAEILQTQATKLVHSSNLYFTKECLDLSEK
FT                   LIEKTKKFGGQHDASKVFLCNSGTEANEAALKFAKKHGITKNPKKQGIIAFENSFHGRT
FT                   MGALSVTWNKKYRTPFGDLVPHVSFLNINDELSKIKDFINTKKDEIAGLIIEPIQGEGG
FT                   IFPIPIEKLVALKEICQKNDIIVIYDEIQCGLGRTGNLWAHAALPKAAHPDIFTSAKAL
FT                   GNGFPIAATVVNEKVNNALQVGDHGTTYGGNPLGCAVSNYVLDVIGDQAFLDSVTKKGE
FT                   LLKKGLLKIKEQHPDKISDVRGSGLIWGVEFKDAPGAIVQKARELGLLVITAGKTTVRF
FT                   VPSLTIEDEVVEEGLTIFNKAVNDVFSK"
FT   CDS_pept        137174..138283
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204332" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046811"
FT                   /locus_tag="CAGL0B01529g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57936.1"
FT                   /db_xref="HOGENOM:HBG013535"
FT                   /db_xref="HOGENOM:HBG523770"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B5F3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA3"
FT                   /transl_table=1
FT                   /translation="MLRYQTTGFSGYGVQYSPYYDNILAVNTGSNFGLVGNGKLFILEI
FT                   DNNGVVKEKNSFLTKDCLFDSAWNELKPNQVVVAQGDGSLRLFDTTLQKFPIAMFHEHS
FT                   KEVYSCNWNLVSKSNFVSSSWDGQVKIWSPNRKASLITFSPHPIDVSRALDNLPEVSQR
FT                   DKLSPNQVAQNRNCIYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGK
FT                   GALSCDFNKYRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVK
FT                   KVCWSPHHSDILLSTSYDMSCKIWKDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFVF
FT                   GADWSLWGIPGYVATAGWDSNVFIWNGLQ"
FT   CDS_pept        138826..143916
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112248" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446612"
FT                   /locus_tag="CAGL0B01551g"
FT                   /product="Similar to uniprot|Q03921 Saccharomyces
FT                   cerevisiae YDR141c DOP1"
FT                   /function="binding"
FT                   /protein_id="CAG57937.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059784"
FT                   /db_xref="HOGENOM:HBG203173"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B5F3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA2"
FT                   /transl_table=1
FT                   /translation="MSLPLKPLTLDSNSKQLDSRQKKFCSNVEKAIKKFDLVNEWADYI
FT                   ASLGTLLKALQSWSPKFQNVKYFVPYPYDVSRRLSSSLSPSLPAGVHLKTLEVYTYIFE
FT                   NIGIEALAHECNIWIPGILPLMTYASMSVRSRVIELYDNYILTLPSEILKVIIRPLLSS
FT                   LFPGLEDESSEYLDQTIKLIETLQENLGDDSLFWQTCFLVISTYSDRRAGGLVWLTRKF
FT                   PSLNAIPHKIAERNKIKVNSTGGSTNSMQDRKKVKEDALATLLPSAKNLVTPEPGLLIR
FT                   CLVSCLEPENDILIKRGILDLLLQRVRIDSPVIQVLISPEDKKLLIMSCCKTTLNKDMS
FT                   LNRRVWNWCLGFSSSTTRSSNGSTTSVNSGASDKGDNSQDKSNEYFRTNGLLCLKQGIE
FT                   DLLYNETDVVTAFKLCISIMDRWEIGSMIIPTIFTNLLLASYKMKENELVMKAAGVFFD
FT                   AVETNIIWGNVINHFFITNDIFLIQFVINNFNISTDEEIIVNHLPLVLLSLLTEYEIFA
FT                   ELDGAKQTQYYNLCYNILTVIPERAFTTISNSTVMDISHISDGSVIEAIKCYYGKVSDP
FT                   SSFMISDANSIERPYSMEVMTALILNKTTNIVLSQLHNQLHLNDATKLFIYTYEKIPES
FT                   NQQAKKIDTIDDELSNTVFGSLKKITETDMEYISGLVDLFGNYLCKRMDFIESIKLLNL
FT                   LVQSLWPFLKVPKSQDPAIRCLESIERSIPTDYVESAVANAFAKEESLNVRIDVLNLLW
FT                   ISLPQTSTLYIRPLEIIFDELNNSQNPYYLSVSKWIYSLNTAGTINNLFRIIMNQLSEF
FT                   EFFKRDTIKETDDLDMFTYRIQIIKNVLSTNNHSILKTFASEINTTVMIKTLGNEDVST
FT                   YKSCCVAIIINFLKKQNNTHPRSIRSSLVLLDLLLDGSEANFKEIVIFLLEKSSFYISQ
FT                   GEIESELIAVALIDIVSKVLMISHQNGIKLDIFDDNSTHLKYIDYLVTSVSTMEGPFIV
FT                   TAYVKLLSESIAYFENSIFRTILPLTASMVQCIGRLFEKEKESGGYLEPILLLLGGLEE
FT                   LLEVSHGFLTAGEKDNYFGNTAKSDFLQSVVSNVFSSENTAVDIKIQGERDVIIQSFKQ
FT                   VTNSAYRIWSWAHIQSRISLKSNPSNSGTHANYKLKFGAKKLLEKLYILEPLETLETLI
FT                   STNKNETTVPLIQALDGNRPALTIPSYFSSIVLRCNKNSTVRFSSNTSSKTTTFKGMKS
FT                   DPSLLNKLHADAIMQNLLDYVKTLENTAMEDFYGDYILFLKEVSNNQYLYKNVCLQVMD
FT                   LCVVIADKLSRSKFGEQKRPRKDLSDLCFKYIPAAVEGLAKSKENYNHILETLTKVTRN
FT                   ITLLLNENESGDKVHAVITSIISNIVVPHLKTEDAVFSMPEFMSLLTELVKVSGRVKLW
FT                   RQVIGDAFNDDTVLIEILQNIKWQDIIFKWSDYEEHKYKLLSDLTMLVTTKKSALAPTA
FT                   ISFNSWGDSEDNTKKKNVLRIAYLLMISPKDYYLMHFEPLISYALSTLSSQEHTFKSEF
FT                   WALLRVIFMKFSLSHFTSTWPLISYALQTNLQEFYENIQIQNFTNPEATFQLCKTLDQL
FT                   LAMNIEGFCATNEWIFIIDTINCIYKTNSYVALADSIASCKEFEITTMDDLNLSKNISS
FT                   FKPLLLGVHKIDRHNQLRSFFQNLSYVHYESTYMMVKFDTNEFLNDTNSDLLYLIKKS"
FT   CDS_pept        complement(144100..144771)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197929"
FT                   /locus_tag="CAGL0B01573g"
FT                   /product="Similar to uniprot|Q03920 Saccharomyces
FT                   cerevisiae YDR140w"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG57938.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG268641"
FT                   /db_xref="HOGENOM:HBG646581"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI00003B5F3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA1"
FT                   /transl_table=1
FT                   /translation="MLPTPYVKCDYEKVYEPSEDSFLLLDILEKERQYLADRFSKSLNV
FT                   VCEIGVGSGIVTTFMMQNTIPSAGHLNLYYAIDVNPWALESTLTTADINNCKKSYLEPV
FT                   QADLTSSFRTREIDLLIFNPPYVPAEDVPTIPEETDDQDKWLDLALLGGEDGMDVTNKV
FT                   LDNLEAILSLRGVAYILFCARNKPEEIAKRMEQIWDIKLIEQRKAGWEILSVYRFQKKN
FT                   L"
FT   CDS_pept        join(145132..145280,145404..145488)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351122"
FT                   /locus_tag="CAGL0B01589g"
FT                   /product="Similar to uniprot|Q03919 Saccharomyces
FT                   cerevisiae YDR139c RUB1"
FT                   /protein_id="CAR57998.1"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI00017BD5C1"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX4"
FT                   /transl_table=1
FT                   /translation="MIIKVKTLTGKEIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIF
FT                   HGKQINNDDTISTAKLSDGMQLHLVLTLRGGN"
FT   CDS_pept        146542..148740
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446613"
FT                   /locus_tag="CAGL0B01595g"
FT                   /product="Similar to KLLA0E12067g Kluyveromyces lactis "
FT                   /protein_id="CAG57939.1"
FT                   /db_xref="HOGENOM:HBG124305"
FT                   /db_xref="UniParc:UPI00003B5F3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXA0"
FT                   /transl_table=1
FT                   /translation="MKLPSEILDIIASHGLDSCKTSIAWSYVSSYFRDLVKKTVGVMLV
FT                   QDGGHSPLEDECVRPDILDFRVLLHKNRNMLYLNSDENATIRSIECFLQNFKNIVIVIQ
FT                   SDRSFSDPLASTLNEIARHCTSGTNVCIIYSTTTNFLSKLYFREFGIREDKLVLSELHI
FT                   IGSSALSNNADLCDVDTLFETTYIYEIDNLFSLSVKHQHHSLIAPQLTTIKQLNYNDSM
FT                   LNINAFLNDCTNLEMIDSMRFPLSPNNESAGQYILPSCKVLHLNNFNSGVKYPTINGNN
FT                   VSLYLKISPAIRLSDPEFSNLIFENIKKLEIDTNPSICHHVRFMNCKFPKLKKISCNSS
FT                   IISWDDLKQSQAPLTSLKINLNSFEQLQWLTNCPYDLKNLDITTLNKKILDFNNNTNLY
FT                   QDMKIVAKNVKFQLDSIWKAFILQNVFLTNYSSIEQLTICLDEHELYESINDCPKNLKE
FT                   LGFTNDGDCILIDIPYITHLTLFETVAQKSLSQNYSTQAAATKSLNSTNNRKFSYGSDI
FT                   SNDYGFSSDLAPVISPSLFRWNNVIGVNNESIRKNSIISFDERYSYSKRRTSSMSTTSM
FT                   FSRSSFPYINDEVILDDAIVFKFNDKMPDIFTTGLGALESALFNFEDLRDKQLANLHII
FT                   YQFSQPEGIYNEGDVTGILFESISRIINYPYHLKLPSILISNLHITFKVPTEFELFDSK
FT                   ALETVQSLLIQSKYNVKVVNELDFHGNKSHTELCFQRL"
FT   CDS_pept        complement(148808..150934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046812"
FT                   /locus_tag="CAGL0B01617g"
FT                   /product="Similarities with uniprot|P17629 Saccharomyces
FT                   cerevisiae YDR138w HPR1"
FT                   /protein_id="CAG57940.1"
FT                   /db_xref="HOGENOM:HBG124306"
FT                   /db_xref="InterPro:IPR018558"
FT                   /db_xref="UniParc:UPI00003B5F3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX99"
FT                   /transl_table=1
FT                   /translation="METIIDKESERLLSLFSHIAEKCNDALTAPIAQGQFDPEDLKWSS
FT                   LITLSDSFDKTDVELIKEVVLKRVVEKLLPVEEQEGDEDDTIEAAQKNEHSKLTENLKV
FT                   CSVLLDFCFHMRQFMSDTSQCSLVYYELFATVVEMLNWPDDVCLFWDYVESRINWFKLG
FT                   NTLKDDNSGETTLISYKQPLFEKLRRWNTSLMELSYRTHSNTPVMNEVKQKWLSFLSDL
FT                   LPIQEESNFNRTGSIAKLSNSTTNWNIYQTTENYRGQSKEESFFSDIKLVYQNFIYAPL
FT                   EFLSSSLDHKIKIDKVISTIIDNILELEEVFYNKIKKELKEINIINNKLNPDYFIPSKP
FT                   QEGLPEYLRTSKLFEELNSSSMSEFQSIYDKIKHLPVPNPLDMSTTDEYSLFDQFMTLE
FT                   NDIFRKQFMIQVYFTSYIITQLIESDEVRDFFNTNISKVKAAHSISFDDMEKQNIKKAS
FT                   TFTKHLMVNRIKRFYGNKDKKFLDMIESLELSESCFHKLKMNGFKQFNDFHITEEDIVV
FT                   PDIDKSFKKFGFVKMGNKQINNVWKIETGISNIKEVKLVPHEVLEKLQDKYAQSEGNEI
FT                   DIVKSWQSLRLLRGPYLFKLSGINEEKGLKGLFEESNQSYFQDKYSDWKKKSIEVFNEP
FT                   HKLLLAKARDYKQSKLNGKRENLEEESNSNKKVKLSNDNNIDADNNENENPSQERSLSN
FT                   TQKGRESDDLVSKL"
FT   CDS_pept        complement(151250..153283)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446614"
FT                   /locus_tag="CAGL0B01639g"
FT                   /product="Similar to uniprot|P16664 Saccharomyces
FT                   cerevisiae YDR137w RGP1"
FT                   /protein_id="CAG57941.1"
FT                   /db_xref="HOGENOM:HBG059789"
FT                   /db_xref="HOGENOM:HBG203171"
FT                   /db_xref="InterPro:IPR014848"
FT                   /db_xref="UniParc:UPI00003B5F40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FX98"
FT                   /transl_table=1
FT                   /translation="MHLHKIDAFYITDNVKVELIHESNPFFAGEPISIIVRIKHLGSLR
FT                   ERDHLETTLNNLNGKIQRIRQENREILENEIPESKWSLRNMFSKKNGDESAQNATDSNL
FT                   TLITDVKEQLVLLEKSRERLTKDLKFNSIVNFVSCYLQVSGKLQYDNSIIDKSTFKSND
FT                   SKLLGVTYADSTAKQLNEESISKSDKYVNSEYANITEGLRFGYREDEKIINDTNISMGA
FT                   NDRENSNAEYEQVPIFLIPQTLIFSEINLEPGEAKTFLFKSQPLNKEICPTYMLSNFLS
FT                   VLYDAEFGITGVVDGNLIPIAKKVPISIAPYVLEGGMQASSVLNRPAVIQGSGTVKEIK
FT                   SSPSSIRRASAPQNHVSNTLERRYSVERRSSLYERRLSINFERKNSNPTVVDDIEPERL
FT                   SLMKENFIKIISDKETNYDDIDKLVDNLVEVQFDKDEKDKDSKPDIELEEEHKNEEYVV
FT                   TRKRSDSVRDHIAELQNTPNMQYNVESYVIDGVTMIPQLANLQSTYQINRNGETIAKVV
FT                   FSKPFFMTSDDIDISVTLDDCDERQTRITGISAILQSFVLLNPRFAVDKTSKAARPKGK
FT                   TVAVDNSISFDDFTSISFKLSPSKTPTNHIAGQFKSDIFQHKWMVLLKFVIQKPIEDGH
FT                   LEQFYEDKKGRLFHAKETMEGEEFSCHIPIPIITASQEFGGW"
FT   tRNA            complement(153740..153812)
FT                   /gene_name="tRNA-Arg (ACG)"
FT   CDS_pept        complement(154275..156350)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446615"
FT                   /locus_tag="CAGL0B01683g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57942.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG181368"
FT                   /db_xref="HOGENOM:HBG524073"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniParc:UPI00003B5F41"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE0"
FT                   /transl_table=1
FT                   /translation="MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSL
FT                   NFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPF
FT                   NVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFY
FT                   GQGFELGFVEVRQAVGGKIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEV
FT                   REAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCAL
FT                   ANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVL
FT                   LLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGS
FT                   GIQLFLMIFLSIILSALGILSPSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYW
FT                   KANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGS
FT                   LISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLW
FT                   FNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIFI
FT                   HSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD"
FT   CDS_pept        157245..159263
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065958" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446616"
FT                   /locus_tag="CAGL0B01705g"
FT                   /product="Similar to uniprot|P46944 Saccharomyces
FT                   cerevisiae YDR108w GSG1"
FT                   /protein_id="CAG57943.1"
FT                   /db_xref="HOGENOM:HBG059935"
FT                   /db_xref="HOGENOM:HBG203156"
FT                   /db_xref="UniParc:UPI00003B5F42"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD9"
FT                   /transl_table=1
FT                   /translation="MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTV
FT                   LLDRHIEETYGIDSLYMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGL
FT                   TVPRQTRVRSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYL
FT                   SVVDKKFSPHIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDY
FT                   ETAAEQLKEFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQL
FT                   FVESIILPLWSTEFTDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDM
FT                   IVYDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGS
FT                   NYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLM
FT                   GAQNIVTAKMLKNEINPAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFL
FT                   ASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRI
FT                   GNLELLQKKEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELS
FT                   WCLDDLESTYSDLKCFNKENLLYTRLRNELIAARQDM"
FT   CDS_pept        complement(159373..161106)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197930"
FT                   /locus_tag="CAGL0B01727g"
FT                   /product="Similar to uniprot|Q04585 Saccharomyces
FT                   cerevisiae YDR109c"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG57944.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG252634"
FT                   /db_xref="HOGENOM:HBG294587"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI00003B5F43"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD8"
FT                   /transl_table=1
FT                   /translation="MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQ
FT                   SSNEIWDAVCYCVKSAIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNN
FT                   QNIIMWMDHRAIEETKEINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVF
FT                   MDLPDYLTFMASGVNTRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFN
FT                   ALGGPNESGNFTYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEV
FT                   PNNKEVVDIEECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQS
FT                   FTGALLAHILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFL
FT                   YGDYHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH
FT                   TIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSD
FT                   KGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAI
FT                   R"
FT   CDS_pept        163063..164673
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446617"
FT                   /locus_tag="CAGL0B01771g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57946.1"
FT                   /db_xref="HOGENOM:HBG124308"
FT                   /db_xref="UniParc:UPI00003B5F45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD6"
FT                   /transl_table=1
FT                   /translation="MVKSAKKTGTQDVDAIMKMNGTNLPSERPKFDIDGFRATKRRPAG
FT                   TSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLT
FT                   QETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVL
FT                   EPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPI
FT                   EKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFR
FT                   TRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGL
FT                   KLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASN
FT                   ILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIEHVQDYEKTMESIDRTG
FT                   TYKSGRKADQLPAEDTPTSHEPVANTTAINNRSTKANKLNGPNLRKRTKEITEIPMSDS
FT                   DDDEPKSKRKTRSRTRTRR"
FT   CDS_pept        165053..165349
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046813"
FT                   /locus_tag="CAGL0B01793g"
FT                   /product="Similarities with uniprot|Q04598 Saccharomyces
FT                   cerevisiae YDR115w"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57947.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG124309"
FT                   /db_xref="HOGENOM:HBG398786"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniParc:UPI00017BD5FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD5"
FT                   /transl_table=1
FT                   /translation="MLSSSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTL
FT                   FPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH"
FT   CDS_pept        complement(165648..166520)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351123"
FT                   /locus_tag="CAGL0B01815g"
FT                   /product="Similar to uniprot|Q04599 Saccharomyces
FT                   cerevisiae YDR116c"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57948.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG529802"
FT                   /db_xref="HOGENOM:HBG626811"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI00003B5F47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD4"
FT                   /transl_table=1
FT                   /translation="MLRIGSKVRYCNANRVIFNSALFGRRLLATEAAPIPQAAAPTLTK
FT                   EQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV
FT                   ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSG
FT                   KIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ
FT                   VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTA
FT                   GPGIVIDFQ"
FT   CDS_pept        complement(166953..168662)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503349"
FT                   /locus_tag="CAGL0B01837g"
FT                   /product="Similar to uniprot|Q04600 Saccharomyces
FT                   cerevisiae YDR117c"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAG57949.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG059923"
FT                   /db_xref="HOGENOM:HBG395452"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI00003B5F48"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD3"
FT                   /transl_table=1
FT                   /translation="MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQT
FT                   NFKGITTIGTIYTDEGNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIF
FT                   NGANLMISGTIPPFDERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAV
FT                   QIVHHLEDELFKVFKVKEEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKS
FT                   NLDDMAEVLDELRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNL
FT                   AEVNIKKSSWKKTAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQ
FT                   GSNTGSEGGNAKTTIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKD
FT                   LVDKKDKKCVLVDDMLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITG
FT                   NEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGST
FT                   TIGETTSSAKKTAEVQVQGPHGQLIMSYLNDLGIPNKWIDFENKLKNKKKRK"
FT   CDS_pept        168976..170844
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351124"
FT                   /locus_tag="CAGL0B01859g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57950.1"
FT                   /db_xref="HOGENOM:HBG124310"
FT                   /db_xref="UniParc:UPI00003B5F49"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD2"
FT                   /transl_table=1
FT                   /translation="MGEDIVLDRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINV
FT                   RNIVLLLDYFWDPIDGKYLALFLKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDC
FT                   CLWDRIIIPKSGSSELRIPNNDLTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNE
FT                   KKVVDVHLGYSCSSAQVTILINGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHF
FT                   DDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIG
FT                   GINDLDVLERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPI
FT                   CERLMVLTNRINGMIKGIDLQESQETSLLDISELQSFLNLVLKLLAELNEDETYFKQDF
FT                   LPWLTDKVYESINNEYKSVFFKAEYGNNKRILNIIKYFEATVIEIDYSLRTHLNKLKDE
FT                   NEKIINLFQKFSKSSLKTCLSEFETKLFEPKKAVKLLACEKICNDVCNYVQVLMSKDYI
FT                   LEILLVDAVTGTVLLSEKYNSIQNPFGYEITLDNIISCTLVGTEKVNKDDTYMQDILAG
FT                   GNSLVQENDNKIEIYAVFGTALDVDIENIIQVKLHPPKISLKLRTA"
FT   CDS_pept        172117..172341
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503350"
FT                   /locus_tag="CAGL0B01875g"
FT                   /product="Similar to uniprot|Q2V2P9 Saccharomyces
FT                   cerevisiae YDR119wa"
FT                   /protein_id="CAR57999.1"
FT                   /db_xref="UniParc:UPI00017BD5FF"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX5"
FT                   /transl_table=1
FT                   /translation="MFRSVGINRMRYVMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKR
FT                   LTPTLIGWASFLTVTLGWPFGIYFWKKPN"
FT   CDS_pept        complement(172860..174521)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446618"
FT                   /locus_tag="CAGL0B01881g"
FT                   /product="Similar to uniprot|Q9URQ8 Saccharomyces
FT                   cerevisiae YDR120c TRM1"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="CAG57951.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="HOGENOM:HBG053543"
FT                   /db_xref="HOGENOM:HBG386594"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI00003B5F4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXD1"
FT                   /transl_table=1
FT                   /translation="MSAMLKAAFSKVRNNLFKGQLPAVAVDPSDFTIVTEGKADILFPK
FT                   QEEVFYNPIQQFNRDLSVTCIQAWDHLYGSKLKSHRQRKRTSSEPEAKRRKLDPKDEEH
FT                   RYITILEALSATGLRAIRYAKEIPHVKEIIANDLLPAAVKSIQRNIDYNGVQDIVTANQ
FT                   DDANVLMYRNKSDNKKYHVIDLDPYGTVTPFIDAALQSIEEDGLMLVTCTDLSVLAGNG
FT                   YPEKCFALYGGVNMVSHDATHESALRLVLNLLNQSAAKYKKHVEPLLSLSIDFYVRVFV
FT                   KVKTSPIKVKELQSNTMITYHCSQCGSFANQKLGRKVDKQSRKKKQQTITKFSVAQGPP
FT                   IDSKCQFCGGTSLLAGPMYAGPLHNHEFIEEVLKINEKRFKEKDTVYGTKERIKGMLTL
FT                   AKNELNHDGSQFYFSPNTLSSLIKLQVPALKTIAAGLGSLGFECSLTHAQPSTIKTNAP
FT                   WDAIWYVMKKCHENKEDYQGRNLEDMPEKGIGYRILKYLEDNKEHYDQLYGEKLSFAPN
FT                   ETSGSIEKLRKLKIVRYQENPTKNWGPKARPSGKET"
FT   CDS_pept        175134..175709
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046814"
FT                   /gene_name="DPB4"
FT                   /locus_tag="CAGL0B01903g"
FT                   /product="DNA polymerase epsilon subunit D "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57952.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG203164"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B5F4B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXD0"
FT                   /transl_table=1
FT                   /translation="MPPKGWRKDAQGNYPTTSYMKEQENVTMQDLLFPRSVIMALAKEV
FT                   PEMQQQQVQVQAAEKGEPVEKTPAKKLVVTKDASMALQHSATVFVNHLLMYARELAKEQ
FT                   DRRSCNVDDILNALEHMGHPGLKPLVANRLDDYQEALEWKKQLKAQLQILNGEAEEEPN
FT                   ELGTYDHDNETDDEEIRDEPEKKLKVEP"
FT   CDS_pept        176316..179150
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446619"
FT                   /locus_tag="CAGL0B01925g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG57953.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059908"
FT                   /db_xref="HOGENOM:HBG626487"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001772"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020673"
FT                   /db_xref="UniParc:UPI00003B5F4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC9"
FT                   /transl_table=1
FT                   /translation="MYGAVLMDSDTRNNEGKSGRRRDSVSTTPRMFSTNTEQTGAQIDT
FT                   AREKHSKSSQPRVFHRKSLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKA
FT                   YMHKAQQLPPPADENEAKERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLS
FT                   NHYYMFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENI
FT                   MLSKTGEIKLIDFGLSNMYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVL
FT                   YVLVCGKVPFDDENSSALHEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKRATLQQVV
FT                   NHQWMLKGYDFPPQSYLPRRVPLTVDDINIDVIKEMYRFEFVESIDAAYKTIIDIITEP
FT                   EYKQLADQYWELADKSSFSEDSKFFTDDFKDPTQAYHPLISLYYLTFEKMQRDAKKENK
FT                   DWLSTKSSEITNSDVGLNKEYKFTPKKMESIQKEPSPSELLEEQGNVTPEDISPQISND
FT                   KEQSPIAGQSGSKAPRSSIKALTNRADQSAQVGKNAGISPKPSVENTEKSGFTNIFRRF
FT                   SQRHQRPSNINNSIASKNNNIRTHTRAVSDYMSVAPNELQKPVEIVSQNLPDLPTDAKL
FT                   IIEKTRNSSKNKSDENETLQPVPHAKGKKLHPTARAKSVGHARRESLNFTRPAVVPPNM
FT                   ADIEEVVDTGFLQTPDEEKLVKDKAFGEALSNTIVEDLTDDEILKEASKAPPGSMPSID
FT                   YPRTLFLKGFFSVQTTSSKPLPIVRYKIISVLKKHNIEFVEVKGGFVCSKSPTVTILNT
FT                   KTAPEKVDVYSGYDNDDTPDWSSQQSPKSMNDARLVFSDLDKSSNPHLTEGHSNSSLND
FT                   FENDNLSVGGKGDYLDNIQGPRAKVMDRAPIKFEIHIVRVRIVGLAGIHFKKLSGNTWM
FT                   YKELATRILHDLKL"
FT   CDS_pept        complement(179403..180701)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197931"
FT                   /locus_tag="CAGL0B01947g"
FT                   /product="Similar to uniprot|P26798 Saccharomyces
FT                   cerevisiae YDR123c INO2"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57954.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124311"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B5F4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC8"
FT                   /transl_table=1
FT                   /translation="MMQDHQKSGVSSSQDLFDLFEQGNDIDFETAYQMLSGTLEESEPL
FT                   QFMHKGPRQQEVSTPIANILPPLDPIKPATPNVMSNTTPYEYANTNLIKTPHDNNILFS
FT                   PDNHTKSMFSLDGHTTNHGISNNQKSYYNFDGIRSKHTGFEGSVLPHFYESKLTSPQRL
FT                   LTESPHLPTISQNFLTRSPIFTSQPFENHQNIGIPPMIQEKLHNNFGFPQKGLDDHFKS
FT                   PELLSSYESHAIENFLDNLVASDPFHNDKNDIDFKIGNDKAAVHEDMNNKGNILSAEII
FT                   NNNKCNSSIDVTQNRINSTLHKNSNSSDIVHNREDYKNTDLTTNHKIKKIPVPKDYPTK
FT                   NIELPGIVISDDDIPADIRHDMAKVRKWKHVRLEKLRRTHSKNAFDDLIKLIETPHPNL
FT                   DKRIPKYKLLGLVMNDIKGLLEANEKLEKLLNS"
FT   CDS_pept        complement(181406..182677)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446620"
FT                   /locus_tag="CAGL0B01969g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57955.1"
FT                   /db_xref="HOGENOM:HBG059912"
FT                   /db_xref="HOGENOM:HBG203167"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B5F4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC7"
FT                   /transl_table=1
FT                   /translation="MVRNSSQVRHFSSYLRLCQQQKNLETRVISRILKPANSTDNNEAR
FT                   SGWKLWAGHLFKTKKETFDKLKMLQSRIMGDIEIAGHSSNKILFDEINQWHFHNNLAKK
FT                   VRTPTVLIHGYAATSTAFFRSIPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLK
FT                   IENIDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKLGKINVVAHSYGGYL
FT                   SFNYALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLN
FT                   DYLFQKQLKPLRWLGPIGAKLCWNYIRSAYARVPSIDYKDYTFETFYGRGGLPEQTSQI
FT                   FTSLLTSSLLARDPLLDHVSQLQVPKLIMMYGQYDWMNKNGGKLMTQIFNGETKYIDIP
FT                   NAGHNLFLDNPSDFASQLTTFLAD"
FT   CDS_pept        182894..183886
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446621"
FT                   /gene_name="SWF1"
FT                   /locus_tag="CAGL0B01991g"
FT                   /product="Palmitoyltransferase SWF1 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57956.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059915"
FT                   /db_xref="HOGENOM:HBG203168"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI00003B5F4F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXC6"
FT                   /transl_table=1
FT                   /translation="MLLFLVFILVVSQVVLLLLSPQFRDKFIFRWYYDEVYKPMILDNS
FT                   RYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPMLTSIETYVVIPLMLILPLFFGSMS
FT                   MIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCKQVKPARSKHCTVCNSCIYLADHH
FT                   CVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFIQFNKSAYNTTPTGEKSLLILSI
FT                   LCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHDYINTGDLVRDPEGKYFIKYQNG
FT                   GNNYEFYSTDSYDGTQYTIVDYFTVKSPAEITNIYDKGNFINNLREFIG"
FT   CDS_pept        184252..187614
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197932"
FT                   /locus_tag="CAGL0B02013g"
FT                   /product="Similar to uniprot|Q03897 Saccharomyces
FT                   cerevisiae YDR128w"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG57957.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059916"
FT                   /db_xref="HOGENOM:HBG398310"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B5F50"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC5"
FT                   /transl_table=1
FT                   /translation="MVVLSGEDLHDSSTFGKSLSLRVDGGFNAVSINPSGRDVVLAGRK
FT                   GLFIIDLDDPFSPPRLLQHVTPWQVADVQWSPHPAKPFWVVSTSNQKALIWNLARPSTD
FT                   AIEHVLHSHSRAITDINFNFQHPDILATCSIDTYVHAWDLRSTSRPFYTTSAWRSGASQ
FT                   VKWNHMNSNILASSHGNELFIWDIRKGCIPLKKLDASSSINNIDFNRFNETEIMTSGNN
FT                   GEVRIWDYSKSEGSECQRVINTDFPVWRSRYLPFGRGFCVMPMVGGNNTVYMMNLDTEE
FT                   SEDSHKSKLQPIYTFKGHTDRVTDFLWRSRYTEDNGMEYQLVTWSIDRDLRLWTVNDTV
FT                   YEKLGYDRKLNRNTVINEYKYQSYNKVISPAHETGKGYYDRIKENFVSKSGLRKDNNFS
FT                   HLTWLSGIRLNQNGPSEDLFVAHKLQSLGEEVSAIGHKFPKIVFERILVSEREITVTMS
FT                   GPWSEDDPEEYIFLRITVNFPLGYPDAGNSPTFTVEENPKLKPTMKSKLLDGLSNIAKI
FT                   YTDKSIYCLEPCFRYVLGEDVNLQEIEQDEEPLLNFEIADHLDFDGFENEKSTDIDSNY
FT                   LDESSSESDIADYSDDLDPLAGPKKVFQHNVKFDSTPVPNQCGAVWTSSGQLLCFFASE
FT                   GTPEKKQQNLMKYMQRDIIRHHKVSDYSLNKAPPKGLRLLKQSTQDTESAKDDSSLKLD
FT                   VDSQNNSDDSYDSFEDDWDDILRNDIVVRNKFPVLQTSFPKAFNSLHSESAKTAESIKV
FT                   NKNLISLVDFNYLIPDKRELALEYRVMDALPEELARQNALIAEKYGFEDITHCWQILSD
FT                   FLLSQETDDPYTFIWDNDPMTIKWFVKEAVSYFEKCKNVQMLAMIYCIICNKRMQRMRK
FT                   RSQEERIEDAGNALGVISYEAVRNGDKMNGNTSRSISSSGFTRNSNDRMPIKKLHSPDV
FT                   SSISSGDYFIHNHNWNRNRLPDTNSPLSNRQLNNNGVDSSAITTFLPEITIQLIDDDVL
FT                   EAVNDPLYNFFDEAEERKLKHYVLQYSSLLYQWNLPIERVKVLKASTIKKEEDRYLTNY
FT                   TEEVGIEWVRNDCGREGLNRCTYCHLKAQYSIFVCGNCQHVLHLKCSKEWWNVSKECPT
FT                   GCGCNCPNMFDVG"
FT   CDS_pept        complement(187858..189792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197933"
FT                   /locus_tag="CAGL0B02035g"
FT                   /product="Similar to uniprot|P32599 Saccharomyces
FT                   cerevisiae YDR129c SAC6"
FT                   /function="actin binding"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG57958.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG014822"
FT                   /db_xref="HOGENOM:HBG316743"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B5F51"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC4"
FT                   /transl_table=1
FT                   /translation="MNIVRLQRKFPDLTQEDMFATIEKFRAIDLDDKGWVEKQQVLEAV
FT                   AKDGEATYDEARETLKHVNVDASGHVELEDYVELIAKLKESKTAAPPQTSFNVDTVETS
FT                   APTAGLGNSGLQHKGSAAHGRIIVGGSTTGTTHTINEEERREFTKHINSVLAGDADIGH
FT                   LLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKAGKKLNNFQASENANIV
FT                   INSAKAIGCVVVNVHSEDIIDGKEHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEEDE
FT                   TLEQFLRLPPEQILLRWFNYHLKQANWERRVSNFSQDVSDGQNYTVLLNQLAPELCSRA
FT                   PLQTNDLLQRAEQVLDNADKLGCRKYLTPSSLVAGNPKLNLAFVAHLFNTHPGLDPIEE
FT                   TEAPEIEDFDAEGEREARVFTLWLNSLDVDPPVVSLFEDLKDGLVLLQAYDMVMPGSVD
FT                   KKHINQRPANGSELSRFKALENTNYAVELGKAKGFSLVGIEGADIVDGSKLLTLGLVWQ
FT                   LMRRNIVNTMQTLSSSGKDISDSEILKWAKEQVAKGGKSSDVRSFKDDSLSNAHFLLDV
FT                   LNGIAPGYVNYDLVAPGNSDEEKYANARLAISIARKLGALIWLVPEDINEVRSRLILTF
FT                   IASLMALKR"
FT   CDS_pept        complement(190333..191136)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446622"
FT                   /locus_tag="CAGL0B02057g"
FT                   /product="Similarities with uniprot|Q03898 Saccharomyces
FT                   cerevisiae YDR130c FIN1"
FT                   /protein_id="CAG57959.1"
FT                   /db_xref="HOGENOM:HBG124313"
FT                   /db_xref="UniParc:UPI00003B5F52"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC3"
FT                   /transl_table=1
FT                   /translation="MDRPLSDIGNVVQGRDTRNVFDRLSISPQKRSSNKRDSVVWKPAS
FT                   RISPKKSNNAPLTTAIHETPKRLQSPSFLKDRSFTQSLDRPQFDPKDIVSATPVNKVKP
FT                   GIPRSVGNPTTSTFMIPISPTKITFSNEKRTGGDGSSSRILSRMRNIRASPVRSVPSTA
FT                   TTIKKRNLTERLRQEEEGENKNNEKRVRFQVPSQPRPGSSQSSSRTPSRDSNESMTNAN
FT                   KHISRERKAPMPVKTSPDARIDQLENTVRLLEERVKYLEKLLRNR"
FT   CDS_pept        complement(191736..193610)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197934"
FT                   /locus_tag="CAGL0B02079g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57960.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG124314"
FT                   /db_xref="HOGENOM:HBG395756"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5F53"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC2"
FT                   /transl_table=1
FT                   /translation="MDKDSVIADTRGDASSVSTGSVKEEPVRTNAFGQRFPTGVELWAP
FT                   LGSLVLCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATL
FT                   VGFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEER
FT                   NRGLIIAVMSSSFGIASVVGPFLGGAFTTHVTWRWCFYINLPVGGLAFFLFLTFYNPEK
FT                   WVVNKDTAEDEVVGNGRLGLLSILGGQAVRFVKSVGVQLAKLRYPGTWRIIARELFYRF
FT                   DIVEFVFMTLGSVLILLAFTFGGNKYKWNSGSTISMFVLGILFTLGAFVYDFFIYPKFE
FT                   AVKTVPHYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQLVFNDTAWKAA
FT                   IHLIATVVPVVITVVSSGIVNSKTGYVKPIAIFSGVTGIIGAGLLTLLDNHASSAKKIG
FT                   LLILPGVTFGAIMQSSIIGVQILLDKSSPTYRYDFIAVTTLNAFIKNIGQAYGAVLCDT
FT                   VFSASAINLMKKRHVSLPGGYETSANNLIIARREYFDGPTSAIGNIISDSIINVFYMAL
FT                   GMFAVVVVCVVFVSNKKVDIRKPEDIKRQQEEDPEKQDQNKDFKEDSE"
FT   CDS_pept        194461..195798
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503351"
FT                   /gene_name="HSV2"
FT                   /locus_tag="CAGL0B02101g"
FT                   /product="SVP1-like protein 2 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG57961.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG058622"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00003B5F54"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXC1"
FT                   /transl_table=1
FT                   /translation="MDVREAIQQEAGAETGFASVTFNQDESCFSCANEQGFLVYNTFPL
FT                   SLKLTKEFKQTPERGAGIGYSQMLYRTNYIALVGGGQRPRYSLNRVVIWDDLQQKESFS
FT                   LKFMSIVRKVVLSRVHLVVALENELFIYSFHSTPKLLCPPIKTAPFGPFDFKVVTIEGK
FT                   ATDQAKVTSLLAYPSAKLTGQLHVADLSKLRSNQNNNQDMALTSESFLPTTIIKAHKAP
FT                   IRNVRINNQGTMVATASRKGTLIRIFSTHNGILLKEFRRGLDRAEIYDMCFSPLGTRLA
FT                   VVSDKQTLHVFQIAPMAEGTLNPANPEDHQSSGSNGHIKANTNQVHSLRNIVPTSWKPK
FT                   YLDSVWSMCKVHLRNPKLRNNVNDLAFNEDRCTIAWCRQNRSHTFKNGNHFNENEENKL
FT                   VLVWKNSRIWEKYVILEKEAPNSNDGIKGPSPLTEWELVRESWREL"
FT   CDS_pept        complement(195958..196785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446623"
FT                   /locus_tag="CAGL0B02123g"
FT                   /product="Similar to uniprot|P10834 Saccharomyces
FT                   cerevisiae YGR222w PET54"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG57962.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG124315"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B5F55"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXC0"
FT                   /transl_table=1
FT                   /translation="MTSHKQLIESVLKGVNGTNIRKVGEKLLKQEKASVVGHPGVLALA
FT                   YDSYDPSLTYADFAKLVTQRQMSMTSTPQTIKFDLLKRRDPKYFTFKDQYLLLFNRNID
FT                   LRDYLNITKDSTINRVRVRWRPLVEGKDEHSSYLGERHELIYRKYCRNLEAAYLDRKQY
FT                   FDVVNKEMTQETISDEPQLSCLIERIHEIEKKCAVVWNMPMESKQLEPYFSFYDIVHSF
FT                   DMYWNRDLSKTFKFIRFNTQEDCKQFKKNYHGYVYDETNPDVNKILVETLNGM"
FT   ncRNA           197220..197677
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="SNR7"
FT                   /locus_tag="CAGL0B02137r"
FT                   /product="U5 RNA"
FT   CDS_pept        198831..200696
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446624"
FT                   /locus_tag="CAGL0B02145g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57963.1"
FT                   /db_xref="HOGENOM:HBG125024"
FT                   /db_xref="HOGENOM:HBG203794"
FT                   /db_xref="InterPro:IPR014805"
FT                   /db_xref="UniParc:UPI00003B5F56"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXB9"
FT                   /transl_table=1
FT                   /translation="MNTIGFENDFLRPTSTIAPTSTTTLFKRDDVTGSDSATSTSSDSD
FT                   SSSTSTSTKCTGSAQYCEKPTDAHWKETVGIAVGVPVGVIVLGLLIVLILVWKKGKKEA
FT                   DEDLDPEFQSGSEYLPYISNEKHIGSSSTNSSAGSKIDAPYKSRADPFQLPDASTDSLR
FT                   DFARMAHDPSLDKYKLATSSLRNKSNLSLVNNQTRHTTSGDSEKDSFDFANNSTTSTLE
FT                   DESTPIKKMPNNDAEEVGNDTTLNPFESEDDPAEMRPQIIITDSDPSNDDAPLTPREEE
FT                   DIQRIKSIYNVYLDQNGNQIVVDPTDENKLGNTETVSTEDSENIEGLGIQTGTGIQAQR
FT                   ASRIASSVYSENPLAGSENKEDYFNHKDMNDNVQYDMQSQQQYIPQTVQYPNNGFVYDQ
FT                   QYHDQQQAYYMQHYQQPNAQQMMYYQPPINQTYHQYHPQTLEAIDELPTPTELAYSPSY
FT                   HSLTSFKKPMKQQLLIKNQIATLNGLTLNPIDHPEMFFTQDDSYSKYQEKIAPMSGKPS
FT                   NKNPASNVPLPHHLRQSVVMTNPHDLSLSTTHKPAGSFRKVHNAAQSPHLGVDPRYGNN
FT                   TRVSGLLDDTDVVQPASVGEILPRHGNNDDLRKQLGISHNYHIQL"
FT   CDS_pept        201332..202123
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446625"
FT                   /locus_tag="CAGL0B02167g"
FT                   /product="Similar to uniprot|P31334 Saccharomyces
FT                   cerevisiae YGR220c MRPL9"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG57964.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG154396"
FT                   /db_xref="HOGENOM:HBG734653"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI00003B5F57"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXB8"
FT                   /transl_table=1
FT                   /translation="MVGLVTFIRQSSTMRAKLIARSAVSAVPLPEPVKKHQPQQAHLRK
FT                   WLPNRCGAVTQKVGMMPYFDEKTGERIAATILQFNNVEVLMHRRLDEDGYVACQVGYGN
FT                   RSVDKVSRQMLGHFATLNVNPKEKVTEFRVKNEEGLLPIGTHIKPDFFTEGQYLDVRSV
FT                   SKGKGFAGVMKRHNFKGLRASHGTSVMHRHGGSYGQNQDPGRVLPGKKMPGHMGVQNVT
FT                   VQNVKILKVDEANNVIWVKGAVPGPNGTYVKIQDAIKKLKD"
FT   CDS_pept        complement(202354..205617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503352"
FT                   /locus_tag="CAGL0B02189g"
FT                   /product="Similar to uniprot|P30822 Saccharomyces
FT                   cerevisiae YGR218w CRM1"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG57965.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG028487"
FT                   /db_xref="HOGENOM:HBG315058"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B5F58"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG2"
FT                   /transl_table=1
FT                   /translation="MEGILDFSKELDITLLDQVVETFYQGSGAQQKEAQTILTKFQEHP
FT                   DAWQSADKILQFSQNPHAKFIGLSILDKLITTKWKLLPQEHRIGIRNFIVGMIISMCQD
FT                   DTVFQTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSASVNVCENNMVILKLLS
FT                   EEVFDFSAEQMTQAKALHLKTSMSKEFEQIFKLCFQVLEQGSSPSLIVAALESLLRYLH
FT                   WIPYRYIYETNILELLSTKFLASADTRSVTLKCLTEVSSLDLPDNNSSMQQQTVQYFQN
FT                   TLQQIASNVIPVTADLKSTYATANGSDQSFLQDFAMFLTTYLSHHRSLLESNENLKELL
FT                   LNAHQYLIQLSKIDERELFKTTLDYWHNLVSDLFYEVQHLPANELNPLMQLSVGSQAVS
FT                   TGSGAISPEFMKRFPLKKHIYEEICSQLRWVIIENMVKPEEVLVVENDEGEIVREFVKE
FT                   SDTIQLYKSQREVLVYLTHLNVIDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISG
FT                   TMTEDTEKRFVVTVIKDLLALTEKKRGKDNKAVVASDIMYVVGQYPRFLKAHWNFLRTV
FT                   ILKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEPFIQTIIREIQKTTSD
FT                   LQPQQVHTFYKACGIIISEERNTVERTRLLSELMQLPNMAWDAIVEQSTANPALLLDAE
FT                   TVKIIANIIKTNVAVCSSMGADFYSQLGHIYYNMLQLYRAVSSMISEQVAKEGLIATKT
FT                   PRVRGLRTIKREILKLIEIYISKAKNLEEVVKVLVEPLLNAVLEDYMNNVPDARDAEVL
FT                   NCMTTVVSKVGHMIPQGVILILQSVFECTLNMINKDFTEYPEHRVEFYKLLRVINEKSF
FT                   AAFLELPPAAFKLFVDSICWAFKHNNRDVEVNGLQIALDLVKNIEKMGNIPFANEFYKN
FT                   YFFIFVSETFYVLTDSDHKSGFSKQSTLLMRLISLVYDNKISVNIYQDGEAPQGTTNQV
FT                   YLNQYLANMLSNVFPHLSADQITGFLTALTKQYKDHIKFNGTLRDFLVQIKEVGGDPTD
FT                   YLFAEEKENALQEQHRLEKERAAKIGGLLKPSELDDEDD"
FT   CDS_pept        complement(206410..212784)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197935"
FT                   /locus_tag="CAGL0B02211g"
FT                   /product="Similar to uniprot|P50077 Saccharomyces
FT                   cerevisiae YGR217w CCH1"
FT                   /function="ion channel activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57966.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058518"
FT                   /db_xref="HOGENOM:HBG204428"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B5F59"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG1"
FT                   /transl_table=1
FT                   /translation="MPMVKRQLTERYEPGNEAQDADDGFVPPFVNIVPPDSDEDKNSSS
FT                   NSLPIRRIRKRGPYEDSDEGDYSDNDDDFEERVEYSPRRLEGTFGDDGELDGISEHDHS
FT                   HRDDMISNTDTAHSDRVSSLGMSSKAESPSKKWEPRIANLFKSALGNNNAKQKPQLSLR
FT                   TTSLSTNTQDKARKYSSSDEPGSPSAKSAVSFHSSGVRSNVLHRSNKSGESSPRRRSIS
FT                   TDGPPRSAKVLSIIDADDMDEFEDMKRGFQSAIEDKKFAWLPQLQQETESADELEAGDK
FT                   SKLNIDIKSTLTPRGRSGSQFRNDSTEDLHFEPGLFSSPSKHSSRRPSIIASSIAHGLG
FT                   INLEKDKNVDTVSIEVELPDFDEYENAKKRPPLILHGNSLGYFGPNNPLRYKVAHILLN
FT                   KYYKIAHILLLTFLTALLAYRSYEPENFDFLYRFRNWSDYIIFILFILFTSNDIAKIFA
FT                   FGFWDDSQMFAYHQLEYISLLERFGITKLYHLIKKKYGPKIVHFLLPFNVISDESEKET
FT                   IQRNMKANISAKNDTNSKSLKFNCPRAFCRSSWNRIDLLSSVCFWLGMFLSINNYDKRV
FT                   GIRIFKPLAAMRILRLVNTDTGITSILRGLKYGMPQLINVGSMLVYFWVFFGILGVQIF
FT                   KGSFRRQCVWYNPENPNDRYQYQLQFCGGYLEPVTKKKMNYIFEDGREGPVSKGFMCPQ
FT                   YSKCVSSSNPFNGRVSFDNIINSMELVFIVMSANTFSDIMYYTMNSDEFSACLFFIISI
FT                   FVLTIWMMNLLIAALVSSFQLAHEEFKKKKLEESSNESWPIRFALGYWRYFKVKASQTE
FT                   FPSWAERGLKYYEKIEPVFIILIMFDLIMRCLIKDTSSQHFVTTLLRIDRGVTIVLFIE
FT                   SIFRLVLHIPNMWKFLTRFNYVYDLFVAILTLVITILANAGLLGHGYYWLSFFQITRFY
FT                   RLVIYIGFTRKLWKEVLGNGIMIWNLTAFYFFFTFLASIILSLYFEGVIPQDQIEDQLL
FT                   GMYSLPNSFLSLYSIGSTENWTSILYIIQQYSPNISSAFFSTVFLIIWFILSNSVILNI
FT                   FIALISESLEVKEDDKRPMQIKHYLKHIYPQKIQRFRHASLLARIKKKIFRTDSQEDSR
FT                   DFKQFLMRGTAIMNIAQNLGDLSKEFNTEQDRDIVTLLVRLTEYIPILRKFGIYSNNPF
FT                   YKRNEIMFSETSDLNGRNYMLQLNEFEDEKLDYLQKHSMFNYSYYLFSPRHRFRKFCQK
FT                   LVPPSYGKRTDNYKFYEDDTDTYSRKTYFNHIWRDLFVVFYAAATVLLIVFSCYVTPIY
FT                   RMKRNMSSKNWVTYVDAAFLAIFCVEFIIKTVADGFIYTPNAYARNPWNLIDFFVLISM
FT                   WINLIAFLRNDGNLSRVFKGLTALRALRCLTISNTARETFKVVLFNGIGKILEAGLLSL
FT                   TLLFPFTVWGLNLFRGRLGVCNDGDLGRDECFNEFSNEVFQWNVMMPRVYDNPELYLDS
FT                   FTSAFNSLFQIISLEGWTDLLGNLMNSTGVGKPASLLASTGNAVFIIAFNFLSIVFILN
FT                   LFVSFIVNNQAKSTGSAYFTSEEKAWLESQKLLSQAKPIAIPTFHDISRVRIFLYNIAV
FT                   EKNNIYYAIFLQTVTYIHIIMLLSLTYKDHGSGLLYSQVYFMFSTTVFLLQELFHVYGA
FT                   GLRIYKMNKWNLIRIQILIVSFLLTLISFNVDRAYIWYHNVNGFFHLVIFLFIIPQNDT
FT                   LSELIETAMASLPPILSLTYTWFILFLVYAIALNQIFGLTRLGPNTTDNINFRTVLKAL
FT                   IVLFRCSFGEGWNYIMDDLKVKEPYCSQRVKGNYSDCGSQTYAYILLISWNILSMYIFL
FT                   NMFISLIIGNFSYVYRKGGTKSEVNRGEIRKYVETWARFDPDGTGKLDFEYLPKIMHSF
FT                   NGPLSFKIWEGKLTVKNLVKNYMEVNPNDPYDVKVDLEGLNKELDSINMESIMNRRLQY
FT                   RRFVQEVYYTQAYMGYMKFSTLLDLVPLYTTYDPRECLGIDQYVRHLYIMGKVDRYLDN
FT                   ERNVDVLDMVVTRWKHHLKRKYGPNYKLDQDSIKKDLNIKVPEIKTWNESVESVTTPRV
FT                   SYGVNDFIWSPRNNSNSSAYSKPLPQSHARPIPPHIQISNSRVMEYTNRDSLSSLENIH
FT                   NQSDEELKDPFRDI"
FT   CDS_pept        213180..215003
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351125"
FT                   /locus_tag="CAGL0B02233g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57967.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="HOGENOM:HBG058519"
FT                   /db_xref="HOGENOM:HBG204427"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniParc:UPI00003B5F5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG0"
FT                   /transl_table=1
FT                   /translation="MSYVFWPESLRIREQQLGDGPLVAVALQVKDSYVVLDICYEQVIR
FT                   TIKLEKPYCVVAKSSGTERKWVYSIDGTILVWFKEPKVKLMQFYSLEPLSLELPEKIAS
FT                   PELDPSADKANAIKLFSHPRYQNYNRDIRDIILVINVYFRQLKKLHKEYPKLSREVVSS
FT                   SAQLFEDVKHFICKTWIWAFFRSSFHYLLLMVNYISSSVLVLLNRNFPQLINISATAQQ
FT                   IDLRCRQHCYFPVQYLKITKNIQFREQIPRFRSNSIRSILQLRDDLPFENYPEYIRMYN
FT                   TIWLIFNDLSFGLIISAYITENSEAIVTSFSSLTRWLLYDQLRDLTIFLSNNPFGIKLN
FT                   QEMGGFLSELFLWVIDVSYFTYIRYFIKEEIFRRLLKVLVQVSYVIGATFTLAIIIDFI
FT                   SIISFPILIFYHISCKLYRLQVNIMVSLFYLFCGKKRNVLRKRVDYKYFDLDQLLMGTL
FT                   LFIILLFLFPTVLVFYAAYTSLRVVFLIIELGLQSLIALINHFPLFALLLRLKDPMRIP
FT                   GGVYFTTSFNQDRIVMRMYNKPTQIGLMFRPYQALMRSLYKNYLSPAAVKHLIKGGIIV
FT                   MQRKNLYSVLYSSLPDNPVSSGELYDGLFNK"
FT   CDS_pept        complement(215215..215538)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446626"
FT                   /locus_tag="CAGL0B02255g"
FT                   /product="Similar to uniprot|P53305 Saccharomyces
FT                   cerevisiae YGR215w RSM27"
FT                   /protein_id="CAG57968.1"
FT                   /db_xref="HOGENOM:HBG190931"
FT                   /db_xref="HOGENOM:HBG737511"
FT                   /db_xref="InterPro:IPR013219"
FT                   /db_xref="UniParc:UPI00003B5F5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF9"
FT                   /transl_table=1
FT                   /translation="MSIPKSRLLAVAELSAKIFDQGFNPSGARTGAKILSQRLKGPAVS
FT                   SYYGNPDFVKFRTIRKLYSDIPMSDPEEDYRLMMVSARKRRGKGAPKKTKKSEAGEKSK
FT                   KKK"
FT   CDS_pept        complement(216053..216745)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446627"
FT                   /locus_tag="CAGL0B02277g"
FT                   /product="Similarities with uniprot|P13483 Saccharomyces
FT                   cerevisiae YML113w DAT1"
FT                   /protein_id="CAG57969.1"
FT                   /db_xref="HOGENOM:HBG124317"
FT                   /db_xref="UniParc:UPI00003B5F5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF8"
FT                   /transl_table=1
FT                   /translation="MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRDPIANNITN
FT                   TTNTTNTTEVNPNHTLVNNTNGIIGNNTQQFLSLVTENVPEPLNTQPAYGHPQHDLQQL
FT                   QRIPSVRVMDAVDALRGLTKTQPGNHRQIVQHVPTLTPYMDIMSQSPMLPRKITTDMSQ
FT                   PLGHAPSSRHFAGQNITTNNPLSSQAPAQGQLKVEMHVDIPGNDIPAISGGRNIYSVPH
FT                   TTQNSVPN"
FT   CDS_pept        217341..219272
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446628"
FT                   /locus_tag="CAGL0B02299g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57970.1"
FT                   /db_xref="HOGENOM:HBG124318"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="UniParc:UPI00003B5F5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF7"
FT                   /transl_table=1
FT                   /translation="MPAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQ
FT                   LQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNL
FT                   LPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTDNDVD
FT                   IDEDDDYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKP
FT                   ETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKDNQKGTHLKQENNLILSEESNNLEVQ
FT                   SISTDKPDDVGSLEDINKQDDDKTQGNKIEVDAENKDQVVKIEENKESSTEKATETATE
FT                   TATEKQLSEEELADLEIKALLYRIENNKEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFD
FT                   VEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIKRTM
FT                   DRFKRNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKKEQEIVRKSREMEAIEN
FT                   ANKFGILPGEKPLEVLQDASNASTGESSTTTAQIPQGAPLLVNPVNSTLVPLVDSEKPK
FT                   PLEEVQTIDVIAKDVEDDDEDLGLFGGFNSSSDDEEIDQNKETQESPTKKTTHVKFELG
FT                   ESDSDKDI"
FT   CDS_pept        220222..221760
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197936"
FT                   /locus_tag="CAGL0B02321g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57971.1"
FT                   /db_xref="HOGENOM:HBG323986"
FT                   /db_xref="HOGENOM:HBG435756"
FT                   /db_xref="InterPro:IPR005109"
FT                   /db_xref="UniParc:UPI00003B5F5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF6"
FT                   /transl_table=1
FT                   /translation="MMMSIPSFRDLAKLRRSADNKRGGEYSLPISRTGSEATLSKHDKF
FT                   IAKKKNFKFRKLATGAIIVIVIVSIFLVFFNIEVSPISLPSSFYHKEYLPFEFKDAAYH
FT                   SFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGN
FT                   FQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKT
FT                   LEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPN
FT                   YSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVY
FT                   WRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAK
FT                   TLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHF
FT                   SAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK"
FT   CDS_pept        complement(222130..223743)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446629"
FT                   /locus_tag="CAGL0B02343g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG57972.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176437"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5F5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF5"
FT                   /transl_table=1
FT                   /translation="MGIFRKSGTDSVQQETLSSSSSGSSFKQDNNDIVDEKQCDTQAID
FT                   GNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWL
FT                   MAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRA
FT                   FQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDAN
FT                   QWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQA
FT                   PIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGW
FT                   GSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLS
FT                   MVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAG
FT                   SLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALML
FT                   SEIIQGRKNEKDSAVVEIAK"
FT   CDS_pept        complement(224663..227815)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046815"
FT                   /locus_tag="CAGL0B02365g"
FT                   /product="Similarities with uniprot|Q03735 Saccharomyces
FT                   cerevisiae YML117w"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG57973.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG252923"
FT                   /db_xref="HOGENOM:HBG398788"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018835"
FT                   /db_xref="InterPro:IPR018885"
FT                   /db_xref="UniParc:UPI00017BD677"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF4"
FT                   /transl_table=1
FT                   /translation="MTEKVKKHGRHYVPQTYYSVPDLYFPMAHAHAHAHPQPPQLMNSP
FT                   YQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRN
FT                   SGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVT
FT                   KKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQ
FT                   TDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSY
FT                   VTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQD
FT                   ALFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKAN
FT                   LMTYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRELE
FT                   SLSDELASLKLEEKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMY
FT                   LHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTN
FT                   KVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFI
FT                   EDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGAN
FT                   RNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCC
FT                   WVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSK
FT                   FYKKVKKPSYDIRIKKMEEKRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKLSGGH
FT                   TTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGSDESVISDFEN
FT                   SASKETSSSDRKYQTTNSRGDTFVPKTNLSHAPPRAPSTINMTYKKISYVPPLNGQAPK
FT                   MDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEEDPS
FT                   AP"
FT   CDS_pept        complement(228209..229624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446630"
FT                   /locus_tag="CAGL0B02387g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57974.1"
FT                   /db_xref="HOGENOM:HBG058309"
FT                   /db_xref="HOGENOM:HBG397568"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003B5F61"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF3"
FT                   /transl_table=1
FT                   /translation="MIERNGNTHNDMGYDKASGKYATPAEIEAKREARRLKKQKLREEL
FT                   LSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPA
FT                   LKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGV
FT                   MIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSR
FT                   SGVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVKGDYCKMFTGDFNSQPNSVPY
FT                   LVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYDQGT
FT                   DPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIADHHEPEL
FT                   SSWSTKWAGLLDYIFYVNQRPSTPATFETANNIAIAGYLQMPTHAQMHNHSQPYTGEYP
FT                   SDHISMMCALEIY"
FT   CDS_pept        complement(230087..231172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046816"
FT                   /locus_tag="CAGL0B02409g"
FT                   /product="Similarities with uniprot|Q03208 Saccharomyces
FT                   cerevisiae YML119w"
FT                   /protein_id="CAG57975.1"
FT                   /db_xref="HOGENOM:HBG124257"
FT                   /db_xref="UniParc:UPI00003B5F62"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF2"
FT                   /transl_table=1
FT                   /translation="MSTWQKGDIMYSPTKRTLNNKTSGSKIASGSNGNGNGSGNGSGSA
FT                   YHDPGSSYSSLQKSNKMVFQEQPMLVRNMYDQNYYYYDGQGYGSPPMSNRNAMANPVSP
FT                   FLYSPVMLPNHVHASPTTGRKKKVSLNRNPRNSNLVMPSSPIKNNNIDTGSKTANLSGP
FT                   GKKYKELRDIDDLPRSPCNYETPNLKNRYFGPVQKVEDNTDRKANVNISYKNSKSKQKK
FT                   PPVVYKLATPLASKDVNALDNSFLLQPDTPRYYKIQPIKFLHSEPIENFAGLQDISTHL
FT                   LDNNTPKKKSHISRVQPPPAATNDSFDLSFDGKALDRSDIFRMVDSFSIAFSDDEDNEE
FT                   SSFISRRNNNDILPADMTNNR"
FT   CDS_pept        232347..233921
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446631"
FT                   /locus_tag="CAGL0B02431g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG57976.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG238038"
FT                   /db_xref="HOGENOM:HBG319217"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI00003B5F63"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF1"
FT                   /transl_table=1
FT                   /translation="MLSVLSKTTVIKRAPGAIALFPRYNSTSSKPKETQGVEKKGTGPT
FT                   SFKTMKVIDPNSRDKPNVVILGSGWGAISFLKHIDTKKYNVSIVSPRNYFLFTPLLPSA
FT                   PVGTVDEKSIIEPVVNFALKKKGNVTYYEAEATSINPDRNTVTVNEVSAVEQVALGNKE
FT                   SEQEIGIERKSDAEIKYDYLITAVGAEPNTFNIPGVEKYGNFLKEIPHSLQIRKRFLEN
FT                   IQKANLLPKGDPERKRLMSIVVVGGGPTGVETAGELQDFVHQELGKFLPSLAEDVQIHL
FT                   VEALPIVLNMFEKKLSSYAQSVLEDTSIKLHLRTAVSKVEETQLLAKTKHEDGSVTEET
FT                   IPYGTLIWATGNKCRPIITDLFKKIPEQNTSTRALNINSFLQVQGSNNIFAIGDNAFCG
FT                   LPPTAQVAHQQAEYLAKTFDKMAQLPNFHKSLAERKEKADLLFEENNFKPFKYTHLGAL
FT                   AYLGSERAIANITYGKRSLYTGGGLFTFYIWRLSYLAMLLSARLKFKVVSDWLKLAFFR
FT                   RDFFKDL"
FT   CDS_pept        complement(234125..235075)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046817"
FT                   /locus_tag="CAGL0B02453g"
FT                   /product="Similar to uniprot|Q00582 Saccharomyces
FT                   cerevisiae YML121w GTR1 GTP-binding protein "
FT                   /function="GTP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG57977.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG021744"
FT                   /db_xref="HOGENOM:HBG332545"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="UniParc:UPI00003B5F64"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXF0"
FT                   /transl_table=1
FT                   /translation="MDDGGNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGVTMDV
FT                   EHSHLRFLGNMTLNLWDCGGQDVFMENYFSKQKDHIFQMVQVLIHVFDVESQEVMKDIE
FT                   IFTRALRQLRKYSPDAKIFVLLHKMDLVQLDKREELFRLMMKKLKETSADYGFPDLVGF
FT                   ATSIWDESLYRAWSQIVCSLIPNMSVHQSNLKKLKQVMDAYEIILFEKTTCLVICSSND
FT                   PGSATTTTTTTSAPTSTTIDKLDPKRFEKISSIMKNYKESCTKLKSGFKNLVLNDNIYV
FT                   SELSSNMVCFIVLNNSNESHQLVSENIKKASQFFE"
FT   CDS_pept        236029..237771
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446632"
FT                   /locus_tag="CAGL0B02475g"
FT                   /product="Similar to uniprot|P25297 Saccharomyces
FT                   cerevisiae YML123c PHO84"
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG57978.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744844"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B5F65"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE9"
FT                   /transl_table=1
FT                   /translation="MSRNEKDEIEVDTREKKVPVHITEGGNMAFHNYLNDFAHIEDPLE
FT                   RRRLALQKIDERPFGWDQVRTILIAGVGFLTDSYDIFAINLSISMMSYVFWQGNMPNST
FT                   QTLLKVSTSVGTVIGQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGINFPA
FT                   VLTFYRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAGGLVALIVI
FT                   RAYKGDLIYANSGAECDYACQKACDQMWRILIGFGAVPGIIGLYFRLTIPESPRYALDV
FT                   KEEVDLPSNIEKVRATADDEHLEDLERSSTVVEDGIVVPPPKKASWKDFRSHFGKWKYG
FT                   KILLGTAGSWFVLDVAFYGLSLNTAIILQTIGYAGSKNVYHKLDDSAVGNLILICAGSL
FT                   PGYWATVFTVDTIGRKPIQMMGFIILTALFCVIGFAYHKISDHGLLALYVICQFFQNFG
FT                   PNVTTFIVPGEVFPTRYRSTAHGISAACGKVGAIIAQTALGTLIDHNCARDGKPKNCWL
FT                   PHVMEIFALFMLLGIFLTLLIPETKRMTLEEISEKYHDEVDISKLAPVTVADSTSSSSV
FT                   SHMV"
FT   CDS_pept        238507..239847
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503353"
FT                   /locus_tag="CAGL0B02497g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="structural molecule activity"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="CAG57979.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG496287"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI00003B5F66"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE8"
FT                   /transl_table=1
FT                   /translation="MREVISINVGQAGCQIGNACWELYSLEHGIRPDGYLEEGLTKPKG
FT                   GEEGFSTFFHETGAGKYVPRAIYVDLEPNVIDEVRTGPYKDLFHPEQLINGKEDAANNY
FT                   ARGHYTVGRDLLDDILERIGKIADQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSIEYG
FT                   KKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKKNLGITR
FT                   PSFSNLNNLVAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKSK
FT                   AYHESNSVPEITNACFEPGNQMVKCDPRTGKYMATCLLYRGDVVTRDVQQTVAQLKNKK
FT                   TIQMVDWCPTGFKIGICYEPPTATPNSQLSAVKRAVCMLSNTTAIADAWKRIDRKFDLM
FT                   YSKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYGDEEF"
FT   CDS_pept        240486..241424
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351126"
FT                   /locus_tag="CAGL0B02519g"
FT                   /product="Similar to uniprot|Q12746 Saccharomyces
FT                   cerevisiae YML125c"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG57980.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG477179"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00003B5F67"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE7"
FT                   /transl_table=1
FT                   /translation="MNEDPVVYKNILDEPLHGLYIPTALFLVGTAIMTALSGEWRILLA
FT                   LPVLGLLIGARFFAAFKRRRSLYPDKWTSLELEDQTLISRNTAIYRFKLKTPLETIDIP
FT                   SGHHVQVRVFIDGKEEVRNYNPISTRFEKGHIDLLVKSYKDGKVSKYFASMKPGETVDF
FT                   RGPVGSLVYKPNTYKNIGMVCGGSGITPALQMLNDIITVPEDLTKLSLIYCNETEKDIL
FT                   LKEELDEMAEKYPHFNVHYIVSQPTGQWEGEVGHISKETMVKHLPHPADDSRLLICGPE
FT                   GFTQKVFDQAKEIGWKMDYTKTKGDEQVFVF"
FT   CDS_pept        complement(241731..243497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503354"
FT                   /locus_tag="CAGL0B02541g"
FT                   /product="Similar to uniprot|Q03124 Saccharomyces
FT                   cerevisiae YML127w"
FT                   /protein_id="CAG57981.1"
FT                   /db_xref="HOGENOM:HBG058700"
FT                   /db_xref="HOGENOM:HBG203545"
FT                   /db_xref="UniParc:UPI00003B5F68"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE6"
FT                   /transl_table=1
FT                   /translation="MFHNTGMNYEVQQLREGSVNGLENDAPMEGFRHISAIPIRVSREQ
FT                   SSGMHVESQHNNNTTMSVDPKTYSLANLNIFQNIPKETARGVDDLSRMRMSLLSGIPEE
FT                   IKWALKKYLAYSNKAPYMINLQKSKELLPLFNRFIEQLVDLINKFNEPLIDGASAMEKL
FT                   QAGLNCLLILRNLAQDQDSVQALIRYEPIKKFLLFVLQKYASLADYDPKWTVYESNTSY
FT                   LNEIIHYSLDLIEAMSSYMAPAMKGDPYFLALLKVLGYTKDRSMVISILRSLSRLLVRS
FT                   KADEESVVDNINPDTLTQIVCFLLIECDEELVIASLDFLYQYILPGNQRIKELFSDPKR
FT                   FSIFISIIPKLLTYNVKLPQYETLKHTEVKLIKRLRPPAPEEVPDVDEELFNQLLSMSE
FT                   PLRSTTWLRCCFESMDDAEFTQIALWRAYESRFGPKLRESSRKLLPAVEFIKNVSNSFR
FT                   NASAMVVTEPETGKKRFIIKGIQPRHKAISIRESAELLRQQHLNTSKFLFKDGDNIVPA
FT                   KQENLPSITFTDDLSDVSKVAASFLCLVSNDNEGPGTKFCQTIKPVLLHELADVPPLNA
FT                   VLSEYMDNVLLM"
FT   CDS_pept        244624..246171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113661" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351127"
FT                   /locus_tag="CAGL0B02563g"
FT                   /product="Similar to uniprot|Q03104 Saccharomyces
FT                   cerevisiae YML128c GIN3"
FT                   /protein_id="CAG57982.1"
FT                   /db_xref="HOGENOM:HBG124258"
FT                   /db_xref="HOGENOM:HBG203539"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniParc:UPI00003B5F69"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE5"
FT                   /transl_table=1
FT                   /translation="MKLVGVYATTLAVLVSVDALGSSDGAIANIRNKFTKRDLSEYVND
FT                   YSDDLARSFSKSKDELIKELEEKWESAKDATGYNNQGWWNTWGSDQYQFPWLGGVDSAK
FT                   SKAKKKSSELKNWFFDSWSQDSLMKFLAKYDLPHEANQSKDQLIKTIKDNFDTISKKLE
FT                   VSGYYPSSSYFDDWSNKDLQDWLDHYKIKYDQTTDKRDQLMSLVKKNIYKVSEDVDNKR
FT                   LDLLNQLDLAKLDLFDKAGEIKGTVFDTWNSDQIENWLKSHGVSVKENAKDQADYLKNL
FT                   ASTHANLLKDDVEWYTQEMQDTATPYLKKSADTALQYSKSSFWNLFSFFKRKTGETVDA
FT                   VSQYGMDTWDSAKLKAYLDSYRVKYAKDATEQQLRDLAVSTKNKWFKSLPKEYTDDFVS
FT                   WLKTKKNNIAGQGSDTYDYIVNELTNVQKGAANMKDDVANKFMDSFQGWSTDDLTQYLK
FT                   KVGVNVKQGMYSQDELVAMARENTQWLFGKIQPEPWYKRAARRVSDTASMVYNGVLH"
FT   CDS_pept        246796..247680
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446633"
FT                   /locus_tag="CAGL0B02585g"
FT                   /product="Similar to uniprot|Q04947 Saccharomyces
FT                   cerevisiae YDR233c"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAG57983.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="HOGENOM:HBG058105"
FT                   /db_xref="HOGENOM:HBG396976"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniParc:UPI00003B5F6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE4"
FT                   /transl_table=1
FT                   /translation="MDTQKENKCHCDCDLLLWRNPLETGKVFGTTLVALLILKKVNLLT
FT                   FFLRVGYTILLSTALLEFSTKLVLGQGLVTKYGPKDCPNVVGMIKPVIDNALKQMPVKQ
FT                   AKMRQLVFANSPKQTFKAAVVLYLLHKFFSWFSVWTILFVGDIALFTLPLVYKTYQKEI
FT                   DAVVAEVLKITRQKTQKYSKVACEKSKPYLEKLGPISKMVESKLNQVNPPTVSSAAPNT
FT                   TAANIAADIPINENRQYDNTNTMDQGISTAAQMMPNIPEAHPSATKEFDVDHLKDELKQ
FT                   STQHLQNQFEQNQ"
FT   CDS_pept        complement(248795..250387)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446634"
FT                   /gene_name="HEM1"
FT                   /locus_tag="CAGL0B02607g"
FT                   /product="5-aminolevulinate synthase, mitochondrial "
FT                   /EC_number="2.3.1.37"
FT                   /function="5-aminolevulinate synthase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="heme biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG57984.1"
FT                   /db_xref="GO:0003870"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG344231"
FT                   /db_xref="HOGENOM:HBG649839"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B5F6B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXE3"
FT                   /transl_table=1
FT                   /translation="MFRPVLKVRPSFSYPYSIVSSRSVRLASTATANANTAAATSTVAA
FT                   HGTQETPFDFEGHFESELAKKRLDKSYRYFNNINRLAKEFPLAHRQLEDDKVTVWCSND
FT                   YLALSKNPQVLDAMRKTIDKYGAGAGGTRNIAGHNIPTMRLEAELAALHKKEGALVFSS
FT                   CYVANDAVISLLGQKVKDLVIFSDELNHASMIVGIKHANRPKHIFRHNDLAQLEEMLQM
FT                   YPKSTPKLIAFESVYSMAGSVADINKICDLAEKYGALTFLDEVHAVGLYGPHGAGVAEH
FT                   CDFEAHRVAGIATPPQGDNGRLRTVMDRVDMITGTLGKSFGTVGGYVAASSKLIDWVRS
FT                   YAPGFIFTTTLPPAVMAGAAEAIRFQRSHLNLRQDQQRHTAYVKKGLHDLGIPVIPNPS
FT                   HIVPVLIGNPDLAKQASDILMEKHRIYVQAINFPTVSRGTERLRITPTPGHTNDLSDIL
FT                   IAAVDDVFNELQLPRIRDWEMQGGLLGVGDKNFVPEPNLWTEEQLSFSNEDLNSNVFEP
FT                   VIDQLEVSSGVKL"
FT   CDS_pept        250886..253363
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351128"
FT                   /locus_tag="CAGL0B02629g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG57985.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG124260"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="UniParc:UPI00003B5F6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE2"
FT                   /transl_table=1
FT                   /translation="MSLSVLVYGDDPFDLFLAWRFSLAKSIELCVVGSKYSQDVTVRTR
FT                   QYGNGGLQVDPTKVFMSVGDLLDSRGNAGFDLVFVNAAASSLHALSKRVNEVLPLFNNT
FT                   NTKLVINESSAINLQKFVTEVVGTAIPHHNIFGYVTDYDLRFTIDSNSIQHYTKAGNVK
FT                   LCDSASDNSILLGSTDIDQRTGGYTTHALNLLQTFTKLFSKLLPNDTISDCNNSYQQYQ
FT                   TSQWSFAIPKICLEPLLIILEELNPTNLSSHILSKPLITGLINEVITIASRFGVQLPQR
FT                   YSSETEILNSWPTLFQNQNTLPTNVHYFAQGQNKFINFDVVLLQPILLADDLNIKTPYL
FT                   EFLYTMIRQYQILNAGKSIWFQRSDTNQKSSQNEQLLEEKLQKLNEELAYQQNYAKELS
FT                   TKLDQDEKKHQDELNALKARLKELETQSRMSNTSISRGSVMADDTLSQPISKSISESRI
FT                   NGLDNMSYLKEKELELKRKELELQERELSMKKKSLSYEQPQTTNPQQYHMMRKQKNNSS
FT                   SRIPDLGNNIPISDNRPYSNGSVNNNPYYNNSRISSGHSIPSASTNVMNNYVGNNNSAG
FT                   GYPQGHFNSNVPLKTTSRKNRPVTMHSFNNVPGYTSNDYGGRMMGNYSTSTSQSRFNSL
FT                   SSNTMPMMQGPNSNMTTPRHVSNPFFNGNQQPSQPNQPKNMPVVNRILSNQNNYPTNNG
FT                   IAPTNNTTAITSSYNTLPNSQSQPANLNTYGSREPIRFGNSAPPVQTNQSFNNKNVNDQ
FT                   QGSNNTSNQYLNVQQPPSSQAGTVTSESRPASSQSGSFMNLSSNTTAQDVASEKTDTDK
FT                   KKKKKRFGLFKRS"
FT   CDS_pept        complement(253495..254064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351129"
FT                   /locus_tag="CAGL0B02651g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG57986.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124261"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B5F6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXE1"
FT                   /transl_table=1
FT                   /translation="MVRNKLPSVDEDEAFYRLAADAINYVRSPSFQPNAGNTPSLIVHE
FT                   LTLRLTNMNKEVAVPHIKPHLIPMSLDDHVEQIIPSITAQVRREKSGIKTASIEPPNYL
FT                   YDNGKHTRRRSNQKIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDA
FT                   LKRHFDTVLCHVDKRNNQISPRERSK"
FT   CDS_pept        255316..256731
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503355"
FT                   /locus_tag="CAGL0B02673g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG57987.1"
FT                   /db_xref="HOGENOM:HBG124262"
FT                   /db_xref="HOGENOM:HBG203226"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniParc:UPI00003B5F6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI4"
FT                   /transl_table=1
FT                   /translation="MELEDTYVPKLKDDIIYRKLNRLKVDQLCELSVKWTRKFGAGSQD
FT                   PISVEEVKQTIEGYLAQQVNKKTVIAQMMYVYWPMGLNAYQLAEIDCILLMERPANYSW
FT                   KSKYLKNSLTGQNSNFSMNPKKFVSALKNELTKLYLTHFFLCQHAVLPVLILRIQSYDT
FT                   NNLFLSSVKRNRIILNEEIFEQKLIKSKENQLISRKPYYLVFGINTPFIIHSPENDIYA
FT                   SFIHDCIERVLSFRDPIILEEKTKTPILNLEKILIIDGPSRYSKAMGQWSKYAEGQVET
FT                   TPFGDIESHESYKGRRILVRKIHDLDDLDEVNHEDRDTKRLRLQKNMIRFKGSENGIIH
FT                   EKIFEIKKKIDKVYNLSQKQSNILLSKYTSLLPMKKAHYTVTNDNWSGPYNKEDEDVDI
FT                   AIIEGESDKGSQSISLKLIGNDIFGGLHELCDRNLIDIEHMPGWLTGENGASSGIIKNN
FT                   EFTATVSPKSGII"
FT   CDS_pept        complement(256863..258152)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046818"
FT                   /locus_tag="CAGL0B02695g"
FT                   /product="Similar to uniprot|Q12508 Saccharomyces
FT                   cerevisiae YDR255c"
FT                   /protein_id="CAG57988.1"
FT                   /db_xref="HOGENOM:HBG059749"
FT                   /db_xref="HOGENOM:HBG203227"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B5F6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI3"
FT                   /transl_table=1
FT                   /translation="MSKLLASVEGEYAKFYRQFEEDEQPRRLTHIEKCLEDTQEFKLQL
FT                   KKLRAHLNKYINDCEEGHIEDQKKSQKKKDLIVDKINRSHKQFEHSIRKSHKLQQSALT
FT                   GYHKHFLNRLTKIEIDQIYLNKLPEDAHSYVKEAIGYHICRYHMKSLPVMDSKDVLINY
FT                   LESLYGVSPQMSDKFIDMGEVIQNIQTQSTHRCLDWINHVSEDQIYSETISKEGLTTLK
FT                   DLQFQLYILEFLKVLREGDALQSFKYITNVLPRGNFNDKANDIIQKIAPLLTKSVIGKP
FT                   VADIDAILKEQVDKCVSIFTMEYCAYLNLPHHSPLFLIVLSGIISFQFFIKYKNIRSTA
FT                   HVGWTTEDELPFDVKLPPFLSHFHPIFICPVLKEETTVENPPYSLACHHIISKKALDRL
FT                   SKNGSLTFKCPYCPVNTSMANTRKVNFIMV"
FT   CDS_pept        complement(258671..260722)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446635"
FT                   /gene_name="ACS2"
FT                   /locus_tag="CAGL0B02717g"
FT                   /product="Acetyl-coenzyme A synthetase 2 "
FT                   /EC_number="6.2.1.1"
FT                   /function="AMP binding"
FT                   /function="ATP binding"
FT                   /function="acetate-CoA ligase activity"
FT                   /protein_id="CAG57989.1"
FT                   /db_xref="GO:0003987"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016208"
FT                   /db_xref="HOGENOM:HBG519036"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003B5F70"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXI2"
FT                   /transl_table=1
FT                   /translation="MTLKEHKTVHEAQNAVARQAPEHFYKSQPSRGGFIKDISEYERLY
FT                   KQSIEDPETFFSEKARELLHWDAPFSKVSYGSLEQGDVAWFLNGKLNASYNCVDRHAFA
FT                   NPDKPAIIYEADDEKDNYTITFGELLRRVSKVAGILKSWGVKKGDTVAIYLPMIPEAII
FT                   AMLAVVRLGAIHSVVFAGFSAGSLKDRVVDAGSKVVITCDEGRRGGKTVHLKKIVDEGL
FT                   NGVDQVSRILVFKRTGTEGIPMKAGRDFWLHEEADKRRSYLPPVPCDAEDPLFLLYTSG
FT                   STGSPKGIVHTTGGYLLGAAMTTKYVFDVHPEDVFFTAGDVGWITGHTYALYGPLLLGV
FT                   PTICFESTPAYPDYGRYWRIVERHKATHFYVAPTAMRLIKRVGEAEISKYDLSSLRVLG
FT                   SVGEPISPELWEWYNEKIGNNNCVVCDTFWQTESGSHLIAPMAGAIPTKPGSTTLPFFG
FT                   IDACIIDPVSGVEIEGNDVEGVLAVKSPWPSMARSVWNDHVRYVDTYMKPYPGYYFTGD
FT                   GAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEACLVNHENISETAVVGINDELTGQAV
FT                   IAFVSLKEGYLQNDAPEGDAEHITPSNLRRELILQVRGEIGPFASPKCIILVRDLPKTR
FT                   SGKIMRRVLRKIASNEADQLGDLSTLANADVVPAIISACENQFFAEKK"
FT   CDS_pept        complement(262590..264620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446636"
FT                   /gene_name="STE11"
FT                   /locus_tag="CAGL0B02739g"
FT                   /product="Protein kinase MAPKKK"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG57990.1"
FT                   /db_xref="EMBL:AAT98628.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058154"
FT                   /db_xref="HOGENOM:HBG396208"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI00003B5F71"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI1"
FT                   /transl_table=1
FT                   /translation="MSHIEFLERAGCSQYADLFEEYSLTDINDLMHIDRDILLEIGVKK
FT                   LGDRIRILKESKKLQEPKDDAKHVQQLQELISNISELSTTSTNINEEVITERHCVIFIL
FT                   NDGSAKKVNISGCFNADSIKKRLIKRLPSNLLAVNTDGQTTQESSDYDVFIVDYSKNVL
FT                   RLLYDIELVTICHSNDRVEKNRLIFVSKDQTPTDRAINASKKLYLKTITALNHIESYYD
FT                   AQSGMPNTPVTQDGTLRIHKEGKDKLRKIFDQRPPSEFISTNIAGYFPHADTKRLEKAL
FT                   RESYRQSARISMKSNNSRHISSESNRVGDILLKHSNAVDMALLQSLDNNNAPSSKPEVI
FT                   PPSTPQEEDNEGKIKLMEETESIDDYYMNSDEEHGTVSLPTKIVTPKNWLKGARIGSGS
FT                   FGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNLHRKMIDA
FT                   LQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLIVNF
FT                   TRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQENQDKRTSL
FT                   QGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPYPDFSQMQALFKIGTNVTPE
FT                   IPSWASPQGRDFIRKTFELDYQRRPTAIELLQESWLESHII"
FT   CDS_pept        264963..265178
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446637"
FT                   /locus_tag="CAGL0B02755g"
FT                   /product="Similarity"
FT                   /protein_id="CAR58000.1"
FT                   /db_xref="UniParc:UPI00017BD6F1"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX6"
FT                   /transl_table=1
FT                   /translation="MSDGKEDKPIKVTLDRGGKKVEYDIEKFRNPHRVIPQRIPNQQTT
FT                   KDVHGKESNNGNAGGLLQNDGHRPGN"
FT   CDS_pept        265971..267707
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197937"
FT                   /locus_tag="CAGL0B02761g"
FT                   /product="Similar to uniprot|Q05924 Saccharomyces
FT                   cerevisiae YLR361c"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG57991.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058156"
FT                   /db_xref="HOGENOM:HBG202556"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI00003B5F72"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI0"
FT                   /transl_table=1
FT                   /translation="MRLGRIISRRKVFFLLFTGLLVLWLEKFVLNISKYHHNDELKAGY
FT                   DLKVLDTARQWMEQSNLKNIKHDDVMVVNYGTIKCFHLGTKYERCLKPKHFHNKPRIVT
FT                   NSITVRKDLRGSYGYNLIGISEYFFFEVVRFDEFLLYGKPLDVLVFDATPNLNLGAHHI
FT                   PSATFKEISLGEILRDNFFDIISDVNILFGEDAVDPRPNWHLVKSSPYLSYKHPSFMSY
FT                   MKLGSQEPEYTKSKVLVKKEHEDDGFKIVQLADLHLGVGKNRCLDEYPHHDKCEADSKT
FT                   LKFVEEVLDIEKPGFVVFSGDQIMGDRSLQDSESVLYKAVDPVIRRRIPWAMVWGNHDD
FT                   EGSLSRWELSKLAMKLPYSRFQISPHDTKDNTFGVGNYAHQIFYENDPEVAALSLYFMD
FT                   SHKYSKTGKIYLGYDWLKEEQLEYIQSLYERGMKSHIKENIHRHAAMTFIHIPLPEYLN
FT                   LDSKKRPGESNELIGTFKEGVTAPRYNSGGLVALDKIGVDVVGCGHDHCNDYCLHDDST
FT                   SNKNIWLCYGGGAGEGGYAGYGGTERRIRTYKFDPQTGKITTWKRLNSKPSEIFDFQIV
FT                   KD"
FT   CDS_pept        complement(267689..268987)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046819"
FT                   /locus_tag="CAGL0B02772g"
FT                   /product="Similar to uniprot|Q05919 Saccharomyces
FT                   cerevisiae YLR360w VPS38"
FT                   /protein_id="CAG57992.1"
FT                   /db_xref="HOGENOM:HBG124263"
FT                   /db_xref="UniParc:UPI00003B5F73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH9"
FT                   /transl_table=1
FT                   /translation="MPQYLLKRHLRHLKSISVNNISLIDESKKIGSRVGFIPCFIVLED
FT                   TRSRKPFYVSELETGSLSSLHFTELVIPKEFELCTLFEIKIAAKIPSFLLRHDEDELWC
FT                   FVAMHTVNLDELTYIGNQRDDHITMEQNLPMIEMIDGWYALPNKNIRYTGLQISPVANM
FT                   NNKNRKRMCPFNSLVKLSKLTQYTGDMVEEKQISTNKIERLIKSTHNIGTGILDTYQEN
FT                   IKMIESRCEIKRQKLKRLKDQLSELDDGNELNDVDSNIETYRDEYANIYSKLSNAKEAI
FT                   EKLQKKKLIQLINVFKNTFLFDKDVGLISFQFDDDEIEVEEFCKNLERVSIEQIYDRYN
FT                   EYPKSVKIINAMLGFYSLFIVIYSYRIIQRKLPFDIVFQGSETIVGRKYRLSFPESRST
FT                   KSKEEFHIALRAFNENIMQFTQYLGHITQSFTI"
FT   CDS_pept        complement(269303..270751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046820"
FT                   /locus_tag="CAGL0B02794g"
FT                   /product="Similar to uniprot|Q05911 Saccharomyces
FT                   cerevisiae YLR359w ADE13"
FT                   /function="N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-
FT                   forming) activity"
FT                   /biological_process="purine ribonucleotide biosynthetic
FT                   process"
FT                   /protein_id="CAG57993.1"
FT                   /db_xref="GO:0004018"
FT                   /db_xref="GO:0009152"
FT                   /db_xref="HOGENOM:HBG171016"
FT                   /db_xref="HOGENOM:HBG302411"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI00003B5F74"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH8"
FT                   /transl_table=1
FT                   /translation="MSEFDKYATPLSSRYASKEMSAVFSLRNRFSTWRKLWLNLAIAEK
FT                   ELGLDVITDEAIEQMKAHLEITDEEIAKASEQEAIVRHDVMAHVHTFGETCPAAAGIIH
FT                   LGATSCFVTDNADLIFLRDAYDIVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLT
FT                   TLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDER
FT                   VTELLGFDTVYPVTGQTYSRKIDIDVLAPLSSFAASAHKMATDIRLLANLKEVEEPFEK
FT                   SQIGSSAMAYKRNPMRCERVCSLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPS
FT                   AFLTTDILLTTILNISSGLVVYPKVIERRIKSELPFMATENIIMAMVEKGASRQEVHEE
FT                   IRVLSHQAAAVVKEQGGDNDLIERVKANEFFKPIWNELDQLLDPSTFVGRAPQQTEKFV
FT                   GKDVKNALQPFQKYINDAEVKLNV"
FT   CDS_pept        complement(271482..274166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247903" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503594"
FT                   /locus_tag="CAGL0B02816g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG57994.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG190514"
FT                   /db_xref="HOGENOM:HBG204354"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00003B5F75"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH7"
FT                   /transl_table=1
FT                   /translation="MANTKELQENLRPEYLRLYNVINEENVNISPVFTVLPPRKDYPDY
FT                   YDVIKKPISINTLKKRLTTYTNAQQFMDDLVHIPWNAKVYNTKESEIYKYALTLEKFIN
FT                   ETVYPNLKKKYPKLELPYLGPTPDEPGYQEFQEKLLIKEKEKQEELERKERLEKEAKSH
FT                   KVLIRTRKTSNKEGYTTDSYDSNNEVHTETGDDDHYTDYGKGDDDDEYTDSGRRYKQRR
FT                   VHAKFSPSPSGTPHPLGLRHSEKPVKKYVKRGRPPIIDLPYVQRMKNVLKVIRKEVDER
FT                   RRSLLDSFEKIPDRNYNPQYYSIISNPISLDEIRKKVKTRKYKDFEGFHNDIKLMLSNY
FT                   RTYNKNNPNELKRSFKFEKSFNELAQFELSRPDTDYMPEGEFRCPLDEVIVNGITYQVG
FT                   DWVLLKNRNDESKPIVGQIFKFWSEGTSGTKWLNACWYYRPEQTVHRVDRLFYKTEVVK
FT                   SGQYRDHKVSDIQGKCYVVHFTRYQRGDPDINIDGPLFVCEYRYNESDKAFNKIRTWRA
FT                   CLPEEIRDVEEQTIPVTGRKFFKFPSPIRHLLPPNSTTRDPVPDPTLGVPNAPPIVGGV
FT                   YMRSKLDRDDLGEYSTSDDCPKHIIRPNDPKDRLEGKIDNDMGTIIVSGGMGNLARMTP
FT                   SHTKLNTMRDNHIENNYQFNNNESASLPFSLAKENVPIPNLNKTNRPLNISDLHSRHVA
FT                   QFVANQRQREITHNLEAAKYSHATIADKIANEASKHTRLGQQIVSLPHSYVLPLSITKN
FT                   TGVLQTSDISNQSRRQKEDALMPRKRTKEEILWFTGPSVSINERLMDSGIVRTLSMNTL
FT                   TNSSKDGLDYEEFEEVIPVIRKRSKRNTRNIIEQVEEEEFDKEEAQTTKKDEDDSVTQL
FT                   FHTSLHSLRPSASFMSHRLAEST"
FT   CDS_pept        complement(274984..276693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503595"
FT                   /locus_tag="CAGL0B02838g"
FT                   /product="Similar to uniprot|P50276 Saccharomyces
FT                   cerevisiae YGR055w MUP1"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG57995.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177066"
FT                   /db_xref="HOGENOM:HBG448377"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00017BD6F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH6"
FT                   /transl_table=1
FT                   /translation="MSDFLSQLNIFNKENYKFSSSEKSEDDTSDFETGQQFATELDQGE
FT                   KRLGLISCIGLICNRMLGTGVFAVSSTIYTLSGSIGLALILWAVGALIALAGLYVYMEF
FT                   GTAIPRNGGEKNYLEAIFKKPKFFITCMYASYVFFLGWAAGNSVNTAVMFLTAANTEVT
FT                   KWNQRGIGVAVVFFCFAVNSINVRAGLYIQNVLGVFKLGIVIFISITGWVALAGGLKHG
FT                   YQSHNFHNAFEGTNKATAYGVVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTS
FT                   LICLAIIYIFVNIAYFAVVPKDKLISSKLILAADFFDICFGGHAKRVAAALVGLSALGN
FT                   VMSVIFSQGRIIQQLGREGVLPFSNFFATSKPFNSPMVGLFQHFIICMITILAPPPGDA
FT                   YNIILNLISYPMNIVNFVISAGLLWIYWQRRQGKIEWNPPIKAGVFITTFFMLSNVYLI
FT                   VAPYIPPTHGESVYEHAPYWIHCVVAWGIFAFGGFYWLVWAKLLPRWGHYRLESKEVLG
FT                   DDGFWRMQIIKVPESEVGDDSIDSSDGENIHSNDIEVLDYQESKESHKISHE"
FT   CDS_pept        complement(278007..278657)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047080"
FT                   /gene_name="ATG33"
FT                   /locus_tag="CAGL0B02860g"
FT                   /product="Autophagy-related protein 33 "
FT                   /biological_process="autophagy"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAG57996.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG124264"
FT                   /db_xref="HOGENOM:HBG202554"
FT                   /db_xref="UniParc:UPI00003B5F77"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXH5"
FT                   /transl_table=1
FT                   /translation="MSTCLTVTKGIAISSLGLYAGIVSAGTLLVVNDRVTPTNDSKHDL
FT                   VRTLLCKVGTGLNVVATVVFGLVYFSSPGYARHPYLVYAALTGPATSLYMFLSKRYWLK
FT                   QLRNLKETKITDEKHSPPPVGQDAAQTSDKAEISYAAAAAVGAENGGELSESVVDLGIE
FT                   KTIAQAEKDFEKQKADEVVRRETQSIKVRAVATAVIATVGFIQSVIGVSGEHL"
FT   CDS_pept        complement(279334..281184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503596"
FT                   /locus_tag="CAGL0B02882g"
FT                   /product="Similar to DEHA0A06369g Debaryomyces hansenii and
FT                   CA4539|CaIFQ4 Candida albicans"
FT                   /protein_id="CAG57997.1"
FT                   /db_xref="HOGENOM:HBG049440"
FT                   /db_xref="HOGENOM:HBG124265"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI00003B5F78"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH4"
FT                   /transl_table=1
FT                   /translation="MSLLFGEKKPWRVTWRLVVLAIVSVLCLLSLSTIPDVYERTISTS
FT                   RNTTCETEGSHDMSWKNRKTLAHMVSNFRKMDYKQFKFVNYLGNRPIPTDIDELQSCKH
FT                   IEHDAMLEHGNVTYPIRPNFKVFNEIIKNTNARIYKFLEGMAGDEPIESTFKNKWFMFG
FT                   TTAEWLEQEQCYVAFSRLIISKGRNRAHPSVSLITAQAFDKDWNELYGKRIKYLDVETP
FT                   EDFEEQLKAIDEKYNVEEDCYTNVEEGGIESNQEADTNSCIKNREERAMLAEEEKQELT
FT                   DKYFRVYPTILDIPFKNKGNLDFMGPEDPKVIVRTNTDGKQEPLVAYNMNDKNYDRRLM
FT                   FVILPHRKINPIVPLVDKTFSISGTQKNWTPFFHEGDASSDGSRGFVHVIQYMIPTTIL
FT                   RCSLDDGRCIFVFKANEIDSLKKVEFKDLRGGSSFIRVPQGIPELDGRKLWVGMIKSHI
FT                   KKCGGATDFYRPHLVIMEEKDGKYNLLSLSSALHFDREVLGWDRETSFMVHVNVMSPNS
FT                   ISSWNIISHDHENDSYEDYMELSFSESDCTSYILTVRGVLDYILKILRDGSDAKFLDWN
FT                   ADDLAAKVGKPPKCVCSHLREHCDKYGAERVPDREIPWVS"
FT   CDS_pept        complement(282093..283910)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447743"
FT                   /locus_tag="CAGL0B02904g"
FT                   /product="Similar to DEHA0C03091g Debaryomyces hansenii and
FT                   CA4636|IPF1520 Candida albicans"
FT                   /protein_id="CAG57998.1"
FT                   /db_xref="HOGENOM:HBG049440"
FT                   /db_xref="HOGENOM:HBG124265"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI00003B5F79"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH3"
FT                   /transl_table=1
FT                   /translation="MRALSVFKKNVSRKRFARRLLVLVIASVLWLLILGRIPSMYRESP
FT                   SLQRKVTDESKTYDPLLAQQITLDQKIGNFRNKVFRTFEFVNFMGNQAIPSGFNQDEPC
FT                   NYNSKASLEYSNSTVPIIPNYTVFSESINHPKSRLYKFLQELTNGKPIDTTFAKKWFMF
FT                   GSSAEWLEEEQCYVSYSRLIISDWDTRTRASVSLIAAQAFDKDWNELYNKRIKYVDIET
FT                   PEDFDEQLKAINAKYNIVEECLGREEDGGYTKSDINSEGTSKCTPISDDVKELAETEKR
FT                   MLIDRYFRVYPTVLDIPFKLTGEVSYRGPEDPKVIIRRNADGRHEPVVVYNMDDDNYDR
FT                   RIMFAVMPHRKINPIVPLIDDEFSISGPQKNWTPFINDGDVTKDGSRGFIHVALHIIPT
FT                   TILRCSLDDGVCMYVFRGEKINKLQKELKDLRGGTSFRRVPEIPELNGRKVWISIIKSH
FT                   LNNCGGASQFYRPHVVLMEETDGKFNILSYSSAIHFDREVLSWDMHSSAMYHVNIMSPN
FT                   SIASWHIVSHVHSKYEDYMEISFSEADCNSSVIVVRGMLNYILQVLGDSESVDWESKDL
FT                   GLRLGTAPACVLTHLREHCEAYGKLRPKT"
FT   CDS_pept        complement(284897..286753)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447744"
FT                   /locus_tag="CAGL0B02926g"
FT                   /product="Similar to DEHA0D04994g Debaryomyces hansenii and
FT                   CA4636|IPF1520 Candida albicans"
FT                   /protein_id="CAG57999.1"
FT                   /db_xref="HOGENOM:HBG049440"
FT                   /db_xref="HOGENOM:HBG124265"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI00003B5F7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH2"
FT                   /transl_table=1
FT                   /translation="MGTFSFRSEKRLGRGFTWRLVVLAIVSVLCLLSLGTTPDMYGKSL
FT                   FMSSNTTSDDSGSHDALSWKNKTTLAHMVTNFRRMEYKQFDLVNYVGNRAIPEGLDMVE
FT                   SCKHIEHDAKLEYGNITIPIIPNYKVFSDSMNQPSSRFYNFLKKLAKGKPIESTFKKKW
FT                   YMFGSSAEWLEEEQCYVVYSRLILSEANARDQASISLIAAQAFDKDWNELYGKRIRYLD
FT                   VETPDDFEEQLKSIDTKYNITEECLGKREDYSSYLEPQSDPDGSESCILVSEESIRLAD
FT                   MEKQELIDMYFRTYPTVIDIPFKTTGDLRFMGPEDPKVIIRRNANREQEPLVIYNMNDK
FT                   NFDRRLMFMVMPHRKVNPIVPLVDKEFSISETQKNWTPFIRDEDAVADGSRGFVHIVQH
FT                   IMPITVLKCSLDDGKCTYEFRADKIDKLKKSQFKDLRGGTSFVRVPQGIPELDGRKLWL
FT                   GVIKSHIIGCGGATHFYRPHLVLMEERDGKYSFISLSSPSHFHRDVLSWDMKTTSMKYI
FT                   NIMSPNSIVSWNVVSHDHENDSYEDYIEMSFSESDCKSYVLAVRGMLNYILQVLRDSSD
FT                   AKYLDWDSNDLDIRVGTAPKCVISKLKEHCKEYGALHKEPSK"
FT   CDS_pept        complement(288006..289799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503597"
FT                   /locus_tag="CAGL0B02948g"
FT                   /product="Similar to DEHA0D05027g Debaryomyces hansenii and
FT                   CA4636|IPF1520 Candida albicans"
FT                   /protein_id="CAG58000.1"
FT                   /db_xref="HOGENOM:HBG049440"
FT                   /db_xref="HOGENOM:HBG124265"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI00003B5F7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH1"
FT                   /transl_table=1
FT                   /translation="MLRRKVTLKIVVLISVFVLCLLTLTTVSNTHRNPVTSNSFIPEPV
FT                   THSLPSWKHQASSAHLLTRFRKMEYNPFRFVNYLNSQHLAQETDKTKVCQHMEYQTMLQ
FT                   YSTATHPITPNYKAFSTSLYQRKSRLHGFMKKLAHGQPIDTTFKDKWFMFGSSIEWLED
FT                   EQCYVAYSRLIISERKSRGHPSVSLIAAQAFDKDWNELIGKRIKYVDIDIPEDFDDQLK
FT                   AIDEKYNAFAKCVEKSAEVHSDQANSENYDKCASQHKENQKLAEVEKQELINRYFRVYP
FT                   TVLDIPFKTTGDLQFMGPEDPKVIIRRNLDGTLEPLVFYNLEDDNYDRRLMFIVMPHRK
FT                   INPIMPLVDEEFTITRIQKNWSPFIMDGDSVKGGSRGFVHIIQHIVPTTVLKCSLDDGK
FT                   CSFVFNASAIEGSQSIESRDIRGGTAFIRLPQGIPEFSGRNIWIGVIKVHIKDCGGTSQ
FT                   FYRPHLALMEERNGEYSFLSISSAIHFNRDVLGWDLESTSMFFVNIMSPNSIVSWNVVS
FT                   HDQETDTYEDYMELSFSEADFNSHILTLKGVIDYVRQVLRDSDSTNQVSALEPHSSLAI
FT                   SKCVCSHLREYCEGYGKLHEQ"
FT   CDS_pept        complement(291248..293137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447745"
FT                   /locus_tag="CAGL0B02970g"
FT                   /product="Similar to DEHA0A06369g Debaryomyces hansenii and
FT                   CA4636|IPF1520 Candida albicans"
FT                   /protein_id="CAG58001.1"
FT                   /db_xref="HOGENOM:HBG049440"
FT                   /db_xref="HOGENOM:HBG124265"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI00003B5F7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXH0"
FT                   /transl_table=1
FT                   /translation="MKWLPINKERNRYMTPTRYILNTKVLVLLVLTLVCFVSLESLRDV
FT                   YQMTVVKLSDSGACKESCTHNTTTWKDKTTLAHMVRNYRNMEYTPFKFVNYLGNRNIPA
FT                   GLKEADACNYISHESKLEYANVTKFIRPNFKVLSESVKKTDPRWHDFLKGIAGDKSIDD
FT                   TLDKKWFMFGSSAEWLEEEQCYVVYSRLIISKEENREHPSISLVAAQAFDKDWKEIYGK
FT                   RIKYIDVETPENLDEQFKAIEMKYNLTESCMPGKSAKTLPKNKDPQFDEQEHCLKQLEA
FT                   RFKMAKEEKEELIAKYYRVYPTVLDIPFKATGNLDYMGPEDPKILIRRNHDGQQEPIVV
FT                   YNMQDNNYEQRLMFVVLPHRKINPIVPLVDKEYKIGGTQKNWTPFIHEGDATSDGSRGF
FT                   MHVVQHMSPTSILKCSLDNGKCKYIFDAAKIPSLKDVGVKELRGGSAFVKIPHGIPELD
FT                   GRNLWIAMIKSHQGHCGISFKFYRPHLAIMEEKDGKFSMLSYSSALHFDRDVLSWDGNS
FT                   TYAGYINIMSPNSIVSWNIISHNHENDTYEDYMELSFSESDYMSYVVTVRGVLDYILQV
FT                   LRDGSDRKFLDWTSKDLATMVGTPPKCVRSNLKQHCSVYGNAHKEDIPKKLYT"
FT   CDS_pept        298526..299725
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000016231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447746"
FT                   /locus_tag="CAGL0B03047g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="coenzyme binding"
FT                   /function="ketol-acid reductoisomerase activity "
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58005.1"
FT                   /db_xref="GO:0004455"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG101431"
FT                   /db_xref="HOGENOM:HBG286525"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016207"
FT                   /db_xref="UniParc:UPI00003B5F80"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG6"
FT                   /transl_table=1
FT                   /translation="MIRAQASRLICNSRVITSKRTFALAARAASMRPAASLMAQKSIKP
FT                   IVATRGIKQINFGGTVETVYERADWPREKLLNYFANDTFALIGYGSQGYGQGLNLRDNG
FT                   LNVIIGVRKDGASWKAAIEDGWVPGENLFEVEEAVKKGTYVMNLLSDAAQSETWNSLKP
FT                   LLTKGKTLYFSHGFSPVFKDLTHVEPPKDIDVILVAPKGSGRTVRSLFKEGRGINSSYA
FT                   VWNDVSGKAHEKAQALAVAVGSGYVYQTTFEKEVNSDLYGERGCLMGGIHGMFLAQYEV
FT                   LRENGHSPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPIFKDALK
FT                   PVFQDLYESTKNGSETKRSLEFNSQPDYREKLESELQTIRDMEIWRVGKEVRKLRPENQ
FT                   "
FT   CDS_pept        301443..302447
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447747"
FT                   /locus_tag="CAGL0B03069g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="transaldolase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58006.1"
FT                   /db_xref="GO:0004801"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="HOGENOM:HBG001532"
FT                   /db_xref="HOGENOM:HBG286747"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniParc:UPI00003B5F81"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG5"
FT                   /transl_table=1
FT                   /translation="MSEPVQKKQKTNSSLDQLKASGTVVVADTGDFESIAKFQPQDSTT
FT                   NPSLILAAAKQPAYAKLIDVAVEYGKKHGKTVEEQTEAAVDRLLVEFGKEILKIVPGRV
FT                   STEVDARLSFDKEATIAKALQIIKLYEEQGISKSRVLIKIASTWEGIQAARELESKHGI
FT                   HCNLTLLFNFAQAVACAEANITLISPFVGRIMDYYKAKTGETYTGETDPGVKSVRAIYN
FT                   YYKKYGYKTIVMGASFRNIDEIKALAGVDYLTISPNLLDQLLNSNDPVPKILDPATAKD
FT                   EAGEKVTFVDNESAFRFALNDDAMATDKLSDGIRKFSADIITLFDMIEKKVKA"
FT   CDS_pept        complement(303112..305202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047081"
FT                   /locus_tag="CAGL0B03091g"
FT                   /product="Similar to uniprot|P41698 Saccharomyces
FT                   cerevisiae YLR353w BUD8"
FT                   /protein_id="CAG58007.1"
FT                   /db_xref="HOGENOM:HBG124269"
FT                   /db_xref="UniParc:UPI00003B5F82"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG4"
FT                   /transl_table=1
FT                   /translation="MSSQSGGSSAGDTSGSSFGSIDTVLLTADRRESQLDVSAIQRQSL
FT                   FIENIDENKSSLTFGEANTSSSKISSYEKLSENNGRSERLYPVYVDDSKHSASSSNGVT
FT                   STPSPPSKSNILKENISEKQDDLDEQDGRDDDFISAKSQYSIDEDDIHVPGYTVGENKS
FT                   INISPGRALRDFNVRQNRDSIITVSTSVLLDSAQDNILNTPGSGSIHPSEFDPRESALL
FT                   ETLSPRGRIRHNSQSHDKIMDNNNDTNLMEKIKSRREENSANFEREIKLLEEEVSKPSY
FT                   VNKTSGNVPKVGTIDELQRFAQEERGRPPLEHFKTESEFVPLEFNLSRRNSQTTSSFNG
FT                   SPSINTFLSRKSSPENKLAIPQSPSLISKILVPSPVNSNRFNDRNISGSSGSSGSSSRY
FT                   RTTSNNSQQSLIRQRRNGDYVAIPVLRTVSGSGQWRAGSESNSSLRDYTPTRQRFEKFR
FT                   LETPESLVLPDIEPHRQSDIPEEMPYHDEEDNDRDNESVHVKQLVEPGTMELLEPEEAY
FT                   YNSRDSPRDNIKISGNVQPLYSNKAVAMPHEEDDKQTYGRISSMEDHVDVEAFGDMIRI
FT                   RHDDGEVSTVQSINSHDYAFSDLYSIKRIIIVMTLCFVSPPLFFLMGVGYKRANYQRYL
FT                   VSDYKLMRMLMNPDYRQGLLKGFVWEVDLTWFRRLCLVLGTIEMLCAFAGIGIGFGVGL
FT                   TR"
FT   CDS_pept        complement(306015..308585)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047082"
FT                   /locus_tag="CAGL0B03113g"
FT                   /product="Similar to uniprot|Q06479 Saccharomyces
FT                   cerevisiae YLR352w"
FT                   /protein_id="CAG58008.1"
FT                   /db_xref="HOGENOM:HBG058335"
FT                   /db_xref="HOGENOM:HBG202551"
FT                   /db_xref="UniParc:UPI00003B5F83"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXG3"
FT                   /transl_table=1
FT                   /translation="MDTNTTFPRDNVPPEIIYQILTYQFNDFMRNDQPGSAEKFNENLA
FT                   TFLKSNLTVNKMFYHICRVLVYRYCNLTTAKRFHSLLTSLKSNASLRNVVQVLDFQELT
FT                   SIGLGRTGEMNKMIKNLTNETIMEFLQLTSPTLREFLANENIQDDLDANIIKYLFSNNK
FT                   VLSVIDFCGCSGPIFTKSFIDAIEALQLSDPNGGMYFNYQITCLGLNDCTDLPSKTLKA
FT                   TLQMLPELQKLDLAHTSIDDDTLINGIPHYKNLTHLSLAMCLQLTPRAVLEFFSHHPAV
FT                   TDENNTTTLEWLNVSALTHSSSWTEVHTMFLLKKLCRYGHNKTLQYLNIGGLPLHIEEI
FT                   DSTNPSNADGNGAQIRFTRNGYYITTRDTLQFIKLNFPKLKSLSIRGNDIPISKLVDFL
FT                   TPDPKMTTQLHKSLSSTNNSSYLALLQPQQEEMNENYQKLRYLNISDNAHVNRWTINEH
FT                   KLYTSCPTLVALEVSFDAWQQIEKSNRQHEIIAMKPAYNVGDTTTSIVDMARMEPVRWK
FT                   CYIDSSYGRRYWLFKTDPYLNRGNLEMLTNVTEYDSDGHKIIKIINQPDFLKFAQCKIM
FT                   LGCGLVPQSTVRRQRCYRDLKPPISQFFTRNGGITFGNRAVPITAPRLPSGGWRRIYNN
FT                   LEDANQIGSADDESMGPTDTIIEEDESRDTPMHYNQNGQSFRPLSSSTDSGGAGIESYF
FT                   QRRSSSSSSVGDIREGLYWDRSIHDLQAFGYSNTNTGDNVMSEDDRYETDDEYLNNPEL
FT                   QRRRSQLSLFLRASNNPKPAVRRPGLSILGATDNSRSSSSKSLLTQSQRRPKNYYYEHP
FT                   EEFLYDPNDPATSERYRTHFHLVNEYVVFGCVERGMYRYYSLKA"
FT   tRNA            join(309417..309455,309491..309535)
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        complement(309816..312599)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447748"
FT                   /locus_tag="CAGL0B03179g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58009.1"
FT                   /db_xref="HOGENOM:HBG124270"
FT                   /db_xref="InterPro:IPR018844"
FT                   /db_xref="UniParc:UPI00003B5F84"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK6"
FT                   /transl_table=1
FT                   /translation="MYKLQVVLIQPQNQLKANGYSIDGDNSDDQTITTIRNGGHIIRDH
FT                   TRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKDV
FT                   FSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRRSSKAFGNSSRIEPQ
FT                   ILVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNVSTAFAANRSTLTDR
FT                   SFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEVVDPDKSKQQLIVPDIPME
FT                   FISTPNRVNLSGQRVISESQPKSLVFSKKRINSPINNHIDVQLENDSNTARGKKLVGAE
FT                   RKILPNTRNSDSPTNRNDKRTSSLELKVHNKRVNSTNIPIIEDVLKRIDNFSDTEEGQI
FT                   VHNPVRSTSLASRQYQVDYGTNTTDEKDSVRSIIGSDKEQTMCRSEESTKSLGTSLDPT
FT                   TETEKIALGVINGPSSLPNSKKENKELAVKLHNTNLNDSPNATEINTKTPKKNTDKASS
FT                   VSKTSPVKTSSSKVSSPKKTPTLSKKLQAIVDHEYPDESKKRKSPIAKEVRNITDNKKS
FT                   SNVRTPSKSLKVNNMELSLKSLISQQSTPNNLERSATKEKTDYDTMKDNLRETLSALKQ
FT                   IKSVASPTSAKSKTAAEKITEIKEKVLKTITNAEKPLTVKLANGNISAGKNEKVDNEQI
FT                   AKGIPVKISKISSQPHVATTPRKENRAQPSTSALRKSPRISSQSNKTNTKSISATPNKS
FT                   ANEKPLSTSRDTIRSSQNGSSKETVSNDQSSSHNIQNSKSTKSAVVSSSQPVHNSNRLQ
FT                   QQDNSISEPSSAKKHGMASRYEKAGLIKKVKLLRKESDSDSDSSDSSNDDSNRSFRSSQ
FT                   LRLSQPKQKLVGNSQTESNGTDKGTSGRQGKKSEKQYLSKEFVDSDSDESDAGSSD"
FT   CDS_pept        complement(313239..314195)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047083"
FT                   /locus_tag="CAGL0B03201g"
FT                   /product="Similar to uniprot|Q02209 Saccharomyces
FT                   cerevisiae YKR011c TOS5"
FT                   /protein_id="CAG58010.1"
FT                   /db_xref="HOGENOM:HBG124271"
FT                   /db_xref="UniParc:UPI00003B5F85"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK5"
FT                   /transl_table=1
FT                   /translation="MSGETVYVRGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKF
FT                   KCSETIADNLKVEVFLGNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWY
FT                   DTLHGNHRSAKKTKSDDWREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEI
FT                   DNHCRVDAKQASKHATASTEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRF
FT                   RKSRKDSIMESISEDSCEDEEMIRVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNM
FT                   LFKPIVENFEDVYLDKYSKYPERKRRKQATNRVSKIK"
FT   CDS_pept        complement(314690..314992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447749"
FT                   /locus_tag="CAGL0B03223g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58011.1"
FT                   /db_xref="HOGENOM:HBG124272"
FT                   /db_xref="UniParc:UPI00003B5F86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK4"
FT                   /transl_table=1
FT                   /translation="MEFFIRIFKINTKPAIVEKECDVNSLEMASIFSKTKSVSNLNSGE
FT                   IDHGATRRQSKQKRKHSIRENKDSSHESLCYNDKYQRTLKATTRRKNKKKRRHNK"
FT   CDS_pept        316192..317667
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351370"
FT                   /locus_tag="CAGL0B03245g"
FT                   /product="Similar to uniprot|P38353 Saccharomyces
FT                   cerevisiae YBR283c SSH1"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58012.1"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG436076"
FT                   /db_xref="HOGENOM:HBG589438"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniParc:UPI00003B5F87"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK3"
FT                   /transl_table=1
FT                   /translation="MAIKLIDLARTFLPLLPEVEVPFEKITFDDKVVYTIFSALIYLFA
FT                   QFPLVGLPKETAPGTQVNDPLYFLRGVFAAEPKTLLEFGIFPNVASALILQLLAGLKVI
FT                   KVNFKNQKDRELFQTLIKLFALFQYFILANIFIYSGYYGQNLSIVQVGLINLQLCGAGL
FT                   VTTLISEVVDKGFGFSSGMMVINTVSIATNLVSDTLGISQISVDEDNNTEPQGSLINLI
FT                   QSFRAKHRSLLEGIISAFNRDYLPNLTTTVIVLGIAAVICYLQSVRMELAIRSTRARGM
FT                   SNIYPIRLLYVGCLSVLFSYVILFYIHIGAFTLIQLIAKNNIENPICKVLGHYDMVNNL
FT                   LAVPSFPLSLLTPPRSLLSSITEQPLTLITYTIFMVATGVYFADKWQEISGSSARDVAA
FT                   EFKEQGITLNGRREQSVAKELNKVIPVAAKTGAAILAAITVCGELLGLKGKAAGIVVGV
FT                   AGGFSLLELITLDYQQSGGQSALTQVLGAPMGM"
FT   CDS_pept        complement(318076..318516)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047084"
FT                   /locus_tag="CAGL0B03267g"
FT                   /product="Similar to uniprot|P36526 Saccharomyces
FT                   cerevisiae YBR282w MRPL27"
FT                   /protein_id="CAG58013.1"
FT                   /db_xref="HOGENOM:HBG059662"
FT                   /db_xref="HOGENOM:HBG396053"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniParc:UPI00003B5F88"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK2"
FT                   /transl_table=1
FT                   /translation="MLKATGVNLFQGSRTTLLTRPWVKYRDGTLFYGESKAGNKRTPLT
FT                   TKQGNKDMYKGTRSSGIGRHTRKGGYVIEWRKVRTFVTPKDYNMDLKPLVSHNVPELKH
FT                   HFKGYKGGIMDAQLYADKLKEYVLKGRIQSEASDVDCYIERG"
FT   CDS_pept        319012..321624
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447750"
FT                   /locus_tag="CAGL0B03289g"
FT                   /product="Similar to uniprot|P38149 Saccharomyces
FT                   cerevisiae YBR281c"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG58014.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058962"
FT                   /db_xref="HOGENOM:HBG395935"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017149"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B5F89"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK1"
FT                   /transl_table=1
FT                   /translation="MSANSDLIHRWSHTYSILSILPFPKKKLLIAGTQDSKILVFDLPA
FT                   YNLIETIKLGEISENNTRSSVLSLAKSKNEKYLFSAGADSLVRVWRVGSRDSHHGVCLT
FT                   EMATIYSVTDIGDIFSMKYLDSLDTLVFGCQNASLLFLENLCERMCIAQKSSTRDMNRL
FT                   PHRRYDKFFDSQGPTGTGSKKPNYGDSGTDSGDDSDTQNVILEVPSENIVPYAHNGFIY
FT                   SICKLDNEFHSFFSTQRSDDTNVEYITSASGDGINKIWKFSGRANTVTITFMDIQLDNH
FT                   DSVISQAVEFPFLYSGLTQGIINIWDLSTRELVSTIKTKNDDDITSISVYKDHIFAIDE
FT                   SGINMIYENQAIHWNPNQGKILSSEIFEKSNSNHSLTVYLLAGGNDGSLTLWDVSTLME
FT                   TGFTMRPSTLSANSSNISYYSTKSSSASPVNNEEMLETLKTLIQFQTVSQCKSTLHQMA
FT                   LRKCATFLQQLFTSLGATNCQLLPSTKGSSPIVTAKFIGSQTQDKKKCILWYGHYDVID
FT                   AGDTQNWQSDPFTLTCENGYMKGRGVTDNKGPLVSAIYSVTNLHRRGELLNDVIFLVEG
FT                   SEECGSPGFAQVCREFRERLDTAIDWIFLSNSTWVDENNPCLNYGLRGVINAKLTISSD
FT                   APDRHSGVDGGVHREPTADLINVVSKLQDTDGRVLIPDFYSPVKEIDQEEYERFQKIIE
FT                   IADINRDTTADDLVTNWAKPSLSLTSMKISGPGNVTVIPQTASIGLSIRLVPGQHVAKI
FT                   KEDLFKYIRDCFDTLNTENHLEIELLNEAEPWLGDPNNHAYRVLRDELALAWEKEPLFV
FT                   REGGSIPCLRTLEHIFQAPAVQIPCGQSTDNAHLNNENLRIKNWTKMAEILDNVINKL"
FT   CDS_pept        322659..324521
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000739" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503598"
FT                   /locus_tag="CAGL0B03311g"
FT                   /product="Similar to uniprot|P38352 Saccharomyces
FT                   cerevisiae YBR280c"
FT                   /protein_id="CAG58015.1"
FT                   /db_xref="HOGENOM:HBG058961"
FT                   /db_xref="HOGENOM:HBG204230"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI00003B5F8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK0"
FT                   /transl_table=1
FT                   /translation="MSTLSYDSQISGRAQTQHQANKSDKEGIHVLPPDIVQSTLPYLEP
FT                   EDIKNLSYTNRYYHNLLDYESSMTLWHDLFHKAFVPEYTSAEPFQAENTVEFKTCAEVI
FT                   MMNKYPDLDWHERYLIRENNAELYTWGCLKHARLGYTVSSNRFLEQDHLNGSLRIKIGV
FT                   NAPTKMPWFDNDGSESFLADDRVVSQLTCGGFAFQVLTKSGKLFNTGSTFSGGHKGPST
FT                   PEGEADVNPFRELTRALERSHTSNMTTGGPTPINLTGTFPRRASYGGSQASYVGVPTSG
FT                   PHEDIYDKLNRLENIFNQGVPGNDHVKRLFTMDSVRLSDLIDSNGNIIDIDISNEQIDC
FT                   NKFVAISAGRSHILALDDKNRLYSWDSPETDVGVRINFEFLHDSNERPILKIDSGWDFN
FT                   CVFIHSVGLVLWNRRDALRKGDAYAKAHYKIIPNTGIINSSNRVLDFSCTQNNTVYYIT
FT                   REGSCLWQYSNGLTEAINLPIEGKLSKLIACFASLIVFDNRKNCYSLKLNSGKIDITSL
FT                   TKLELEDPDEYFIQLASGDYHTLGLTQKGNIYTWGIESQSCGCLGLGSQDRRNTPHNFI
FT                   TLQNVTVQRPAKIDLGENRTCVAVAAGGWQSGAIIINNNDSSRS"
FT   CDS_pept        complement(324767..326083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447751"
FT                   /locus_tag="CAGL0B03333g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58016.1"
FT                   /db_xref="HOGENOM:HBG058960"
FT                   /db_xref="HOGENOM:HBG396402"
FT                   /db_xref="InterPro:IPR007133"
FT                   /db_xref="UniParc:UPI00003B5F8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ9"
FT                   /transl_table=1
FT                   /translation="MSKKQDYVAKIKFQNNLPAPLLPPKLLAVPERPEENVDSPQLIDS
FT                   LYVKTNVTPLIKIDNDLGMPLDLMQIPGLLNRQDKKFLYALDGSIKLHPEDRVLLRDPR
FT                   VDRLTKTDMSKVTFLRRTEYVSSSITQVDGGKKRGVNALGKRMRRDSDEAILNASQIVE
FT                   KVESTFESTAKNLDKLQHPVKKKLKAVKTWSLLPDTASMDQNYFTLRLVGSAAFDAQEK
FT                   KKLALSTAIFRPVELEEDEWISMYTTDGKDSENLKDDMERNLEDQLNADDIADKNYKFK
FT                   RVRDFDMKHVKQAQEGISTINNEDGFNELAIVLNDERGIAFYKPLRSRIELRRRRVADA
FT                   IRPIVREHNIDQLNVTLRNATPKEANVRDHLRMKYDPINFAAVDEEELDGEEQQETKSE
FT                   ELPNEGETQNEAEKDEDIDGDINEAGEKGRDENSPSGSI"
FT   CDS_pept        complement(326446..327213)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447752"
FT                   /gene_name="DPB3"
FT                   /locus_tag="CAGL0B03355g"
FT                   /product="DNA polymerase epsilon subunit C "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58017.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG124274"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B5F8C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXJ8"
FT                   /transl_table=1
FT                   /translation="MSMSEEEKMVLQQKIRDRTPKLPISKVKRIGKVDPESILTSNMAY
FT                   VATAFATELFVQSFVEQALFGAQLRRGKKKAGLRLTNDALVECVRNRDDYIFLEDVVRH
FT                   IEKPKTSSGLHKLSAKPVGQGQEAEQKDASMEEDIPEEDLQEDDEMDVDETEPAERPAA
FT                   SKASDVNKASASAKSILSAFKYAPESAPQIHGSTQTEEDEGDEKEEDEDEEEEIDPEVQ
FT                   TQLQEVEKMNVVADLDEESEVSSDEDEASADDG"
FT   CDS_pept        327774..330068
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447753"
FT                   /locus_tag="CAGL0B03377g"
FT                   /product="Similar to uniprot|P38148 Saccharomyces
FT                   cerevisiae YBR276c PPS1"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAG58018.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG058958"
FT                   /db_xref="HOGENOM:HBG204228"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI00003B5F8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ7"
FT                   /transl_table=1
FT                   /translation="MIPAEDAYITVEKSWKQSTLPPCSDMFPWAHEFYVNSPRPSYAGS
FT                   AIILRSKTTRDKTIDNIARFRGSVDLADVFMSWPNVTDMSTNDISLEDEILSLNIGFTK
FT                   QMVDLCKHAGVMPFLKTDVPAYSQFHLKRMRNRVMNRHHSASLSSASCRSSRSPESNIN
FT                   PLRRFDLQCAKMIEIAQHILVYCLHFENGRDHLQCKTCQMVTDIIKLALFHLRAKINIE
FT                   QTDLGYNQIIDYIGFSSFADLPTGFLVVPLNHVRDVIISQNNETRQHQLISQYDILRFN
FT                   NWDSDLKYHENMELAIFTSATNIDDTIWVGNHQDNVNYRKQFALRELGKYQKPKTVMNA
FT                   PSVDRSIINVDAISYDDSSLCSEKLYYIPSIEVPWILFIKCNESSSLPSSEILENTLTS
FT                   ILNAHTDEGEFTPRKSKSLDFPSSGSIALGQLNIASVEVLLNTCYLIYQVYASTKFQAL
FT                   LYCSNGYTETSLLLIAYLIFLWDIPLEETLLRLHKEYGRPYFLFHADLQILGHLQSILR
FT                   EFSPNRKSNSTKYLESVKTYLVTQDPKDLLRLSITSEMFSNIFLFKLPSSSNFTNLKGP
FT                   LPSKILDHLYLGSLEHAEKPELLKKLGITHILSVGERLSWVFNHESKRSKCEEWYSNWK
FT                   IIEKQGIQICWIQNLEDNGVDPIINQLTHALEFIDTCYKQNGKILVHCMVGVSRSATVC
FT                   IAECMKRLKCDVMRAYLYVRVRRLNIIIQPHLMFMYELEKWAEEYTEQKTPKTEWHLLC
FT                   REISKLNCKYD"
FT   CDS_pept        330838..335832
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447754"
FT                   /locus_tag="CAGL0B03399g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58019.1"
FT                   /db_xref="HOGENOM:HBG124275"
FT                   /db_xref="UniParc:UPI00003B5F8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ6"
FT                   /transl_table=1
FT                   /translation="MSDGSADRKGKMRALDILSKHLRGKNSDKTTPTRYGHKSVELESI
FT                   LRKDNIVSSPLESRDHQESQRINNPHSNTASPTPKRRKLNTQAISSDNKTKQVLSIGEL
FT                   SHPDMQSTPARSRIMKKDIGDQNMSSSEIYSPSVNKSVSFLDESNKNSESTSSNSSPRH
FT                   SPTSKPKKSILRNSSSPEHNKQRMNDKYGKPIAANVHLSRSENHSKNQYSPDNLQFWGN
FT                   GEIHSLSSNNSVAEFEKLFLGALKILMQSKNPEYGAKKFEVHATINNIMPSFSSTTSNQ
FT                   FIEKAAHIVKDNLKIIANISIEHLRDEQNSLLQDKEKKNPFSIRLYIQIVRFFTNLFGS
FT                   FIINKFLISSKALCERMKQVYELSLEALKNENSNKMMLICQMTFLRDEKLSYISFTEDE
FT                   GKHMIQIINQIRDIPSTNAICEKLMLIKQFLIKFPGPMISTIPEWLPTQVISKIVFSED
FT                   VYSTKTGFTAISVLLELLKRCIDHSIGHEYVFQCLHIDSTALYFGDSKDKKLQWSNNTL
FT                   EQTYDINETHLAAILRDHIDYLVNSKREYKLAMDMWLSFMGLLFNSKGRLAFLASKEGE
FT                   KWVDINLNCLSVNDPKCRILSLKVWRILIYCVTNNIDFLGEKEAKKISQVLLNPVNVTV
FT                   NKLEDNSTFMGVKYLLNDFFFSTCGITNKCKPTTNIVLWGNFIFPMLATLLNYSANEDV
FT                   KFELDTYIGKLLTKAIQNQKNVDKTKSLHPIKVIASEGVSVDDISALQLSQLPYLLETL
FT                   GSVILLYVLNSKSQNHSQTRMLILEYLEQIPNNQITLSTLCRCISMFYEYYNSIDFIAN
FT                   SPRSLISDMSRVCIKFKDIIFDDNYNVFRNFILSFLMLFQEEEHHVDNLLQELIQNALQ
FT                   ANISELKLIEGILSLKKTDCDLFAINWVGKKLLSPSVQEGDFILYSRIVAKISEKQTIV
FT                   NFLDLADKLGFEVNPTEILRISFWKPSGLVIFLEEYIAKHHVDFADIVSSIIDADRLNN
FT                   VELFSYVLKHLPENQKSAFIKQHYTKCPLIWNQGVLIDDYDLIDITLDCEICTFIAHHF
FT                   SFLSTSSKAKLLIIFIEKDMYDLLVQFRYNLIQEFLPTLTIYKKDDIITTVQQHLINYC
FT                   FAKNSFVLLDCIEPSTLTSRTLEDVIKLLEKSYEDNITFVPAKYIIFIDNLPMDTKINT
FT                   TEILRVYLVTGDVTQCLFFLTSLINDKKMVPLTRCRNEVFDFFIALDSSNDLSIKAKAV
FT                   TTFESLINVIFLLRKKVDIGFLSQYIARLPERPSRYLVDLSEKLILNKSFNRSKFRNSS
FT                   SFNDLHTHVRTWCNQLDNTSGSPRETTPISAAHINDHINKNALSLEKDKDNLTNNTEQQ
FT                   KNIPNSKSQEISKFSSNIADANDLPSNTRESNCDGSQSTEPAGGKMIKIDKGQISADMK
FT                   NNKIAPRQISSIASEPDTLVNSNIDNKSMIEKGKNGDKTVNNNATTNDFEYRTSEDPIV
FT                   SVNIPIFNSRVSGLDKLNNQKISDEYVISSHDLELARNGLQNQAQLHDMHEGYKKKSAN
FT                   LLTQHNMRPPFEDVAIPTHKELKIPIFNSLILKSTNQQPMIPNSQRKVQSEVAIRKRPL
FT                   GNPSTQGQYTDIENERVRDYDDSQSLEDSADIRLHFPNKRARRIVSKLRGFSEYDMGQL
FT                   SAEEKRNLRIELLDFLMKIEYHTITD"
FT   CDS_pept        complement(336071..340138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447755"
FT                   /locus_tag="CAGL0B03421g"
FT                   /product="Similar to uniprot|P12351 Saccharomyces
FT                   cerevisiae YLR256w HAP1 transcription factor "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58020.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059398"
FT                   /db_xref="HOGENOM:HBG202512"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B5F8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ5"
FT                   /transl_table=1
FT                   /translation="MSTTTTIPGAAPKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTK
FT                   TGVAHLCHYMEQNWAQDAKKEISKDNELKNLKERCKILEEKLARYMHNPAVTASLGASV
FT                   VNSPVGLSSPVDAPIKLTNSPMVKLEDDTNMVDDMARPVKEHDYDELDLTRQFDLLHIK
FT                   SNGTIHLGATHWLAIMKGDPYLKLLWTHIFTMREKLLEYYTNGSGHKRRKRQKNGGKCP
FT                   IDHSKFKAAESEQKNHFVKTTPMVNDTPKSSIGKCPIDHRAMSNPVGVNSNAGQFQPMH
FT                   PPHTHIVQNKCPVDHKVNDSNLTSANTDNKNAATKKCPINHSKYTKEKMQGAGLNDKPL
FT                   TKQEVIEKLCQLLPPKRIIMLYIDKFFKHFYPVIPILDELNFKNNINQIFDLNSLISNT
FT                   IMSTSSDLELEPITSMTLNKPTDYSNLGILIIIMRLVWLSLPMNSCKIDIENPLLNKLR
FT                   TDHDFKNEDYESGSLASSLRLKDELQLLKYEVDGFALDLVKKHLIKFDEISSISNTNVN
FT                   MSTIQFAVFFKFYLMNCANASSQGNSAGNFDNESHQILLSSIMMMAFSCGLHRDPDNFP
FT                   QLNVVSANLTTDNTRSGPPSNSNRNGSETPSVSPKDTNVSIERAKHTWRKVWYYIVSLD
FT                   VQQSLLLGSPRLIRNLNDISDTKLPSASKIDYVKDIKELIIIKNYTLFYQLDLCIVAVL
FT                   NHTLNISIAKNVRKFELDALISNLQKLTDGEKGINDVINSLINHGLLSTSEVPIGLQKF
FT                   DDIYDLPRMEDILLARKSEQEIVGDENERIGQDVDKKLDLPHEMTSKALFFSKHMTLRM
FT                   LLYLLNYILFTHYEPLGAEDPTTTILAKNYAQKALDYALDGYRNCMLYFVGVSDQNPLF
FT                   KYMNVILCFHSLDIGHRALQFIICLILRVKCGPLNGLKETQTIFGTSVPSSCNSSSVED
FT                   ENTEEPNNLNQDNQFQDDLMQNINLDNSDSLAEKLMSRMVLFKQLTEKLAPKYSFSVRV
FT                   MKSTGFFISLLTTPSGSFGSKKNGSKHKHGVGKLLLSNWKHPKISNIPALLSSDSDQLK
FT                   KCPVYQDALGFMPSRPSVTNLPSISNVEGLLPNAQANGRMTPQLPPIRSYQPITYSSSH
FT                   MRVTPNSESDARKLGPDSHQVTNPLIPSPLSPANQQQNQVNVLHMHQQRSMSPAPMPMM
FT                   NPTAMTTNQNMIPERKYAPHSGAATPILPGTNSDIQQQTQMTRNDPYPTEQFSLPPISS
FT                   AKNNMAWGTTPESEQGDHLTPNTTTSSLDTPDFEDFIIQNSNFNGLLINPNSLAEAMGS
FT                   LPSGRDGAILNVNSFKDFTTSTNDKTITPNSADQTDLFSVDMASTDFLPIDNFAIDGFM
FT                   DSANLDIGSIWE"
FT   CDS_pept        complement(341791..343548)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503599"
FT                   /locus_tag="CAGL0B03443g"
FT                   /product="Similar to uniprot|Q06567 Saccharomyces
FT                   cerevisiae YLR253w"
FT                   /protein_id="CAG58021.1"
FT                   /db_xref="HOGENOM:HBG324320"
FT                   /db_xref="HOGENOM:HBG338194"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00003B5F90"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ4"
FT                   /transl_table=1
FT                   /translation="MSLPTLIRNLTRPKTPIVGVAKSRFYNKRWVQVLGLSVGTSCILY
FT                   ETNENFHNTVRHGYISFKRIGVVTIALSRCVIQYKKVLSLNDTIDDEDQKDENLRQCHL
FT                   KAANITLKALEKNGGVFIKLGQHIGAMSYILPLEWTQTMVPLQDHCPESSLDDIDRMFA
FT                   KEIPGEDLTTYFEWIDDEPLGVASLAQVHRAKLKQGTKEVVAVKFQHPQLQEFVSVDVM
FT                   MTKFVFATLDKVFPQYSLVWLADELHSSIYDEINFNKEAQNAELTAKFFNKNKKLKRAT
FT                   SVRVPKVLLHKDRVLIMEYIGGARLDDPTYLEDHNIKRNEVSESLAHIFNSMIFTKDAG
FT                   IHCDPHMGNLSIRTCKPTKENGYHNYEIVLYDHGLYRYPDLKTRRNYAKFWLSLLRHDQ
FT                   NEMRKWSYELAGITDDEFPLFAAAITGRSVESALNYDIDSVRGNDEIEIMRKRMLDKAS
FT                   MPADLEGTSTQGEENKLLKQLMKILAHIPRIVILLLKTNDLTRYLDESLRNPLGPARGF
FT                   LILTSYCSSLVLQEDLETAAAMWKDNIYIKAATQYIAAWYKYIATAYVRTTAYEIILFS
FT                   RDCYKKLAH"
FT   CDS_pept        complement(343994..344626)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039675" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047085"
FT                   /gene_name="SYM1"
FT                   /locus_tag="CAGL0B03465g"
FT                   /product="Protein SYM1"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58022.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG472290"
FT                   /db_xref="HOGENOM:HBG750297"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI00003B5F91"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXJ3"
FT                   /transl_table=1
FT                   /translation="MIRLFQLYEHQLKVRPKLTNSIMTGALFGIGDVSAQLLFPSGPDT
FT                   LPPSAQTNDVKRGKYDIPRTVRAVVYGSMIFSFIGDRWYRFLTKVKFSNKPAKHWSNMV
FT                   LRVCVDQLGFAPLGLPFYFGCMSLLEGHGLGAAREKIKLQWWDTLKTNWCVWPLFQMVN
FT                   FSLVPLQHRLLAANVVAIFWNTFLSYTNSQIPVGGHKLTVQYPPTVQ"
FT   CDS_pept        complement(345399..348536)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447756"
FT                   /gene_name="TEF3"
FT                   /locus_tag="CAGL0B03487g"
FT                   /product="Elongation factor 3 "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="CAG58023.1"
FT                   /db_xref="EMBL:BAA33959.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG056255"
FT                   /db_xref="HOGENOM:HBG325362"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B5F92"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93796"
FT                   /transl_table=1
FT                   /translation="MTDSDQSLKVLEELFKNLSVATADNRVEAAQEVASFLNGNIIEHD
FT                   IPEKFFEELAKAVKDKKTSANFLEAVAHIANEANLSPSVEPFVITLVPEICAKAGDKDK
FT                   DVQAVASKTLVAISKAINPVAIKAYLPHLTKSLETTNKWQEKVSVLAAISALVDAAKEQ
FT                   VALRMPELIPVLSETMWDTKKEVKEAATATMTKATETVDNKDIERFIPQLISCIADPKQ
FT                   VPETVHLLGATTFVAEVTPATLSIMVPLLSRGLAERETSIKRKAAVIIDNMCKLVEDPQ
FT                   VVAPFLDKLLPGLKNNYATIADPEAREVTLRGLKTLRRVGNVTEDDVLPEISHAGDIET
FT                   TLGVINELLKGENVAPRFKIVVEYIAAMAGDLIDERVIDQQAWFTHITPYMTIFMHERN
FT                   AKDVLDEFRKRAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRGRR
FT                   YGLCGPNGAGKSTLMRAIANGQVDGFPTPEECMTVYVEHDIDGTHADTSVLDFVVSSEV
FT                   GTKEAITAKLVEFGFTEEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT
FT                   VNVAWLVNYLNTCGITSVIVSHDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTA
FT                   QSYYELGASDLEFKFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISFQCSLS
FT                   SRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHAFAHIESHLDKTPS
FT                   EYIQWRFQTGEDRETMDRANRQINENDAEAMNKIFKIEGTPRRIAGIHARRKFKNTYEY
FT                   ECSFLLGENIGMKSERWVPMMSVDNAWIPRGELVESHSKMVAEVDMKEALASGQFRPLT
FT                   RKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACSWQRPHLIVLDEPTNYLDRD
FT                   SLGALSKALKAFEGGVIIITHSAEFTKNLTEEVWAVKDGKMTPSGHNWVSGQGAGPRIE
FT                   KKEDEEDKFDAMGNKIAGGKKKKKLSSAELRKKKKERMKKKKELGDAYVSSDDEDF"
FT   CDS_pept        complement(349638..351431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447757"
FT                   /locus_tag="CAGL0B03509g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58024.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG738506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020650"
FT                   /db_xref="UniParc:UPI00003B5F93"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ1"
FT                   /transl_table=1
FT                   /translation="MQKFKALFKKKVTDLESGVDNSKSKKDTMIGAGDSTMVAPAEPTK
FT                   WDPTVNSHDLIGSLAKELTAVADTPIPVDMGHLDNVKEEQVEGTSEYTAESHSFDNGSL
FT                   DQGSQLSFDGEYDVEEDYEEEDSEEIEEQFTNTPLRFAEQVELKGYKLIEKIGEGAFSK
FT                   VFCGIPDKNSDSAYLARNYKQVAVKVISKHDLDVSNKEQQAKDKRAGRDKQNNTNRMSS
FT                   REQVMKEVRIHKAVAAGCPYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSED
FT                   LSRHVIKQVALAVRHMHSLGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEG
FT                   VFIPTIGGGGIGIVKLADFGLSKQIFQKNTKTPCGTIGYTAPEVVKDEKYSMQVDMWGI
FT                   GCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRK
FT                   RYTIDEFLADPWLNTFDTFAKRKKKLEEEEAQQRRIMKRKRRKNVFERDPSLLYSPAAV
FT                   AMRDAFDISNAVQREEEDKRFSPGPRKHNLSVLNESDLDEPSNEIVDGLDEQMFQLKLN
FT                   SSTIIKRRKDDHKSPLEQVIT"
FT   CDS_pept        352819..353751
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447758"
FT                   /locus_tag="CAGL0B03531g"
FT                   /product="Similar to uniprot|P25616 Saccharomyces
FT                   cerevisiae YCR015c"
FT                   /protein_id="CAG58025.2"
FT                   /db_xref="HOGENOM:HBG124276"
FT                   /db_xref="HOGENOM:HBG398779"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00017BD7B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXJ0"
FT                   /transl_table=1
FT                   /translation="MRKVIISDFDETITRKDTITVLGKIPYHIKPGLTPSWDHFSSNYY
FT                   DCWKKYHSKNQDLRRLPLLSSHVRDQGIHGGNYSSLFKDEIEYQRNNRVIELSSTVEMA
FT                   KQKIFSGVTHQHVHDYVGTKLKKDECVLREGVLDCIDNAVQDPRDFYILSVNWSPEFID
FT                   ACIGTGKIPKENIICNRLLSDEDATYTGEFENEVLCGSDKIVKLQEIINKRAGEQDHLS
FT                   LWYIGDSETDILAILHHSINGILLVDPEENASKFKKLAEDVLGVDKQLLDSFTTDSSLL
FT                   FIKCLNKDHNNSLYLAKSWKGVQQILNQN"
FT   CDS_pept        354365..357430
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047086"
FT                   /locus_tag="CAGL0B03553g"
FT                   /product="Similar to uniprot|P39985 Saccharomyces
FT                   cerevisiae YEL055c POL5 DNA polymerase V "
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /protein_id="CAG58026.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="HOGENOM:HBG058377"
FT                   /db_xref="HOGENOM:HBG397536"
FT                   /db_xref="InterPro:IPR007015"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B5F95"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI9"
FT                   /transl_table=1
FT                   /translation="MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNY
FT                   TINRLVKGLGSSRNSARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGAD
FT                   FDEGKKRKGKDERGILFGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKC
FT                   KNWIREPALFSLYQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNK
FT                   ISRAEIAEIKLQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNP
FT                   RLHFVWEKLLSTIINGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKA
FT                   SSERKYLGFLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEII
FT                   VESCENDTTKILPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILS
FT                   RQLSIKSEEKSFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQE
FT                   MSKERLFSILSELNSLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSAL
FT                   RILAEIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLS
FT                   SITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLFEG
FT                   IDEYEEDEDDEQLEDEEQIKEVTDDSSSNSESDSEEDEDNSDSHEDTSSDSVEDHNDAV
FT                   NNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDD
FT                   QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQRED
FT                   VDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKLDTADV
FT                   VEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTT
FT                   IKEWLKDTKFPHSIFLDFVNWLASKKQGPKTN"
FT   CDS_pept        complement(357525..358784)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503600"
FT                   /gene_name="HAT2"
FT                   /locus_tag="CAGL0B03575g"
FT                   /product="Histone acetyltransferase type B subunit 2 "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58027.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI00003B5F96"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXI8"
FT                   /transl_table=1
FT                   /translation="MSVQLDPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLY
FT                   DFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTE
FT                   NSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDR
FT                   SKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITF
FT                   EDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS
FT                   SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIV
FT                   WDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWK
FT                   CSSNIPRIGGEPEVDLSILD"
FT   CDS_pept        complement(359018..360640)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503601"
FT                   /locus_tag="CAGL0B03597g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="magnesium ion binding"
FT                   /function="phosphoacetylglucosamine mutase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG58028.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004610"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG022937"
FT                   /db_xref="HOGENOM:HBG434897"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="UniParc:UPI00003B5F97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI7"
FT                   /transl_table=1
FT                   /translation="MSLQLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALR
FT                   SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFEST
FT                   LNAIMQELNISPGHAPQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQL
FT                   HFLTANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSY
FT                   SQTDLPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSF
FT                   DGDADRVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANG
FT                   SSTTYVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDR
FT                   LAKNAHDKSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKL
FT                   TKVVVPDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEA
FT                   QTVEATEKLSTEVTDALIETVKE"
FT   CDS_pept        complement(360764..360952)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447759"
FT                   /locus_tag="CAGL0B03611g"
FT                   /product="Similarities with uniprot|Q05676 Saccharomyces
FT                   cerevisiae YEL059ca SOM1"
FT                   /protein_id="CAR58001.1"
FT                   /db_xref="UniParc:UPI00017BD7B1"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX7"
FT                   /transl_table=1
FT                   /translation="MALSAHCLKSLVKGMHTNMSLCTPWPCVFGAQWYCVSDFKGQSRL
FT                   ASAGIPSITGVGGAIPM"
FT   CDS_pept        361572..362978
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199176" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447760"
FT                   /locus_tag="CAGL0B03619g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="identical protein binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="negative regulation of catalytic
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58029.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0042802"
FT                   /db_xref="GO:0043086"
FT                   /db_xref="HOGENOM:HBG540727"
FT                   /db_xref="HOGENOM:HBG752219"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00003B5F98"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXI6"
FT                   /transl_table=1
FT                   /translation="MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFN
FT                   FVNAEGLPRGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDT
FT                   QNNAPWGLARISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGK
FT                   TIPLNDLDIDGNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYA
FT                   AQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNT
FT                   SPASAEKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSM
FT                   ASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPN
FT                   LLIYNGAGGDLGVFWNSTSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQV
FT                   RNLLDKMNII"
FT   CDS_pept        363897..366863
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447761"
FT                   /gene_name="CIN8"
FT                   /locus_tag="CAGL0B03641g"
FT                   /product="Kinesin-like protein CIN8 "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="cell division"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="spindle"
FT                   /protein_id="CAG58030.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG398095"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI00003B5F99"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXI5"
FT                   /transl_table=1
FT                   /translation="MVVTTEAVTSRSERDAEPVQEPLVEKLATEELNILVAVRCRGRNE
FT                   REIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEE
FT                   IAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDT
FT                   LEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDSNVNGTSASGSSSRS
FT                   SSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRFKQTSQESTRAHASN
FT                   NHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVAS
FT                   TKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSI
FT                   NQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETC
FT                   STLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYK
FT                   DLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQ
FT                   SSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEISNIRDT
FT                   LKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMMLKETPRL
FT                   FESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQN
FT                   TYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWEK
FT                   SSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRNRQSIEEMIQ
FT                   GNDVIRQQITRIKQKNKSLSLFKEHSTETATTSIGSVNKVEGNLKVIMDKVLNDPQLSR
FT                   GKAEVPDEELHRLEKIPLGITNKENVVDLQHRYPALQEKRKPEDEVLLQAKLQRRNPD"
FT   CDS_pept        367614..369005
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000130831" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047087"
FT                   /locus_tag="CAGL0B03663g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="citrate (Si)-synthase activity"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG58031.1"
FT                   /db_xref="GO:0004108"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="HOGENOM:HBG127450"
FT                   /db_xref="HOGENOM:HBG309523"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI00003B5F9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR4"
FT                   /transl_table=1
FT                   /translation="MPNLSHQWESVSLKEAYARNLPAQAERLKRFKSEFGSTVIGEVTV
FT                   EQALGGMRGVTGLVWEGSVLDPEEGIKFRGLTIDEVRVSLGVAGEREPQPEALFWLLLT
FT                   GQIPNEDQVAQLSRELAARGELPGHVETLLDTLPRDLHPMAQLSIAVTALEGESHFARA
FT                   YLAGVPRGELWEHTYEDALNLIAKLPAIAGRIYHNVFGGAQGAQGQGTQGAFVLDPQAD
FT                   YSENLCRALGVQPDGETEDFHNLMRLYLTIHADHEGGNVSAHTTHLVGSALSSPYLSFA
FT                   AGLDGLAGPLHGRANQEVLEWLLVLKGELVREGKTVTDREAIRQYLWRTLNSGKVVPGY
FT                   GHAVLRKTDPRFLAQREFGRTRFPGDELYQLVSTVYEVAPQVLKEHGKTRNPYPNVDAH
FT                   SGVLLTHYGLDQPSFYTVLFGISRCFGVMAQLITDRALGAPIERPKSLSTDRYIELATR
FT                   HHNKL"
FT   CDS_pept        369880..370695
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000030539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351371"
FT                   /locus_tag="CAGL0B03685g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="negative regulation of transcription "
FT                   /protein_id="CAG58032.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016481"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG341443"
FT                   /db_xref="HOGENOM:HBG686708"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="UniParc:UPI00003B5F9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR3"
FT                   /transl_table=1
FT                   /translation="MKVAIITYSTYGHIDNLARAVKKGVESAGGQADLYRVEETLSKEI
FT                   LAQMNAPEKASDIPVATENILTEYDAFLFGVPTRFGTLPAQWSSFWDKTGGLWAQGALN
FT                   GKVGGFFVSTSSYGGGQEATVKHCLSYLAHHGIIYVPLGYKNAFAELANIEEVHGGSPW
FT                   GAGTLAGADGSRTASELELRIAQIQGKTFYETAIKFAPTSSAMMDDKMMKDDKMMKDDK
FT                   MMKDDKMKSGKKAAMKDDKMMKDDKMKDDKMKDDKMKEKDSKFSCCTVM"
FT   CDS_pept        371461..372900
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447762"
FT                   /locus_tag="CAGL0B03707g"
FT                   /product="Similar to uniprot|P46957 Saccharomyces
FT                   cerevisiae YJR006w HUS2"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAG58033.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG324241"
FT                   /db_xref="HOGENOM:HBG345712"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI00003B5F9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR2"
FT                   /transl_table=1
FT                   /translation="MDSLLEKFNSKRTSTHEKPLQRARINEDFEQDNAFALDFDKRDYS
FT                   PQYHFLYQYRLTVLKNRIREQCYKKWDAGFQLNGKEVVEKKNVLDIQGKEPCWCIGTIY
FT                   REMKYKPNVLEEVMNDTYGTVDINPESYTDPDGTDEIMLEDESGRLILVGDMIAETPFI
FT                   TGTVIGVLGMEADAGTFQVLDLCYPKALPQEPMPAATSKGKIALVSGINISTTAQERVI
FT                   KLQLLQEYLMGRLGNEEAVAQIGRLLICGDSIDFNPSSEDPGALVNKLDEFGKFLGNTL
FT                   QSISIDIMPGANDPSDRTLPQQPLHKALFRENLGQYFDKVNANLLNLVTNPYVFSINGL
FT                   ELLTTAGQNITDICKYVIPAKSDTESTTNVSTDDTDAKCAKTTEHILDLMECTLKWQNI
FT                   APTAPDTLWCYPYKDRDPFILNKWPHVYIVGNQPYFGTRKVSLDGVEVVMISVPTFSET
FT                   GQIVLLDLEDLSTEVVTIGSI"
FT   tRNA            join(complement(373286..373322),complement(373214..373250))
FT                   /gene_name="tRNA-Trp (CCA)"
FT   CDS_pept        373956..375773
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447763"
FT                   /locus_tag="CAGL0B03773g"
FT                   /product="Similar to uniprot|P06775 Saccharomyces
FT                   cerevisiae YGR191w HIP1 Histidine permease "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58034.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B5F9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR1"
FT                   /transl_table=1
FT                   /translation="MPKNPLKKQYWTEVIDGFHSPDRTDSANDRSSSPDNFELSSVNSP
FT                   VRVNVSSSGNDDILKGDTKEYPRDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGG
FT                   AIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITR
FT                   FIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANML
FT                   DVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSAGS
FT                   QFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIG
FT                   CLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYAC
FT                   SRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALS
FT                   GLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFW
FT                   TSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD
FT                   AETREEELRVEREYLANASFFTRFLHIWC"
FT   CDS_pept        376266..377177
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447764"
FT                   /locus_tag="CAGL0B03795g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 2 complex"
FT                   /protein_id="CAG58035.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005850"
FT                   /db_xref="HOGENOM:HBG008005"
FT                   /db_xref="HOGENOM:HBG499933"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B5F9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXR0"
FT                   /transl_table=1
FT                   /translation="MSINHCRFYENKYPDVDDVVMVNVQQIAEMGAYVKLLEYDNIEGM
FT                   ILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQK
FT                   SKTVHSILRYCAEKFQIPLEDLYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSQ
FT                   DILNELKTYISKRLTPQAVKIRADVEVSCFSYEGIDAIKEALKSAEDMSTEQMQIKVKL
FT                   VAAPLYVLTTQALDKQIGIDLLGKAIDKINEVISKYGGVCNITMPPKAVTATEDAELQA
FT                   LLESKEQDNRSDSEDEDNSDYE"
FT   CDS_pept        378159..379157
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351372"
FT                   /locus_tag="CAGL0B03817g"
FT                   /product="Similar to uniprot|P47085 Saccharomyces
FT                   cerevisiae YJR008w"
FT                   /protein_id="CAG58036.1"
FT                   /db_xref="HOGENOM:HBG020808"
FT                   /db_xref="HOGENOM:HBG575564"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniParc:UPI00003B5F9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ9"
FT                   /transl_table=1
FT                   /translation="MVSIRSATHAGTWYSAHAKDLSQQLLQYLESSSRECVSKARIIIS
FT                   PHAGYRYCGPTMAHAYASLDLKKKPKRIFILGPSHHVYFKNEVLVSHFQEVETPLGNLN
FT                   VDTEVCETLVGGSGDGRKLFRYMDKDTDEDEHSLEMQFPMLAQALLWRQIPLSEVKVVP
FT                   LMVSHNSVNVDTSVGSTLAKYMKDEENLFIISSDFCHWGRRFSYTGYVGSTEELENVIA
FT                   EETEVEMLTTRSKLSHHQVPIWKSIEIMDKYAMHVLSRNAKSPENLYSEWKQYLEISGN
FT                   TICGEKPISVIACALASVGYKDFEWPAYSQSSNVNSINESSVSYAAGYGCL"
FT   CDS_pept        380291..381814
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000069044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447765"
FT                   /gene_name="MET3"
FT                   /locus_tag="CAGL0B03839g"
FT                   /product="Sulfate adenylyltransferase "
FT                   /EC_number="2.7.7.4"
FT                   /function="ATP binding"
FT                   /function="sulfate adenylyltransferase (ATP) activity "
FT                   /biological_process="cysteine biosynthetic process "
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="sulfate assimilation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58037.1"
FT                   /db_xref="GO:0000103"
FT                   /db_xref="GO:0004781"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="HOGENOM:HBG049369"
FT                   /db_xref="HOGENOM:HBG480761"
FT                   /db_xref="HSSP:1R6X"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI00003B5FA0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXQ8"
FT                   /transl_table=1
FT                   /translation="MPAPHGGVLQDLVARDASKRDSLLSESQQLSQWTLTARQICDIEL
FT                   ILNGGFSPLTGFLAQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQ
FT                   DGTIPVAILTVKDIYKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQ
FT                   HYDYPGLRKTPAQLRLEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPV
FT                   VGLTKPGDIDHHTRVRVYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGA
FT                   SHFIVGRDHAGPGSNSKGVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAP
FT                   IDEIDTSKTRTLNISGTELRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFN
FT                   DDIKVDRDQLSIALLSTFLQFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWS
FT                   ASNKVNSANVYTIGHAKDADIKLASTEETIFHIVQKVVLFLEDNHFIQF"
FT   CDS_pept        complement(382111..382395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447766"
FT                   /locus_tag="CAGL0B03855g"
FT                   /product="Similar to uniprot|P46965 Saccharomyces
FT                   cerevisiae YJR010ca SPC1"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAR58002.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398781"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniParc:UPI00017BD7F3"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX8"
FT                   /transl_table=1
FT                   /translation="MDGVNEILNEVRKHLVLPVDFKAQERIEKLAYVILGIGAVTSFGI
FT                   GFVTQSLQNLLVCFGGFFVVTLIVTLPPYSCYKKNQLKWVQPKVMEIKK"
FT   CDS_pept        complement(382452..383336)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198191"
FT                   /locus_tag="CAGL0B03861g"
FT                   /product="Similar to uniprot|P47086 Saccharomyces
FT                   cerevisiae YJR011c"
FT                   /protein_id="CAG58038.1"
FT                   /db_xref="HOGENOM:HBG124277"
FT                   /db_xref="UniParc:UPI00003B5FA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ7"
FT                   /transl_table=1
FT                   /translation="MEAVCGKELRSDLLQSVERVRDGDKRELLDVMLEFMFDTVSFIRE
FT                   LSSDIFRMEQELDDEMAQLCVFYRTAIAGVFVLSPDECVTIRKALIDPDPAIPEAVLKR
FT                   VVSPLYKKAAYYLWYFIMHCCYAKYPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDR
FT                   DQDPEQEALDAIKTKTLLHCIKNELLPSWRKVLEDYKAACFDAVMQSRKLKDLFVTVDK
FT                   SVSDSNFEDTESMHTYLNWIDNMLKKFILDSKTDLHVTESDLCSPMPLTLAELKKFSEE
FT                   KHITDQLEKLRVV"
FT   CDS_pept        383602..384522
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198192"
FT                   /locus_tag="CAGL0B03883g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58039.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B5FA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ6"
FT                   /transl_table=1
FT                   /translation="MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSG
FT                   AGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYP
FT                   EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQ
FT                   GMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGG
FT                   LSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFL
FT                   RSFPANAAALAAFEFVLRTSGAKPS"
FT   CDS_pept        complement(384701..384955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047088"
FT                   /locus_tag="CAGL0B03899g"
FT                   /product="Similarities with uniprot|P47087 Saccharomyces
FT                   cerevisiae YJR012c"
FT                   /protein_id="CAR58003.1"
FT                   /db_xref="UniParc:UPI00017BD7F4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMX9"
FT                   /transl_table=1
FT                   /translation="MSQPLSYEEVIDHILHNKEVPGVEDVPDVVLEEPIDQQSSAPRLK
FT                   PWQVSGHNTESQGSGADVKTDMEKELKKAQEQGLNMDIE"
FT   CDS_pept        385192..386487
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447767"
FT                   /gene_name="GPI14"
FT                   /locus_tag="CAGL0B03905g"
FT                   /product="GPI mannosyltransferase 1 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58040.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG014124"
FT                   /db_xref="HOGENOM:HBG559139"
FT                   /db_xref="InterPro:IPR007704"
FT                   /db_xref="UniParc:UPI00003B5FA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXQ5"
FT                   /transl_table=1
FT                   /translation="MFKLGTIGLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFND
FT                   AAWFVAHRKSPYNRDTYRYTPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLK
FT                   KLKSKYRYGTDRMTIMAAIWLLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGG
FT                   LLFGLSIHFKIYPIIYALPIAIYVAAAHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVF
FT                   MYMLYGDKFIDQTYLYHIYRTDHRHNFSVWNMLLYFNSALPKTSELSKFVFLPQMIIVL
FT                   AISLTQLRRPSSFPLLCNVLFLETFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRR
FT                   GIVMLVVWVATQALWLRQGYLLEFEGQNVFYPGLFCASVGFFVSNAWILGQFIEDTIIQ
FT                   NDYVYRIEPSESRSKDSAVIDKPAIAKTEKAE"
FT   CDS_pept        386875..387465
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447768"
FT                   /gene_name="TMA22"
FT                   /locus_tag="CAGL0B03927g"
FT                   /product="Translation machinery-associated protein 22 "
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58041.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG058530"
FT                   /db_xref="HOGENOM:HBG436297"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="UniParc:UPI00003B5FA4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXQ4"
FT                   /transl_table=1
FT                   /translation="MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYSE
FT                   DDAAAASLSAKLAESSIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREAR
FT                   TKRKYIVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEVVVQGDVLDEVVAY
FT                   IHSLLEEKGMKDVKVETIDTKKKKKPEATPAAK"
FT   CDS_pept        complement(387861..389759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447769"
FT                   /locus_tag="CAGL0B03949g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58042.1"
FT                   /db_xref="HOGENOM:HBG058589"
FT                   /db_xref="HOGENOM:HBG204421"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI00003B5FA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ3"
FT                   /transl_table=1
FT                   /translation="MFEKKLEKKYRKFNSKCWKDPADALAETIEGGLKAANKKEEKERR
FT                   MRRKDLENMSFTSSSDSSYSVEPKSDTAKSGAGGRHKSKSPKQMYSSDDISYKSPSPGQ
FT                   AKPKRRKSTRTSLSDDSDSDSDSDDGDSSSDSDDDDDGVPAVMADDEGDVISRVSSTAS
FT                   QWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSI
FT                   AVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVA
FT                   ELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYP
FT                   ILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRV
FT                   LLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTC
FT                   TVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIW
FT                   TILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAV
FT                   NTAINPFVNKFISKVVKKREERKELKRKIQEEREQERRRYEHRQRHASSKHHEHDS"
FT   CDS_pept        complement(390700..392331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447770"
FT                   /locus_tag="CAGL0B03971g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58043.1"
FT                   /db_xref="HOGENOM:HBG058589"
FT                   /db_xref="HOGENOM:HBG204421"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI00003B5FA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ2"
FT                   /transl_table=1
FT                   /translation="MSNANRDRRGSVRAGLSQVHSTLNDGIYDGALPELNYADREELND
FT                   EHYGGAPSIPLEDEESIRTSNEDYSEEAKDPQAYAPGPEGDEKGKPTQNNNPEPTNTLT
FT                   KTKTRFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAV
FT                   IQEDQVYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVID
FT                   LVYKEEFWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLP
FT                   VFQGIEGVFQKVYTYQYLPQLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLL
FT                   STQIGAVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVS
FT                   AMYQVDFTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVIL
FT                   NLAPAFFAIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTI
FT                   SMPFVSKFVLKTLHKRARKAAMEKSG"
FT   CDS_pept        complement(393430..395181)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503602"
FT                   /locus_tag="CAGL0B03993g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="dihydroxy-acid dehydratase activity "
FT                   /biological_process="isoleucine biosynthetic process "
FT                   /biological_process="valine biosynthetic process "
FT                   /protein_id="CAG58044.1"
FT                   /db_xref="GO:0004160"
FT                   /db_xref="GO:0009097"
FT                   /db_xref="GO:0009099"
FT                   /db_xref="HOGENOM:HBG431429"
FT                   /db_xref="HOGENOM:HBG671001"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniParc:UPI00003B5FA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ1"
FT                   /transl_table=1
FT                   /translation="MSSRLTFARKFSSTRNVAKKLNKYSYIITEPKDQGASQAMLYATG
FT                   FNKDDFSKAQVGVGSCWWSGNPCNMHLLDLNHRCSQSIEKAGMKGMQFNTIGVSDGISM
FT                   GTKGMRYSLQSREIIADSFETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRPSIMVY
FT                   GGTIMPGHPTCGSKNIPENIDVVSAFQSYGQYISKQFNEEERSDVVQHSCPGPGSCGGM
FT                   YTANTMASAAEVLGITMPNSSAFPAVSAEKIAECDNIGAAIKNTMELGITPRQIFTKES
FT                   FENAITYVIATGGSTNAVLHLVAIAHSAGVKITPDDFQRISDKTPLLGDFKPSGKYVMA
FT                   DLIKVGGTQSVIKFLYDNGFLYGDALTVTGETLAERAKKAKGLSETQDIIRPLSNPIKP
FT                   SGHLQILYGSLAPGGSVGKITGKEGTYFKGKARVFEEEDAFISALENGEIKKGEKTVVI
FT                   IRYEGPKGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHGFLIGHIVPEAAEGG
FT                   PIGLVRDGDEIVIDADNNKIDLLISESEMSQRKAEWKPPAPRYNRGTLSKYAKLVSNAS
FT                   QGCVTDA"
FT   CDS_pept        complement(395822..397030)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447771"
FT                   /locus_tag="CAGL0B04015g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAG58045.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG113645"
FT                   /db_xref="HOGENOM:HBG397195"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B5FA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXQ0"
FT                   /transl_table=1
FT                   /translation="MAKLSRTTSLKKRLSNSSFTKLFKAKRKREDDEDSTTDSADHEET
FT                   PGKENREIATPSAKRHRPISKEQQEFEKKEALLDAELPEELRKYRPKGFRLNIPPKDRP
FT                   IRIYADGIFDLFHLGHMKQLEQCKKAFPNVELVCGIPSDEVTHKLKGLTVLTDKQRCET
FT                   LMHCKWVDEVVPNAPWCVTPEFLAEHKIDYVAHDDIPYVSSDSDDIYKPIKELGKFLTT
FT                   QRTDGISTSDIITKIIRDYDKYLMRNFARGATRQELNVSWLKKNELEFKKHISDFRSYF
FT                   KKNQGNLNNASRDLYFEVREILLRKTLGRKLYSKLLGDKHIPRSIALGSLSATSDEEEQ
FT                   SDDLPEPKRKKMLLIREPSPATEFASKYTGAKVTKQESEEDAESEDINDEDDEEEADEE
FT                   DSH"
FT   CDS_pept        complement(397590..398111)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503603"
FT                   /locus_tag="CAGL0B04037g"
FT                   /product="Similar to uniprot|P22696 Saccharomyces
FT                   cerevisiae YJR017c ESS1"
FT                   /function="isomerase activity"
FT                   /protein_id="CAG58046.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG179572"
FT                   /db_xref="HOGENOM:HBG526275"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI00003B5FA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP9"
FT                   /transl_table=1
FT                   /translation="MSETQEVSTGLPAPWTVRYSKSKKREYFFDPETKKSQWEEPEGTD
FT                   HEQFISYLKDHPLRVRCLHILIKHKDSRRPASHRQEKITITKEEAIKELKEIQARLEED
FT                   QEQKKKHSFEAIAKERSDCSSFKRGGDLGYFGRGEMQPSFEKAAFALKIDEVSDIVESD
FT                   SGVHLIKRVG"
FT   CDS_pept        complement(398402..399442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198193"
FT                   /locus_tag="CAGL0B04059g"
FT                   /product="Similar to uniprot|P41903 Saccharomyces
FT                   cerevisiae YJR019c TES1 thioesterase "
FT                   /function="acyl-CoA thioesterase activity"
FT                   /biological_process="acyl-CoA metabolic process "
FT                   /protein_id="CAG58047.1"
FT                   /db_xref="GO:0006637"
FT                   /db_xref="GO:0016291"
FT                   /db_xref="HOGENOM:HBG058526"
FT                   /db_xref="HOGENOM:HBG202229"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="UniParc:UPI00003B5FAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP8"
FT                   /transl_table=1
FT                   /translation="MSFAKYSLEKILELVPVTSTRFVTRYLPSAPVGARGTFGGTLVAQ
FT                   SLLASLHTVPVNFHPTSLHCYFINGGDPRSMITYEVKDLRNGKNFIHKQVRAYQHEKLV
FT                   FASMILFSVKKSQEHDSLHHLKRLKESNKPEIEDLVDAGKLFKDEVVGNLVKFQNIAPE
FT                   KFNNVSILNKYIESFDEGPMEYKFPKDFFHSTKVTDHLDYVVKIRHPVLSQDDGDAQSQ
FT                   HASKHHFHGHGKIPDKVTPANDPRYNYVAFAYLSDSYILLTIPYFHKLPLYCHKFSVSL
FT                   DHVIHFHQLPSVNEWLYTEITNPRSNFDKHLVQGDYYDTTGEIVASVSQEGFVVYDSEP
FT                   ILRAKL"
FT   tRNA            399907..399978
FT                   /gene_name="tRNA-Thr (TGT)"
FT   CDS_pept        400331..401164
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142385" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047089"
FT                   /locus_tag="CAGL0B04103g"
FT                   /product="Similar to uniprot|Q06104 Saccharomyces
FT                   cerevisiae YPR109w"
FT                   /protein_id="CAG58048.1"
FT                   /db_xref="HOGENOM:HBG124279"
FT                   /db_xref="HOGENOM:HBG203989"
FT                   /db_xref="UniParc:UPI00003B5FAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP7"
FT                   /transl_table=1
FT                   /translation="MSDRVDRNKKIFDLRRRNFSRNMVMKLGFLGYLIIIFKYLKYGTN
FT                   VLSLLFRCVVQALLISPFPDKSYSQWLLARNGLPTSLQGSIPGGFTTAGASGSNNSDST
FT                   QTDTGDFALEVLKRKIRAILFNCVLTINILYVVFAILFPTDFYIPQDGIYIDKQNGHQN
FT                   MPSPFKYGKYMLEGERKGGITFQAIGETLPCSNLSGNLGVILCEALILIAQLLLFCVTC
FT                   INFAELGYADDDENDEYFINNDGYDGNVLLTTINLHEGIDVMLNEKLPITETQTV"
FT   CDS_pept        complement(401513..402517)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447772"
FT                   /locus_tag="CAGL0B04125g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAG58049.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG285589"
FT                   /db_xref="HOGENOM:HBG539019"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniParc:UPI00003B5FAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP6"
FT                   /transl_table=1
FT                   /translation="MSNIVGIEYNRVTNTASTDFPGYSSQGANAWDVERFRETFDIQVS
FT                   SHEERELNFDMIGIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHRIGLV
FT                   PLKVDPEKLERLDTSDPDNLEFHDKNTIVMTLNVKCTRNPDAPKDCTDPTILYNNAHVY
FT                   ARDLKFEPHSSQVETFADCPVVPCDPDILLAKLRPGQEISLSTHCILGEGKDHAKFSPV
FT                   ATASYRLLPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDTVSREVLRH
FT                   EEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKKAEYLKKCQITQ"
FT   CDS_pept        402798..404498
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447773"
FT                   /locus_tag="CAGL0B04147g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58050.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058711"
FT                   /db_xref="HOGENOM:HBG396340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B5FAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP5"
FT                   /transl_table=1
FT                   /translation="MFRREKEDGVEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQ
FT                   YKENRSGASPYSTSPTKSIFKKEKPRERIINSPKKLPRDFHRKATSNKTQRLVSVCQMY
FT                   FLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRR
FT                   LKPKNKDFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDI
FT                   LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCA
FT                   VNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF
FT                   PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCML
FT                   FEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINR
FT                   LRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKR
FT                   QDKLAAMVDDSEVDSKLIGFTFRHKNGNTGSSGVLYKGHENANPFSTFY"
FT   CDS_pept        complement(404713..407298)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503604"
FT                   /gene_name="MRD1"
FT                   /locus_tag="CAGL0B04169g"
FT                   /product="Multiple RNA-binding domain-containing protein 1 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG58051.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG012874"
FT                   /db_xref="HOGENOM:HBG412223"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B5FAE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXP4"
FT                   /transl_table=1
FT                   /translation="MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRIL
FT                   KNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMKEKK
FT                   REALKRLREKEEKLLEEKNKKLKVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSW
FT                   DKITETAEPESGLAEEQELDDEESSNVNPLLKHALSMKKGDENDSDDEYMSFNNADSKA
FT                   GSDESNEEEKMISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEK
FT                   VGEEFATNVQDKESEENSQATPAEELQEEIPDEEQAIAKIQKTGRLFLRNILYSSTEDD
FT                   FKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHIL
FT                   AADEMKDHRLDEFDLKNMPLKKQRELKKKAAASKATFSWNSLYMNQDAVLGSVAAKLGV
FT                   QKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVK
FT                   NFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTV
FT                   IYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADLLESVSSKKTEDKEDEDEQVV
FT                   DGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFR
FT                   TKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKD
FT                   VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP
FT                   AEQEAANAEEELERMTKKVRKQAAVSEIAAMTRNAGKRKLDMEDEEEEF"
FT   CDS_pept        408700..409593
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503605"
FT                   /locus_tag="CAGL0B04191g"
FT                   /product="Similar to uniprot|Q06107 Saccharomyces
FT                   cerevisiae YPR114w"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58052.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058019"
FT                   /db_xref="HOGENOM:HBG203990"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI00003B5FAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP3"
FT                   /transl_table=1
FT                   /translation="MDLKDFLVGYLDIPSPTIFDAKVIPFLRDYNIVKSEAILSNLHSI
FT                   IYVALGYQMWFLATRWLLFPPLTKWRLSHSKVPNDEKKAKKLNIEAAIHFVSFLQTLVV
FT                   VYLSLIFLCDGDKTSNYDTVNARIFGRSRDTEIITVYAIGYFVWDVYISVLHSTLPFVL
FT                   HGIISTVVFTIGLKPYIQYYAPVFLMFELSNPFLNLRWFGLKYLPTENRVCSIALLINN
FT                   LLLLIFFFSARIAWGWYQIGKLTWDFYTVHTDPRFLWLDSSIIVGGNLVLDVLNAIWFG
FT                   TMLSVAFNVITKRKKD"
FT   CDS_pept        412230..414932
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047090"
FT                   /locus_tag="CAGL0B04213g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58053.1"
FT                   /db_xref="HOGENOM:HBG124280"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00003B5FB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP2"
FT                   /transl_table=1
FT                   /translation="MTETQTEYFNTRQVSLADDLLKHTTSIGSKLTKVVSPTTKVKEDS
FT                   LKPMKTISNTISKTTSATTANDSSFDGFNPKYLNSESVYRAQSNSQSGPVVSRTEVNSP
FT                   YYLPVPVPEAVTDSANPVSSSAKEQYLNGYHHSQYVKEYPTVLLADRFKKWNKILKYLI
FT                   SYLREAAYVEEHIARLHVKLKKKVTFPFLTDLDDHNQLVDPYQKNLPTKRTQPITPAEK
FT                   KRLEAEAALAAATTTEETTEELDFDTELEDEVPVSSDNDTMAPSGFLKFGSGSIQDIQV
FT                   LLKKYHGSIAGQQLKVSREIMENVIPKLEGLVKELNNKIREIKSLDGDFRTNLIGQMNQ
FT                   TSRLIQKYNSVVKKLANEKSDATTTIQPKCDPYLVKIQLETQLKKQLAEEKYLMEAFVN
FT                   LQSSGLDLERIVYTKIQSALENYTALIDSEARLILKNLCQELQQGMLSKPANYEWDQFI
FT                   THHTNCMLNWTSTQPKPVPRELSDIVYQNMKAPQSKCIRKGYMYYGSGKDVKKYSKGYF
FT                   ILTSHYLHEFKDSDFSKEMKGSTDASNNFCHMAISLVNLIPEKSFSLSDIDIEEITDTE
FT                   MVFTARSLKSTKPRSSPSPAPIPAPEHKSRSPSITAAVPKFLRGGPSRSTKTRSNSGAN
FT                   RQTLFAEPSLSEPLREIGERTTWHLRLSLGDYDEEYKKQFKKWSSDFKALADFNHSYHR
FT                   NSFINERAESATRRASKTAGPGEFNKQNSDSSRGSSDSTIVQDSGRSDSKIGNIVGLDE
FT                   DGNLIASDGRKYSVSPQLQRQGSSGLTSPSSQPGSPLGDGSTTQYRDRVLSLPTNKRQD
FT                   STTIEGVMADSKKSPNTSSRGSVSYVTSSKVTRTSSLPVNDKDAASPADVPRSSQMRDQ
FT                   LKSTIDTIDESNQENSASSTMKLSKSMYS"
FT   CDS_pept        complement(415660..416601)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198194"
FT                   /locus_tag="CAGL0B04235g"
FT                   /product="Similar to uniprot|P06105 Saccharomyces
FT                   cerevisiae YJL080c SCP160"
FT                   /protein_id="CAG58054.1"
FT                   /db_xref="HOGENOM:HBG124281"
FT                   /db_xref="UniParc:UPI00003B5FB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP1"
FT                   /transl_table=1
FT                   /translation="MNSKIVSTLVILLLILFSCNATLITDEAAKLRVVSRIEGAIATSW
FT                   MDKAKLKLSIITGKHANFRSDLPIETVQPNYLQYLVNSISNMHEVNLVLLLPELEDYND
FT                   SDIWKIRDSLEDFIKGAQNLTEKLDNASWMRKKLYASTVRANTIFYLRHLLFRSSFLSY
FT                   MTQKGNEDPNLMLTELIQIIEESKVTLLTAIKIIAIFETNNFESLLGILPTINNNDSTE
FT                   QALVVNQLGYELCPECEKQRREEMETEHLWQDAYIKTMALLLGRTAAFVVFCTAIGAYS
FT                   CTAALLVFGCKAYIIWTQIWIDSIKLSLGKWI"
FT   CDS_pept        complement(417273..418361)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447774"
FT                   /locus_tag="CAGL0B04257g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58055.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG055795"
FT                   /db_xref="HOGENOM:HBG316531"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="UniParc:UPI00003B5FB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXP0"
FT                   /transl_table=1
FT                   /translation="MSRPQVTVQSLTGEATSSSVPLPAVFAAPIRPDLVHSVFVSVNKN
FT                   KRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFAPTK
FT                   TWRKWNVKVNQNEKRYATASAIAASAVASLVLARGHRVEKIPEIPLVVSKDLESIKKTK
FT                   EAVAALKAVGAGADLLKVIKSKKMRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNV
FT                   PGVETVPVTALNLLQLAPGAHLGRFVIWTEAAFAKLDQVWGSETVASSKTGYSLPSNIV
FT                   ATTDITRIINSSEIQAAVRPAGQPSQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLG
FT                   SKKAAKSSTKPSAVFTETLKHD"
FT   CDS_pept        complement(418678..420273)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447775"
FT                   /locus_tag="CAGL0B04279g"
FT                   /product="Similar to uniprot|P38222 Saccharomyces
FT                   cerevisiae YBR030w"
FT                   /function="binding"
FT                   /protein_id="CAG58056.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058075"
FT                   /db_xref="HOGENOM:HBG204125"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI00003B5FB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN9"
FT                   /transl_table=1
FT                   /translation="MEVFGRVALPCVPYKPMSVTQEGDIRDILEFVRESKGLWDQRCEV
FT                   KVSGLGGVGVFAKQDINESVPLLKLHKSSIFSASNSSVANLLVEEQIDGVLALNIAFIY
FT                   ETTVFKARSHWTKYLKSIRVDENILPPFYWDEELKRLIRDTTIDCLYGALEPQDELVEG
FT                   FEIAVDLARKWHDELGLEVPRGYFDVQDNSPEEIDQKLRRFVAVAYAISSRGFEIDAFH
FT                   ETALVPIADLFNHHSESPHLQFRTIYDVCDQCGEFFGCRHNESDEEDEEDEEDEEDEED
FT                   EDEDDGKDKVNGKGLTMELVKEIDDEQEEDLVEPRVKNEELEDDECVEMRLMSPVKQGE
FT                   EIFNTYGELSNPLLLVRYGFCVEGNSNDVVHLGTILTDHSRKHKLKHVTEWFKETGYKL
FT                   LQEWMKEDDDEEEGGEEEEEEEEEETSWLSDILITSDGEPSQTLIVLCKLLSMDQLHWK
FT                   KFMKYPDEKKYNQLGKTQDARTLLLSLAQQKLKLLDKKPLHKNATQQSPEHKAAWTLLM
FT                   QERQILQRCIDNYT"
FT   CDS_pept        420544..422172
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198195"
FT                   /locus_tag="CAGL0B04301g"
FT                   /product="Similar to uniprot|P38070 Saccharomyces
FT                   cerevisiae YBR028c"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58057.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B5FB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN8"
FT                   /transl_table=1
FT                   /translation="MVFSLDEELLKPVDGAVPRTIITSEGSGFMPLERNDAQAYEQGHL
FT                   SVGAAPIPRTKARTNSNSQPLLRGRRRRSSVLDKFSVYEPEFIRRVSLGGAGSFPQETQ
FT                   FLDGSYKECAVFDEEDEDGIDGGAIVGGDVRTGISREISDFKPIRVLGQGAYGKVILVK
FT                   DKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDKPVDSEDEKLSKRIERTFAERT
FT                   ILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGTLEEDTVAFYAAEISC
FT                   ALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNEGEDVNE
FT                   LHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYTGANHKVIANKIKND
FT                   KQGPKIPYYLSDGMKDVLGALLKSDPKKRWDVDKYWSEPKKDNSQKKGQKKKKSKERTS
FT                   PFQSHFVFRKVDWKGLSSGELQNTTFGPIVPVITDWELAENFDSEFTSMSYEEDDFLHP
FT                   LHNKSPDAFKGFSFKASGSYLEKYF"
FT   CDS_pept        422687..423979
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447776"
FT                   /gene_name="ETR1"
FT                   /locus_tag="CAGL0B04323g"
FT                   /product="Probable trans-2-enoyl-CoA reductase,
FT                   mitochondrial"
FT                   /EC_number="1.3.1.38"
FT                   /function="trans-2-enoyl-CoA reductase (NADPH) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG58058.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019166"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniParc:UPI00003B5FB5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXN7"
FT                   /transl_table=1
FT                   /translation="MWCLALLMLLVRLHCFFKRYTYIYITCCVSISPVAANTKNNIVFA
FT                   MSGLRAASVFSPVFKRMASSIPSQFKSIIYNSHSLEDCTGVLSVHNYKPKQDLNKSVVL
FT                   RTLAFPINPSDINQLQGVYPSLPEKTLDYSTEKPSAIAGNEGLFEVVSLPEHGDHGELK
FT                   VGDWVIPVQANQGTWSNYRVFDKASDLIKVNGLDLYSAATVSVNGCTAYQLVNNYVDWN
FT                   ADGNEWLIQNAGTSGVSKFVTQIAKARGVKTLSVIRDRDNFEEVAEVLEQKFGATKVIS
FT                   ESQNNDKDFGKKELPKVLGDKARVRLALNSVGGKSSSAIARKLERDALMLTYGGMSKQP
FT                   VTIPTSLHIFKGLTSKGYWVTENNKRDPTDKVNTIKGFIDLYKQGKIISPEEEIETMEW
FT                   DANNGDDQQLLELVKRGITEKGKKKMVLLKW"
FT   CDS_pept        424411..425592
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000087628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198196"
FT                   /locus_tag="CAGL0B04345g"
FT                   /product="Similar to uniprot|P38219 Saccharomyces
FT                   cerevisiae YBR025c"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58059.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG489518"
FT                   /db_xref="HOGENOM:HBG586249"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="UniParc:UPI00003B5FB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN6"
FT                   /transl_table=1
FT                   /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRSPL
FT                   GNPANYPFATIDPEEARVIVPSPRFDELVNIYKPASEVPAHLTVYDIAGLTKGASAGEG
FT                   LGNAFLSHIRAVDSIYQVVRCFDDAEIIHIEGDVDPVRDLEIISTELRLKDIEFSQKAL
FT                   EAAEKIAKRGGQSLEVKQKKEEMALIERIIKLLEDGQRVYNQTWTPKEVEVINSLYLLT
FT                   AKPTIYLINLSERDYIRKKNKHLLRIKEWVDKYSPGDLIIPFSVSLEEKLSHMSIEEGE
FT                   EELKQLGTTSALPKIITTMRQKLDLISFFTCGPDEVREWTIRNGTKAPQAAGVIHNDLM
FT                   NTFILAQVMKYSDVIEYKDDNAIKAAGKLLQKGKDYVVEDGDVIYFRAGAGKN"
FT   CDS_pept        complement(425899..426747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047091"
FT                   /locus_tag="CAGL0B04367g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="copper ion binding"
FT                   /biological_process="cellular copper ion homeostasis "
FT                   /biological_process="copper ion transport"
FT                   /biological_process="respiratory chain complex IV assembly "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58060.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006825"
FT                   /db_xref="GO:0006878"
FT                   /db_xref="GO:0008535"
FT                   /db_xref="HOGENOM:HBG533755"
FT                   /db_xref="HOGENOM:HBG756383"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="UniParc:UPI00003B5FB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN5"
FT                   /transl_table=1
FT                   /translation="MLSRASRRIVDGRINQLRALSKCTVQYQTSKKSLGRFSVNKDEGV
FT                   NDTVHLNPTSGTLGSTWKYALGLIAAGSLTYYYVNNERKLLQTEKEQEANRLYGEKFVG
FT                   GPFRLVDTEGRSFTEKNLEGKFSLLYFGFTHCPDICPEELDKMNDWIIGLESKGLSVQP
FT                   IFITCDPIRDTPEVVKEYLKDFNPGMIGLTGTYEAIKDVCKKYKVYFSTPENADPKSDY
FT                   LVDHSIFFYLIDPEGNFIDALGRIYDEKSGLEKIIQNIKAYTPKEERERRNKSWYSFLF
FT                   K"
FT   CDS_pept        427594..431085
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158449" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447777"
FT                   /locus_tag="CAGL0B04389g"
FT                   /product="Similar to uniprot|P29465 Saccharomyces
FT                   cerevisiae YBR023c CHS3 chitin synthase III "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /protein_id="CAG58061.1"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG057742"
FT                   /db_xref="HOGENOM:HBG333864"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="UniParc:UPI00003B5FB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN4"
FT                   /transl_table=1
FT                   /translation="MVGYEDDDYYVGFSRDQESFIRSRNGNSLSMKRTSMPTRQGSLVR
FT                   PERNRFDDPNNPHHYYVKTAEQQRSHLSVLPSSTGVAPGIARNSGSQRSDRSRLGRLGR
FT                   SYYNGEEDDFYYPMQDLSKDRSGDSRYNPEADYPDRTALNSDDVANKNDNEGYEDEEND
FT                   FDNSTDVENHLISNRPTSELKPKAESTRSLWMIYCYVVTFWAVPPLLSLFGMPEKARQR
FT                   AWREKMGLLSIIAYIGAIVAYITFGFTKTVCGEQKLRLKNNSVSKEFSIINGQAFKLDS
FT                   GTHPELLGLEVDSTGLYGPWSAAGKDASFLFQNVNGNCHGLITPKEDCTIPHNDNGDLA
FT                   WYFPCKLFNQDGSSKPNFTVEYSPGWDCHTSDAEREAFYSLKSAAEVYFTWDGIKNSSR
FT                   NLAVFNGHVLDLDLLDWLETDQLNVPSMFDDLKTSSLQGYDLSLILSTDHEKKVARCLT
FT                   EIIRVGEVDSKSVGCIASDVVLYVSLVFILSVVVTKFLIACYFRWFVARNQGAYPVDNK
FT                   TMDQHLKQVEDWSENIYSQGPIKTVQPEQRPKRKTRRRRSTIDLIRKKSSNFLNLTESV
FT                   IDFDGGDGDGTDGPAISGMTTMTLQNNWNTNNLNKETQAKNSSPFFSYGNNSKINQLDA
FT                   SIIHPDIVQQPPVDFMPFGYPLAHTICFVTCYSEDEIGLRTTLDSLSTTDYPNSHKLIM
FT                   VVCDGLIKGSGNDLTTPEIALGMMDDFITQPDDVLPYSYVAVASGTKRHNMAKIYAGFY
FT                   KYDDSTVPVEKQQRVPMITIVKCGTPEEQGSAKPGNRGKRDSQVILMSFLQKITFDERM
FT                   TELEYQLLRNIWQITGLMAEFYETVLMVDADTKVYPDSLTHMMAEMVRDPLIMGLCGET
FT                   KIANKGQSWVTAIQVFEYYISHHQAKAFESVFGSVTCLPGCFSIYRIKSPKGADGYWVP
FT                   ILSNPDIVERYSDNVTDTLHKKNLLLLGEDRYLSSLMLKTFPKRKQVFVPKAACKTIAP
FT                   DEFKVLLSQRRRWINSTVHNLFELVLIKDLCGTFCFSMQFVILIELIGTLVLPLAICFT
FT                   IYVVIFAIVSHPTPIITLILLAIILGLPGMIVVITATSWSYLGWMFCYLIALPIWNFVL
FT                   PSYAYWKFDDFSWGDTRTIAGGNKGAGGHGEEDGEFDHSKVKMRTWREFAREESDI"
FT   CDS_pept        complement(431271..431810)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447778"
FT                   /gene_name="POA1"
FT                   /locus_tag="CAGL0B04411g"
FT                   /product="ADP-ribose 1''-phosphate phosphatase "
FT                   /EC_number="3.1.3.n2"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="CAG58062.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG124283"
FT                   /db_xref="HOGENOM:HBG397260"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniParc:UPI00003B5FB9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXN3"
FT                   /transl_table=1
FT                   /translation="MSNIHYIKGNILKGRTYKRIIIHSCNANGAWGGGIAYQLAVKHPK
FT                   AEEVYVDLCERFGQKLLGKCVVIPSYSDDDVLIGCLFTSIFGGASHGSGTSIVDYTDKA
FT                   LSHFDELLAKEQSKSDNANLDKEIEKLLKLKSGVLKDYKLEMPKINSGIFGVPWPETEE
FT                   VLKKYDRSMNFTVYEL"
FT   CDS_pept        complement(432245..434227)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047092"
FT                   /locus_tag="CAGL0B04433g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58063.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051000"
FT                   /db_xref="HOGENOM:HBG333533"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI00003B5FBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN2"
FT                   /transl_table=1
FT                   /translation="MNSHDADAFEGHATRRRSTVGHHQINSDDDDSDNYYNETGSGGSK
FT                   RNLRNLFGSSKESDKDEAGDSNHVVTNLLDVTSVDVESFDEDEKLAKPKYKSRWQEIYY
FT                   EYIIVDKSTIGTSLLDSFMYNHDLKPVEEERRVWSWFNFVYFWLAESFNINTWQIAATG
FT                   LQMGLNWWQCWVSIWIGYSFVGIFVVLASRVGSAYHLSFPISSRAAFGIFFSLWPIINR
FT                   VVMAVVWYSVQAYIAATPVSLMLQSIFGNDLPRRIPDHFGSKNATTYDFMCFFIFWVAS
FT                   LPFLWVPPHKIRHLFTVKAILVPFAAFGFLIWAIRKAHGKIALGTLNDSQPHGSAFSWV
FT                   FLRSIIGCMANFSTMVINAPDFSRFSKHKNSAMWSQLICIPFLFSITCLVGILVTAAGY
FT                   ELYGVNYWSPLDVLQKFLDTAFTSGTRAGVFLISFVFAIAQLGTNISANSLSCGTDMSA
FT                   LLPKYINIRRGSIFCAMMALCICPWNLLATSSKFTMALSAYAIFLSSIAGVVCSDYFVV
FT                   RRGYIKLTHIYSHRKGSFYMYNNRFGINWRALVGYLCGVAPNLPGFIASVGGPNIKISM
FT                   GAMKLYYLSYWVGYFLSFISYTALCYFFPVPGTPVKNILRDKGWYQRWANVENFETEWR
FT                   HMLEREDLYGDDVSIYNHEEEEKFF"
FT   CDS_pept        435437..437254
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447779"
FT                   /locus_tag="CAGL0B04455g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58064.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124284"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00003B5FBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN1"
FT                   /transl_table=1
FT                   /translation="MASNKPILITITKNNARVFVGTWIEGSNGAHSSSDSPRLKHFGIK
FT                   KKFKKIIVSSQVVWNCIVRHSKWPHVGNLPNNKWYKDMVTNAHAMEKMALNKSQLLSFN
FT                   QDYLHLYSHFAGISASPRTTSRCSSIIKYDDNDTCSIGEDVIVKGGISNFKAYILLLKS
FT                   FVGTGVLLLPNAFKNGGMLFSIILFIFIGIYSFWCYYILSVVKVSTKLSCFGEIGKRIY
FT                   GTPMKVVILFSLILTQLGFASTGIIFVANNMKPSLEALFHWKDIKYFYLIFCQLILYIP
FT                   LGLITDIKKFSITTMVSNVLMLSGLSIVFISCCSTLSIQPSEHFVENINYKFNPRNWSL
FT                   FVGTAIFAFEGIGLIIPVQDSMRHPESFPLVLALVITSSAVIFLAIAIIGYMAFGNGVE
FT                   VIILQSLSSGNILINLLQLLYSFAIMIATPLQNLPVVTILEDLLFAKIDIDNNNNETLD
FT                   DCSIEEVSKSNNLMPLTEKKDITTQKEISSTDISEGALLPVLDCFRIVKDVLTNSQVPK
FT                   VCLRLGITNLVVFLAYFGSGHLEKFVAVIGSLFCIPLVYMIPPALHLKDYSIKKDSGKI
FT                   LKPNIYLDVGLIMIGAISMVYTTYLSIIL"
FT   CDS_pept        complement(437357..438208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198197"
FT                   /locus_tag="CAGL0B04477g"
FT                   /product="Similar to uniprot|Q12057 Saccharomyces
FT                   cerevisiae YOR104w PIN2"
FT                   /protein_id="CAG58065.1"
FT                   /db_xref="HOGENOM:HBG124285"
FT                   /db_xref="UniParc:UPI00003B5FBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXN0"
FT                   /transl_table=1
FT                   /translation="MIGRCQAEALFRRSSFTDGVIDTGKSFKSWDTCMHNKACKIIAIV
FT                   GIVIASIVAVWLIGGLLSCFTRGVSGIGEFCCWCCNLCNKNPNEPNGYGNQNFNTVPNG
FT                   KFVGSPPDVVYQPIHMPERAYNKFDAYAEYDPRKNSSKNTVYDESIELNDRYDLESQNL
FT                   QGRSRKQTHLSPQRMPLTMETERFDGRDELSVYGGYHHRGQSTSDVSDISYEMEPFPPA
FT                   QQSPSRRQHLSTNYNSSSNLVSGGRGSRSSHTSPVRQPVRAPYPADNDSYYEENVYRNN
FT                   RY"
FT   CDS_pept        438657..439061
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211854" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447780"
FT                   /locus_tag="CAGL0B04499g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58066.1"
FT                   /db_xref="HOGENOM:HBG058552"
FT                   /db_xref="HOGENOM:HBG329225"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniParc:UPI00003B5FBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM9"
FT                   /transl_table=1
FT                   /translation="MAGPKKVSSSKSSKDAQSGEVFNDFKEAINSSMKAYTTQVEGNNK
FT                   LKLIDIFCVFLVLVGGIQFLFALLVRDSFPFNAFLAGFIMCVGQFVLLISLRLQILNQI
FT                   EFPGISSNRAFAEFIIASLTLHFICLHFIN"
FT   CDS_pept        complement(439732..440751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351373"
FT                   /locus_tag="CAGL0B04521g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58067.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI00003B5FBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM8"
FT                   /transl_table=1
FT                   /translation="MNKPSIREYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSY
FT                   RKQVVIDDKVTILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQ
FT                   IQRVKDVEYIPVVVVGNKSDLETERQVSFEEGASLAKQLNAPFLETSAKQAINVEDAFY
FT                   TLVRLVRDDGGKYNKYLEKTQDGNTGAGAKDHSTSNMATSANNYNSQMNNAQSAGMGGE
FT                   YKGSSNSMNNNSMRNSNGHMEGANNAMDSYNKGTAGNDMYGQDTNMDSSRMNQQSTSAA
FT                   NNMNSSSGANRANNQQNRSSGNTGNDGRQARAQQSSQSENKITENKTKESGGGCCVIC"
FT   CDS_pept        441599..442552
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351374"
FT                   /locus_tag="CAGL0B04543g"
FT                   /product="Similar to uniprot|Q12289 Saccharomyces
FT                   cerevisiae YOR100c CRC1"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58068.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B5FBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM7"
FT                   /transl_table=1
FT                   /translation="MSDTPAETNILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLI
FT                   KVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTP
FT                   IFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTN
FT                   SEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKK
FT                   DKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISMVQATKDIYIQRGGIK
FT                   GFFPGLGPALLRSFPANAATFLGVELTHAFFKKYNF"
FT   CDS_pept        complement(443110..444315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047093"
FT                   /locus_tag="CAGL0B04565g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58069.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B5FC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM6"
FT                   /transl_table=1
FT                   /translation="MSKLRIPPGKEPLVKRIGIALVLFLSTFFLYSTVSGGEFFHSGKP
FT                   VKGASTAITGNTGYKYTYADEDGHYPESKKVRATFVTLVRNKDLWELLPTIKNVEDRFN
FT                   RHFHYDWVFLNDEPFTQEFITTTTAMTSGKTKYGLIPREHWSYPEWIDQEKARLTREEM
FT                   KKQKIIYGFSEPYRHMCRFESGFFYRQKVLDEYEYYWRVEPGTKLHCDVNYDVFKFMKD
FT                   NGKKYGFTVSLLEYEATIKTLWQTTVEFIKKFPQHLAKNSMLDFISDDQGESYNLCHFW
FT                   SNFEIASLDLWRGEAYSAYFDYLDHAGGFFYERWGDAPVHSIGAALFLDRDEIHHFGDL
FT                   GYYHPPFHACPIDENIRLSNRCDCHPNKDFTWVPYSCALKYYNVNKLTKPLGWQEHVGM
FT                   KV"
FT   CDS_pept        complement(445179..445964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447781"
FT                   /locus_tag="CAGL0B04587g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58070.1"
FT                   /db_xref="HOGENOM:HBG042202"
FT                   /db_xref="HOGENOM:HBG756784"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR014623"
FT                   /db_xref="UniParc:UPI00003B5FC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM5"
FT                   /transl_table=1
FT                   /translation="MALKTIYVARHGYRSNWLPEGPYPAPPTGIDSDVPLAEHGVDQAK
FT                   QLAEYISATWDEERKPQMVFTSPFYRCVQTSEPVVKALDLPLIIERGLGEWYKPDRPVI
FT                   PEPATVAQLSELFPEVTFDTQWGGPTVIPSGKGETEQEIFARSGDFLSKFLDRMQRDYP
FT                   DIERVLFVTHAATKQCIGMKLLNIENVRDSIDEQGNVLHNASCSIDWFEYTGNNWLLKM
FT                   NGETSFLKDGAEMDWNFTYGFEAGSDADIKARRLRGEIN"
FT   CDS_pept        446314..446979
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447782"
FT                   /gene_name="YAF9"
FT                   /locus_tag="CAGL0B04609g"
FT                   /product="Protein AF-9 homolog "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58071.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG072995"
FT                   /db_xref="HOGENOM:HBG748014"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="UniParc:UPI00003B5FC2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXM4"
FT                   /transl_table=1
FT                   /translation="MAPPTSKRIKTLSVSRAVIYGNTAKKIGENRPPNAPSEHTHLWTI
FT                   FVRSPTGDDISYFIKKVVFKLHETYPNPVRTIEAPPFELTETGWGEFDINIKIYFVEES
FT                   NEKFINFYHRLRLHPYVNVNPPMSTEVKKEETGNATTSDEISSIFYDEIVFNEPYEDFF
FT                   KILVSKPGNLLPSNKTEDCLFSRQLEQDELTRIKMASSNVDKEIEIYKKKLEDTLKSR"
FT   CDS_pept        complement(447218..450508)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447783"
FT                   /locus_tag="CAGL0B04631g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="CAG58072.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG058693"
FT                   /db_xref="HOGENOM:HBG396456"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003B5FC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM3"
FT                   /transl_table=1
FT                   /translation="MLLLLSRQPDRRIAIVSDRHALIFKSVGHNKSTNAPLCAIDLVEK
FT                   GQLKDQGFKKLTHNEVHGFIGMIEIEGYIFLGAITGKSKVAQPIPGETVNKIYAVDFFC
FT                   LNDSRWDFVEIDNSGYPVLPNRDSSDLKETLPRHPCYELRKLLSDGSFNYSSNFDLTST
FT                   LQKRRFSDHSLSVDNFEEEYMWNYFLMNEIITYRDRLDMETKRILDDEGFLTTVIRGFA
FT                   ETFVTYVKKLKVGLTVISKQSWKRAGTRFNARGVDDDANVANFVETEFIMYSNEYCYSF
FT                   TIIRGSIPVFWEQDTSLINPKVQITRSKEATQPVFDKHFHRLIEKYGPVHVVNLLSTKS
FT                   SEIELSQRYKQQIVDSKSLRLNDDVFYSHFDFHKETSQEGFSAVRRVLPLLSNSILEAG
FT                   YFSYDVKDKKVLSEQHGVFRVNCLDCLDRTNLVQQTVSLAVFKIFLEDFQIIGPKSFID
FT                   EEDFAIKHNTLWADHGDQISQIYTGTNALKSSFSRKGKMSLAGVLSDATKSVSRMYINN
FT                   FMDKGKQQNIDCLLGRLADQKSVELYDPFNEYVTNKLHERAEEFTNNSNINIFVGSFNV
FT                   NGTSKRSDLSKWLFPIGDKFKPDIVVLGLQEVIELTAGSILNADYTKGSFWETMVSDCL
FT                   NQYDDKYLLLRVEQMSSLLIVFFVKADKAHYVKQVEGASKKTGFGGMTGNKGAVSIRFD
FT                   YGNTSFCFVNAHLAAGANNIDERRNDFESITNGTQFTRSKNISHHDSIFWLGDLNYRIQ
FT                   LTNEEVRKLLVTQPDGYIDKLLKYDQLTQEINAGVVFKEFKEPTLKFRPTYKYDYGSDN
FT                   YDSSEKARTPSWTDRIIYKGENLYPLAYSDAHLLLSDHRPVYAAYRAKVTFIDDDKKHR
FT                   IVQALHKEYKIEHPEETSLTNNLLLDLDIESRTQSEQTNGSQTSSINFEAPLSHSLQSS
FT                   TSSFASLTPRNRNAQQDTEVRSSSASVLSSPGAIDKSVKPKLSAPPPPAPRIQPKKELE
FT                   VESNGSRLSSPATPKPTVLSPQVPPKRKVLPPGFSDSIVLTPKNSSQSSVDVKALSPSP
FT                   KPKVSSPPISLKSNNEGEGKRKIPPAKPEKKPELESLTLDSWKPLQPK"
FT   CDS_pept        complement(451396..452586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198198"
FT                   /locus_tag="CAGL0B04675g"
FT                   /product="Similar to uniprot|P33309 Saccharomyces
FT                   cerevisiae YNL001w DOM34"
FT                   /biological_process="translation"
FT                   /protein_id="CAG58073.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG049937"
FT                   /db_xref="HOGENOM:HBG629960"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI00003B5FC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM2"
FT                   /transl_table=1
FT                   /translation="MKVVSIDKGKSERGRTVLTIVPEDKEDLFAMYQIIDIGDVVIFKK
FT                   LYTNKSEDTNKKTVTDLARIKLKILNREFDIKDEYLRYKGISCPDESGTENIDSEVPIG
FT                   KYISFSIVYNHPITIYKSHFNKYAEQLLAEACEPESQADTAAVVLQEGISHICLLTASS
FT                   TILKQKVEFSMPKKKNAKDVEKFEAKMEKFYRATYDAIVKQLDFDQIRMVIICSPGFYA
FT                   KTLLTNIMKYASQDQNDLILKNEAIFVVAHCSTGYLQGISEVLKNPEYASLLEDTKFVK
FT                   EALIFDDFLEHIETEDDKAWYGKTEIYKAAEMEAIDTLLITSNTLRSDDIAEREKNMDL
FT                   IEQIKAQNGKVIVFSNFRDSGVELQHIGGFACLLKYPVPDLDDLANDAPPDTLITA"
FT   CDS_pept        complement(453356..453910)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447784"
FT                   /locus_tag="CAGL0B04697g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58074.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG027216"
FT                   /db_xref="HOGENOM:HBG315333"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="UniParc:UPI00003B5FC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM1"
FT                   /transl_table=1
FT                   /translation="MESDLGEQVSSNSVIAFVHKYKNLYQFYLDKCTPYVKERWAAELG
FT                   LLVLFILRVVFGQGWYVVCYALFIFLLNQFLAFLTPKFDVSLQQDEENNELEAGEKSDE
FT                   FRPFIRRLPEFRFWHNCIRATVLSMFLSLFRILDIPVFWPILLFYFITLFFLTMRRQIQ
FT                   HMIKYRYIPIDIGKKRYKPQI"
FT   CDS_pept        join(454309..454353,454553..455302)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047094"
FT                   /locus_tag="CAGL0B04719g"
FT                   /product="Similar to uniprot|P25565 Saccharomyces
FT                   cerevisiae YCL002c"
FT                   /protein_id="CAG58075.2"
FT                   /db_xref="HOGENOM:HBG124130"
FT                   /db_xref="HOGENOM:HBG398783"
FT                   /db_xref="UniParc:UPI00017BD86D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXM0"
FT                   /transl_table=1
FT                   /translation="MLYTGTVQSCGKILEIYAIVQQKRYNAVHKSVYGLSYDLYLMQFA
FT                   TYFISLYCTVIYKYSELAARQFSDRFPLYYSLNAEPIPISMPILLIDLVMLAVSSIVIF
FT                   QLWKYRATRNVKQGTSLLLICIFLMILIFSYFTYICAEYNLPERNSGRFGVYYIEHVNY
FT                   LWVIGQFLSAVKYLPQISLNWMGISTKGLSPKYLKISIIATSILQASNLCSFIDNLEFY
FT                   QWPFNLTPRVVSFLQLIWLGIIYYQHYYAYAMNKPYLKRIYE"
FT   CDS_pept        complement(455475..456995)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047095"
FT                   /locus_tag="CAGL0B04741g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="CAG58076.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG176116"
FT                   /db_xref="HOGENOM:HBG737293"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="UniParc:UPI00003B5FC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL9"
FT                   /transl_table=1
FT                   /translation="MLPTSIAPNHCRVYSHQLRKFMTQPSNYYESVQSSLSYLKTKFLF
FT                   KRGEIEVIESPSEFYDTLKKKITTAKKRVFIASLYLGSSEDELIKCVSDAMKNNKDLKV
FT                   SFLIDGLRGTRETPAKCSASLLATLVRDYGNRVDTRLYRTPAYVGWKRLLIPKRYNEGI
FT                   GLQHMKIYGFDDEVLLSGANLSNDYFTNRQDRYYLFKRKEFTDYYYSLHKTISALSYKV
FT                   EYSNNNQKYKMFWPSDNLANEPIHGRRQFLKKSSLVISEFLNRPRKPNIPIDDLGKYPT
FT                   TVYPVSQFTPLFNRGYDESTERPAVLKLINSMCSPLNEWFFTAGYFNMLPDIKKALFSC
FT                   RAKAGTVITASPYANGFFESKGMSGSIPDAYLYLSKKFLKDVRKSGKSDTITLREWQRG
FT                   VVNKPNGWSYHAKGIWITDSTDDSDKGYPVGTIIGSSNYTRRAYSLDLESNAIIVTKDE
FT                   QLRENMQHELDNILKYTKPVNLEDFNNEAHRQVNTKVKVATAMLGKRL"
FT   CDS_pept        complement(457409..458314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351375"
FT                   /locus_tag="CAGL0B04763g"
FT                   /product="Similar to uniprot|P25587 Saccharomyces
FT                   cerevisiae YCL005w"
FT                   /protein_id="CAG58077.1"
FT                   /db_xref="HOGENOM:HBG124288"
FT                   /db_xref="UniParc:UPI00003B5FC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL8"
FT                   /transl_table=1
FT                   /translation="MFGALWYVKRAVYLVVSPVLMWLAWSLKLVYCAVWALCGPIVWFT
FT                   SMFVVTPVRIAVWNWLQLVTLPLNIFLRVTLGTTWFELLRNMDTWLNKFVIVTLLQYIV
FT                   SVLILGATIGVVYGLMLAMTHHFFKIPSVYIEIPLKFWRIPSVIIRTIRYYLNIAIQKI
FT                   KVGMRATHQDSFPTPPPTPKFSPYDKAIFLRDFYPGDTGSRPASMTFGNSSTLASPKAG
FT                   KRFKSASEIGLPDRVVHKSDTSQDTVAHESTSQSIRDSTDNVWDEFDSIPSLLDDTDRL
FT                   TTVTNRKQKQKEDVIQIHRM"
FT   CDS_pept        459394..460194
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503606"
FT                   /locus_tag="CAGL0B04785g"
FT                   /product="Similar to uniprot|P25554 Saccharomyces
FT                   cerevisiae YCL010c"
FT                   /protein_id="CAG58078.1"
FT                   /db_xref="HOGENOM:HBG057966"
FT                   /db_xref="HOGENOM:HBG397808"
FT                   /db_xref="InterPro:IPR010750"
FT                   /db_xref="UniParc:UPI00003B5FC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL7"
FT                   /transl_table=1
FT                   /translation="MDGQWDLVISSLQDIYNANEVTAFDEDMEMKKLNFENLELAQLDE
FT                   YFDKFQEHKENIRRAHRLLETVRTNLATVIENTEPSQSAAGTPGPNHSEEVTPGGSGAA
FT                   ANAVATGPLGKLYWISQFCSNEPIYLHSEVAYKPKKGNIDGEWFQCEVVKISSDGMRFE
FT                   VMDPEPDEQGKTGKVFKCSWKDLLLIPPETTPRSKIPNYPPGTQVLARYPETTTFYPAV
FT                   VIGNKRDGTCRLRFDGEEDAEKETEVPRRLVLPSPMISAFPTKK"
FT   CDS_pept        460721..461980
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047096"
FT                   /locus_tag="CAGL0B04807g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58079.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B5FCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL6"
FT                   /transl_table=1
FT                   /translation="MSDYPEYRSRSRSPSRRRLSVDDGMRAPRGGYGDAPRGRDRRYED
FT                   YRGDFRRGGYGGRRGSSRGRGFGGYRGYGAPPPRMGGRGFGRRGGYGHRPRGGPMMARE
FT                   MEPPYEEKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRHRGMGTV
FT                   EFTSPEGVDNAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMF
FT                   EVFIVNLPYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIER
FT                   FNGFDVDGRILQVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERS
FT                   TLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQ
FT                   RLNNYNYGGCDLDISYAKYL"
FT   CDS_pept        join(462676..462778,462918..463231)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047097"
FT                   /locus_tag="CAGL0B04829g"
FT                   /product="Similar to uniprot|Q8J0M4 Saccharomyces
FT                   cerevisiae YCL012c"
FT                   /protein_id="CAG58080.2"
FT                   /db_xref="HOGENOM:HBG124289"
FT                   /db_xref="HOGENOM:HBG398785"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="UniParc:UPI00017BD8A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL5"
FT                   /transl_table=1
FT                   /translation="MTTGLADYYIHIRIFWLVVIVTIVALIYRHRNKIGYKIRESVILI
FT                   RNRFGGHISLNNSFTDDLESGLASRHFDIISQNRHDDRGGLDAKAKDEIKAIMETEHLT
FT                   FDKARLLYTERKFGQNGIAPDGTPIDPKAVTFGS"
FT   CDS_pept        complement(463474..468096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503607"
FT                   /locus_tag="CAGL0B04851g"
FT                   /product="Similar to uniprot|P25558 Saccharomyces
FT                   cerevisiae YCL014w BUD3 budding protein "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58081.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG057969"
FT                   /db_xref="HOGENOM:HBG204096"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR021895"
FT                   /db_xref="UniParc:UPI00003B5FCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL4"
FT                   /transl_table=1
FT                   /translation="MVSEQSSNYSKESIEEKPILLHNNLAHISPDVQVSLTEMKDTLTI
FT                   FRGSDELIWGDFLVAIGMDNNTNFNSIMVNKFGATTFNNVNISKNSKYYPAIENLDPKY
FT                   KDSNARKCLAVTLLKIYPLFEKHITTVSDLPFEYDQTHAGELASTATLIPNVDPEVFLL
FT                   KLKNYGMLNDTSRVITSTMVDVVYENNEDVIDYNNQLVYYLGEQLEQLFNPVTEYSPEQ
FT                   TEYAYKAPDEEPSLFNSDTSLLKSVCNELLQLQTKFTYDLVEFLQEFLIILRVNVLNEE
FT                   IEGLSTLKLNRLFPPTIDEVTRINCIFLDSLKAAVPFGSFEVLKACNITIPYFYKAYTR
FT                   HEAATKNFSKDIKLFLENFGDVIPKKEEYTEMKMEALMKGPQEKLLKIKLIIERLWEST
FT                   PDWGNQEKEATSFYNNIIDIIDSFGKLESPLHSYTTRVFTPSGKILTELAKGWPIELQY
FT                   KWLKRRVVGVYDIIDSSDISKRKLLVIFSDYVVFLDIQNSESYYKNPNRPMLSDILTNS
FT                   LINEVPLPSKIPRMKVQKYSYIDDVQVTIVDGNILRFDCIREVDPFSISCRLKSKSTTE
FT                   KRIADLITKAKILEKDTAFHLFKAEVNGVTLYSTAHEYQAYQSERQKSKVALFLNLSPS
FT                   PSYITENSLYAGLFMKFEDTTRLDKIRITTVLYDGTKSNYVVRPEQMITFVVRQLSQLL
FT                   PNCYSSTRSPLATSLLNLQAQLISELVKPKIAASSKSNDSAKLMDMNNFIAEKADKSDK
FT                   YDAKHEKKRSYGTITTFRSYKSDLKDVESSGEIYSREHNTSTKISKNNVQKISKNVRTK
FT                   VTESPGRKQRVSKTQADKSKKTSGLSNFFKSIFKGSGKKTKRPTNEKIQLKRIGSNKNI
FT                   SHVHISSKPRNKAVIKDTTNTAELEEPLISRAVTSVEISAEKVDRKDEDERVLSVVHNK
FT                   QFEETKANSEAPADNERMGQDIHHDAGNTSDLLIKEIADEVVEQKEFLEQLSKNMSIQK
FT                   ENKTVQPQVTQKPTSIKNQASALYLYDNDLFGDFKQKPNDHDNISVSLENELTAEGSEN
FT                   EDEDPKKVSHQYQEETIEYQENEPKNDEPDNPSKEADEQADSKENVELLPTKSEVSAGK
FT                   PLVFPTIQKVVKKPQQIQRSDSFYELYKGMRMVLDDTDVKYNWKRLPSLVSLSVQNAVN
FT                   SDKSKHAFEKIAHARETPSLVENLMEKKELPMQATETQVREARKLKNAAVIKPVENNFK
FT                   PVSDTLKSPFKAYPELTKSTEYVNNDSINIFSELEKAFEVPQAKVSVPTFKVVRTSPTR
FT                   YVQLESGSIRTDRMVPSPELSQSLSYSSFVEELQNKKPQRLVEIADSITDMQSNLTKDD
FT                   ETIASSNAPSHVSSEFEQQKDISQQSDSSLEEEHYSAKKPLSQEINSSGILESLEFSSF
FT                   TMGFEDTIDVVNSSHIPSGDLLPETGSRNMVLTRPKRNDAHPVYLLPRYSISTTKSLNQ
FT                   TRERMQYDEDAIWVSPTKLSFSEKDSSIRLVKEGTTPTKTLTHQGNKTKVDIPREESSF
FT                   GYLSSLLAVDSNNNNILEFV"
FT   CDS_pept        468917..470005
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503608"
FT                   /locus_tag="CAGL0B04873g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /protein_id="CAG58082.1"
FT                   /db_xref="HOGENOM:HBG057970"
FT                   /db_xref="HOGENOM:HBG204095"
FT                   /db_xref="InterPro:IPR019128"
FT                   /db_xref="UniParc:UPI00003B5FCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL3"
FT                   /transl_table=1
FT                   /translation="MVMKLYSKLQHDTSYKVVQLDDTILAAVKNGEPLQFKSMDETQSE
FT                   VVLCSSNATWRLKQKNHSNCVMVMKRDTSSNLEDESEFCSLNDTTYEYELTKVPGSLNY
FT                   HLIPLYDGEELSFKTTFKELLANSQCSNEEAMCEWHDIGGCILESGNICKLSDKFITRA
FT                   LDITLVSIMADSLDMSHLDLDEVLKSVRKDSETVKDNPFTKPVIETILNKFGTQEKDHK
FT                   WHIDKKRITYWYGLETLKKFAMGISKEQQYPLNQEEFLIKWKSQMPPYFPNSDLDIREL
FT                   RGHYYLDRHTDEIHYIDKKSLPGDIKQRLVYLFKLQSQWNPDEMAPLMQDLNQKNTKFE
FT                   SFIIKYARIKRLSSKQKVVIQR"
FT   CDS_pept        475072..476955
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447785"
FT                   /locus_tag="CAGL0B04895g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG58083.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124290"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B5FCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL2"
FT                   /transl_table=1
FT                   /translation="MFQFTPSSTPHSGSFYSVTQNHVRQNNANVNHINYNNSNFHPITN
FT                   SNANTNTAPRSFNSYLGIPTLLNSGTNLLTDYHSQHLLKTSIRNIRNRDSKSYATPKSI
FT                   ALSLKDLPLEHYAKIVHETEKRSEELDPTLHSKSVIQATEHSREREKQVFALIWLLQNC
FT                   SNSDPNSFVPRGLIFEQYSIACRQFDLKPLSQATLGKLIRTIFSNLKTRRLGMRGQSKY
FT                   HYCGLRLLKIVTPAQQENNIIETKSLIGNSLDSESGELSVANNKLSTKLVCSSNVDDPL
FT                   NAVKEKNINISKIRKLRQACLLYCDNSFVNEENSILLYETAFPAIFDIISADVFDKEET
FT                   KLLERFEPLYKNYCNLFINNFRLMKIENLVVIYQMTDLCRDYHFDINTFLNLLTNNSSV
FT                   KRWTNIVDTIMFTNILKWIMKFFRLNGLDAEKNEELKIFCVFYEKLKTHFFSCEKNDDL
FT                   IISHKQMIFSNFFMITDTILRKFKFLSYVQENLGYHQTEMQQDWNQCIDLKTVIPFIEP
FT                   QSILDPTFKSALLNRLERQVKFIVDPKFSLSSLISSLGQTVHTSMKEYYGNPEVLKAIQ
FT                   HLVHSYFDVISGDLCLKCPRNLQLWTALIQVITLSIKICNQMNYMVHENCK"
FT   CDS_pept        complement(477939..479174)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447786"
FT                   /locus_tag="CAGL0B04917g"
FT                   /product="Isocitrate dehydrogenase "
FT                   /EC_number="1.1.1.42"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="isocitrate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG58084.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006102"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG020077"
FT                   /db_xref="HOGENOM:HBG596047"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI00003B5FCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL1"
FT                   /transl_table=1
FT                   /translation="MSKVKVVNPIVEMDGDEQTRIIWHLIREKLILPFLDVDLKYYDLS
FT                   IEYRDETNDKVTEDSALATLKYGVAVKCATITPDEARVEEFNLKEMWKSPNGTIRNILG
FT                   GTVFREPIVIPRIPKLVPQWKEPIIIGRHAFGDQYRATDVVIPDEGEVRLVYKSKDGKT
FT                   DIDIPVYNFPKEGGVAMMMYNTTESIRGFARASFNMALEHEMPLYSTTKNTILKKYDGK
FT                   FKDTFESMYEAEYKEQFEAKGIWYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVESDIV
FT                   AQGFGSLGLMTSVLISPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGI
FT                   IQRGKLDETADVVKFGELLERATVDTVQEDGIMTKDLALILGKTDRSAYVTTEEFIDAV
FT                   ENRIKSEFQKNF"
FT   CDS_pept        complement(480761..482563)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447787"
FT                   /locus_tag="CAGL0B04939g"
FT                   /product="Similar to uniprot|Q06247 Saccharomyces
FT                   cerevisiae YLR173w"
FT                   /protein_id="CAG58085.1"
FT                   /db_xref="HOGENOM:HBG124292"
FT                   /db_xref="UniParc:UPI00003B5FD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXL0"
FT                   /transl_table=1
FT                   /translation="METQSLLPNERPNGYSYTGDELPSDGQENGIEPTVMVQRKKQWYL
FT                   NWKVLLSLFILVNLVIVSLVVVSWIPDTDEMQDKFGRITNGKLESFHIDGWLDEDNGGL
FT                   NTEYGKELQISTSMKVWFDYDLLEDVEERKKFKRLSEGIIKSFCFNVQNISTYDSSTFL
FT                   GSLRIVEPICLDLKDGYVNTINVTVLVKPKMIKIVGVLKKLWRHEYDNLNIRSHLDINV
FT                   HKYLIPGMHFKDIRVKWDDFIDWDKIAISVKELHDLLQRSNLGLKTINVKEQTNGFHVR
FT                   LVPKVTDLVNDISRFLRHRLFFNQAFVIPALKLDVKVPDCLELFSIGLSNAYIRTEEFR
FT                   FDPRVDLEDSQEPIELQCELEAPLPEQFITQECWSFNGHRITPLTKMLNKLLNSKDKVG
FT                   VGISADVLDQKHDKNQMMSQLLVAVGYVPVYGHISVNSSTLLQECVLEDISLKWQDGRL
FT                   KFVGSIHEQVNLSFYEPMLYKNDDSDDRNSTDAITVTGIKGKIKLYHEGVHFLNVPMEE
FT                   WIPVNSVIERDDCGTPQLVVDVDVGSDNVEVLNKWELSKVFNEMVFQGETQVEYRNALD
FT                   VQVTTLLGGFDVLGLEWTGETTVT"
FT   CDS_pept        482911..483807
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047098"
FT                   /gene_name="DPH5"
FT                   /locus_tag="CAGL0B04961g"
FT                   /product="Diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /function="diphthine synthase activity"
FT                   /biological_process="peptidyl-diphthamide biosynthetic
FT                   process from peptidyl-histidine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58086.1"
FT                   /db_xref="GO:0004164"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017183"
FT                   /db_xref="HOGENOM:HBG023668"
FT                   /db_xref="HOGENOM:HBG460511"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniParc:UPI00003B5FD1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FXK9"
FT                   /transl_table=1
FT                   /translation="MLYLIGLGLSYKSDITVRGLEAVKNCTRVYLEHYTSILMAASKEE
FT                   LEEFYGKEVILADRELVESGSADILRDADKENVAFLVVGDPFGATTHTDLVLRAKKDKI
FT                   PVEVIHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKVMENRKIGLHTLVL
FT                   LDIKVKEQSLENMARGRLIYEPPRYMSIAQCCQQLLEIEELRAEKAYTADTPVVGISRL
FT                   GSPTQSFKAGTIKELAEYDAGEPLHSLVILGRQSHELELEYLLEFTDNKEKFKNDVIAD
FT                   QEYFKPAPWVPPVEEED"
FT   CDS_pept        484166..484636
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503609"
FT                   /locus_tag="CAGL0B04983g"
FT                   /product="Strain CBS138 chromosome B complete sequence "
FT                   /function="protein transporter activity"
FT                   /protein_id="CAG58087.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR015604"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00003B5FD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK8"
FT                   /transl_table=1
FT                   /translation="MTHLKYLLLVSRQGKVRLSKWYAPLSTKEKAKIIKDLTPTILARK
FT                   PKMCNILEYSDHKVVFRRYASLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCEL
FT                   DIIFNFHKAYDILDELVMCDGAIAESSKKEVLHHIAVMDQLEGNDTLERVLS"
FT   tRNA            complement(485047..485118)
FT                   /gene_name="tRNA-Pro (AGG)"
FT   tRNA            486877..486950
FT                   /gene_name="tRNA-Asn (GTT)"
FT   CDS_pept        487186..491598
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447788"
FT                   /locus_tag="CAGL0B05049g"
FT                   /product="Similarities with uniprot|Q06554 Saccharomyces
FT                   cerevisiae YLR247c"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58088.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057960"
FT                   /db_xref="HOGENOM:HBG202509"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B5FD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FXK7"
FT                   /transl_table=1
FT                   /translation="MHTDSVNCRIVGFSEVEYGTAITEREKASSWLKNKRLIHVGILTL
FT                   TILRPTEGYPSDLKEMNVSILPIQTESEDKKMSMFRLKLYNQKGILLFSLEPETETSTI
FT                   NHYFRILNEKYIDQKVILNNEKLRSEAGIKQKRKKRKIAFGLIQPTRNYKDILVTKQAL
FT                   TFNQNSKVWQIHVSFSVIANQDKRNKFTADVNALLQDISTSLIPASNELYLPKMTSNYV
FT                   QSHFNQYIISCTNERLKNLRANRQYTAVDSVINGKLFPFQKDSLLWLLEKEHYFDCNVS
FT                   KTTTSDQKHEDSVSELLYFLNHSVSFGYSTIKDLVSKQFYFWNKYTGYILSQEEVRSLK
FT                   SSFNEYEVGAKGVLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTT
FT                   LIVCPGSILKQWIDEMQSTHPAIKIYHYGGFIAVKKEFACDNINTIVQKLSQYDIVITS
FT                   YNVVSNEVHYAQFNNAFRQNRRRHVQYDYSSPLSLMQFYRIILDELQMLHSGSTKAAIC
FT                   TSLLHRVHTWGVSGTPIQKVRDFQTILSYLKIHPFSEFPELIKNLDNASVGLTEMYSAE
FT                   NGCPINEIEVIKNGINTNLSDLFYIFKQYDIAIRHSKANVSSQIKIPKQHLLLIPLKFT
FT                   PIEWESYLEVWKSFLEDSGFNPDGTNSTHLTNQQLNQWLHKLRYICCHAVLPHSASINN
FT                   ITTANEIHTLNDILKKMKAEAEDKVESLYREQFQLLIRSAQFDIEEQGRYNFAIDCLLS
FT                   LEKNIFDRLKPLTKSSNDILNFLEYLDIADSHASSKSCRHLLELLHQCYFFIATAYYYL
FT                   GSYQIECKQDAGIPIRQDDLCNDETLKNHFSPDEIKSIAYHKNLEDEYYSRAENIRRSI
FT                   LKGRIAKFEQELDEVQKSHFPTKAIMLIKFEELPNCSISLSTNKCYSKLLDLFSKLDEQ
FT                   AIQSNRQINLLYDLLSMPIIKEYDSDTPEKTHEYASSIEDQDKIYALFDCLEKLISNRE
FT                   EIVRAEEEVTPPKISLSLYENLSTYHTELLKDQILISGTPFKTIFDDLENVRIVHRISK
FT                   KQSNDKSFEASLLSYKKCLKKIRKENAQLRSYLQALNTVYNAKVDYYAYLQRISDSVVP
FT                   LSQLDSTTLSSLRKFISNVNKKQELQRKIVSTESRVKYLHNLSTLTYEAQKNTTMECSI
FT                   CLQPITNGAMVNCGHLFCTSCIFSWLKNRKTCPLCKHPTSNCEVYNFTFKLESGSSRKT
FT                   KCDNKTRHHRYPNMQNFENTLDSLFLTKYERFKQSKTTADIIIKESYGSKIDFIIKLVL
FT                   FLLHQSEIEDATRPQILMYSQSFDFMKVVSQVLSLHNINNICCLQNNRNVGDMIARFKK
FT                   TSDITCLLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNF
FT                   MLENTVEESIMRYKCVLENQNRHKREERSMPMYEQSEQLDVTDSEVCISDFSNEVVSEQ
FT                   HIRNCLFLK"
XX
SQ   Sequence 502101 BP; 152647 A; 98507 C; 96853 G; 154094 T; 0 other;
     cattcagaac aattcacact tatagctact gttcgataat acatgcctca tgccaatcag        60
     ctgtcctcag ttgcacggag atcaggttag gttatctata tgaaatatgc cgtgtagttt       120
     actttactca tataatacag actcaatgca tgcaatctcc gtagaataat gtacaatgtt       180
     tggattgaaa ttcacatcaa aatccttgag caaaacaata tactatgtct ggaatcacaa       240
     ctctcaatcc atcgacaatg tactatcgaa ttcaaataag aaactttctc atatccacat       300
     atggatagta tcacgacctg taaattcatt gtacaagtct tcctacacta ttattggttt       360
     tgtatcatgc catgtgtgtg taagagagaa taacagtcat agttcataca ctgtaaacta       420
     aatatttcct ctctcttcga ctcgatttaa caattttgtt aagttttgaa tgattcaata       480
     ttgaacaaca gcacattact gtggacttcg aagctgtatc aattgcttga taaagccaac       540
     tataaataca acctttatgg tgtcaggttt tattgaatat agtttgtcaa gttgccccag       600
     cgataatgaa ctaatttgtt tgtatataat ggccatccta atgaatttcc gcatactatg       660
     aggtagttga acaacaagat cggcatccat cactgggatg tatggttgta tattttattg       720
     tgactggttt gtttagagta acttgaataa atatgatgaa tcaatttgac caccgaacct       780
     cgatagagtc ctattattaa tcaaaataat tgtttcaaaa acatatcttt tagtatgggg       840
     attattaatt atacacctat aaatacactt ctaaatatta aagtattgat atgggtgagg       900
     caagaaggtg tattagataa attacatttt ttggtaacgt caatgaaact gtaagtatca       960
     cccagttttt cttgataact attgggtact tcaacaccca cgagaaatgc caacatgttt      1020
     aaaaatattc cttctcgtac aattatacat actcggactc acatgattac cgtcactgct      1080
     cacatctcgc gtttttcgca acttggtcag ttttcattta aacagaggcc tatgttcggc      1140
     agcagtgttc cagaaacaca tgaaaaacat tctatcaaag agaaaatatt tactattata      1200
     acaaatacat aaatataaaa actccttaaa aaatatattc aaattcgaac tggattacaa      1260
     taaacccagc agtgtaaatg aatgttgctg cataacgaac tagataatta ggggatctct      1320
     ccaactttat atgaccttaa gactataata gcattgccat tgctttcccc caatagtagt      1380
     gtgattaatt aataaaacaa acatcatgta aagttatatc catgattcaa cgaacgtgca      1440
     tttagcacaa ttattatctt aattcagata atagtcggct taagccatgc ctaacagaat      1500
     caagatagtc aatgatgtgg atagtagaat ggtattaaat ttgatcttga atgtagaacc      1560
     tgcaccatgg aagatggagg cagtttgggt ctgggacacc ttattgccac tttcaacagc      1620
     agaagctcct gtaggagcaa acatctccaa agagctacct tggtctgtcg aatgaccggc      1680
     attagatgtg gtgccttgac ttagagcaac ttctgtaaca atagttgggt taggcttgtc      1740
     attgacagtc ttagcactaa caccgttttc agaaccaaca agtgaggtgg tatgcatgct      1800
     tggtgaagtt gtttggctct caacgtggga ttccgaatta gagcatggag cagtagtgtt      1860
     atagtagttg gcttgccgtt ggagtcggtg gtggtgatgt gggacacaac ttcggtctca      1920
     acactgccgt tggacttcgt gacaactgtg gtgtagtctg cgttgcttga gcatacagtg      1980
     catggaacag tggtgacgat tgtggtaggc ttaccgttgg agtcggtggt ggtgatgtgg      2040
     gaaacaactt cggtctcaac actgccgttg gacttcgtga caactgcggt gtaatcttca      2100
     ttaccattgt gttcagtaca tggagcagtg gtagttatgg ttatagtttg gccgttggag      2160
     tcggtggtgg tgatgtggga cacaacttcg gtctcaacac tgccgttgga cttcgtgaca      2220
     actgtggtgt agtctgcgtt gcttgagcat acagtgcatg gaacagtggt gacgatcgtg      2280
     gtaggcttgc ctgcggcgtc tgtgatgatg atgtgggaca caacttcggt ctcaacactg      2340
     ccgttggact tcgtgacaac tgtggtgtag tctgcgttgc ttgagcatac agtgcatgga      2400
     acagtggtga cgatcgtggt aggattgccg tcggagtcgg tggtggtgat gtgggagact      2460
     aatgtcggtc tggacagagc ccgtcgcgag ttggtcacga cagtggtgta gtcaccatca      2520
     ccattgtctg cagtcatcga tgaaggtggt gacgatggtg gtaggattgg ccgtcggagt      2580
     cggtggtggt gatgtgggag acaatgtcgg tctggacaga gccgtccgcg ttggtcacga      2640
     cagtggtgta gtcagcaccc gctggcagct gggtgctggg aaggtggtga cgattgtggt      2700
     ttgattgatg ctggatgcaa gcttggtgat gtgggagaca atttggttgt gtgatgttct      2760
     ggtaaggctc gttataggtg ttgtaagatt ggagtcaaca gaattataaa acgttgaggt      2820
     gatggggacc attatgttgc ttgagtttgt tacgtttatg gccgaggcat tattaaattc      2880
     ataattattt tgatatgtgc tcattgtagc agttactatg ctatttggtc cacttgaaga      2940
     gacattcgca acagtatcta tgagagtagt tgttttatcg accgtagaca cactatatct      3000
     accactactt gatataggag agtaattaga aaaactaaaa gtgtagtttc tcgacattag      3060
     tgttgttttg gtgctcctac tattattttc tgtaatagta atcgtttctc taattacccc      3120
     ggtttccatt tcaccaacag tcattgtggt gtaataagtg aatggtagcc cattatagcc      3180
     gatacccgtt actctactaa taatttctgt ctcagttgta ctttcattga ccttggttaa      3240
     ggtatagaca gctggaggta catatattgt agtattacca ataactggta tatcattttt      3300
     atttatatgt agaataaaat gacacggtct ctgaaaatcc gcagttcatt gggttggttg      3360
     tataatggat cgggaaccgt gaaatgaata caatgggtat ctctgacaca tggttgacaa      3420
     acagatggag ctaaatttgg tggcggtcca gtatatctca caaagttata attattataa      3480
     tttacatctt gaatcttgat ggaacgaact atttcgaagt tagactcatt gtaaccaaca      3540
     ccgataaaga ctgtgaactt ctgtaagcct gcaaagacct gttgaaaatg ttgctacacc      3600
     actcaaggaa tcataagtta cttttttaat gggaaagtga ggatatagga atccatttcc      3660
     atttcctagg cctatataca gtaacagctt tgtccgttac ttaatgcgac aacagaggaa      3720
     gaatcagaca aataaatagt ttgttgacga atatcaaagt tataaatatt aaaaagcgag      3780
     ttttcaccaa tagaaataca tcctccacct tgaattgtat tttgtaaaag aaaggtagtg      3840
     ttggctaagc atactgtaca ggtgtttatc cagttattac cattgctaat ttctaacttt      3900
     tgtggatgat cggcatcgaa taccttttga atataggaag cctgtgtttg ttattggatt      3960
     ggaataaata cctattgtat caccaaacct tgatgtaaac atcattcttc gctgtattag      4020
     taaatctacc gtcattaact gtccatgaac caggagatga actttgcctg tcgtcaacaa      4080
     cgactgtacc ttcattacga aactcaaatg gaacagtgta agcgtgacca gatgagatag      4140
     aaaaacctct ttcgtcattg ttaacataat aaagagcacc tcctttgtcg actctaacaa      4200
     tctggtacat aggaacactg ttcgtatctt ggaatgctaa ataggcacct cctagaataa      4260
     cgtaaccatt ttcatatcca ctcggattat ttccgtatac aattgtatca ttaccaataa      4320
     cagtttgagc agaaacattt atactaatag agaaaattgc cattagcatc aacttcaatt      4380
     tcgataatgt taattttttc ttcatcatat aagtagcaca gacaagttat ctcgattatc      4440
     tttttatgtg taaaattgct atatttgaaa gctgtttttt tttaaatgtt ccttaacagt      4500
     tttatttgct tttcttaatt ttcagaatag gcagctaaga aataaatcta attctcaatg      4560
     tttaagtact agttctgcca tgtgatatta aatataattc tatttgcacg tttgttggag      4620
     caatatagaa acaatctttc aatagcagat gttacttaga tcattggtat agtatgccag      4680
     catcaataca gactaaagaa ttaaactaat ggtgtggagc tagagagatt tttttactgt      4740
     ttttatgatc ttttaaggaa attagtatcc tttattctgg tggtctttca tgataactcc      4800
     tgcggttttt caaaacttaa gtaagtgcta gaaattagat acaaaaataa ggccagaact      4860
     tctgttcact attgttttta taaaagcatt tgtatctctc ttcaaacatt ttctaggctt      4920
     aaacaataat tttactgaat gccactctag ctcctagtga agataaatgt cgcttgtagg      4980
     caatgcatag atattgagaa attaagaaag ttaattattt ggcgatatca gcagaggggt      5040
     tcataaattt ctggtttatt aacatagttg cagtactggt tattattgat tattgtcagt      5100
     taggtttgcg acattactat ttagggtaat aaaactgttg tgagaaattt tttatttccc      5160
     tttattctat aatacattcg aattgtaata atcggtattt ctatttatta agtgttttta      5220
     ttgtttattg agttggtatt attaatgtct ttattttact aagcttaact gaactaataa      5280
     aaaacacaaa aatatgtgca aaagacaaaa aattccaata aattaattct tattgttaca      5340
     tgattgtggt acgctatagc cacgatttta ttggaagtat tatgataatg acacaatttt      5400
     gacgatttaa tgatggactt tatattacac tattgatgac agtatctata ctttaataga      5460
     ttgtacaata atttaacaaa atttctgttt tctttacaag gtagatatct cacaaactat      5520
     aataggtaga tagggctgtt atgtagctat tgtattactt aaaaattaat ttctcactgg      5580
     aattgtttta tctcattaaa gcctggtaaa ctatttactt ctgagcccag tctatactaa      5640
     tctataataa ctagtttatt actttacttt attgttgctt taatttgaat tcaaaatctc      5700
     tatcaaataa tccaaatatt tttacattca ttgatgttat tggtgtttct gttgttcttg      5760
     gtagttaaca gtgctactaa gataataaaa atttagacta gtttgtcttg aattagagca      5820
     agttttcgta caatattgat ctaggctttt attaaccaat ttaattcttg aatgaatgaa      5880
     attattcttt ttagtgatca agttactaat gtgtgtttta aaaccacagg ccttagctat      5940
     cagtaattaa cagcgttcag ttctatgata ataatgaaat cgaaattacc gtaacctgtc      6000
     aaaatatata tgaaatacta cataggtgtt atgttaacgt cattgaaatg gtagtgcaaa      6060
     cccatttccg agaccaaaac ccgtaagagt tatcttaatg tctggtatga atatcatgaa      6120
     ctttaaaaat gtgtaggtag taaaggcaaa aaaaaacagg gtaaatacag cactatactg      6180
     gagtgagaca ttatttttta aaaaacacgc aaacttaatc gttttgaaaa atcagggaat      6240
     atatttttgc tctaaatatt ggttcatatt gtcgatatac atattattat gtatcatatt      6300
     agtaacaatt gacgagcgat ggagtaaagt cctctatttg caacagtaac aatatctcaa      6360
     cgatatgttc aaaaatagaa aacattaccc ataaaatgaa aaaaggaaaa aaaatgtgtg      6420
     ataccttaaa aattgaactt acttttctac attttaaatt tatttgatct tatctatgtg      6480
     gtactataga taatgtattt atcctgatcc tgcctttgac ttgattaggc caattcgctg      6540
     ctgactaata atctatatgt gccaactttt aaaataacaa tttaatgcaa ttaaagataa      6600
     ttatttgttt cttttttatt tatatattgt atagtgatgt taatataatt ggaatcttca      6660
     atgaaatgca agacactcaa gtaaaataat ataacttgaa attgtgatat gaaatgttga      6720
     taaaaagtgc acatagaata ttataaataa aatcagaggg aggtaataca tacagaatat      6780
     aagtttatgt acatgtattg ctttttctac aaaattatta tggggaaatt aaatgatatc      6840
     agccttaaca gaaatgaatg caaaaataag accttatttt gctatatatt cctcattcca      6900
     ttaataactt tcatggtctt gctgataaaa gtagccaacg gtttatattt taccaaggtc      6960
     tatatgtaag gtatatatca cattataaat tttagtatag ccagttagta acaaaacatg      7020
     taccgaacta gacctgaggt atctttaggt tctgcctatc tatctacagt agcacaaact      7080
     tgttcctgat atattttgtc aattaataaa taaaacttga tttgataaaa acaggtagaa      7140
     tactttgatc acgataggta gctctcatat aacttttcaa acaattttgt aaatgattaa      7200
     tgtttttaat tatgttaaga gaaattacga tcaaaatttt gaattaaatg aagtggcagg      7260
     tatatctatg tagttgaatt tgtcagttgg caatatttat ttagctaatt aaaaaatatg      7320
     gtcacagttg atatgatatg agttaataag gtcaacgaat taataaaaag tatctgataa      7380
     ttattcttcc tcaattcaca tagttctctt caatggcatc gtaattatct tatatgtaga      7440
     aactgtttaa tatttgcttt tttatgtttc ggtgttttca aattcggaac catctcagta      7500
     cttctgtatt ttgcggtaat ttctgatttt ttttttcctt caaaatcacc tcgaaagtca      7560
     cttttgtcag caaaaatatt cttcaacaat tcaaatatac tgaaaaagga aatgaaaaat      7620
     cattttttca tctcagatcg tgtgagtatt tattttgaga tgacgtcaca atttttttaa      7680
     aaacaagcat ttgcacactg ctttttatta tttatgtctt tttggtcata acattactca      7740
     taatattgtt caagtagtag ttaaaaggtt agcaattctt tcaaacatat aacaatttgg      7800
     ctatgggttt catacgcaag cttagggagc aagtaaataa tgtccactca tgacttgcca      7860
     ttagattgga ctacggctta gtcgtgtgta ccatatcaat acagttgctt agaaaggaat      7920
     gtactttttt cagaagtcaa ctcaaacatg tggaaatgct tacattttag ttagtaatta      7980
     ctgcaagggt gaacacaata taaagcatta ctctctcact ttcagtacgt aattacttag      8040
     tccagctatt aactattgag tagttccaca tcacttgata gtacatctat cttacgcttt      8100
     acctttaaat tttataacaa ttaatatcaa tattacttat ttttatataa gttcagaaac      8160
     acagctacaa acaaattatt attagaatgg aaaggtctag gagaacaatc cagaatatcg      8220
     tttgaaattt agcaatcaat gaaatccaga acagacaagt tggcaaagtt attggtttgt      8280
     tttattctag ttctcgatta gtgttattca gcagtcgttc aagtgctttc tctatcattt      8340
     ttagagaact aatgagaatt tagtggtttt ttcttagaag tatatgactt ttgagcttaa      8400
     gcagatcgat tatgataggt ggctcattga gtatcaagaa attatgataa ataatacttt      8460
     gaaaagatat atcttagtaa tatcctttag tgcgtctaca taaattcttg atttaaataa      8520
     aataggcatt cgcttaatgg tgaaccaaaa gtgatatgga ttatgaaagt gaaatcttta      8580
     tattttgttt aactcttagc caagtaaaat gtttccctat caaatagttt agttcaagca      8640
     ctatatccaa tgtatgtatt agcttttgaa taagtcaact agtgtaggaa aagaactaaa      8700
     ccaaacttga ctatttgttt cgtcgatcgt tatgtttaaa gtcttccaat ataaaaaaaa      8760
     atggttgcta agagattcga actcttgcat cttacgatac ctgagtgctc ctgagtttgt      8820
     taacccagta agtatttttc aacttgaatc aggcgcctta gaccgctcgg ccaaacaacc      8880
     acttaattta tattttcttg ggcttggttg cattaatata ttgtacgtat atagatcatg      8940
     tgagctagtt agaattggaa gctacctatc atgaagagta agatctacag gtctccacga      9000
     caatattccc atgaatacta aattcaatga cgctagatca tttattctta ataattcaac      9060
     aagatccaaa ctatttgggt ttacatatat aacttaacta acatcgatta attcttcaag      9120
     ataggatttt ttttatatat ctttgttgta tttaccaatg cttgtattac gaagagtcca      9180
     tgagtttttt cctttgtata ttttgttcta agataagtaa ataatatata gatgtttttg      9240
     gtatttgcaa ttcctaatca gtaagtgcag tcactatcga tgttcttata aatgtcctca      9300
     tgataataag cttttaaagt actcacagac taaaatgagt aaggccatct ataaataatg      9360
     aactcatagt ttgtctaaca ttacagaatg ggaccatgat ttgaataaaa accttatcaa      9420
     ttgttataaa aatttgaaca atggtgaagt taaaagcttt atgaatgcct tatacagttt      9480
     acagataggc aaaaaaatta aatgttatgc cttcctaata tttatacact ttgaatttca      9540
     gtaatcacta ttgttattaa actttactgc acagtttctc atcttattga tttttccaat      9600
     gcagtaaatt actcacgaat ttgaaagcta taaaacatgt tgctacctaa tagtaaagcg      9660
     ttctctgaat tgtcacattg ataaaacaaa taatattata ggaactactt gattgcgcaa      9720
     attgaagttc ctgacgctcc aactagttga atatttcaac tagtagaata ctgaaaggga      9780
     gcaattgaca tttctagttt aatcttttaa aagtaaatgt aaaagctata actgtaagaa      9840
     atctatgtgt ttcatattgt tagcttaagg tatgcgcacg catagagcca agataattcc      9900
     ttatttgtga ttgtaaatat taatcaataa tgctttctct agtatttttt tgtttaagct      9960
     gtagtggcga aaataagcca gtttcgaagc ttgatgaaat ggcaaacgta catattatag     10020
     tgctttgcct gatatgacat aatgatgtct agcaaaaaat gttaaatgat gatatccatt     10080
     ataagacaga gagatttgaa tatatatatt gtgtttctta tattttgtta attactgtca     10140
     atctcatctt ttacattcct acgaatacta agaatattga tccactccaa atggtagtct     10200
     tttcgtatca tgtgattttc tatatctgac gctgttgcaa ttgtagagta attaatgtga     10260
     gcactttgga ccttcaaaat aagcaggaat atagtttctt aatggtagtt gttaattttg     10320
     cagtcaaagc gtaagtattt tattattcag cagatgaagg tgcaattttt ttctttaatt     10380
     aaaaatgtta gtatatcaaa ctctttcttt tgacgctgag gtgatgaggc cgcaggagta     10440
     ccttggggat aagcaatcag tatgtgtatt tgtgggggcg atggcgagag gccacgactc     10500
     ctttgctgat gaatatgtag atgacaaaat agctatatct aactacccgc tctccgcctc     10560
     cgtcgcctgc tccaagttct gtcatggcgc tgaggacgca tgggccatta tataatttac     10620
     aaacccacac cgaggactcg caaaattaaa ctgctgcgcg aatatgtccc aaatattttg     10680
     atccgtttct ggggcgttcc aagcttctga gagaatgacg gagagtgtat tttgtttgag     10740
     gccggtgcct aattgggcat agtatgtacg aaatgccata aaagcgttca taggtctttt     10800
     cttactgctg gatttcgatt ttaaaacatt tccgatggaa gtattgaagt gatgagatat     10860
     gaacttatct atctcccatg atgtttcaat atcgatgata ttgatacctg actcaaatga     10920
     gctcgtcagt ttcatccttt cttctctaat tcgctttagt aacacagggt gagggggtgg     10980
     gatctgaaac ttgttcggtt tagttaacag catgttaaga ccaaaggagc tctttgtgga     11040
     actacagccc agaaaatcgg agtgtttttc aggatatttt tggcttctga gtcttttatt     11100
     tgttctaacc ctgaattttg tggcagtata cttcatagtc agtgtttcag ttaacattag     11160
     tagagtgact tcagatattg tacaactgac ataaaggaat ggttaatttc tgctcattaa     11220
     tcatgttaac atggcaattt tttgggtttc ttttatatta attctcttgg atatgagact     11280
     tgtgtaagat taatatagta tttacagtat tttaccatat taggtaaata tgatagacag     11340
     ggagtgtagt tttattaaaa ttgcaatttt taggcggttg aacctcaata aatttatata     11400
     aaaggaacgg aatgaaattc agtctgaact agtgaatata tatgtggttt aaaaatacca     11460
     aagtacatta tgtcaaagaa atcaagaatt agtattacgc atctacttaa tccaatacaa     11520
     gaagaaaatt taaaggaaaa attgcaagag attaataacc aacttatatc attgtgttcc     11580
     agtttaccca aaagacagtc gctcccgggg ccgtcgtccg atatcctaag gttcctatcg     11640
     agaaacaact tggacccaca agagataggg ttgatcaaga caacctatcg actgtctact     11700
     cttctgtcaa aactacggga gcatgagatc gtattcaatg tggttaccaa agaccatctg     11760
     cttaaaaaag gcgtccccaa tcactatgcc gcttcctatc gaggccaccg cttcacaagg     11820
     gaaaacgtac agatactaga gacctggtac cgcaaccata tcgacaaccc atacctcgac     11880
     cacaacagcc agcaatatct agcacagaag acaaacctat caaaaataca gatcaaaaac     11940
     tgggtagcaa acagaagaag aaaacaaaag tcaatttaca tctcactatt tgatatccat     12000
     aacatagaga gtggagagta tgcgtacata gagaaggtat gttatattat tattattata     12060
     tgtcatttat tcctggtctt ttctttgagt tgtcttacat aaaaaaaata tgagaacgat     12120
     ttttctcgct attattatat aacggtcggt ggtctgacta tggtaggtgg atttaaacac     12180
     ctaaagaaat tttaaacttc agtatttttt ttgagctaaa gttttaataa tgctgttgct     12240
     ctattgatat attaaagctt ttgaattata tatatgcttg gtatttttta tttatatata     12300
     gcatcttgac attaaatgtt ctattttctt ttgcaataaa tgtgtttcac gttagtgttc     12360
     aactgttaga atatttaata ttttctttac aagttcaatt ggacagaaca atttcggtgt     12420
     tttctactac gaagtgatca atatgtataa taatagcgag tcaaatattt ctttggtgtt     12480
     ccctcaaaac tactcaatac ctgaattgat atgaagtgag tgccaagaac caaaacaaaa     12540
     caatattatc cccgtgggac aagatttttg ttcaagtgtt tgaaaattaa tgttatggta     12600
     atgaagtctc gcattggtaa aagcaatgcg tgttagaatg gattaaaaga gtcactatat     12660
     aatttttcgt aacatcattg attctatagg ccataacgaa atggttttta tgatactgat     12720
     ctagagaata gctagtgatt gaggaaactt actaaagata aaataaatta caatgacatc     12780
     caatagtata aattgtttca agttaagcta ggacagacac ctcaggcatt ctgacaataa     12840
     tattttctgc aacatttggg atattgatgt tattctcctc ggtggacagt ctttgtagta     12900
     tcgattccat atcttcgaca gtgttcgatg aacctccaca ggccactact agtacaatgt     12960
     catccgcatt tagttttgtg ccgagttctt tttctaagat ctcggtgtga taagccaaat     13020
     ggacggcagc gccacatgct ggttcaatta ccatgttaaa gtcatgagtg tatcttaggc     13080
     atgtcttgac aacgtcctga tcacttaaaa ccacagactt cgtaccatat cttttggcgt     13140
     atttaaaggc ctctgtagat atgtcggcag tacctaacga ggtagcaata ctggtgatct     13200
     tcttgaagct caccactttg ttcattctca aagatgtatt gaatacatgg caacctttag     13260
     tctctacgcc tacaataggt atcttgtcag ctaagttata tttttcgagg ccttgtatta     13320
     taccattgta aagtccgcct cctccaacac tgcacactat agcttttatc ttgttaagag     13380
     gtatcatttt atttttaaag tcttcaacaa tttcatctac cattgaagca tgaccttccc     13440
     atatatctgg attatcaaat gggtgtacat atattggttc cacattttta tgtaactctt     13500
     ctaacttaga taggatatta tctttcaggt agttatctgc ctccttccag aagttaccag     13560
     aaacaatgac attagctccg gtagctctaa tcttatctgc catcctctgt ttcgtagcgg     13620
     ttggtatgac gacggtacaa ggtaggttta aaaattttgc agctgtggct gctgctagtc     13680
     ctgcattacc accagagctg gcgaatacca ttggcttctt acccaggcca ttgcctaata     13740
     ttctttgtga ttgtttcgat attagatggc caatacctct gcttttgaaa cttccacttg     13800
     gttggaaaca ttcatgtttc aagtacatct gtggtatgct tggaaatatc tgacgtatta     13860
     gtggtgtctt gttgtatact gacattattg tgtgtgagag attttggtta gtttgagaaa     13920
     agggtctagt tattagtagt ataacttttt gtctgtaagt tttaacttga tgtagaggta     13980
     tcactaaggt taggatgctt actaccagtt aattactttc ttgaaacttt tcaatggcac     14040
     aataaaaaaa acaaaagcat aaaagaataa tataagacta aaggcaatcc aacatcaagg     14100
     tcaggaccaa ttccaatgct aaacattgtt cctttatata gttattgttt ttgctcttct     14160
     tttcaatgct attgacttca ttttgcatta agtgctaagt tagaaacaca atggagttat     14220
     aattcctcat atgtaactta acttcttgct catcacttca agtctttgta agatatggcc     14280
     cataactctc caagaagaaa gtgcttactg cagcaaaagc actcaagcat ctgttaaagg     14340
     cctgatgcca taaaatgttt tcttagtgaa gtagcctgta tttcatgcta aaacagagta     14400
     ttcaggagag aatagaaaga acagctctaa cttaacgttt cccaagctaa ctaatggaag     14460
     gggaccatta ccacggagat gcatctccac cgcttcccag agagaaaaaa aaaatcaagt     14520
     ttttttcaag agagaataaa caaagaaagg gctctttgag gggggaggga agagtgggaa     14580
     aaaaatgatc ctgaggcagt ctctgtgtaa actaagttta tcattgtgga gaaattctca     14640
     tttttttttg gtttcttctc aaaataaggt cgacgggcca agggagatag ataagatagc     14700
     agtggagatg taattccaca taaataaact aaactcaaag gaaagctgat attggaatta     14760
     gaggcaatcg caatgggaag ggaccgtctt ctcttttgaa ggggagagga tatctaatcg     14820
     gagatcttca atttcttttc tacactatcg tttatagggt aaacatggat cgagataaat     14880
     atgattttgg gaataaccct ttcatgcagg cagcaatagt attggtctac tgctaccttt     14940
     gaaatgggga gttgttcgat gtagtggtaa taacagtgag ataaaaaagc gtaaaagaaa     15000
     tgggattcct caatatcagt gttatcaaca gagttagggt tagtgggctc tcaactgaaa     15060
     gtaaagcttt tctaacatgg gtcagattgt tttacctgtt gtgactctat cgattgagca     15120
     tatcacatat cttgttgttg ttttttttga agtacaggtc tattatctaa gcgatgtaaa     15180
     agacggaaat tttcgccttc ctagctatct tgtagattgg tgaagatgtt cataaaagtt     15240
     agttataata gtgacaaaga tacttttcca gcagtagtct ggttgctttt tgagtcatag     15300
     gaagtgtaag acattcccgt ttataccata gtgtcaaagt tcgcatttcg gtcttgcaat     15360
     atgcaatggc aagttaactt ccaaagttca ataaatatgg cagtattgtt gttttcacaa     15420
     caatagataa tgggtactat atgtgtcacg ctacacatct atggcatgtc atggaagatt     15480
     agaaaatact cccattaaat tattcgtttc attagggtgc ataggtttga gtcatctttt     15540
     caacctaata tatcacagta gctgctattg cgctctcatt aatttataga taatgaaata     15600
     ccaaatatct caccatagta ctcttaatca aaacatctca tttaacatta acacaaacca     15660
     ggatatcatt taacgattat tcttttgttg gctaccgtct tggtttcctt cgaagcattt     15720
     tcctgtccca tagcttgggt tgagtaagaa tattgtttac ccagcctctt gagttggtgt     15780
     aatcctgaaa tgaaagttat catcatctat ctcaattaga aaatgtaaac aaaaaaaatc     15840
     aaagatagtt ttttcctttt ctaaccattg tgctaaaaca gctctctttg cactcttcat     15900
     tcagaaaggg ccacgtctca gtatgtgggg tgagggttga gttgtgttgg catattgcaa     15960
     gagatgagca tatgcatatg tcaaatgata aataaaatta aatacattct acatagatgc     16020
     tggggctgta gttgttatct ataataatta gctttttcgt gtttttttta ttgttttcat     16080
     ttgcctgttc ttaccttgct agtcttttgc tccgactaac cactaatatt gaacgcaata     16140
     taacattgat aagcacaaag tgagaaaatt gtctccagtt caagaaagaa aacaacaaag     16200
     ttagagattg aaccagttgt attatattca ccacatttgt ttattgatct tcactgcatc     16260
     tgataacagg caagatatat atcgttttca caatcccgat caaatcgaga caggtactaa     16320
     ggtttatagt tgccagcaag gtcattatca ttgcagttat agcgattatt ttcaacatac     16380
     cttgaaagtt attgaagcta taaacaaaca accgactaaa aattgtatta aaatattggc     16440
     gaggtaatac tcattgacat aactgcagca tcaagaaggc atttttctta gttgtatact     16500
     gaagaggact tatctacacc aacacctata ccatggcttc gctagaggaa attactgaga     16560
     gattattaga aaggtcaaat gaggccatag aacaactaga tgaatggatc ctgctccaga     16620
     ataagaatag acacatctca gaaaataaaa gtggactcga tagtatagaa aggcttgacg     16680
     ataaatatac agagtttctc gagaagttaa attcattgta cataagatcg caatatatta     16740
     aggataagat cagaacagag aaaaatgcaa aagcaacaaa gagaaagagc gaattaaaca     16800
     ccagtcggat acaagaatta atgttagagt ttaaagagat aactctgagt ttaaatgaga     16860
     ttgctcaaca agatgatgaa acaaacagta aacagttgtc acctgcgtct acttcaacca     16920
     agagtagctt agagtcattt acaccaaaac ctctaaagat actcaatcgc gctagtatga     16980
     ttagatcacc tataaattca cccccaaaaa agagaaatat atcgttttgc cctatacatg     17040
     aaaacttatc tgttactgaa tatgaatcgc tcccgagcag ccccaacaga agtaatctac     17100
     tagaagaaca agaacaagta ttacatcccg ctaggtcttt tcagacagga ttaaggacag     17160
     aaaaagctag aaaaccagat aagaatcaac tggataagta tttcaaagat aagcaaagat     17220
     tatccttaac tctatttgga tctgctgatg cagatgatgg ggagagtcta aataataatg     17280
     attactcgga tgaggaaact gtgatattta ctagctcctc aaacattgaa acagatgcaa     17340
     taacagatga tatgaaacct atacggaggt gtaattctca tgaaagtgtt ttatcagtac     17400
     acaataaatt tgtacctaaa aataataata acctgcagtt tcaaaatcga cttgagccat     17460
     tcggtagata ccttgcaacc tccaataaca gaaacttcac aataccttca atccaaaata     17520
     tacaagttag tggaacttcg acattaagta gattttcaag ggaacaagat agagaaatga     17580
     cacaattggg atctaaaacg tcaaaggatt tgttaacctc agtcatgaca gcgacgccaa     17640
     tcacaacgca gaggaataat aaattaacat tttttgacaa gttcaatagt atgtttaact     17700
     tttcaacaat atctgaagag caaaaaacaa cagtcgagaa gaaccggagt gctgaatcgc     17760
     caaggaatga ttttgtatca atagaagagc taaatgaagc attgaccact aatatggtta     17820
     tgtaatctgt tgagtgcatc gtctacgctg ctatatctta atatcagaaa gtgctattaa     17880
     ttaataaaat gctattttta tttcttgtac tatatgacgt accggtactg aaagcactat     17940
     atgttggaag atatccaaca ctatattgta ttgtttttat gctatataac tttttaagat     18000
     aaaactacac agtctttgtt taaaatctgg ctaatcaaat ggatcatttt ggatattgaa     18060
     aaggcggctt gtattatttg aattcctttt cctaacagtt ggtccatttt ttggaggtac     18120
     tagttttcgt gttttaccca aatatgtaat agatgccttg gaacctccca ctgttttata     18180
     agaagttgaa actttgactg atttgtttcc gtccttgaat ttgtcatcaa ttgtaaactt     18240
     agaactgaat gattgaataa ttgaaggtct cttaaacgac tcaaactctt caataacatc     18300
     ttcctcatcg ttaatgattt ttctagatgt tgataatttt gaacaaaaag acaagctact     18360
     attggactta agagcattca tatcaccaat tcctttctcc ttggacatga taaagctggg     18420
     ttgaaattcc tgtgtgctct catcattatg caaaaatgac agagttttct gaacaaaatc     18480
     ttctgatata cgtattttcc ctcttttatt ggatttagcc tcattatact ccttctcatt     18540
     atcttcttgg gtaatattct cctccttcaa ttcaatttga tctgataaat catcaaaatt     18600
     gttcttatct tctactaggt ccacaatcat actctcaaag aaggcttttg atttcggatt     18660
     tttagtcagc ttgtcggtgt cttcattttc aagcattcgc tgtttcatta actcacgtct     18720
     ttttcttctg aattcttgta gttcagcgtc ttcatcatca ctaaattcta gttccatgtc     18780
     attacggccc ctttttctaa atccaccatt ttttatatca taaagaattt tgttcacaag     18840
     tttgaggtcc atttctttat tttcatccat aattttttgt cgcagagaag ttagatcgac     18900
     ttcagttttt gaataatcgt caatcatttt ctccacttcg gaatcatatt caccaaaatc     18960
     atcaccatct acaccgccaa tacctcgcca ttcatcatca gattcttcag cctcttcttc     19020
     aaagtattgg ttcacacctt tattagcgag ttcctgcagt ttttttcttt ctttgacttc     19080
     tctttcctgt tgacgcttca cttgctgttt gatagcagca attctttctt gctcagtatc     19140
     aatatcttct gagctatcat ggtcttcatt ttctggtgaa gtttcttgtg actcatctat     19200
     tggtaatctc tcagcactcg atgaagcatc agttatgatg tcatcattct gaaaatcact     19260
     ttcagtatca gagaacaaga aaggcttctt agatgtacga tgactccttt tgatttcaat     19320
     gtctccttca tcatcaacat tgtcaagctc taattcaatt gggccattta tgactgcagg     19380
     agaattatca cctttatcag actcattgga atttttgagg ccgtatgtta tttcttccgt     19440
     atagttgatc tgctgagagg atatagaact attatctaca atatcactat tggatatatc     19500
     gctttcatcg ccactgtatt cataatctga ttccattatt tcctgttcag ctagtggttc     19560
     attactttct ttacgttttt ctcgttcacg aatctttaag ttcctttcaa tctccttttc     19620
     taagaggtcc tctaccatga ccttttgttt ttctaagtct tcaaaattga gacctctact     19680
     ttccatcaat tcctttctat gaagcataat ttgctgcttg gtagcttttc gaaggttgtt     19740
     gaatagtaag tttgtagaat ctttttcgtt atggaccttt tttacaggtt ttttttttga     19800
     caaacggact ttaaggttta gcagggttgc ttttgattta ttagagagct tgtatattac     19860
     tgcactatct acctcatcgt cagaatctga tgataattga agttttttat tctctacttt     19920
     ttgtttcaaa ttgttgacat atgcaggtaa tatcatactt gaggatttcc atcttggttt     19980
     agaaatgggt gatgatctta aactaatact tgctgaatgc tcattgtcgc taccattata     20040
     ttcggaggaa ggagtgacag aagtcttttg gtcggtcata atatcattgt tttcaaggct     20100
     ttcagaatca ctcaggtttt gatctttttg tttttcacct aaaatagtat cttcttcatc     20160
     tgaggagctg ctatcaaagt tctgtagtag tttttccttt gtaaattggg attttgcggg     20220
     tagtacattt ggtgatcttt taggtatata ttctgtttgc ttgtcagtaa ttgctctttc     20280
     atcattctct aattcctgct caatctttgt tattgcaaga acttctgtta tttgtgtatc     20340
     atccatctga gtgtcgttct ctttagtctt atggacttcc tcatgaacta catctatttg     20400
     agtttcggat tgtgcttctt cagaagaatt atttttgaat aacggtaaaa ttgaagtatt     20460
     ggggttaaaa tttggtgtat gaaggtcttt tgatgaccca actgtcttat cctcatggtc     20520
     tttaatagtc tgcaagtagc tattttgagt ttcaatgggt acatgctgag ttgcacctat     20580
     tatctgcgta gatgcatcca tggtttgtct ataatcgtca tcatctttat tgatttctac     20640
     gcttctgtcg ttctgactag cagctatttt ctgggtaggg atgaggggct cagaatcaaa     20700
     taagagagac ttccctactc caatgttaga gaataaaaat gacgatgttt catgttcctc     20760
     attcaggtta acggttgtca cgctattatc cttctctgtg cttacaattt gggttgcttg     20820
     tgtttcttct acaccgtcat tatcatccag atcatcatca atgtcatcat cactaaccgt     20880
     tttataacta cttctatttc tcagtcttga tgtatcgtaa gttgggttaa ttttcttcgg     20940
     tttcgaattc ctagggttaa tccaaatact gttcttttta cgtttctcat atatcacttg     21000
     cgtactattt ttgattatat cagttgcatc taaatcctca ccaccatcat aatattcgtt     21060
     aataatttgt gtagagatat cgtccgattg atttactaca atattatttt gttcagaaga     21120
     aaatgttttt tctttagact gttcctctat ttgtggattg attagagctc tatcctcaac     21180
     tacttctgaa tctttagatt gtgccaaccg actccgtatc gtatccagtt tatcgctagt     21240
     cagaagaaaa ccctttttat tcacattgtt gaggagacgt tccgaatctg agcttgtgga     21300
     agcattattt ggtacaatct gattgctagt gtcttctctg gctatttcat ctccttggcc     21360
     tgttccaaca acctggactt ttttataggt agttcttttt tttattttga cttgctctag     21420
     ctcatcaaac aaaaaatcca tactgggctt aactatgctt cgtgtctcgg tttagttgtg     21480
     ttgatttaat agcgttccta aattatttct ttctgaattt gtattcttat accaggacaa     21540
     tattgcaatt tgtgaaagtc tccattaact ctatcttgga aagccactag agtaaaaata     21600
     tagctgtgat gagtttaaaa attactgtat gttgacctat taacagctag tagttcggtt     21660
     tgtcaattaa atccttttac tgataatata tatcttcctt gataagtgca tttgtttcaa     21720
     gtctgcccgg tatcacattt tagagacgcg tcttttttct gaaatttaca attcgagatg     21780
     agctaaagtg aggatctgag aaattcgcgt ctgtctgtta aaggtgaaaa tgataaagtg     21840
     cactcttgtg acatactaaa aaggacacag taattattaa attcgagtat acacgttatt     21900
     tagaactgag ggtactacga attatgaatt tagatttacc acttagctca ttctcatata     21960
     tcaattaact gagtacctaa tagacaaagc agtcttttac ttaggttaaa tttaaagatg     22020
     ggcgaccata gtaaaaacgt ttcaaaagca ttagagctat tattacataa taaaccgatt     22080
     tgctcagatg atcaattatg aggtttgtgt tatatgctct atagcagttg taatcaatgc     22140
     attattaaat atacataatc tctggttact ttattctctc tttcttttct ttgaatcttt     22200
     gtcgcctttg tcttcattac ttgtcctctt tttcgtggat ttgtggctac ttttatattc     22260
     atcttcctta ggagctatat aatctttcct tctttcctca tccttcaaaa tttgcttctc     22320
     ggcttgcttt tctctttgct catgtagttt tttgatttct ttttctttct tactcaagaa     22380
     atactcaccg ctttcaattt gtagatcaac ctttctaggt agttgtgcag gtgggaatgg     22440
     agtgtatacc ttcttttctg ccttaacttt acttggtttc tttcttgcaa catttctttt     22500
     cttgaacatg ggcaaaaatc tggaccaatc ctcgttagcg agttccggtc tctttgctaa     22560
     ttctcttttg atcattagtt ctttgatgtg ataaattgga tggacatttt tcatgcaatc     22620
     tagtacaact ctacgtattt ctttcaaacc tttgtatgga cccatagcac tgactgtatt     22680
     accttgaact agaatatagc attttgtcaa caattcaagt gcttttaaag tgttaccatt     22740
     aggccccacc agtctctgtc ttctcttcac aaatctgtct ttgttagcaa ctgtattacc     22800
     aatcttgata acatcgcagg ctatgtcatc ttgaaggatc ttcacagcct gtggaaatgg     22860
     cactgatctt gccagaagtt ttatcagatc cctggccttt agaattattg ctggatcaaa     22920
     agtctttctt gtggttttaa cagtcataga accttcaact aaatctaatg tacatccaat     22980
     gtggtgctta tccaatgctc tggtaacatc attccatatg ctcttcaaat atgcttctct     23040
     gtatttgggg aacaaggtca taaagcttga ttcttcagca aatggttgtc cagacttgtt     23100
     gtcttctggc ttgaactctt caatcttcca tttatcgata tcctcagtat cccatggttt     23160
     atccttattg tatgttgaga ccattgtttt agtcactcta tttcacactt tttgaataag     23220
     taaatataac ctgataataa tagcacagta taatagaaac tggaatctta aagacaaaga     23280
     tattccaata atatatttct aatacttaat gtgataatta tggttatgat caatagcaca     23340
     gacagatatt caggactata atattattaa aaaaatcgat gagcttggaa aaattttcgt     23400
     cactttgaaa ttttccacgt tcaaggtcct cgagaaatcc gcaggaaggt aatagaagcg     23460
     atgagttagc gatgtagaaa atgaaaaaaa aaaatcaaga ttatgctatt gaaaatctaa     23520
     ttaaaagaaa tttatgcgat gagcataagg atgtacattt gtaatgtgtt taatatttag     23580
     gtagagtgac acgtttaata agctgaaaca catcagtaat tagcaatata ttgttatttc     23640
     aagtcggcta gtgaatagat tggtatattg gtttgttgaa agttaagcaa taatgagcaa     23700
     gaaacaaagc actaaaacat cgaagacaag taaaacattt agttcgagat caaagagctc     23760
     tgtaccgaaa aagactggtg ttaataaaat cagtgcatct gaaagaaaga aatctaaaat     23820
     attgactgct agactcaaca aggatgcaga tgttgctgaa ttaaagataa ttcaggaact     23880
     gaatgataac aaaattgctg aagagcctaa gaaaaggcaa acagctttag atatgaactg     23940
     tttagtcaaa gaccaaaaga gagacaagaa agtacgagaa catattgaaa aaataaactc     24000
     tgaaacaaat tcagacatgt taaaacaact agaattgatg tcaggttttt ctctgtgact     24060
     gatacgctta cttgatggcc tatggaccta acaattaatt tgtgatggat ctcaataacg     24120
     tctgggcttc agcataggca ttttctatta ataccggatt cgtagaagta aaatttattc     24180
     tttgtgttta gtctaattac atagatagtt tgaatataaa aattataata ttgattaaat     24240
     gctgttatcg aagtgtatca caagctgatg gatacctcaa tttactgtcc cgtaacgata     24300
     aatatggata gctggtggtt acaagttgga aaagaacacg atgtcaatat aggtattttc     24360
     tgcacattag atccaagttg ccgctggcta gatagccggg attagctatc atgcaaagta     24420
     actcatgatc agtagaagaa actattatac tatcatcgtt ggtcatgtcc cgagtacagg     24480
     tgccctttac ttttgtctta aaccttcact gatctcaaac ctgcagtaga acggaagata     24540
     gcatcacctt cagaatagcc tctacctgca ccgaagccta caccaagcca tactgggaag     24600
     ctgcgacgct taaagaaaag cacagaagta acaacaccta ctccaaagcc taggcccatt     24660
     ttaacaatca tattagataa gacaacatcc catttgtcat ttagaatgga tcttacaggt     24720
     gtgtagtcaa cagtctttgc ttttgtttcc tctttgtttg acatgtttag tataatattg     24780
     attgtagtga cagagttatt aaatagcgat ggatctcgtt agcttatact taggactaaa     24840
     tcggcaggaa tcagtagaca gttattatgc cggttgaaac agttgccaaa atggaaatga     24900
     aatgaataat tgacagtatt aacagttttc gaattagctt cagtaatcag atatgtattt     24960
     caacaggtta agaaaataga aatgaataca aaaagcctgg gaactattaa attttacaat     25020
     tagaagctga atgcaaaggt agtctataat gaaagggttt tgttcagaga agaaatatca     25080
     aagatgattt tacattttca ttccaaagtc caattagttt gagccttact tcaacagtca     25140
     ttcgctggtg acgatatcca atcctcgact tcgtcgaaaa gtcttgcatg gtaagtacta     25200
     tcatccatac agttgtggag tatagagagc tacaaatgat tcacagctta ctacgataga     25260
     ggtttatcga gttatagaat gaccaagata tttactggtt gattgttata ttatgggcat     25320
     tgaacatggt agtttatcat ttctcttaag tttttaatca gtttacgtta aatactattg     25380
     agtatcacta ataatgatac tcaaatatta aaaaagtaca attagtgtat tctattaaca     25440
     caaattaacg ggctttcact tcgctttgca attgaacttg ctacttattc tcgagaaagg     25500
     gcaggatagt gagagagtga gaaatgagat aaagaatagg gaggaaactg aatgtagata     25560
     ctactacagg ggggtggttg gatggagaaa tttcgcggag gtgattggtt aagccaaata     25620
     gagaggaatc gtggctaagt acagaggagt ggtctataac tgaaaaacaa ttcatagtag     25680
     tctatgagcg gtgtgctgta ttcaatttta gcagatacgt caaattgtgg tcttgaagta     25740
     ccttttatgc tagtgttttt tagtcttgga ttaggttttt attaatcact caacggaaag     25800
     ttaagtaatc tgccttttct cttatagtat taactcgagc cgtgtttatt gtgagaatta     25860
     atttcgtcta tttgctacca aataaatggc ataagtacat taactgtact cattttttga     25920
     gcataattaa tagcttttgt aagagtgaat cgctaatttt tttttcattt ggcttttatt     25980
     tatgcatagt caaactcttg tactttgtaa ctattcttca aaaagagaag acattgagat     26040
     agtacttttt ttaattaaaa gggaaatctc ttactaagat gtcaatgttg gagaatggct     26100
     attacctgaa cttcattctg ataagtgtgt gtgttcttgt gagttcattt acgttaatac     26160
     tctagtggtg ttagaacttc tcaatttcgt gtgtgttata caatggggtt cattcactct     26220
     atatataata gacaaaaaaa ttgctggtag cattgaaata aaagacacaa ttgtatatca     26280
     agacaacttc ttgtttaagc tcgtatttta gttggctcta aattttgcat gagtcttgtg     26340
     tacagaaact agtgaataca tgcatatcaa ttgtcgataa ataagtgtga tataagagat     26400
     ttttcaacaa gccgactggc ccttaatttt cgctccatta atttttttaa tttcgttccg     26460
     gttctgtctc tcagttttct ggtggcatct tgaattttgc gcattgaaaa gaaaacctca     26520
     ctgttttgta gtctaacttt ccaattgcta agtgattggg ctgagtatat agtctagatc     26580
     ttcatgtttt ctaggagctt atccattatt ggaaggagag ttggaaacac actatttagg     26640
     agcaagaaaa ctacctttgc cttaattgca ctgccattat ttgtcagcta tagagggatt     26700
     catttgaata atacttacac tagtagcatt agaaactaca gtcaattagc aaatactagg     26760
     ttcactaaca tgccgagctt gacgccacca cagtatccac ctagctggga gttcaagcca     26820
     gaagatattc tatcacaaac taaagaattt attgctaaca ctaaattgtt ctatgacgat     26880
     ttagtcgcca ttgataatcc tactattgaa aacctaattg taccttacat caaccatgaa     26940
     aatgaaaacg aactattgat aaatcagctc acctttttac aacatgtttc ggaagataaa     27000
     acaattagag atgcgtctat ggaggctacc atgctattgc aagatttcga gatcgaatct     27060
     ggctctagag ttgatttatt taaacaattc gatctgatct ggaatcaaat caaggataag     27120
     aaggatgaat ttgaagattt cgaaatttgg cgatttgttg aaaaatgtca taaggactat     27180
     gttagggctg gtttaaattt gcctgccgat aagctggaaa aggtcaaaga aataaaaaag     27240
     aaaatagccg acaattgttt aaaattctct aaaaacttag gagaacagaa ggaatatata     27300
     ttgtttaccg ctgaagagtt gaagggtgtt ccagaaagtg tcattgaaca atttgaaaaa     27360
     gttaacgatg agtttggaat tcaaaaatta aaagttactt acaagtatcc tgatattttt     27420
     cctgtgttga agaatgctca aaatcctgaa accaggatga aggcattcat gggtgatcag     27480
     aataaggttc ccgaaaacga gcatttgttt aaagatactt tgaaattgag aaatgaactt     27540
     gccttagtcc taggatatga tacgtatgct aactataact tggatattaa aatggcaaaa     27600
     aatgcggata cggtgctgtc ctttgtgaat gatctgattg tgaaacttca agacccagcc     27660
     aagaaggaac tggatatctt aaagaacttg aaaaaacaag aatttgaaaa tgaattcaac     27720
     atggtatatg atggtgatta ttatatttgg gatcacagat actatgacaa caaatatcta     27780
     aaagagaatt tcaatgtcga tgaggaaaaa attgctgaat actatccctt ggaatccaca     27840
     attgatggta tgttgaaaat ttacgagacg cttttgaagc taaaatttgt tgaagtcaag     27900
     gaaaacaaga aaacttggca tgatgatgtc aaacaattag cagtatggaa gttagatact     27960
     cctgaaaacc cagaatttgt tggttggatc ttcttcgatt tacatccaag agacggtaaa     28020
     tatgggcatg cagcaaactt tggtttgtca tcctcatata taagtgcaaa tggtactagg     28080
     tcatatccta ttaccgcttt ggtatgtaac ttttccaagt ctaccaaaga taaaccatca     28140
     ttgttgaagc atagcgaaat tactaccttt ttccatgaat tagggcatgg tattcatgac     28200
     ttagttggaa acaatagaat aggtagattc aatggtccag gtgctgtacc ttgggatttt     28260
     gttgaagctc cctctcaaat gctagaattt tggacttgga atacaaaaga gctactatca     28320
     ttatcacaaa attataagga taacgcaaaa attgatacca agctgttaga gtcgttgatt     28380
     aaaaccaagc atgtcaatgg ggctttgttt gctttgagac agctacattt tggcctattc     28440
     gatatgaagg ttcacatgat gagtgctgaa gagttagaca aattggacat caaaaaattg     28500
     tggaatgacc ttagagaaaa gatctgtcta atttctaacg gtgaccagcc aaccaccggc     28560
     tataactcgt ttggtcatat aatgtctggc tcgtacagtg caggttacta tggttatatg     28620
     tgggcggaag tttttgctac tgacatgtac tacacaaaat tcaaagcaga cccattgaat     28680
     ccggaggttg gtgtcaagta tagggatatt gttctagcgc gtggtggttt atacgagatt     28740
     gacgataact tggaggagtt cttgggtaga aagcctgcaa aggatgcatt cctggaagaa     28800
     ttgggtttac attagaggta tactattata aaaaaaatat tgtgcagtat agatgtcttt     28860
     ttaagacaac tttgcatgtt ttgaaaagac attcccacat atttttacat tatgttatgg     28920
     ttatatgctc tatttcatct aataaacttg tagtatctat taataaaaat atgacatgtg     28980
     ccaagaacgt ttttttgcca tcagaaatta gaagtaaacg attctgaaca gaaaattttc     29040
     ttcaaagatg tatttgatat cgttttcatt gcgaatcagt taatacacta ttttaaaatc     29100
     catcttttct cggacgtcca aatattatga taacggtttt agtctatcga gcaacgggtt     29160
     ctttctgtat ttgatataat ggccataact atagaattag tatagagcta aaagctacga     29220
     actaagcata ctagcaagct taaggatgga aaacataatg tacgaaccta ctcgattaga     29280
     aaaaccagca aacacttagt tttagctacc ccgctttctc gaaacaatgt tccgggtaac     29340
     attaaatttg ggagggaaaa ttttttgttg ttttggttgg gtggcgttct gcgcacatat     29400
     gagcatattg aatcactgtt ttagcgtggt ttttaagccg ttttgaacct gaaaagtagc     29460
     tagagatatg tagtacactc tcctttatat atgtgtgatt ttttgcgttt gttagagctc     29520
     atattgtgtc caaaatagtc atttgtagac gcccaaaggg tatcccaata ctaaggttgg     29580
     actccttttc agtgtgttgg aaacgttacc cggctacaag aatttaccct ctcatctctg     29640
     gttgtctcga ctccctccct gcctccctac aaacaaatgc acatgtgcac taagaagcaa     29700
     gtttcttcca gaataggaaa acttaacgta caaactaccg taggtgtcga ctcttggcca     29760
     tagttaagat atcatttagt catttttgct cagaggaaga gcttagttaa agctgtcttc     29820
     tgcccttgtc tttacgacgc ctcttgcttt cttattggaa ttttgcaaca ccgtccacca     29880
     cctgcgccag tgcgatgttt tctgcacact tattggcagc ttctagaaag aacgataaag     29940
     tgagaaaata gatgacgagg atagaaaacg agattctacg gtagtttctc agctagcaaa     30000
     gttcaatttt tacccagctt atcaattctg taacttcgat ggctttccaa aagcagcaga     30060
     aaaacttgtc caacttgagt taccctcacc caaaacgggg ttaccctcct tagttttatg     30120
     gaggttgtcc aatcaaaatc gagttttatc ttttttcacg cgttgaaaaa ggcggcattc     30180
     cagacgcgag tataaataca gaactctttt ttcatccctg gttatccaat cctgagacca     30240
     gaattttcgt tttttgccga attttttttt tttttgggaa aatctttttt ttgttcactt     30300
     tttacggtcg aatctttttt taagtttgag aggtttttgt ttttttcgat ttcaacttct     30360
     attttagttt ctcttttagt acttggtttt cttagactct tttttttatt ctggttcttc     30420
     ttagtttttt cttcaaattt ttttctcctt tagaagagac cgaagaaaat tattttctcc     30480
     aattttggta catccttcat atatttaaat acggggatac catcacgctt ctttcgatac     30540
     tactcaacga aggatcatac agctaatttc attttgttct aaaatctttg tttgttgttt     30600
     tgctttccta ttagaaaaag tatttttatt aatttattaa tctttcttct tttcttttta     30660
     attatttttg tgagtgttaa tatttccaaa aaaaaaaaaa gaaaattaac taagaagaaa     30720
     caagaaggaa aaattattat aatactactt gcaggagctt attactaaac tggatttgca     30780
     agaattttag ttttttttta tcatagcgct agaaggttat tttagtataa catctaccgt     30840
     tagtttgttg cttttttttt cgggttattt tttattctaa cactggtttt ttactctaaa     30900
     ggtggaaaaa gataattttt tcgatcttat tttttttctt atttaattct ctacttctaa     30960
     gcttttttca agaagagaat aatttaggaa acgctcagct gttataagag gtaaacgaat     31020
     agaactttgg atcgttaaaa ggtatatttg acggtttatc attgtttctt ttgtttcaag     31080
     acttagttcg atttgtttgt taaatcgata gattgtgttt gtcatttttt gttttatttc     31140
     acatcgaagt taatttaacc ttaatatcaa taaggttatt tcgtgtattt gataatacaa     31200
     aaactgatat ctggagatac attactatac taaatctact cttcattatt atttcaaaaa     31260
     gataaaacca aggaaactcc tttatttttt tgaaagctat aagaaaaggt aaaaaggatt     31320
     agaataaaaa aaggattaca atacaaggga aacttaaaat tcttattttt ttgcatacag     31380
     ttatttctca attttgaagc atctaataat tataatagag gtttctttat tgatcaattg     31440
     gtttttttgt cattattttt tttgtttttt caattctgct tttttatcaa taaacttaca     31500
     acaatggctt tctccataaa caattccaca tgtcatttca ctatcaacaa gaagactcac     31560
     gggactgtga gatttttgga acaagaaagt gatgacgagg attaccatta tgctaccggt     31620
     ttgctaaaga agcgcaaatc tgtcagcacg ccaagaacag tggacatgct gatcaatagt     31680
     aatagtaatg gtgcaagcca tatatctagt acaattacac catgtccaac tccagatcca     31740
     ttcaagaaaa gggttgaaga tgaggtgttt tttcaggata ttccacagag tccagtttct     31800
     atggcatcta gtacaccaga agttccacgc gatgatatag ttgccagaga gagatgcttt     31860
     gattttatcg tacagtcaat cgatgaggtt tgggcaagat atgttgactc atcatctact     31920
     gcagaaacga agacatatta tcttcgtagt ggtggaaaca atttaaatag tgcagacagc     31980
     tctttccaat cgacttctga tgattcttct tgctttgagg atgatgtaga ggtgagcgaa     32040
     gaagatggat acaattccga agtcacttca tgtacagagt ttgatgaatc aaacatcaaa     32100
     agtctgcagt ctctaaaata caggttgact aatgcaaaga atgacttgga attaaactat     32160
     gattctcctg atcttacaga ttccatggaa ttttggaggc gctgggatat gataaaatac     32220
     agcgctgtgg aattaatgga ggatgatgat gacgacgaat tgatagaatc tgtcatcgaa     32280
     gaattggaga gaggaagaag tgtgggcctt tagatgatat cagtcattta aaaaaagtac     32340
     tgcccttcga agattctaaa aattaatcaa attatcattg gcctggctaa tgactagaat     32400
     ctcttgtcag ctacgcttaa gtcatatttc agaaaataag gtcattcacc tagcgcctgt     32460
     tgagtaccac tcacttagtg gtttgccgtg ataagacttt ataaattgga cttaacatat     32520
     catctggtct tctcatctat tttttggtga aacacagtct ccaactgatt caaaagtgga     32580
     taataaggag ttagcggaat tgctcaggaa gtaattagag tcgctctttt aaatagctcc     32640
     aactcatggt aactaagcat tcctattaaa ggtttgcaaa gaatttggca tatctctaaa     32700
     tgccatatat aaattttttt acatggcacg tacttatata tagatcattt taaaattaaa     32760
     cattcatgca agaacattac cgtcataact attctgattt tacattatta gcatagcata     32820
     atatggatta tatttagcac ttataacatg ttcgcacgtc atacggaagt tttaaggttg     32880
     gcatggacaa agaattgttt cagtctcaaa ctcatgtcgg cggttgttcc tgtatcagat     32940
     ttgtaacctt gtaatacgtt gcattatagt caagtttcaa attttaaaac gtatttttaa     33000
     aacaagtctg aaatcttcca tttaatcttg tataaatatg gcaattatca taaaaagctc     33060
     tataaattct taatataatt ggaagcattt aatcttgttt cgcaatacat ttctagaaag     33120
     aatagtataa aacattagta aacatgattg aagatgagct ttacaacaat aaggataact     33180
     tttcagagcc taaaccgaca atgtacaatc aaatagattt caagccagtg aggtctccat     33240
     tctcaaataa ttacagcagc aactatgttc atacttccgt ggtacctcat aaatttgtta     33300
     gcaatgtaga aaatccagtt gaaggctacc ctaaattgca aaagcttttc aaattgaaag     33360
     aacaacagat tgctaaaatt agttcgaagg cctacggata tagagtcgat attgaaaaga     33420
     tgatacctac attgaatgat tggatcaata aggaggcatt ggtatttgat gtcataatgc     33480
     ttggttgtct gacggataat caattcattt atccgctact aacgcaatta ccattggaca     33540
     aattaatttc aaaacctggc tttttattta tatggggaag cgcacgcaaa atacaggaat     33600
     tagcaaatct actgaacaat gagaagtggg aaaaaaaatt tagaagaagt gaagaattgg     33660
     tgtttgtacc aatagacaaa aattcgccat tttttccagg gattgaacaa gaagacacaa     33720
     cactaatcga aagaatgcaa tggcattgtt ggatgtgtat aacaggtacc gttagaagat     33780
     caactgatgg gcatttgatt cattgtaata tagatacaga catgactatt gaaactcaag     33840
     atacaaaaaa taatgcagtt ccagatcatt tgtatagagt cgttgagaat ttttcctcat     33900
     cgacgcgtag acttcatatt attcctgcca gaacaggctc caatatacca gttagaacta     33960
     ggccaggatg ggttattatg tcaccagata tattgctgaa caatttcaat gcaactacat     34020
     acaaacacga tatcgagcag attggtacta atataccaac gacagaagaa attgagaatt     34080
     tgagaccaaa aagccccatc accagaaatg ccgagtaata caaacacgaa ccttggatgt     34140
     atttcttcta attttatact acgttaatct atgaccttag tgttagtatt gtaatcgact     34200
     agctgagagt tgtagtagta tgtcttatga tgttttttta atatgaaaac aacatgggta     34260
     ttagttacgc tattctaaat taaaacgaaa gtctgatctt ttaatgcttc atgttagacc     34320
     tcaaattaac gatttccaaa gctacacgaa aaagttagtc accaaattaa ctgtcagtga     34380
     gaataagttc gtctttagaa ttgaagagtg actttatgtt taaagtcctc ttactccgaa     34440
     aggcagcaga tccgtagttt ttctgctaag gccatgtaaa ttacctaatc gggttaatta     34500
     caagctctta aaaaacggca attgctaatc aagtaataga agtatagcta tggttatagt     34560
     tgcatattgt ctatatggca ttatttcagg ttaaatggta gcctaaaata tcattgtatt     34620
     ttaacttgag gtaataagat agcacataat atcatatttt tatggttagt agtatacatt     34680
     tgagattagc agttcattta tcgaaagtga atgcctgtat aaataatcgt atttgttttt     34740
     gcccagtaac atatttaaaa tattgaggtt cattatacag taaggtccaa atataactat     34800
     tgtaagctta taatcctcac tattattaaa taacggaaat actatcttca agttgggcac     34860
     ataatccaac ttaataatat tatttgaaat tggaggtaca atctgaaatt ataacaatga     34920
     aagacaaact aagaaccata attcaatatt gcacagattc aaaattttgt aattataaat     34980
     acttacatag ctgactgtat atctgtttat atttagcatc gagattaaga cacttttggt     35040
     actgtcccag tcccgtagga atccacagca acgagttagg tacaaaacat aaatataatg     35100
     gatgataatt cattgtcata aatgaaataa tgaaacgata taaacaacgg aaagttaacc     35160
     cagactaaac tagttctatg ttctagttac aaccttctta gctatagttt tatgagggtt     35220
     aaccttgcac tttattatgg gagaacctcc ttttttgaat gttattttca ttgctaactt     35280
     ttatagatgt atcctgttgc agagaatatt tatacaatcc aaagactaaa agagcaatga     35340
     attatacaat tagctggtct ttaaacttaa gtaatacagc aataaccatg ataatttacc     35400
     atagtgatca ttaaaaaatt ttaagtttta tattcccaaa agtgagatca agaataagcg     35460
     ataaaattcc ttttactagt ccaaaaagtc ttgattatgt gatataatca accataaacc     35520
     aaacctgctg tacagttatt aacaaagatc gtaataatag tatatcttgc ttattatttc     35580
     tagccttatc atgtcattgc atcatagagc ctgaacaata taaagctaac taaaaagata     35640
     gttttaatta aatgagctca ggctctttca acgtggatat tccttccaaa ttttaacaaa     35700
     ttataatgta tactgttgcc aatactaagc actttgaaat tactgttata tcaggtgcct     35760
     ggtcaatggt attacgtagc ttatgatatg ttatgaaaaa aatttgcgat gagctgctcg     35820
     cgatgagatg agatgagcct gccagccgat gagtttctcg caatgcatac cttgtggggg     35880
     ttaatagttt tctgttaaaa tattcccatt taaatataag agtatttaat ttgcattata     35940
     taaaacttat aagaccttac tattaataag gaaggtaata gctaagtacc atgggtaaga     36000
     cacagaagaa aaatagtaaa ggtcgtttag ataggtacta ttatcttgct aaagagaagg     36060
     gttaccgtgc ccgttcatct tttaagatta ttcaaattaa tgagaagttt ggtcattttc     36120
     tagaaaaatc taaggttgtt atcgatttgt gtgctgctcc aggttcttgg tgccaagttg     36180
     catctaaatt atgtcctgtg aattcattaa tcatcggtgt ggatattgtt ccaatgaaac     36240
     caatgccaaa cgtcataact tttcagagtg atatcacaac agaagactgt agatccagat     36300
     tgagaggtta catgaagacc tggaaagcag acactgttct tcatgatggt gctccaaatg     36360
     ttggtttagg ttgggcccaa gatgctttca cacaatctca cttaactttg caagctttaa     36420
     aactggccgt tgagaattta gtagtcaatg gtacctttgt taccaaaatt ttcagatcaa     36480
     aagactataa caaattgatt tgggtgtttc aacagctgtt cgaaaaggtt gaagccacca     36540
     agccaccagc ttcaagaaac gtttctgcag aaatttttgt ggtatgcaaa gggttcaagg     36600
     ctcctaaaaa attagatcca agactgttag atcctaaaga agtttttgaa gaacttccag     36660
     atggtccaca aaatatggaa gctaagattt ataatcctga aaagaaagtg agaaagaggc     36720
     aaggttacga agaaggtgat catctactat accatgaatg ctctgtactc gattttgtta     36780
     aatcagaaga cccaataaca gtattaggtg agatgaataa atttactgtt gaacaggatg     36840
     acccagaatg gaaaatcttg aaaaggctaa aacaaacaac aaatgaattc atggcatgta     36900
     ttgaagatct taaagtcttg ggtaaaaagg atttcaaaat gttgttgaag tggaggaaag     36960
     cctctagaga tattttaggt ttagataaag acgaagacaa gggagacatt gaaatagaac     37020
     cgttaaatga agaagagcag attgaaaaag aactaagaga tctacaagaa aagcagaaac     37080
     aaaagcagaa gcgtgaaaag agaagaaaga acgaggagaa acagaaggaa ctaactagaa     37140
     tgcaaatgaa catgttaact ccaacggata ttggtatcga agctgcaaac attggtagag     37200
     attctctatt taatttaaaa actgctgaaa agactggtat tttagataaa ttggcgaagg     37260
     gtaagaagag agttattttc actgaagatg aaattgcaca agataacgac ctccatattg     37320
     atgaaaacat agtcattaga gatcgccatg atatgaatga agttgatgac ttagaaggtg     37380
     agctaaatgc catgtatcaa gattacaaaa atagaaaagc cgaaagagat gctaacttta     37440
     gagcaaaaca agctagaggt ggagatgtgg aagacgaatg gaccggcttt gaaggtacca     37500
     aagactcgga agatgagaat aatgagccta aggactatat tgaatctgat gactctgaat     37560
     tatccgatga agatgatgat gaggcgatta accaacttat cagtaaattg aagagtcaga     37620
     acaatggttc caaattgagt agtcaagcca aggccttgtt cagtaaccca ttatttgaaa     37680
     atgtgcaacc tattctacag tcaaagactg atgatgtagt ggactcagaa agtgttgggg     37740
     atgcaaccaa gattagcaat aaaagatctt acaatgaaat gaaaaaagag gatctatcag     37800
     atagctcgga tgaagattcg tcctctgaat ctgactttga aattgttgcc aatgatgaaa     37860
     gcgatggcga tattgattct gattacgatt ctgatgaaga acgaaagaga accaccaaag     37920
     agaaatatga taaggatatt gatattgcca ctgttgaagc aatgacattg gctcatcaat     37980
     tggcacttgg tcaaagatct aaacatgatc tggtcgatga gggtttcaac agatatgcgt     38040
     tcagagatac tgagaacctt ccagaatggt tcttagagga agaaaagcag cattcaaagg     38100
     ttaatagacc gataactaaa gaagctgtaa tggcgttgaa ggaaaaaatg aaagctctta     38160
     atgcacgccc gattaaaaag gtggcagaag ccagggcaag aaagaaaatg cgtgctgtta     38220
     agcgtttaga aaagattaag aagaaggcag gcttaatcaa tgatgacagt gacaaatctg     38280
     aaaaggataa agcggaagaa atcgcaaagt tgatgcgtaa agttacaaag aaacaaaaaa     38340
     ctaagcctaa ggttacattg gtggttgccc atggtaaaaa caaaggtcta tcaggtagac     38400
     caaagggtat caaaggtaaa tataagatgg ttgacggtgt actaaagaat gaacagagag     38460
     cattgaaacg tattgctaag aaacaccata aaaagaaaaa atagcttttc acatgatctt     38520
     ggtagcattt taatcacttg tatttttata tctgtatatt atttatcatt cgaacaactt     38580
     tgcatggtca ttttatatct atttttatgc tgagagactt ctgcttatat tgaattctca     38640
     tctttagtcc ctctttactg tagataattt cctcgaaggt ctcaacaatt tatagatcaa     38700
     ataacaaatt gctagaacaa caattccaaa ggttgtatat tctatattcc caatatcatt     38760
     tttgttcgga taaggaatat taacatgtac agaagtggag ttaatgtgat agaatttagt     38820
     attttccgaa aaataagctt cgtatcctag acttctggag tagaaaggat ttgacaggtc     38880
     ctcttctttg cctacttgac atgccttgaa aagaattggt tcaaatccta ctgttttatt     38940
     agaggctctc tcttttggtt ctaagtagcg tgagaaatat gtgatttcat tgatctgtcc     39000
     ttcttttaat gtaactatgg actcggagcc ccaagacaat gagttaactt tgtaatctgg     39060
     caactccaag tcatctaatc caaatactat agacccaggt gattggaatt tatcaacaaa     39120
     aatttcagaa ggtaattgag agaacacgaa atgtctacaa tccttatcct ttcttattcc     39180
     acttaaatcg attttcattt taggatgtaa accattagta ttttcaattg taattggtgc     39240
     aatgtctgat gaatcatcaa cgtatagatg gaatggttta taaaaaagag ttgttttttc     39300
     acatttgcca atattgttgc tagtgtcttc ccatgtacat ctcaatccac tcagattgat     39360
     atcttcttca tcctcagtat ctacatgaaa caaccctatc tcgactttcc ctgcgtcttt     39420
     aacaaatttt ttcttttcaa ctaatgaaca gtaactgaaa acttgaacgg tattagcagt     39480
     tattagaatg tcatagtcgc acaactcagg attccatggt atattgaggt ttttaccacc     39540
     tggtaatatc tcgttaatgc ttttccaagt ctctgagtgt aaggatttat acatcggcga     39600
     gtatacaggt tgtataccaa ataagtttaa ccttgcctct ttgtcatttg agtaaatgtt     39660
     aaagccaggg gccaagcgag actctatcac actaaattga cgagttgaac tggggtttct     39720
     ccaactgatt cttctaatac tatctaattc atagtcaatt gcgtatgtcc atctatcctg     39780
     tattgttata ttgctgttag gaaacacaat aactccgtct tcgactgtct caacatcttg     39840
     tatatccgct tcgttggcga atagtaaagc gatcctatgt ctcacacttt ccataattga     39900
     tccttatctt gtcttaattg atctgtcaaa taatggacta ttattggagt agtatgatct     39960
     taaaataaaa aaaagtaacg tggtagcttc tgagttgtag atgagcaaag tgatgaccga     40020
     tggatcacta ctccaatcca aattaaaaag aatagtagaa gtactgccgt ttatcacaca     40080
     gactatttat taatagatta tttacaatac tgtcaaaaat ccgcactcgc aggagaaagg     40140
     ttttatgacg gttccaaaga tacgtcatta gtccgaaatg gcattttttt aacaactata     40200
     acaacttttg ttatcgcaga acactcggat aatagaaatg tgtaccatga actagcctct     40260
     gggttcctat ttttgcaaag tacccactac tacgtaataa atcacatcac ggcagcaatg     40320
     gttcaagcta ctattcaaag tagtcctttc aagaaatgtt tgccctcttt atctcactca     40380
     ttgctgccaa caaagctttt caggacagga gaaaaggatc gatgggtgct caggccagtt     40440
     ccatcggatt tactaacata acaagacaat gatatattgt aagaaaacgt acgaacaaag     40500
     tagaagacat agttatttga aaaacacgaa gcatgcaaaa tcttgaaagc agtagtttcc     40560
     tcctcccttc tcttagttca tttggtgctc caatttaatt ctgcagcaag aggacaacat     40620
     atataaattc tgtctaacat cgtgtgcgac tgtcccgtac acattggatg ctatggtact     40680
     tgcagatgaa cctagcttgt tcaagatttt tggtgtttat ttcctatccc agtgggctaa     40740
     ttttggtaag taatttacgt aaagaaacct ccctgcttgc tactaaaccg aacagaattg     40800
     tcgcattggg aaataaaaat tcttatcctg ccttttcttt tttaaagctc ctcctgtact     40860
     ctctgctgaa aggacttacc tctcaattgt agaggattaa tgggataaag ggacctcccc     40920
     cagcgatata tcgtttctca cctcttggaa acagcatgct ccttctactt tttctattct     40980
     aattgctttt ctaaattaca aaagacctcg aagtaagaaa atcctttttc attcaattgt     41040
     gctacacgtt acaatagtaa aaaagcacct ttcctagaac aaaaaagtaa attacgttta     41100
     ctctttgagg ggaccacatc ttctacacac atttttgtac tttcacttgc catctctgag     41160
     taatctaaac ttgcaattca cgtaattact ccttcaagaa aaaaaaaaaa attatagaaa     41220
     ttttgaaatt agaaggttcg acaattgact agtctattct cttatattat atttctcaaa     41280
     acagcattaa taatacttga ttatggtgtt ttcttgctag ttatccttta ttggtcgtgt     41340
     taatatcttt ctttcgaata atttttcttt tatagtttct ttatgttctt atttgaattt     41400
     gagatttaat tcaagttttg aaataagaac aggttaatca ttataataag caaagtctta     41460
     ccatagcaat agtttttttt ttccttcaca gaacagagct gaaccttttg ctttcttctt     41520
     ctcctaacgt gtaagtaata ggtgctacca attaaccaca tccgaaggga tacaatattt     41580
     gttaaggtga aatccaatcg actgtccatt accggagttc cttcaatata ctactacgct     41640
     cattagaagt gaggaaccct ctctctgtgc ctctcttttt ttcaacaaga acaaggaata     41700
     gtgtttatca aaacaaggta tcgactatat caaggacttt actagggttg tgctataaca     41760
     tctaattcac tagcaactcc ttttggtgta cataatatct gattttggat agtgagcttc     41820
     actttacggc tatttcgacc cttactgaag ttcttctgtt tagagattag ggaaagaaaa     41880
     acgactttat tttacttagg aagtttcaag gcatacgatt ataatcgcgc tagtttcaaa     41940
     ggcatttcga agaaaaacct taaactattc ttcacgctga tttcctgcat cgagacaaag     42000
     gagaagaact cttactgacc aattttcatt ctttactatc gaattgagtc ttcttgtctt     42060
     tcctcatcag gagaaaaaag ttctgttatc tactatagag ataccaagac aagtataagt     42120
     tattagctta ggctttattt gctgacctgc aattccattc gttcaatata caaactctac     42180
     caaaaaacac agaagagttc tgaaattatt ggcaaacaga aattccagtt tttctttgtt     42240
     actgcattat attttttcac ttcacattct attatccttt tttttgtttt atttttgtta     42300
     agaaactcat catattattg ttccaattta attttcattg ctaactcccc gagaccattg     42360
     attatttgtg aagatttcgg agtgtttgat ttcgacatta taatctacac tgcatatttc     42420
     atacctataa tctttgtggt gtatttatca attgttggat aatataaaga aatactttgt     42480
     atttttcaga attataacag gactttattc cattactttc tagctggttc ttggaggtaa     42540
     cacattaagc aactaatata gtcttttaat ctcttcattc aacaaacccg gtttatctcc     42600
     attctctgac ctgaatttta ttaccaaaaa aaacgtggag aaaagttagt caactaaatc     42660
     atcacgcaca ccaaaaatga ccgatacaca acaactgaaa atctctgtac cgcctcctcc     42720
     tatagtttca gcaccgggag gttcaacacc aacacagagt aacttctcaa ctccatcaaa     42780
     aagaggtcat agacataaga gatcattcgc aatttcaggg gattttgagt ttttgaaaca     42840
     gcctcctgca actgctccaa aaccctccat tcatacaatg tctccagaac ctcacatact     42900
     cagcacacca ccaccaaaac acgagcaatt cagaccaaac acgcaacctg ctgtatcttt     42960
     tgtaacacaa caacatgaaa aatcagatta cgagcttagt tattcagggt ctggcactgg     43020
     catgaatgaa gtatcacaac gaaatctctc gccatttaaa gtacctccaa ctgttgcaaa     43080
     aggaactaat ttattaacac caagtccaag gttttttgta agtgaagaac cgagattctc     43140
     atccccatgc aaaggtgttc ctgatgctat aattaacttg gatgatgtgt taagtacaac     43200
     gaagccaaga tcattcaaat ctcacagaag gactgagtct gcacctgcat ttcttgaaat     43260
     tgtactgaac ggtaacaatg gttctgctta taatgatgca gggctgatga ttaaggaaga     43320
     ggacgatata tccgaaaata atgacgctga tgaagaaaag agaagtgtat ctgaaaactt     43380
     atctaaactt cccacaagag cgcgatctca aaatgataga acaaaagata gttcagatta     43440
     cttgccatca gttttgctgt cacctttgag acctaactcg ccattaaaac aatactccac     43500
     taaatatgcc agaggagcta atgataacga aattgcggaa aagactttag acgatggaga     43560
     tgacacaaca ttacaaaatg aggctacaaa caaatataat tctttaaaga ttaagagaca     43620
     aaagcagagg tactctcatt acacaagaca attacctacc aaagtggcag gaaatgctat     43680
     tcaatcacaa accttgaaag aacaaaactc ttctacgtct ttatcctcat ctaataattc     43740
     taaatctcct ctttcagttg cccttactcc atcaaagaat ggtaacacgc cagttacccc     43800
     tgcatctttt agtgaaagca atcctaactg taatagtgga cataacaatt ataataactc     43860
     aactcatatt acgggtagtc actcgaaagg tttagatgct cctagattcc ccatgagtcc     43920
     gttcagacct tacgggagca gtactacggc acattatcta gataagggtc accaaaacta     43980
     ttcaaaatac cgcagaaaca gtgcaggatg tgtatccagc tcccaaacat ttgcttatca     44040
     accacaagtt tatgatatgc cagaaaattt aagggactgt ggtgtaaaac taaccgagga     44100
     tgaaggttca aaaagaacca gctctcctac tcttgaagat aacgaaggtg aggaaaaatc     44160
     aataagccaa accatatcaa ataccacctt tgatcatcaa acagatcaga tcatggataa     44220
     tggtagtaga aacccacttt cccaagttag ttcaaattct actactaatc ttcgcagtgg     44280
     cactgatagt agacagttat cgagtgaaat acttcttggc gaacccggag aggctgttga     44340
     cttatcatcc ttgaactcaa gaactcgcga agctctattt ggattggttt ctttgacatt     44400
     tgatgacaat agtccatctc ctttaatagc ggaaaaaact gggtcaagtt atgcatctag     44460
     caaacgttat gaccatccac agtttcatga caatcgacca gttacaccag atccaaatac     44520
     tagagaaaac aggcatatta gtgatggtgc tattgagtcg aaaagcaatt ttagtatcaa     44580
     atccacacct agatcatcca gtctaaataa agatgaaatt caccggcaag atcccggaaa     44640
     aatgagaaaa catagatcta agttcgacaa atttatgaat atgttcagta aaaaatgaaa     44700
     aaaaaaagac tattactttg tatactacca caaatgacct aagcgaccat caaccgctcg     44760
     aaataccatg gacttcagca ctgtcatttg tgcttatatt ttgtatgatg gatctaaatt     44820
     acctatatag attcagaatt ttaaatactt tcgtcatgaa aacaataatt gcattgatat     44880
     atttctaaca gttatttgat acccaaaaac atcaatttct tgaaagtaat caggaaaact     44940
     gatattcgaa aaactattat tttctgcggc aataattgac atccttctcc cagttaggaa     45000
     gaatgtggat attgatcaaa aaaaagtctt tatacgtttt aacatagatg gttcatcaat     45060
     attatattaa tattctataa tgctttggag ctcataattg cttttttaag cttatatata     45120
     atggttagcg gaaataacag taagtcccac aaaaaaagtt gttagcctta ataatggtac     45180
     tctgttggct ttgttccggc agtgtttggg aagccacatt ccaacaaaac gtcattaatc     45240
     aattctggtt tctcggtgat cttttgaaag acatcctctt tcttaactaa aaccaaacca     45300
     gcataaccaa cagcattgaa accaatttct aaggattcag cctgcgtacg aaaacgtggg     45360
     atcaaacata tccatttctt tgtcaacaga aagttgtaac tcttttccat gtttggtttt     45420
     tcattggtcc aatcttggaa gaaagtcagc gctctttgca acaaggaaat gtaacacata     45480
     gccatcaaat cttcatctac agaatcactg tcttctggca ttggcaaaac atagtgagca     45540
     aaggacactt tatcatcttg caaaggttct gtcttgaagt ctggcaagaa atgaggttta     45600
     cctgcacata ggttatcttg gaatgggaca aaatcttctg gtagagctaa catttgcaaa     45660
     tgtttgtggt cctgagatga gccactttga ggaccagagt tgtagaatac catatgtctt     45720
     ttgctctcag tcttatcaag agtacacaaa agcttgtaag caaccatcaa ctcaggtggt     45780
     gtcaaagcag tattttggtg cttgaattct tttgtaacca acaatgtgtg gttggcaatc     45840
     acagggaatt tattcaacag cagtttgaat tgaccatctt cattcaaatc ttctaaaatg     45900
     gtcaattctg gttctggttt ttcaaaagga tcagtaccat ccttctgggc atcagcacgc     45960
     tcaggtttct tcagcaagct aggtgtgtaa ctaattacaa agttcatacc agaatcatca     46020
     tcctttatag ctttggattc agtctcgata aagtgcagat gatcattttc tttagcactc     46080
     ttgtattttt gagcaatcaa actacctaca gtttctggaa tcattttgcg tataattgaa     46140
     ttgcgtctta acactaatct ttaaacagag cttcttacaa caaaaataat gttgctttca     46200
     gtaaaaactg gttcaatatc tgtgaaaagt aatttctaag gttgagtgta atgctctagt     46260
     taccaacaca ggtgaaatca tagactattc accagtccgc cggtgatcgg tctcaattga     46320
     aagttagaca tcattattgt ctgttactct ggctatttgg gaaacatctc ttccattcaa     46380
     tgctcgatga ggccttgctt cgaattagaa aatgtagttt tctaacaaaa ccccgcagaa     46440
     gttagcatgt agacttgaag aggtattgtt ccgaaacttt ttcacttcat tcaaaatttt     46500
     ttcaaaaatt cgcagacaaa ccccgtaggc aactgggtat ttctgtcaat ttatcatcat     46560
     gggtgtcttt accacgaaat acttcgaatc ttccttcttc gctcattaga tatatgtgcc     46620
     accaaagtca cgtgaccaac cctattgata ttattactct ttaacttttc catcataccc     46680
     atcgggataa agtagcactt tgtcttgtac atttattatt tagatgctgg cgtcatcatt     46740
     atgttttcta aaatttaaat ggtgtattct tttggactta ctgttcgcta tatcaaaggc     46800
     taaacgaagt atatccagaa tggttaagtt tgtagtattc aataagataa caggaaccca     46860
     tgagggattc aaaccagttc tgactatgat aaaattctga gctaatctaa aaatagattt     46920
     cgttttgggc tttggcggaa ttactggccg attagaatca atttcttatg ccgattccta     46980
     ataattacat tcaacaaaca tttaacaaca aagggtgatg tacatatact tttcttgttt     47040
     gtgtcaacag ttccagaaca ttcagtatcg tgtctgggcc tgttctacca ttttagtttc     47100
     gcctccatta atatcaaaga tactggaatt cacgtcatca atgtgccagt caaaatagag     47160
     gaagttttca tttcatacat acaatactat taggaatagt catctatttt tgtccacaac     47220
     aaaaattgaa ttaattaccc cattaccaca acacaccaat cattgaaggt cctccgttaa     47280
     ttagtaacat agaattccac acagtaagat gtcaattttc tttttcaggc attagtttta     47340
     cattttttac atctttagcc aatatgtttc cccgaatcgg cattgtaata gtttaattag     47400
     tgtatattta atgctatgac gagaccaaaa aaaatcatag ccctatacag tgaaaataca     47460
     acaggttaat cctaatacaa tctgtgatta aacatttcct ttaggttcag aggaatacta     47520
     tgtaaatgaa ttgggcatcg ttatgtagtt caacagggtt cacaaggcaa cggaagtcat     47580
     gtgatggtta tttatgattc agttcagttc gtttcccccc cctctgacag caattatcta     47640
     aggtcccgaa tcaccaattt gggaatccgt cttggcacaa gactacaacg gaaatcaatg     47700
     gacagggatg atacgattga ctcgagaact catctatgtt tcaaaaaagg cagtaaattt     47760
     aggagggtgg agttagaact ctcatgagta tcgtagcaat ggcatatttt actgctgaat     47820
     gacaccgaca acatagatga aagtgccgac aggctagact tgagtcacta ttgaatcatg     47880
     ccattactct cggataccat aaataatcaa attgcgataa gaacaaggaa tttatccgaa     47940
     ttgacatgaa ctctaaacga gtagtatgat catatttgaa ttaattaatg gtatatcggc     48000
     aaatttatct aaatttttac cagtcatggt ataccctttt aatcatggac atccacctat     48060
     ttatttgcgt aaattggaag accatgttag gcaatgtaat taagagtaat ttaagcattt     48120
     ttttcaactc ccctgctatc aacactatta aaaatagtga ggcatggata tgtaaagtta     48180
     catccctacc accctttcct gagcaccatc tttatttaaa ttttgaaagt catgaataat     48240
     tctagacctt gttaaaaatg taattctaaa ctgaaagttt ttgagttccc tttcccagaa     48300
     aaccttcact aagagattgt ggttaaaggt acattaacaa ttcgcatcat tatactttca     48360
     ccgaactctg gattaatagg ggtggagaga ctgcggttct tgcttgtacc tttaagtcaa     48420
     ggggtgctta ttctacaacc cttatccttc aaacgaaatc gggcttattg atctccctaa     48480
     caaagggtta tcaaccaacc tgatgtttga aatgcggtta tcagctagtc accggcaggt     48540
     ttgcacagga gaattacaaa aaattgttgt agactttacc attgatgttg caaagtgcgt     48600
     aactcacttt gtaaagttac aaggaacacc catctacagt tatgtacccc tgcaaattta     48660
     ggggaaaata agatgacatg aataagcaca aaggcacaac gcaaagaagc caaagggggc     48720
     atatttttcc acatttttct gtgaatttta gtttacgcgt cttttgccac gcgtcgcatt     48780
     gtaacattta ttcccgaaga ggtccgctag caaaaagaaa aaggagtatc cttggagccc     48840
     atgtgttcca tgatgagaat ataccatact acaaaccaca ggccagaatc ttgtatttca     48900
     tacttttcta atagtaaccc ctctctcaag gatattgcta ttacttgcat tttcatttgg     48960
     ccacttcagc acaaagggca aaactcgaaa tttagtattg tttgttacaa cctgtggagc     49020
     gtctttccag cagagaaaac cataaaggaa atgttcatct gtaaagacgt cgcacccaaa     49080
     agcacctagt atactttttg gaggagaaaa aaataatctt gttattttag cgtgaatttc     49140
     aaaatgttct acgtaaaatt ctgaaccctg aacaagattt cttattgacc aacttcgaat     49200
     atcagactcg ctcaactccc cccccactcc cagcagcgtg cttgtttcga ttgtgcaaca     49260
     atggaaagtt ggtggtagtg gggggagggg agtagacgcg tcttgagaac ctgttctact     49320
     aacgcgagat attttctttt tcttgttagg atcccagttc ctttctttgt tttcatgaat     49380
     ggcggtgggg gagaaagagc gagactcccc ttcgttacag gatgcagagg aagtaacgct     49440
     gcatgccata ccatacacgc gagaaattgg tccttttttt agatctctgc aacaatttac     49500
     tggcatataa ccagaactat gaataaggat acagcattcc cttctaattg ttccgtagtc     49560
     aaatcactgt acaaatcatc tcagaatcac ggtaatagaa cgcaagtcga tttttgaagt     49620
     gggtaacgct gtattatcag agtcgtgcac cttcatttga cagaactacc ctcttttatt     49680
     atttcctccc acccaatact cgctagtgca ggtgcttcat ccttctatgt tcccccccat     49740
     atagtcccaa tacagaaaag tcagcattac actaacattc tcagaaggag cggtagatgc     49800
     ataatttctt tttcaagttc ctttccttgc tttacccaag taacaaaccc atgcacggaa     49860
     gaggtcaacg agagtggggg gtggaggcta agagctaagg gagcgagggg ggtgacgagg     49920
     gggggtgagc gaggggctta tttgggattc gaagatgccc cagttgtaaa tatagagggg     49980
     cactagagga gacaaagaat ggaagatata atggcccccg agtgttcact cagtaaaaga     50040
     gtgtagaagg ccgaaggtag cgatagcaag gggggacaat ctggccactg aaatcaatag     50100
     accaaaagga gacatacatt tggacccttt atgtgcaaaa gagggaatta taagcctgat     50160
     ttggaaaggg atggacgggg aaggaggaag tgtaaccccc taagaaaacg gcctagaaaa     50220
     atcaaccttt gtcccaaaga ggcaaaaaaa agaaactagc actctctgcg ctatatattc     50280
     acagacaaag caggaaggct aagtataatc tgtctttagt atgacacaca tacaacgacg     50340
     agacaaaaaa aaagtaacag gatatgatag taatctttgc agcgccttct tagtatcagt     50400
     cctgaaaaag gaataaaaaa gaaatgagag atatccgaaa gaagatttat ctcttcccgt     50460
     cacgactcca cagaaccctg tgtgaaagaa atgggatcta tcgctccctg ccatccctgc     50520
     catccctgtc tttccttttt ccttcatctt ttcgcatttt atcatttttc cctgccctcc     50580
     caaaaggagc gatttccctc tcgggttcgt aggatgcaca gaatctactg caggacattg     50640
     aggggtggtg gttgccacca tagcagacta ggaaagaggt ccagaaatgg gaagcctttt     50700
     cttctagaat ccctgtgttc acttctcccg caaacaaagc aagtaggact agtagaacta     50760
     gtagctagta gaactagtag ctagtagaac tagtagctag tagaactaga agagaacagc     50820
     tggaagggaa gtgtctttgg tgtctttcgc taattaaact acagaactgc cacttcgaga     50880
     atcatcattg tgcccaggtt tctgtgtagg ctagtgatta taacgcaaaa atgaaaaata     50940
     aaaaagaaaa tttgccatct tgccaatttc ttcaatctta tctcttgtcc tgtcttcttt     51000
     ctttttgtct ctggagcgtc tgagaagctt gcaaacacgg gaagagggtt ctccagcgat     51060
     tctatgggaa aagtaagtag aaaataaata tttgagagca gtgtagtggg tgagatgttt     51120
     ttaatgggca tacaagcttc tgaactaaac taattatgac caactttgaa ttattatttt     51180
     cttgacaaga tatgtgccct ctacacttgc tactgcacaa agagtcttgg taatggcaaa     51240
     caacagctag tagctaggaa ggtaaaaaaa ggaaaaattt tccacttctt gaactgtcaa     51300
     taagcaaact tctataccag atgaagttag aaaaaaaaaa gtataaatac catcctgcat     51360
     tggtgttaaa tcctggggtc tgtttaaatt gattccctgt tttactcaaa ttagttattt     51420
     attgtttatt ttttttacaa taaaccaacc aactaaactc attacacata ctatactatt     51480
     aaaaatgcaa ttcaagaata ttgtcgctgc tgctatcgct ttgggtgtcg cctctgctgc     51540
     taacgcctcc aacatgtcca acaagtccaa ccactctaac gtcaccacca ccaagatctc     51600
     tactggtgct gctaactcta acgctttgag tgctggtgtc ttcggtgctg ctgttgccgc     51660
     tggtgtcgct ttcttgttct aagttgactg ttaacctact ttaactttga gttttttttt     51720
     acatcaactt tattttatga gtttaacaac ttcaaagaaa ggagattcta attctccttt     51780
     ctttaccaat tatagaacac cattttaatt tttttcaaaa atttttttta ttatctaaac     51840
     aataatatta ataatatcct aagagaaaga gaaaaagaac gatcactatt tcatgtttga     51900
     taatataaaa ctaatacaaa acgtgaattt tagagaacaa gaaatgggga ttatctctgg     51960
     aatctttctc ttttttttgt actattagtt aaggaataaa agataaagta ctttttctgg     52020
     gaaaaggtat aatttatact tcaaatttca aaaaaaacaa agaactatac ttaatattta     52080
     aaagaaatac acatttaatc taataaaaat ctttatattc ttttaagaaa gggtgagtca     52140
     acctaccaat atcaccatcg atgattaaat tgacagtgct aagtatttgt tttcattttt     52200
     tttctttaat tcctcattga agaaactcat ccgtccggaa gggtcgggct ttccacattg     52260
     gagcagaaaa ataaaaggta cctgaaaagc ataaaaacat agagagacac atatacacaa     52320
     tctcagtaga actgcacgca ctcaccactt ttttttattt tgccacagtt gttgtcattt     52380
     tcctctttta ggatatgctt atcctaaatg ggtaattctg atactgcgga ttagattgac     52440
     acgtcttcac ttattgctct gaacgaaatg ggagtctact gctacttatc ctgcctttac     52500
     gaggttaccc ggagtgagta aatgatgttt ccgttagaag tttgctgggg tcacatgatg     52560
     acactaaaac tgcaagaaaa gatatcaatt taatgtatat tcttgaatta gcggttactc     52620
     tccactgaaa agtaaaaaca ttgttgtttt tgtgttacca atggcagttt ctctatatcg     52680
     tattcaaaat tgaggtgcct ttgacttccc aattgttgtg ccaaatacaa tctgtcttgg     52740
     ctaactaaag tgttttgcga cactagtgtg tcataattag aaaatcctct ttaagaaata     52800
     acatgtcctc gtatacttgt gcttcgataa tcacaagaca taagacaaaa ctctcactta     52860
     tttcttgaaa aaccaacaat aacaacaaca acaacaacta gcattggtat acataatgaa     52920
     gcttattttt gttgcaacac tgttacttac atcaatctct gctcgagtaa ttgataacta     52980
     cgaggaatta ttgactttac ctgctattgt acatgaggat ctaattatca gatcttgccc     53040
     aacttccttg caactagaaa atttggccca agttgatggt gatcttatta ttgagaattg     53100
     ttctcaatta gctgagataa atttacagaa tttggattat gttcaaggtg acttgaagct     53160
     tcaaaaattg acctctttag tcatattgga tttgccaaag ctgaaccatg tgagatcttt     53220
     tgaattgaga attttgccga ttttaaactt gatgacatta aacccaaata tgatggttga     53280
     gaaaaacttg atcatctcag atacatctct cacaaatatt gatcagggag agtttagcaa     53340
     tgtaaaggac ttggatattt tgagcatcaa caataaccgg ttcttagagg tattcaaatt     53400
     taaatcaata aaaaaaatag cccaacaatt ggcaatacat gcaaatgcaa aagaaataga     53460
     aatagatttg ccagtcctac attcatcaag aaacattaca ataagagata cctcagcagt     53520
     atcacttcct tccctagaat ttgtaaaaac atctttggaa ctcattgaga atcaatttag     53580
     ctcattggat ttctcaaaac taaggtacgt tggaggtact ttagggataa tcaacaactt     53640
     aaaccttgaa agagtggatt tgaacaactt aacggaaatt tccggtggtc tcatgatctc     53700
     acataatgat aagttaagga aagtgaattt cttatcaaat ttaaagcaaa ttggaggagc     53760
     tatccatttt gatggtcgtt ttgatgatat cagtttccaa aacttgaaat tggttaaagg     53820
     tagtgcattc attaaatcaa catcagctct gctggattgt caaaaatgga tcaaccctat     53880
     caggggcaag tccgtagtaa gaggagggaa aatcgaatgt gtcaatggta aatcgcttca     53940
     cggaaatcaa gccattcctg taggtaatcc tatattaccc gaaaaagtca atcatgagaa     54000
     taaaaatcca ggaaataaag gctttaagaa tgcaaagaca gctacagaat ataaccaggc     54060
     caagccatta atgaatagtc taattgagtc cgagaatagc tcaaacaaga agagactatc     54120
     tctcttgaca aattttttac tgatgtcgag tgcactattt ttttagatga cctgtacaga     54180
     ttaggtaacc atattattat gcaagctgta acagattatt agcatttaac atgctattat     54240
     ttttttggcc gtcgatattt caagtctatt cttcaatatc atttttaaat aaactgggat     54300
     tttgctttat atattcgact ataaccatgg gaatactgtc tttaagatct atagcatcac     54360
     tacctttgtt gttaacaaca tccctcacca tagaggagga tatgttttta actgattcat     54420
     tgaaactcag tatatgtatt ttttcacccc aatttgatgg aatttggggc tcttcctcac     54480
     cattgataat tttattaata taatcttctt gaaaatccaa tgtatactta ccatcctctc     54540
     ttcttaaaca acaaaactcg acagattcca tgaatgatct taaagcctct gcaactgata     54600
     ctggttcata atatacagga ttgaaaattc taatcaaagt atcaaaccca actaaaaaag     54660
     tgatcactgg catctcaatt ccgaaattga taagtttaga aatatcaacc aatttatcca     54720
     caaatttacc atgagttgtg agagcacatg acacacccac ttgcattcca ttccagtttt     54780
     gtattgaaat gaaatcggca aatcgtttca tcattgccat tcttttgtca aatgtggcgg     54840
     gctttggtct cttgtctgca ttgtttgtag caagtaatag aagaacatgg aaattagaaa     54900
     aaccgcggtg tccataaaat tctattgcat tctttactaa tgtgaaatga gccaaatgtg     54960
     gtggattata tgatgaatcc aatactagca ccttagtacc actattaata ggtttaacac     55020
     ctaatgatcc atcgaatagg caaaactgac cattcttagc aacaaattct gtatactgct     55080
     gatagtagtc cattgatctc tactttattc cataatgcat ctaacaattg gtttaactga     55140
     cgtagtttgt aaagtcttac tgatgtaaca tttcatataa agccacggat tgtaaaaaag     55200
     ccagagcttt tcgatatctt tcggtaacaa ttttatactg ctgtaaggta gcgagatatt     55260
     gcataaataa gaaagaacaa aaaatatgac cttagtgcat taactttgaa ataagatgta     55320
     ctcaaaagtt gcagcatatt aacttaaaaa acttatgata tctcgcgtgt tcattcaata     55380
     catatttcta cttacaatat attctaaact taataaatgc actctgttag taatgtcaaa     55440
     ttagtctcta actgtccaaa tcgctttcaa tttctttgaa gcaccatatg gacgtaaagc     55500
     cacacatatg agaaacaaaa caccaattgt agtcaacaaa gttccttttt cgaatcctgg     55560
     gctcatgaca tcgaattgac cagatggcgt tattctagta cagaaaacgt caagaccaat     55620
     ggcacaaacg tttgaagtag attccaaatt ggttgcagaa gagacaatct ttatttcttc     55680
     acctaagatg acatctctat aatgtgatag aattaaattg tctgttaatg gaatacctgg     55740
     aacataagga gttgccatga attctttctt gtcatcatcc gacattttag attcttcgac     55800
     tcttctagca ttcaaaagaa atttagggac atatgtaatt tggccatttt caagaacaat     55860
     aataacagct ttagtagtaa tatcatactt ggtttctgac agttctaatc ttttaataat     55920
     gtcaggaaaa taaaatgtat tagcaatcgc ggctggtttg tgaacaccag ccattgcttc     55980
     agtcaaccca gtattgttag agaacttttg atttggtgtc agcgattcat agagttccac     56040
     tacaccgatc ttctgttctg gcagtggagc catgctgaaa taactgtaaa tataccagtt     56100
     ttcaccaaat attatattga ccggaaaatc agtatccatt ttatcatcat gaaattgtga     56160
     atgcaatatt tgccctgtta ccgtatccat taaatttgtc gttagttttt gactttgctt     56220
     gttgacaatc gcaaaggcag ctaagttggg atataaatat ttgtacagaa catcccttga     56280
     acccagtacc gttcctacat tgacagttct cttagactca cgttgtctaa aagatacaat     56340
     ttcttcgtca ggttgaacct tatatttcca tgttgacttt gcattaccat ctttatccac     56400
     agcgaatccc tcaactgtga atttggtgtg atctgtaatg aaaactggat tgccatctaa     56460
     tgagatacgt ttctcagtag tggaaataac tttctttgaa ccgttggtaa atttaacaac     56520
     aaatttgtct gttgaattat ccactaaaaa gggctgaaca gactcaatgg gggagccaat     56580
     tgatccactt atagattcct taatatgcaa tgagttgtct actttgtaaa ttttgtatga     56640
     accatctttg ccaaagacag tcagatctct aaaggcatca ctgaagaaaa ttctaatagg     56700
     attattgatt cctgtggtta tactccattt aactgcacct ttgtttaaca tgtctagtgc     56760
     ctgcaacgcg ccattgtcag ttatcactat aagttgtttc aaatatccaa atctcatatt     56820
     ctgatcctga attgtagcca agtcttctgc atctgcatcc attccaagca agttagtaat     56880
     aatctttcca gggttataat tgaacctttc aagatatttg ataaagcgtt cagaattggt     56940
     gcttaacctg tacaagtatg ccttccatac ttgaggaata gacgtttcaa cagatatttc     57000
     atgttctgtt ggctcaaggg actcatctgc aacatctaga ataacttgat caacaatagt     57060
     acttaaggat tcatctctag tccacctttt actgatggtg tcattcagat aattgtagaa     57120
     cgcaaagcgg tttccgctat atttcaccag aacttccatt tttgttgcat aatctgagtt     57180
     aaaaaataga atcttttcaa agttttcatc taattcaaac ttaaatacgt ccatgctcga     57240
     tttttcatcc actattctaa cctcagactt ctctactttg acattcttta agttaggatt     57300
     acacgaggat tggaattctt tcacttcaac accgacttcc ttcttgaaac catgttgact     57360
     atcgtagaca tccactattc cgtcctcatt taataagtaa atttcatctc ctatatgcat     57420
     gacatcttgg atatgatatg gaagcaattc cctaaatatg atcgatccac tgtttttgtc     57480
     aaggaaactt aaaagcgatt gatccctcca ttcggacaca attgctaaat gattgctttc     57540
     ctcatcagcc ataacacatt tatatgctga gcctaagttc tgtaattgcc aatccacaat     57600
     ataggcctca tctgaaaaga cggcatttag tggtttaatt agcgctaaaa gaaagaagag     57660
     atacccaatg atatcggcca ttgttatcta tcctcactga taatagtcgc agtcgagatt     57720
     ttaaagtttc tcaattctgt tgtgcgagac actttctaga attagtctgt gtgttatgca     57780
     acttaaaaaa ttgaattttg agcaatgttg ataactgcgt caatcaaact taattaccag     57840
     taagtttctt gccgagatag gaacttcttt ttactcgact accaaccgtc cttctatgag     57900
     tttctcattc tcttgtttct gacttatttg ggatgtttcc atctgtcgct atatactaag     57960
     tactaaaata atatgggatg ccagtatttg gttcgagatg agttgaatga agatatattt     58020
     ttatatttta attaaccgtc acagattagc attagactaa tgttacttgg ttatactgac     58080
     ttacttagat ttatgctttg tttagaatcc ataatctgtt aactatctag aaaaataatt     58140
     acacatactg taaatacgta aatttcggta gttgattttc gaaaaagttt attgacgagg     58200
     ttcttcaggt ttgttactat tttctggtat tacacctgcc ttgtcgccta tagtagcttc     58260
     ggtatccatc atgctatttt ctgtaatacc atcctgatta attagtacag taggaatgaa     58320
     tttgatgctc aatgaggttt ctaatgctaa atttagccac gggtcataaa gtgtccaaat     58380
     ttcattaagg tctatatctt ccggaactgc cacatcttct tctagtatga tagatctatt     58440
     ggcagcagct gaaaatccat gtctctgagt acctttcggt atctttgcat ttccagtctt     58500
     aatgctcaaa tcattgctta attgatcttc ggattttagt tcctttaaaa tccgacttct     58560
     attttgagca ttttgatctc ttaaattcga tgtctctgtc tttattcctg tcaaaaagcc     58620
     taatgctgtt tcattggcgg ctctcttgcc ttgaaaatac tcaaacatat caaggtgata     58680
     ctccaatcgg tcaagaaatt ctgaaaaagt cattggctta tactctattg ggccaaacca     58740
     agaaattatt ggattttcag cctcagtctg tgccctcacc aatgctacac tttgtctcac     58800
     ttctggcaca ttagttggca tgatgttccc actaacagca tccttgacct tcactttggt     58860
     gggatcaatt ccctcatgat agaatttcac aatattattg aagaatttct tttctcttac     58920
     cgtcttggct tcttcacacc aggggtcata cctaaggatt gtaagtctac atgcctcaag     58980
     catagattgt gatagtataa ttgaacctgc taaaaggtaa aacactttct tgaatattaa     59040
     ccaattgtct gatttgaaaa aggacttcca attgttttta gcttcagatt ttgccattat     59100
     ctcactctga tgtccagcag agctcaaaac gggagatgca actacaggtg cagctgatag     59160
     tgagggggtg ttgcgattga cattagttgt gttaacaaac atatccccat gagtagtaga     59220
     gaatctatta agtgttggga aatctgcaat gtctttctta actagaggtt tacctgatac     59280
     tgcctcctgc tgtgtgaaag ctgaattata taattttggc tcattcacca ggacactagt     59340
     tggtcgtata ccagatttac cgacactatt tagtgcccca ttcctatcta ttatgcgcaa     59400
     tgatttgaat ctgtaaaaac ataatagccc aaccatactc tgtactgcta ccagagtcca     59460
     aagaccggtc ttattgtccg atgccggcac cagtggcccc cacaatttga gaccaagact     59520
     tggtcgcacc caaaactttt ccacatctgt ttcatccttt gaattagaac cgaggagggt     59580
     tggcttctcc tcattagcgt ctctcttgtc agattttcct ggcggtgtaa atatacccat     59640
     gatattctcc cttatatatg tagtgttgga agcagaaaac agtaacaata actaatatca     59700
     agcaaacgct cttattttag tcgatgaatc acttagattt tcagttacta cagtccagat     59760
     caatgaaaat aggccaatgt cctcttgagt gaactatttc cagtctattg tctttttcca     59820
     ctattaatta tcttaaatcc aacaattccg tagtttttct atgaagttgc cgatttccgg     59880
     ctttaaattc gtcaaattaa aatggcaaat ttaatatgac tggcaggctc tgataggagt     59940
     aacagttgat ggctgtgctg gtattcgaag ttattagtgt aattttagag aatagtgaac     60000
     aaaaagacaa attgtatata aacttaaagg attttgaaat tgctttccat cccctgatat     60060
     acaacattaa atctatacta tgtactgcta ttctattagg tttgatcacc ttaataaatc     60120
     tgtataaaga atttggaggc aagagaaata attacaaaat ctagatattt actagcagtt     60180
     tgaagggtca aaatgccact gtagatcgac tacagcaaac cccttttata attggcttca     60240
     gtcgcaactg atagataaac taaaataaaa cgtgaagaaa acatcatgat aatgagttaa     60300
     ctcataataa aacataataa attgagtgaa ttgaaaataa agtattgtag aaatatctcc     60360
     tttcggagcg gcctacaatt catcatcaaa tccatcctca tcttcattgt cgtcttcaat     60420
     ttcagcctgt tcagcagcct tcttggtctc taggaacttc ttgtgtagag aagaaccgtc     60480
     aataccgttg gcaccgtttt ctttaatgaa agtcaagaag gagtccaaag atctgtcacc     60540
     ttcgtaaaca acaggctcag cgttcttacc agctgggtac aacaatatgg ttgggtaacc     60600
     agcaatttcg acattgaaaa tgtcattggc agtagcatca acctcagcaa taacaacctt     60660
     gtccttagag gatgagtcgg aggcgtaagt gtctgccaat tcttcataag ttggagccat     60720
     cttcttacag tgaccacacc atggggcata gtacttaaca agaacatcct tcttaggatc     60780
     agcaacaatc ttgtcgtggg tcttaccaac gatcttgaaa acgttgcttt cttggactga     60840
     tggaacttct tcagacttga caatagcttc agccttacca gataagacat tttcaaccaa     60900
     tttggtgatg tccttggtct ttaacttgat agccttgttc aacttagcga actcttcttc     60960
     ggccatttgt ggtagaccga atttttggtt gctagtcatg ttgtggatag cgaacaatgg     61020
     gaattgttgc ttcatgttca agttctcggc gtgtctacca aattgcttgg catccaggct     61080
     gacaaaagcc atcttaccac ggtacttctt ggccaagtca gtgaagaatt ttctattttc     61140
     ttcaacttca gatggttcat tgaagaagaa gtaagctaga ggcaaaccac tttctaagta     61200
     ggcattgaaa acttcaccgt tgatttcacc aaagaatggc aaagattcaa ctttcaacca     61260
     ctcttcgaaa acagatctgt ccttagccaa agtcttgtgg tctcccttga agacaatttc     61320
     ttcagcagag gaaccttcga caggtaggaa gacagagatc ttgttctcct tggatggcaa     61380
     agagatgaag acgtagtcat cagaaagagc gtgggcgaat tggtagaaag tagcgttgaa     61440
     gtcgttgaca ccgaagtcaa caaccactgg aactgtagag ttagccacta aagcatctag     61500
     agcagccttg tcttcgacga cctgaacagc tggttgtgtt tgcttgatca tgaacttgac     61560
     aatggcctcg gcagttctag caccgttgta gtccttggca tgagcaatgt caccgtcctt     61620
     gatcaacttg attgatggga aacctggaat ttgcaattgc atacataggt ctctgttgtc     61680
     atcacagtcg atttgtacta gagagacatt cttgctctta agctcctcag cagccttgac     61740
     gtactctgga gctaacttct tacaatgacc acaccatggg gcaaagaact cagccataac     61800
     caaggagttc tccttcaaga agtcctggaa gttgtcttgt tctagcttaa caacagcaga     61860
     atcagctggt gcaacagcgt cttgtgcaga aacacccaaa gctgcagtgg cagccaaggc     61920
     taatagaccc ttgttaaaaa gcatattgtt tattggtatg tgcttttcac agttttgcaa     61980
     agaatatgac cgctagcaaa cagtccaaga aaatgcaatt tatagtgaca aatcctatct     62040
     cgatcccatt aactatatct ctttatatat atatattaac ctatcttgtc gatacgatac     62100
     tatgcaaaac cttagcaaag acacacgtaa tgagtgcaac accttgagat agagagaaaa     62160
     gaaagggtga caacttcgaa agctgtttga gaaaggactt gcggtgaaag gcagaagaaa     62220
     caccagagga tccaaagcag ttctgacagg aaagtgtaat attgaaagcc tcctcctctg     62280
     aattgcagtg aactagtgag gaaacggacg ccgtcccatt tattttgacg tagacctatc     62340
     aactacagac ggtgagaacg attttggctt ccaagacctt ctgctggagg gcaaaaagga     62400
     ttggtatcgt tgctcgagtt cttcatggtg atcgaaagag aatgcttgtc tcccagtcga     62460
     tgatattgat atttgataag gatcaagagc acacaagcag tatattgagc ttcaacttca     62520
     cgaaagagtt tcagagattc gacactgaag atcctcttaa gaaatcgttg agtacttttt     62580
     tgtaaggcca gtccactctt tttcttgtac ttcttgcttc tgatttattg tgggtggcaa     62640
     atgggttaaa tgaaaggccc tctctcagaa gacatgctca gcaatgctat gcgtctgcct     62700
     taggataacg agatacttcc tgcattactg tctgactgtc tgcttcaaat tccgcccttg     62760
     acgtctatgg acagaaatgc tctggacctc cttcacaatg agaagggatc gacagtatag     62820
     cagtaagcct cgattattcc tattagtgtt tctgctgtca ttgggatcct tcaactgcat     62880
     cagtgaaagt aaaaatagaa acctatatct agaagactac gtttttgcag atagcatact     62940
     aaatcaaaag tatctaccct actatatctt aaacttgtat aacataatgt aattcagagc     63000
     ttcttcattt atgctatact gctgatatgg cactagggaa gaacaatcgg aggcattagt     63060
     cttggggtaa ctgtatttat gccttcacat ccctttacta ttgtagaaac gatagaatgg     63120
     aggaaatatc tttatgaaat atctcatatt aacatctgtt ctatgtataa gtaatttaga     63180
     gacggagtaa atgaagcctg acaaaggaga aatatcttat ggcctggagg cataaatgct     63240
     gaaacgcatt tacacagaat aataattaca tatacaacag acataaaggc ggctcgcttg     63300
     cgtttagctt taccaacctg attctctcaa tgaaatgttg atcttaattt tggcatcatg     63360
     acaaacttaa ttattctgat ctcatttcac aatattaccg tgaaggtgat tcaaactacg     63420
     ctatttgcca tatcgaagaa cttctcttta tttacaattt tcggtatatc atgctacttc     63480
     caccattttc taaaattcag tagcacaata cgcagtgcac ttattaatat ttattgtggt     63540
     gtaaaacatt caatacagaa caccagttct gtatgtctag tgtgttaata catggctata     63600
     gcgtatttcg catcctgtta ggcggctgat caactttgtg tcaactaaat aatgtaagcg     63660
     gaattgagcc cttcagcaat agactcacaa aaataggtca acgcaagatt tatttaagaa     63720
     aaccagaaac tctttcattt ttaccaacgt tatcttctct ttcctataca ttagcactaa     63780
     tatgattttt aatgcacata attctataca gtaaagtaca ataatacgtt tcattcattt     63840
     tgttccatta aaataagaca cctattaact cgatctatat agaatacttc aaattatttg     63900
     aaatggcatt tcacgagttt cattcacaac agcaacttaa actagataaa gaagtacaat     63960
     caattattga taagtttgaa ataaatcaag tgaagttgat aaagttatgt aacgaataca     64020
     ccgatagttt acaaacattc aaagtcaatc acttatttgg aacaggacag gaagctggtg     64080
     acgttgtact agcatatcta cagagacctt tctttaaaat atgccttgtg agggtgaatt     64140
     ttaataattc gcaaatacta catcagcaat gtaacaagat atctcaagag ttgttcaatt     64200
     cggaacatca attagctgaa agaatgtgtg catatactct catgtttctc aggttatacc     64260
     tgcctcatct atatgatact ccatttattc taccatttat tgtacaggac tatcccgtta     64320
     gatattatag ccttcccgtc aagtatcaac ggttactgca gttggcagga atttacaatg     64380
     tccaagtaaa ggtgacttcc gaatcccttg catcattaaa ctatacaaat tatagtacct     64440
     atttcatggg ggcttcaaaa aatatcaatt taattgctag ttgctttatc ggagagacat     64500
     attgtagttg cattagggtg acaaattcaa aagccggact acttgatttc agaattcctc     64560
     ttaccaaatt accaaaaacg gattttgatt tccatacaat tgacaggttt gataaattaa     64620
     ttacatcaga tcacatatca gaaactgtta gaaattgctt aatattctta catagtagga     64680
     gacaaatact ttccaaatat cactcactct gcgatttacc caattgtatt aaaagccact     64740
     ttaaacttga tacagatacc atggcccata ttgtgctaga tgagagcgag aaactatcaa     64800
     ttgctaactt ggtaatgctc caacagtggg agctggaaac aaatactaac gatcgacaag     64860
     tgattaaaaa aatagtaaaa gctgtaataa aaagatctgc aactctgagc gcaattccaa     64920
     ttgtagtaga aataatgaat cacataaaac atttaaagga acagaatgaa acatttcaat     64980
     ccgctacgat aggttgtaat ggaagtttga tagaaatatt cccagattat aacaaatact     65040
     tttctgagac tttagccaac tctcctttgg gtccagatat tgccaaaaaa ataaatgtta     65100
     ccactaacat ggaagccatt gaaattggtg gtgcatgttt agtgtaccaa taatgcattt     65160
     ctcacctaca attttataca gttgaaattt gtttatagct agtataaaat tattttaact     65220
     gggccaaaca atttgtattc attgcaaatc caataagtac gtaataatat tcaaggccat     65280
     ataattatac agataacaac cacaaaatca tcgagttatc atagagtaaa tgaatctgta     65340
     cctgtatatg tattgctgat tcatatatca gatgattgaa tgaatcacag gatatcataa     65400
     aagacgttga gactgaacgg ggtatgggaa catcaacaag tcacccttta tgcatgatta     65460
     aactcagttc tcctagaata ttaaagaatg ttaacactat aatttgatcc caatagtagc     65520
     ctatacaaac tacaaatact gagttgctgt tattcaagtg tttctatcag aatcggcagc     65580
     agagtcatac aattttgaga tcaaaactct tcctacacca attgaaaatt ggttgcaact     65640
     aatcgagcgg tggaagctaa gtgttcagtt actggagaat aaacttacaa atatttcttt     65700
     tcaaggatta attttgtatt atagtaatga ctgcttctgc ttcagtacca aatgagagaa     65760
     gttttagtaa tgatgtcact gacccaatgc aaaatatcaa tatgtttgac aaagtacagt     65820
     taacgaaatt actaattcac acattaagag agttaggata tgatgagtct gctataaaat     65880
     tacaagaaga aagtggtgga atacaggttg agtcatccat tgtccagaat cttctcaaat     65940
     ggatacgtgc tgggtcttac cattatatat cattcgtcga attagcacag ctacccttac     66000
     aaaatggccg actaacagat gatcagagaa tggcagaact agtagcacat tatcaatcat     66060
     ttgaatccaa tgatgctggc tattctgaag ctaaaaattc aatgaaaatt gaaaacgtga     66120
     ttacaacccc gattaatact agcaggacta tagatcgaat gagtacaaac ttagaacaat     66180
     ttaatgatgc aattgcacag atacaaacat taaacttatc gtccatcaac atagaacgca     66240
     tccgagcagt tttagaaatt tcaatactga tctgcagaca agtattcctt gagctcatat     66300
     ttgagaataa agattttcac acagccttaa ttttgcttag aggtactata agaagatata     66360
     ctgaagtatg ggatagtatt gatccgaaga ttgaagggct tcaggatgaa cagcaaactt     66420
     ttgcaccaga aattattctt aaagacatgt cttcattaat aacatgccca aatgaatcaa     66480
     ttataactgg actatggcca aactcgctaa ctaaaagccg cgaaaatctt attcagacaa     66540
     tctcaaacta cattaacccc aatgatcttg tccctaaggg aagacttttg acgcttctga     66600
     gacaagctgt gaaatatcaa cgttcaaagg acgtttttaa tttttcagat caagaagtta     66660
     gtaacggtat cgaaatggaa gacataagtg cttcgaaaga gttgaataaa tacaacctgt     66720
     tacaagacaa tactagtaac ttccaaaaaa ttgcgtttga aaatgagaaa accttgactc     66780
     aacactccga tgaagtatgg tatctacaat tctcaccaga cggaagatac ctggctagtg     66840
     tttctgcgga tgctacgact gatagaaaaa tatacattta cgatgtgcag aacgacttcc     66900
     aagtatacaa aatattatca ggaaattccc aatgcattct ttatctatcc ttttctccgg     66960
     atagtaaact tttggtgtca tgtcccttta atgccatcgt aaatatctac tcgattcatg     67020
     cggaagggga acctattgac attaatccag aatctgataa taaaatcgta gctgaggtaa     67080
     ttaaacccat tgattctttt tatgttttac ccggcaaaga gtttaaaaga aatcgctctg     67140
     attcaaataa ttcaatggat ggtgcctctc gagatgttcc atcaaatcaa aataggcctc     67200
     aagatctaat ggccacaatg gaatcaggtt ctccattaga gcctagatca agaagtgact     67260
     ctccttctcg tcactccatt aacccagtaa ggatatggtg ttgtgactgg tttcatacgg     67320
     aaaggcatag tggtaaattt gtagttgggt caccggacag ggaagttgct atatatgaca     67380
     cgaactcttc ttcagtagta ttctgctttt ctcagaatac agttatccca agcagtatag     67440
     cattacaaca aaatatactt ggatctagtc caatatcagg aggaaatgcg ttgaataata     67500
     taaccaggcg cgactctacc tttagtaata atgaaatatt tccaagagtt catgatataa     67560
     agatcagcaa cgatgacaac tcccttatat taatgacgca ccagggtaag attgacgtat     67620
     acgatatttc cagattacca agtaataatg ataattactt tgatatcatg gctgagtatg     67680
     agaaaacaat cataccctta gcaagccgtc taaatgtcga aaaaaatatg acatgtatat     67740
     ccattcctaa accaggttca ttttatgatc cggccttaga ttccctttta cttgtaaact     67800
     tacaatcgag tgaaatacaa ttatggaatt atagggaaaa tatactgatc cagaaatact     67860
     ttggtcagaa acaggaacaa tttattatta gatcgtgctt cggatttgaa aataagcttg     67920
     tagcaagtgg ttcagaagac ggcaaagtat acatatggga tagagtgagg ggaaatattt     67980
     tgggtgtttt aaaagcacat gttaatgaca aaccagcaca gtccaatgga aacatcaatt     68040
     ctaataacaa caaaaagaat ggtaagaatt gtaatactgt tgtttggaac ccagctgatc     68100
     ataacatgtt tgcatctgga ggtgacgatg gatttattaa agtttggaaa ttagttaaag     68160
     actaagtctc gcataagccg atatacttta tattcttgat tgacgaaata tctgtatata     68220
     gaatagatca atattagaat acattgaact ttgaggttag tcaaagtata atgctgttat     68280
     agtagtttag tcttggatgg gatcgatgtt tacatgcaat ttactgattt cttcagcctc     68340
     tcttttacct ctttccacat taagcatctt aaatattggc aacgagaaga ctagtaatat     68400
     aaacaaaata aaaaatgaat atcttatatt atgtgttttg tctgttacta tgccaataat     68460
     aaatggtccg actattgagg aacctttgtc agtaatactg aaaaggctga agaatgtgga     68520
     ttctctacct ttcggaatga tgatggtgaa tagagatctg gaaacggcag caacacttcc     68580
     catagaaatc ccataccata cacctaaaat aaacatttcg aattgatgct tcaatccaaa     68640
     tgattgaaaa atgaaaccta gcatgccata taatggaata atgctggccc aacatattat     68700
     tagtaatata gtgcgttgag gaggtacatg tagagatgtc gatactatct gagggatagc     68760
     gaaagcacca accatagcac tgatcatggt tattatactt agcgaaatta gattgattgt     68820
     tgacatgtga agttcagtct tcgcaaatat tattgcagta gaattgatag ttgtcaatga     68880
     atcacttaag atgaaccaac ctattaaaaa tatcaccaca tctcttagca atgttgcatg     68940
     tttcagagct tcacccagta acttccaacc atacttaagg gatgagaggt tgacaaatgt     69000
     gaatatggaa ccatcgatat cataatatct accatttgca attgcctgat tggattgttg     69060
     atctggtatt atgctgtcag aaagcaacca atacataggg aactgccata ctgcccacca     69120
     aagtcctaca aaaaataccg cgtattgaat atcctgctta gaagggctaa gacgcacaag     69180
     caatatggac attaattgaa caaccaatgc tgccgaatac ccaatactag caccacgacc     69240
     actgatcact gtagtcaaac catccttgtc atcagtatcc aaagatagct cttcggcggc     69300
     gggcactgta tggtcaggtt gcaacctaac aaggtcatcc acaaacaagg gtagtaatga     69360
     atttcctact acgttgataa caccataaca agagttagcc acaatgtaat ataccaccaa     69420
     tgaataatac tgggtttcgt tgagcaaaga aattaagact gttgcgaatg cacctaccat     69480
     gccaaaggtt accagcacat tttttctaaa tgatatagtt ttccacctat ccaccatgcc     69540
     cgatactgaa ataacgacta ccgtttgaaa caggacactc agagagaaga catataatgc     69600
     aaaactagaa gaatcgacaa agactcgatt attgaacaga cctaagacac atttatcgga     69660
     tgatgatgta gaacaaggag cgttatgatc atccaattgc acaccattga ttctagcaaa     69720
     ttgctctagc aataacggaa cgtatgtagc aacagcagaa accacaaatg gctcactgga     69780
     aaatgaatac aggtaccagc ccttgatatt atctctagca gctttaagag tgtctattcc     69840
     cacatacaga gcatcatcat tatgatccgt aaccccatca ttcggctctg acgccaatga     69900
     ttcataagcc attagtttat caaccctatt gagaaaggca aaatatcaat acttattagt     69960
     cttgcactat ggaaaccata gaatcataat agtgtttaat tgttttatac tgttttattc     70020
     ccttaattca ttgatgcgat gaggaatatt acagatagta tattacgagt tatggtcata     70080
     tgatatatag taagtctggc caattataaa ccatcaaatt cgaccatatg gaccttcatg     70140
     gccgtttcat cctttggtat ttttcctgtc gctattattt atgatcagtc cctttacaaa     70200
     ttttattagt cctaacagtt agctagaata aatcaatgat gtaaaaggca gagttggtat     70260
     aaaaacaaaa aaaatgcaag gatatggcat cacatactag tcaaatcatt ggttaaaatt     70320
     attggaagta tttaagaaaa aaaatgcgtt aatggttttt ttaatattta tataatgtct     70380
     tgataatatc tatactgtga tggggggtgg cagtttatgc tccttggaaa aaaaaattat     70440
     acacactagc atcaaaatgg tctaaaattg aaatagtgca tgatgctcct accacataat     70500
     taatagcttt gttataactc ctagtaatcc ctctattatt tgtactcaaa aataaagagt     70560
     agtatattac agattaatct cttagtgaaa gaaaacaaat gtgattgagt gtaatgcaaa     70620
     tgatagcagt aaaatcattc aatatgcgtc aaaaaataat tctcaagtta atgggtgatg     70680
     gaaagtttaa agttatagta attaaaaaaa agatatgctg gcataactaa taaaatcctt     70740
     gtagtaattc ataatgataa tagtcgaatt tggtatttcg agcttttacg tgttgaaata     70800
     attatcatcg gaccgtgaag tctaatttat aaagtaacaa ttttgttcgt ttatgatctt     70860
     tattgttctt cagttgatga tgattcaggc tgttgcacaa cggattcgtc agacttctcg     70920
     gtttctcctt cgttggattc tttactggat tcatcctcag tttggttttc tggggtggtc     70980
     ttatggtggt tataagatct gggtggtggg gttatcactt gggccatgaa cctttctaga     71040
     gagccttcag ttaagatggt ttcggcgaca aattcattag taacggtctc tggaacccat     71100
     tgggaaaatt cctttgagcg aatgtagtat ttggtcaata aagattcggc ttgttctgtt     71160
     tcagaagatt gctcaccagc aatggcaact tcgacagtag cttcggcgtt gtttacaatc     71220
     tctctcaaag cagctagaat gatattttga tcaccaccaa aggacatgtt aaccaatcta     71280
     taaaacttgg atatcagttc tagaggagca taaccgtcct tggacaactt agtcttaaga     71340
     aattcatcct tattcatgtt atcagcactg aagtaatatt cgatttgtct agcaacgttg     71400
     ttgatggcca tcatagctgg ctgtagtggg tagaaagatt gatcaatctt taccatttgg     71460
     cggttctggt atctgttgtt gtaatgatgg ttgtgagaac ggtatccgga gtattgagca     71520
     cggtttgagt gtttgttgta acggttgttg tgctgtgggt gacgaggggc ttcgccgttg     71580
     ttgaaggtgc tattgctgtt attcgaagat ggtctaaatt gcttcgttgt gtgagtgttt     71640
     ggactgttgt tgtatcttct tctttgatta gtgtatggtt tttgagtggt ttgggattgt     71700
     tgtgattgtg gttgttcgga tgcaatttct tcagtcttct tagcttctgc catgcttgga     71760
     gccacaggct tctcattttg agtctgttgt ggagcctcct gttgttgttg gttttgcttg     71820
     gattcgctat ttggagtaga ttgttttgcc tgttggttcg agttggaagg gccagaagga     71880
     gctctctttg gtgtttgacg agtctttctg ttgttgttct ttctgttgtt gttgctgttc     71940
     acgttatttg acactgtgat tgagacctgg ataggaaccc acttggtgtt cgccgaagac     72000
     tttatggcag gctgtggcga cttgttcttt ctctttctgg tttcttccaa gagctcagca     72060
     actttcaact ctggcatgga ctccgcggta gccgtggact tccatggaga ggtcactgga     72120
     gcaggagcag ggatcagttc cttcttgacc tccttcttcg tctcttgtgg tacttcggta     72180
     acaacttcag cggacattat tttcactgat tactaatttt cttggatcga atataataag     72240
     tttctagaaa aaaaatactg ggaatcaatt aatatgttga tctcagatgc tatgattttt     72300
     tttttcttct attatgcctt gaatagtgta tatgctaatt caattcgtgg tatagttatt     72360
     tttttttcta ataatttaat ctttttttat ttatttatta gttattagtt atttttgttc     72420
     tgataataca attgttgaaa ttaacttgaa ctaaatagat ttatacaaga gatgaaagaa     72480
     aatttttttt cgattgctag tgcataattg cgtggtttga attgctattt cacatttaat     72540
     tccaccagaa tttttttttt ttttttgcga tgagctggat tgtgtgtgtg tgagcgatgg     72600
     gcatcgcaat gaaaaatttt tgaaaaaaaa ttgttttgcg cagagagaga gagaagctct     72660
     ggtgttcttg gtttagtact tggcctttcc ctctgcaggc tgctctcttc ttttattttt     72720
     tactgatttt ggtaatggtt cagccattgc gtacctatac gcgttaaata cacactgtgc     72780
     actgtgcatg cttctactca caacacataa gttgtaggaa gtagagagga aaacaccgtt     72840
     acccgcaagc ttcccccagc gaagcaattg aacacgttta atttgccgta cagagccatc     72900
     ttggctagct gcgctttaag aagctagtca tgtgaccgga taaaagccat tcaacagagt     72960
     gcgcctgggc aataacgaac tggtctgccg gcagtactag ttcattacaa gtgtggtcta     73020
     gtactgatta ttattgatta gtgattatta ttgatagttc tgggtccttg gtagatgata     73080
     ttgatgtaga gcctagtgtc ttgcactttt gggctgtcct gcatggtcga tgtgggaagg     73140
     cacgaaccca agtgcaactg ctatctcttg tgggaggtga ttcacattgg tactccagtt     73200
     gctgcttggg gaagggggtg gagatgggtt ccactgcaag ggtccactgc aagggtccgc     73260
     ttcaagggtt ccgtatctat ccatttaaat agtgtactat atagatataa gaagcttgaa     73320
     ttctcgagaa cggctcaaag gctataacga cgagtaattc aagtgatggg gtttctaacg     73380
     gatcatccct atactgcggt taccgcaaac attgaccgtg tggtcagcaa tcgggagtac     73440
     tctctggagg ttgaattggc agagatagtc gacctgatag ggttcaggaa caccgtcaac     73500
     caggaagaag cggcgcgtgc actgcggaag aagctcaagt atgggtcgaa agtacagcaa     73560
     tcgcggtccc tggacctgct ggacttgctg ttatcccagg aactgaagtt cggtgtaatt     73620
     tacaatgacg ataaactgct ggataggctg gaagtcattg cattgaaccg tgataccgac     73680
     ggtaacggtg tcaagtacaa ccctgccatt gttagcaaag ctgccaagta cgagatacag     73740
     tggtatgaac atatagcctc cataggcaag aagagatcga agacttttgg aaggctagct     73800
     gagctcggta gcagagttaa aagagagtac cgacacaagc agagctcttc tccaagaagg     73860
     agagccgata gaagaaacgc atttttggat gacgaggcag atccgtttga aagtttggag     73920
     gacgataacg taaccacaga gagaaacaga ggcaacgctt ctacagacgc ggatcgcctc     73980
     tacagaatac cacaaattga tatcagaaag cacgcaccaa agattaaact gattatcagc     74040
     gatgcattgg ccgcctcagt ggcccttaag cactccctat tgacgttgcc tgcagacaaa     74100
     tactctactg acgatatgga ggctacagat aacttcatca aggctagaaa gattagaaag     74160
     aaggtgttgg catacttaca agtggttaca gaaggggaat tcctgggcag tttgatccaa     74220
     gcaaatgatg aattggttgc atctcttact gagtatgatg agaagagtga caaagctgag     74280
     cacgacactc gtgaggacag aaacgatggc aacgacagtg acgacgtcaa tgaatctgta     74340
     gattatgaat acagcgatga tgatgcggat gaagttagca gggcagacca ttccatttac     74400
     tcggttcctc agtcaacggc ttccaatcca tttggagacc aaaatcattt gtagtattag     74460
     tagtagtatt agtgttatat aatatactaa ttgaaactca attaggttgc aaaaaattgt     74520
     tgttatagtg atagataaca aaaggaaaat atatcgattt cttcagaaat tgatctatat     74580
     ttgtataggg gatataaaga aaaggtatgg ctataagata tagcaatgca gttaatcgtc     74640
     tctagaacgg tagaaaaaga aagatagggt gggcatgaat atagttaaaa attgggtaat     74700
     tgtagtaaaa atattgggta aaaagaccgt aacatagttt ttcataaaag acaataccag     74760
     tgcattattc ttccttcttg aagttcaggg acaaactgtt cacacagtgt ctgctgtcgt     74820
     taggcaagtt gagtctcttg ttccaacctt cgcccttgaa ctcgtgtccc agatggccac     74880
     cacacttggc acacataatc tcggttctca tcataccgtg gctgaagtcc ttcttgtact     74940
     tcaatgcacc cttgatctcc ccgttgaatg caggccaccc gcatccagag tcgaacttgg     75000
     tctcactacg gtacagaggt gcatcacagt tggcacaggt gtaaacacca gttctatcgt     75060
     tgtacaggta cttaccagta cctggagcct cagtgccctt gtccttcaag acatgtagtt     75120
     gctcggaggt caattcaggg ttccactcct tcttgtcagt cttagattga aatagcattt     75180
     tgattgtttt gttataagtt gttttgttag ttgttagata tgtatatctt gctcctcttc     75240
     ctacaagagc aaacatttcc aagactgttc tacaaagtta gccacacctt tatatatttc     75300
     gattctgaat catccagctc ctaaagctca tcgcattttt tttagtcaaa cacacttatt     75360
     tttttttcaa atttgatttt acacaccgac agcattgaaa ataaatgatt tcagtgaaaa     75420
     atttcaagag acacttggct catctcaacg aaaagcaaca agaactctat caaacaatag     75480
     gagatcttat aattacgtca ttaggaactg gcaactgtgc tatcccgtag ctgcactgct     75540
     gggagatcat tcgagaccct actccaaacc tggaagctat caatttgtag aagctatcaa     75600
     tctgtagaag ctatcacttg caggagctat cacttgcagg agctatcact tgtaggagct     75660
     atcacttgca ggagctatca aaaaacggga gaaaactgag tcaacattat acatcgagcc     75720
     ctgtgtctgc tccttgattt cttcttatcg gcttgttact ataactacat ctcacagaga     75780
     cactgcatag ttgtgtagat cagttctcgt ggtggctttg aacccattcc cccaagctta     75840
     attatattac tgattgattt catcctgcct gggaaagaaa gctgaacaga aaggcaagtg     75900
     ttcaatatac tcatagagga atacccgcca tggacgacag tcagaagacc ttgaggcaag     75960
     gcacgctgct caaggataac tttgataagt ggaccacaga cgaagtggtg caatggtgtg     76020
     ggactgtgct tggaaaggac gagcaggagc cgctattcac tcgtatcaga gacaataata     76080
     tagacggcag tgtgttgcag gagctcacgc ttcaagactg caaagagctt accgataatg     76140
     acttgaaaga ggctatcaag ctgaaattgt ggctaaacaa gcttatcgat tcacaattag     76200
     gtgaggatga cgtgcctaca gaagacatag ttgtagtatt gaagaatttg catactacag     76260
     tgtcacagaa attgctggat ttccaaagtc agtactccgg tttgcgagca gatgtggtgg     76320
     aaatcatgaa gagatcgaag actgctgaac atggtatgtc ctcgcctcaa ctaacaccat     76380
     caactgcttc atcaaagcct tctggtgcga gaacagacta cttcgatcat ggccagctgc     76440
     ggcaatcgcc tagagcgaaa gaagtacgcc ccactttgct atacaataaa tctacaccta     76500
     atagtaatag caatagcaat agcaagtatc atgatcaaat tatacatgcc aattcatcat     76560
     taactatacc caatattaag agtaatctct ccccaataga gccacttaaa caattgaaag     76620
     cctcgaaaga ggattcctgt gagaagatac tgaagaatgc aatggtaagg cataatttag     76680
     ctgatcaaga ttggaaacaa tatgtattag taatatctta tggtgatcaa gaacgtattc     76740
     tagacttagc tgaaaaacca gtagtgatat ttaagaattt gaaaaggcaa ggacttcatc     76800
     cttctatcat gctgagaaga cggggtgatt ttgaggaagt ggacatgtcc atgaatggat     76860
     tgagctctgc tgatgttaca cctggtggac gattataatg agcgacattc cttcgccaaa     76920
     atttatacta acatatacag atacatagat aggtttataa atatccttga aagcatttcc     76980
     agtcctaaaa cttatttatt aatattatat aatgcacaac acttaataag ggattggctt     77040
     ttattatgtg tctatatgtg taattaatat cgtgagaggt tttgctatca ttgagcatat     77100
     gggttgaatt tctttttatc tttcataact ttaatcttag cttgatcttc tttaaatttc     77160
     gaaagaagtt cgttaatttc ttgcttctta cgctctctga cttgaaatct atagaaatct     77220
     tgttttgctt tcttatcaac cgcagatggt ggttttactt tattctcgtg ctttgatagt     77280
     ggattcctat tcagaatctt cttcttaata gagtttagag attttgtatt cttacccact     77340
     accagagtga agccgtcttc atccacaatg gatgtttgta tatctccttg agcttgtctt     77400
     tccctttctt caaatactga catgtatgaa tgaatatcct ccttaaggta atcaatgctt     77460
     aatggcttgt aaaaatttgt aaatgtagaa attgaaggtg aactgtactc ccatgtgatg     77520
     taatttgatt ttttgtgcga gttagtgcta tatttcttga tggaggacca acagttattc     77580
     agacttgcct catcgacaaa tttcagcaat gcagtgtttc ttggagtgaa tctttctttg     77640
     ttactatctt ccgatgacat caaatcagaa gttaatggcg acaaatcgac ctcacgtaga     77700
     ccaaactcat cgttatgtag tagctgttca atgtgtgcta ctgagttgtc tctctcaagt     77760
     atgttgttga atgctttctt gagactatca agattggcta acaatggtaa gttaaccaaa     77820
     aacaagcaat ttttctcttc gtctagtttt gtttgatgtt tcctggcaaa tatgtagtgg     77880
     aacgatctct cagcaatacc ttttaatgag ctctcttctg gtaacttgaa cggtagtaca     77940
     atgaacccat ttttcatggc atctatggaa gatacatttt tcgcagattt cttctcagtg     78000
     ctcatattga gtaatggtta ctataggtaa tactttatta gttcagtgat gttgaaaaga     78060
     tatataggca gttttgaagt ggtatggaaa tcctataagc agtttaatgg ttttattact     78120
     ttaaatattc aagctccgct gatgctcatc gatttttttt tcaaaatttc agaaagtttt     78180
     ggtatcttgt gatgagtttg tacggtataa tagtgaacaa ccataatgaa catctacaat     78240
     actaatgtgt ttatggacag gatgccctta atcaaatatt aacataagaa aactgtctga     78300
     aatagcttag aataaaatgt ttatcattac aagtcatata aatatttcta taaaagttaa     78360
     cttactgggg ggagagtact atatatttag ttgaagtcct ttggaagcaa tcccaacttg     78420
     gacattctaa tcttcacagc atttctatga ccatctagac cttcgacttt tgcaacacac     78480
     atcacagcgc gtccaatatt gtctagacct tcaggtgtaa tgctctgtgc ggtgatgaat     78540
     ttctggaaag tagatgtatt agctccgcta tactgtctgg catacccata tgttggtaaa     78600
     gtgtggtttg taccactgga ataatcacca cacgactctg gtgtgtaagc acccacaaaa     78660
     acactcccag cgtgatcaac cagcttaacg taatccttgg cattctcaat ttgcaatatc     78720
     aagtgctcag gagcgtatct gttagacata tcaaaggcag actgataact atcacaaaca     78780
     atgatagaac tgtgagcaat acatttacga acaatgtcta cacgaggtag ttccaaagct     78840
     tgtctgtgga cagcatcttg gatctgctgg atcttatcat cagttaactc aacaccgaca     78900
     agaataactt gggagtcaat accatgctca gcttgtgata gcaaatcact ggcaacaaag     78960
     tcaacatcag cgttgttatc ggcaatcact agaacttcac ttgggccagc tggcatatcg     79020
     attgagcaca gagcttgtgt gtcattttgc acatacattt tagcagctgt aacaaactgg     79080
     ttaccagggc caagaatttt gtcaactttt ggaacagatt cagtaccata ggccatagct     79140
     gcaacagctt gagcaccacc agccaagacg atctttgaag ctccgacttt ctcagccaca     79200
     tacacaactt ctggagaaac tctgccatct gacttacgag ggggtgaagc aaaaacaatt     79260
     tctttacatc cagcaacctt agctgggaca cccaacataa gggctgtact tggtaacact     79320
     gcggtaccac ctggaatata cagaccaact ttctcaatag gtcttgggaa tctagagcag     79380
     agaacacctg gttgagtttc aacttctaga tcttcagttt gtaattgagc cgcatggaat     79440
     ttgcgaacat tttcaattga caagtctagt gattccttca tttcttcagt tagaccctcg     79500
     aaatattctg gtggaaatgg tgcttctaga acgggagatt gtagttggac accatcaaat     79560
     tttgctgtga attcaattaa agctttgtca cctttactcc taacaccttc aattataggg     79620
     ttgaccaagt gcataatttc ggatgttttt tgaattggtc ttgtcaaagc agcttctact     79680
     tctttcttat ttgatgtttt gactacgttt aagtgaatag gttttgaaga caattcttca     79740
     tcattttgag cttgcggttc ttgtttcttt ataaatttat ctttagcatc accctttctt     79800
     ctggtgattt tcaagtgctt catgttcaga ttggattcta catccttaag actgacattg     79860
     tttgccacga gtttagttag agcgaagtag aacaagtctg cagcttccca tgatatttcg     79920
     ttcttatcct cagcttctgt caattcttca gcttcttcct taatcttagc gttcaataat     79980
     tcgggatcat taaataatct tttggtgtag gagccttctg gggcactttc aaatctatct     80040
     ctaagcaatt gctctaaact agctaagcca tgggtgaagc caccaaaaca tgattcggta     80100
     ttcaagtgac aaaaacttct atccttacct tgttgatcaa caacaaactt caaagcatcg     80160
     ccatcacagt caacagagat cgacagcagc ttttgggtat ttcctgaggt ggctcctttc     80220
     acccaaattt catctctgga acgggagtag tagattcctg attcctcgtt aatagccatt     80280
     tgaatggact cctttgaaga gtataccaga cctagacaac gttcctgaga gtcaactact     80340
     agcgtggtat agaggccatc agctcgatca gtcttcaagg aatcgatcag tgtttgactt     80400
     agagttgagg aggtgatttc ttcaactggg accaattgag tctttgcatt gaacttattg     80460
     acaataacaa agtgagtctc gtatacgttt tcatttagca cagagattct ctcctgaggg     80520
     atgccaactt cagtgaccaa gtagccagcg tatgaatggt cctcgataaa caagacagca     80580
     accccattat ttagaatctc aattacttcg tcatccttaa atttaccaga gctcaatagg     80640
     gtacctacaa atagcaattg agagtccttt acaaatttaa tgatgtcttc tttggagaca     80700
     gtataatcca aaactgcttg attcactagc ttaatatatg gtctcgaggc caaattcaaa     80760
     tccttaccaa acactggcag tatagggaaa accattctcg gcttattttt tattgattat     80820
     gcgcgttgct attatgttgt cttccttagc tgttaaattc gaggatacca acagcactac     80880
     gaatactaac cacacaagga tgttatatat aaaggtttga tctggttctt atggtcagca     80940
     gtctggctgg ctgcacaatg tgactaatac aaacataact gtgctatctt acgttgactc     81000
     attgattcct atgaaaaagt cccctttcca gattggtaat tgtctgccct tcactggaca     81060
     acagcatacc tgcgtgatat cacaagatag ccaatgccag tgaggacgag tgatttgacg     81120
     aatactgaaa gaagtcaaag aaagcccaaa ttttgcagtt tttcaaagca tcgcatcgct     81180
     caaacgaagt gacaagatat ttttgaaaaa aaaatagaga gagaattgaa gaatacagcg     81240
     aattccacag gaaaagttcg cacgatataa ttgtgtttcg tgggttcctg tgctcttgct     81300
     ctcgttacgt ctttgagaaa tgttgaagga attaattaat actaattaat taataaatta     81360
     ctttgattga cagatctttt ccaggcgttg aatggacgag tggctttttt aatctatgta     81420
     cttatgagtt tggctgcctt gccaagtgag aaagactcat atgtcatgga tacaaaaacg     81480
     gtatattgtg ttcagaagaa ttcatcattt gtagatttca attcgtgagg acaatcagtg     81540
     gtacgatggc ctggtttttc acagagatag caccatagtt ctctaccggc agccgggtca     81600
     accttcaccg gaggtttgta tactggcagc gagcttgatg atcccgacga ttcgggctgg     81660
     gatggagatt gtgaagcttg ggcaccgctt tgaatatttg tatcagcgga gcttttctct     81720
     tgtaactggg attctagagt tcgtaccctt gttctcaatt ccgtcaattc tgaatttaat     81780
     tcatcagttg gcgggttgct tttctggcct tgcatattca ttagttcttt gttcaatgat     81840
     tggtattcct ggctcagact gtcgttgtgc atcttaagct gcatcttttc cttttcccat     81900
     ttagctctgg cgcgttcgtg ttcgtctgtc aagtcctgta tagtctttgt gatctctgta     81960
     gtatcttccc tcagtgattc ctttctagaa attgcttttt gttcgttttc ttcgatagct     82020
     acttgtaact gactcaccac agcgagtagt tgctcatgtt cagcttcgaa gaactccttt     82080
     tggcttttaa acttctcacg ttgcttatcg agctctgttt caagttcctg tacccgagat     82140
     ctcaaccggc gttcattgtt ctcatactca tctattgtgg gttgtatttc ttctagaaca     82200
     attcgttgat cctcgagtag ttttctgtat tgtaatattt ctcgttcttg tttctcgatc     82260
     cgaagctcgt agtccttaat tatactctct gtctgggaat cagaggctcg agagtctata     82320
     tccattcttt ctccctgagt aggagttcta ttgttgtttc tgcttgtgat cctgaaactt     82380
     ctaatcggtg tcggcgagtg cacttcattc tgttcgagag gtttccttat gatcgtacta     82440
     ccattgctgc taacacgatt ctcagacatg tgtaccccat ccgacatcag gttatcgtct     82500
     tcatgcgcat tatacttgtc tagattaaag gtcgtgttcc caagtgactc tcgtctggat     82560
     tctgtagtgg cattctccaa gagatgctct atcttctgca actggataaa taggccactc     82620
     tgagaatact ccgcctgaaa ataccgccta ccttggaaag atccatcgtt cttacctatg     82680
     ttcgccaaca gatcaacacc cgcaaacacg cctggcttgc tctctacggg acccacgtac     82740
     ttcaattgcc ctcgacccag attcgggatc tgtatatagc agccaatctt gtcgctgtac     82800
     gcactcataa tactaatccg caacgatgcc cagagccttg atgacgcctc gtctctccac     82860
     agctctttat aacctcatcg ccagcttgta gtacacccga tcttattatt taatgacatt     82920
     ttgcaacttt tttcagtttg tagcttaacg agcactgaaa agcccacagc agactaaaaa     82980
     taaatttaag ggtcttcaca agcattgctc atcgcacaag tataaatagt ggccactatt     83040
     ctaacgttgg tagggagtgg ttaatttgtc ttgcgatcag tcaggtaata gcaaggcatc     83100
     aatacttcac tgcacaataa ctacacaaaa ttgatagcaa ttatgtcctc tgttgatgaa     83160
     cttattggac aggccgaaag ggatattgaa aacggagagc atggcaatgc catctccaac     83220
     ttgaccagag cagcacagtc tgaccctgat gagaggcaga tgtccatgat cgagaggctg     83280
     ttgggtatgc ttgtagatta tgtgagatct agggatggta acggtggcga tgggtctcgc     83340
     gatggctccc gcgatattgg atcgggctcc ggggagcgtg gtatggggga ctctatgatg     83400
     agcgctttga tgtccagctc gggtggttcc tcgcaagcgc agcttggtaa gcttgctctt     83460
     ttgggtacta tgatgggatc cggtagtggc aaacagcaga gtcaaggcca gggcttcaac     83520
     tggggctcag cattgtcttt gttctctgga caaagtggga aacagagtgc ggcaaatgct     83580
     ggtactggtg cattgttagc atccttggca tccagttact ttaaaggatc gggatctaaa     83640
     cctcaacagc agcagcagca gcaaggtggt tcttacgggc aacaatatgg tggtaactac     83700
     caacagcatc agccacaaca acaggaatcg agcacattct cctcgattgc atcaatggca     83760
     agcaactact tcaataaacc gcaacaaggc caaggtaatg gatatggtaa tcaaaatcaa     83820
     aatgccggca gtaaccaggg acatcaaaac tacggtcaga atcaaggata taacaatcaa     83880
     ggacaaggta gccacggtta tggtcagaac gaatactcaa acgatggtta tggacaatct     83940
     aggccacctc aacaacaaaa tcaagagtca ggtacattct catctattat gaacatggct     84000
     agctcttaca tgcacaaaaa cgatggtcaa gggcaaggaa gaccaccaag caatcagtat     84060
     agtaacaatg gtggtggtta tggccatggt gatggcgctt acagcaatca atctcaaaat     84120
     tatggctcta atcaaaatta tggctctaat caaaactatg gttctaatca aaattattct     84180
     cagcctaacc acaatcaagg ttatggcaat caagagtatg gttacaatca aggaaatgac     84240
     aactatgggc gcccacagca acaaagacca aataatgata atggcgaggg ctttaacttt     84300
     caaggacatt tctcaaacag atactagggt tattattagc ttataatatt gtgtatacat     84360
     ataatcaagt cacatcaagt ttttgaaaat ttattgtgct actattgttt caaaatgaaa     84420
     cagcatgcca tatatcttgc tgataaaaat caaatagtag cacagcaatt atagacgtat     84480
     tataaatgaa acacttaaat gtcaagtttg atacaacagt attttatcga ttctttgtat     84540
     ataatttggt atgataagta gcgataaaac cactattcac gtttaataaa gaatgcaact     84600
     ttaagtactt aatatatttc tatagtacat agaaatatac catgaagtca ctagttactg     84660
     acgagtgtaa ttagtcaagt gaataacttg ggtcgcagct gctgtgcaac tgatgaaagg     84720
     gaaaggcaag agtttgtcgg cgggactcaa caatttgttt aaagctgcag cagtcctatt     84780
     aaatcccaac aaaaataata gaagtttgag acttatatta ggattgtcga ttggattacc     84840
     tattggagtc ggtgtgctat ttgcaataat gctctatttt tttgttagaa ataagttatc     84900
     tcggacaaat tttagtaaag ctatagggcg ttctgaaacg catactgata atttttcaag     84960
     tttggaccaa gcatggattg atttagaagg tattactaag catactgatc ataacttcag     85020
     tgctactaaa tctagttctg gtacagtatc taatgcaata actcaagact ctcacattag     85080
     gacgccgcaa atggcacatt gtccgctcgc taccgctgat aataacttac cacgtaacgg     85140
     ctctaatcta tttgccgatg ctgataatta tttgtactct catccaccca atatttatag     85200
     tattgattct agtatctcga tgttaaatgc cgaacctgaa ataagaccaa attattttaa     85260
     agatcagaag aagaaaaata gctggaagta caactcacca ttatcaaaat ggttcttgag     85320
     aagttcttta tatttacagt gttcaagtga aaatctgaca aatatatcaa gtttacccaa     85380
     tgttaaatgc tctaatatct tgacttcagt agttgaaagt tgtgttgata agccagaaat     85440
     aactgagcag tatgttgaag aaacgtacct ggggtcacta acagagagtt caatcaatac     85500
     actgtctgtt aatgatgtta aaagcaagga agctaacaaa ttgaatgaaa ttactggcac     85560
     ctgcctcaaa aaaccggcta ttaccttatc cggcttagag ttaccaataa atccgaacta     85620
     taaaaagaat agaaaaaaag cccaaatgag acttcgaacc cacctggact acctcgccaa     85680
     gacaaaacca ttgcccttaa caccaacttc gtctgcgata gttaaattga aagctggaat     85740
     acaatataga gtacgagaag aatatgtacc tagtcttagt gatgagatac atgtgactgt     85800
     aggtgaaaca gttagagtat tagcgtcaca taatgatggg tgggcattag tagagcggat     85860
     cgaagctagt gatggcaaaa ggcttgtatc atctggatct tatattaatg aaaatagagg     85920
     tataatacct aataaatgtc ttttatcata atttctacaa aattatatta tcaacaagtc     85980
     aagatgtcta aataagacac tgattactta caaaggcact tcttatcata atgaaacgtt     86040
     tataatcttt ggatttgatt atttcatata cacaactaaa catgaacaag ttgaccatac     86100
     ataatacgga gaactctcta tatcgtgagc attagcagtt attaacaaaa tatcgttttg     86160
     ctcaatgcca agttttatct agaatgaatt aaaagtaatt gaacggtaaa ataagacatt     86220
     caaacacttt agttgaagat ttcgacttcg ttgtcaatgt aagtcttctc acctggagca     86280
     gcacctggag caccgaagac caattgagag tgaacggacc aagaggctgg gatcttggat     86340
     ggcaaagcag ccttaacgta accgttgtaa tgttgtaggt gaccacctag acccaaagct     86400
     tccaaagcag cccatgagtt gatttgagcg gcaccagagg cgtggtcagc gaattgtggg     86460
     aaagcggcag accaagctgg gaagtcagct tgtagctttt cggtggtctt gtcatcagtg     86520
     aagaagataa cggaaccgta agcttcatct ctgacagatt ctggtctctt cttaccagct     86580
     gggtcggcaa tggcgttagc aacactgtcc cagaccttct tgtgggtttc accggtcaag     86640
     ataacagcac ggttaacttg agagttgaaa gcagttggag tttccttgac gatagcttgg     86700
     atggtagatt gaacgtcatt gatagtaaca ccggatggca attctggctt tagagcgtag     86760
     atagttcttc tagaagcaat ggtcttcaag tatggagcaa cagcggacat ttttaagggt     86820
     ttgatatatg taaaggttgg ttgtgtatat tcaattaaaa taatacttgg tttttttatc     86880
     taattgaaga caattatgaa agaactccaa aatgaatcga tcaatattaa gatgaaacta     86940
     ctcggtttat atacttttca ttggcaaaga gaatccttca atttaggcga tttgccaaag     87000
     gacaccaagt ctaaaataga aaactggaga ggcccattag catcaaactg tggatccatt     87060
     ggaagcctgt ggcccttaat gtttaacatg ttcttaacgc aaacagaagc tctggtttgt     87120
     tttaaagaat agacttacct cgagcaatgg aaaactttag tgctaacttc agtaaataac     87180
     ttgctaagac catttgtctg gatttacagc ttcatttagg gtgtgtccta cacccgatct     87240
     gatcggtctg ggtgtgtgcc aggcatctct gtgggtgtct ctctttgtcc aacgcatttg     87300
     ctttgtacta ctgtttctta tttttatcga gggacgtttt tagagcatgc ctgtgtttct     87360
     acaggtatta acccagactc ccgaggcctt gcagtatacg cgtgagatcg gtcaaaccag     87420
     gcatcgaaac tagatagaat tttagttgtt ttttgattgg tgttggtatt agataactgt     87480
     tagctaagag gcagattggt tcggacctcc ttgggtcatt tctgtgagga tcagaagttg     87540
     tcctcctaag aatcattgtg cttctgtgtc ttactaatat tgatagtgat gattttggat     87600
     ttttgtctct tttacagggg tgggagccaa gattgtagag agattttctt tgctctgtat     87660
     ttcgttaagg tgagagaata ggttttttgg acggcaaggt atctacgcaa aataaaggag     87720
     gcaagtacag ctttcatagt aaatgtatgg ggaaaagtca ggtcaagttg tttcctgttc     87780
     aggtttgtaa aacttacaaa ggctttaatg ctcgtgttct tcactgttct taattatgct     87840
     ttcccgtgtt caatctctgt ctgttggcaa tgcgagaatc ggttgaggct acactcacac     87900
     cccttttcta aagcagtcga cgctttctat agaattcttg tcaaatatga gcgttgggtg     87960
     tccaactgat ttttggcttt ggggtctctc cttttaatgc gttgttattg gtgattggtg     88020
     taagtgggca agcttatgct ctacgtacct gtggagccgt agtcgttgga agtttgggcc     88080
     actcattgca cagacacctt ttcagcctga acacagtacg atcttttaca tcaacttcta     88140
     agccatagga tgtaagttgc aacatagtac tggtttttac gagaattgga ctatgtaata     88200
     gtttcataat ttgatctcgt ggttggaaaa gcactctttc cttatgtttg cataaggtaa     88260
     aaataataaa agatgatagt ggtgaaggaa cccaatatgg cagcactcgc cttactttgt     88320
     gtcaaatgtg ttaatcattc taaaagtgag taaaagtagt ggcaggctgt ttcggccaca     88380
     gctcctaatt gccagtttta cgatatatag aagttctaca agtgtggtaa cccttttcca     88440
     atgtgtgaaa gagtcatttt taatgtggaa gaattcacta gaaattccaa acttgtaata     88500
     acaattatgt aagaaagtaa acctgatcac ttagattgag attagttttt gatattcttt     88560
     gtattacccc ttactcctat tttcctaata cgtagtagta catcatcata cctgttgaag     88620
     atacttggtt aggttatcta gttcaaatat caagcactta gccgttcact cattgtaggt     88680
     atatctgtac gaataataat acatgatgag ctctgtatat cattcgacga atttatcatc     88740
     tgacaattaa aaacgtgtta catgatatca atacggtaat gagagtagat atgactacaa     88800
     tatgaactta taggtgagac ttgatattga atgcagaaaa cgcagcagtt aagcgcttgc     88860
     taaaggtgct actccgcata tatattgtat acttatgagg ttattattcg tgtctaaata     88920
     atgtggggtg agaagttttc tatcctgtgc ccaaactcgg gtcacctttg agtcggtaga     88980
     aaactaataa tgtatttgtc attgattgac tgttatgtct cgttcctcaa attttagtct     89040
     tactgggcta tattgattaa ctaatggtgt attcgatatg tagaactgcg aatatcagtg     89100
     atggttgatt tactagatga ttttacagat ggttgtgagt cttcagtacc actacataaa     89160
     aaaatagcag ttgcgggtga gcaaggctta agataagcaa tctatattgt agcgctaatc     89220
     gcagccaaag gtatttctct attacataca ctcaaaaagc gaatactcta ctgcactcct     89280
     gtacttggcg ttagcctttt attattacgt atatttcaat ttggttaaat aagtagagga     89340
     aagttcctac ccccccctcc caccccccac acacacaagc atactgaccc acattattca     89400
     agaggtggct ctcgatacaa agacaactct acttacaatt ctgacgtaat gctgtatttg     89460
     agtgggcact tgtagcgttc caccacttcc tcatacagaa agtcgttcta cggcaccttt     89520
     tctcacccac ttgcgttagg tgaggctagg tgggccgtga gcaagttcaa ggtgaggagg     89580
     tgctcgagac aggtagttcc taattacgaa gaagacggag tagcccgctg gtctaataca     89640
     ctctttgtac gatttattac acgtgcgaga tagacaatat gtcatctact ctgcagaggc     89700
     gaaaagtagg accttaaagc agggctaagc tgaaccacgt agctggggac ccgacggaac     89760
     gggtgaaaaa aatagttgtc tcacttttgt acaacaaccc cagtagtaac gggaagcatg     89820
     aagcgggttg gaagttatgc cactgttgat tttgctaagc ttttgccgta cgaaagctcg     89880
     ataattcgag gcagttccaa gttccgtttt tttgctaacc catgttgctc tcgtcgttta     89940
     agaaaacaca gcaggagaaa tccagcagac cgtgctggga gtgtacggaa gttgctgtga     90000
     agatattcgg aaaggaaaga cccacacacc cctctccttc cccggccaat tgagattaca     90060
     gaaatggtag atcgctaaga caatagcgta catcactttt caattactta cgactattac     90120
     gttgcgtttt atctgaccgg ttccttgcag agattccttc gcagagctca ctttcatttt     90180
     cactttacgt ttacctgagt tctctggtaa gactttcttc tgagattacg ttgcatagat     90240
     tacagcttat aagtacagta tatttctact actctttcta tttgagttca gatccaaagg     90300
     aagccctctg gcaccttctg tgcagaagcc ctaaaaccct ctcttttctt taaacctttc     90360
     ttaggtgtac acctacacat aatatctttg gtgcctgttg tgaaaatgaa agtcacaata     90420
     atccaggagc aatgttcttg tcactttgtt tttcttgtgt ttgccctccc accctccacc     90480
     ccacttccca agcccattgt ctttttcagt taaacattgc tgaagcgggg ctcacaaaag     90540
     gatggggggg gagaagagct cgaacactat atactctggg ctaacaaaac aaagccctaa     90600
     cccgccctca cagcatgaag caaccctaaa ctgtcaattc ccaccacttt catgcctatc     90660
     ctcccactgc cccacaatca ccccgcagat tgtcacactg attcaagact tcaaaagtgc     90720
     caaaagacta acaaacatta ggctaaaaat aaaaataaat tttgcaagaa gtaagtcatc     90780
     tgccattgtt tatttggcaa caatctacgg caagtttgag tctccttcat ccctcctctc     90840
     gagaatcaca tatctcaatc ttcacccaaa gagaattcaa ttacttccag ggtccgattg     90900
     tttgagtttg tgcagctcat actgtgtgtc tttgttggcg atgacgtgga atgcgggtct     90960
     agaggataat aaggttatct ctgactctta atggataacg tttatctata atcacaatat     91020
     tttgtgaata acagatattg attataattt tgtttttgta agaagtttga aaacatataa     91080
     aagctcaaga ttgtttctaa ttttccaaaa gtttgtaatc ctttctctta tatttattta     91140
     tgtaaaatat aaaatcatca tcatcaaata aacaataata atcatatcaa taacaaacag     91200
     atattcgaac atagaattct aataactgtt cattattggt gctacacatt aacaaaacaa     91260
     ttttaaattt actgctactt gttcatccgt tgagtaagga ttttattacg ctcttaacag     91320
     gaatttgcta tgtctgattt taaagataat tccgctgatt ttaatgataa agtcagtgat     91380
     aaagaggttg agtatatgtc acctcgtgaa gtctctgtga ctccggagac ctctgctaca     91440
     ccaaatactc cagccccatc ccaatttaga agatttgttg actcattcaa gagagctgaa     91500
     caacaaaata actctgaaat cacctctgcc gcttcttgtg atggtagttc tgaaaacttg     91560
     gacaaagatg gtaaagaagt tgccgatctt gaagtacaag aaaatcaagt tctcactgaa     91620
     aagagtaatc aaaagaacaa agaattgaaa caaacaatca aacctagaca tgtcattctt     91680
     atctctttgg gtacaggtat tggtacaggt ttattggttg gtaacgctaa ggccctgcac     91740
     aatgctggtc ctgctggtct tctaattggt tactctatta tgggtacttg tctgtactgt     91800
     attattcaag ctgctggtga attggctgtc tcatacagtt ctctaagtgg tggttttaat     91860
     gtttatcctt cattcttggt tgaccctgca tttggtttct ctgttgcttg ggtatactgt     91920
     atccaatggt tatgtgtctg tcctttagaa ctggttaccg cctcgatgac tattaagtat     91980
     tggactacca ctgttaatgc tgatattttt gttggtattt tctacgtctt gatcattgtc     92040
     attaatactt ttggtgctcg tggttacgct gaagctgaat tcttcttcaa ttgctgcaaa     92100
     attctaatga tgattggctt ctttatcctg ggtattgtaa tcaacactgg tggtgctggt     92160
     aatgatggct acattggtga caggtactgg catacaccag gtgcctttgc tggtgaccgt     92220
     ccaattgatc atttcaaggg tatcatggct accatggtta ctgccgcctt tgcttttggt     92280
     gccactgaat tcatcgcctt gactgctgcc gagcaatcaa atccaagaaa ggctattcca     92340
     tctgctgcca aaaaggttct ttatagaatt ttgttcattt tcttaggttc aatcactttg     92400
     gtcggtttct tggttccata tgactctgat cagttaatgg gttctggggg ttctgccaca     92460
     aaggcctctc catatgttct ggctgtttct acacatggtg taaaagtcgt tccacatttc     92520
     attaatgctg tgatcctatt gtcagttcta tcggttggta actctgcttt ctattccagt     92580
     tctcgtcttt tgtactcctt ggcacaacaa ggtaatgctc caaagttctt tgactatgtt     92640
     gacagggaag gtagaccatt cagagctatg gtttgtgctg gtgtatttgc aattatttcc     92700
     ttctgtgctg cttctccaaa ggaagaacaa gttttcacct ggttgttagc tatttcaggt     92760
     ttatctcaag tatttacttg gttcgccatt tgcctatccc atattagatt cagaaaggcc     92820
     atgtttgtac aaaagaggtc tttgggagag attggtttca aggctcagac tggtgtttgg     92880
     ggttcttact atgtctgttt catgctggtc atgattttga ttgctcagtt ctgggttgcc     92940
     attgcaccaa ttggtgaagg taagttagac gcccaaggtt tctttgagaa ttacttagct     93000
     atgccaattt tgattttatt ctacgttggt tacaaaattt ggaagaagga ctggagcttg     93060
     ttcattagag cgaacaatat tgacttggat aagcacagac aaatttttga tgaagaattg     93120
     ttaaagcaag aagacgaaga gtatagagag aagctaaaga atggtggcta cctcaagaga     93180
     atagctgcct tctggtgttg aaatctctgt tcatcttatt gattttcaag ttcataattt     93240
     ttgagcttgg actttcacac ttttgcatga attaaatcga ctattagtct gacgacaaaa     93300
     taaaataaaa atcaaaaaaa aaaaattaac aattactgtc ttgtattatt taccttattg     93360
     atatttataa ctattatgag cattgtacat tagcatctat atttaaatca tattcattga     93420
     ctttcatttt gtttttattc attaccaaat tcttcattta tatcaaggat ttgttagatc     93480
     aataggacgt tcaaccattt atctattacc taaacatata aacaaatatt tgtgcaaaaa     93540
     actacatttt tttatctgaa tagaaaagag ttagcatacg ttaatgatta tagttagatg     93600
     aacaatggcc atgattagcc gttatagctt tctctgatta tagataaata aatcaacaga     93660
     gtcttaccaa ttttactcaa aacaactacg ttttagtcac taaaacttag acaaaatcat     93720
     caagtacaat atggttgttt ggccgagcgg tctaaggcgc ctgattcaag ttgaaaaata     93780
     cttactgggt taacaaactc aggagcactc aggtatcgta agatgcaaga gttcgaatct     93840
     cttagcaacc attatttttt tgatttttaa atacgatcaa tgtaacataa tacgttgttg     93900
     gatttcgtgt gctataatat agtacaagtg atatatgcct aagtactgat cctttccttt     93960
     ttttttccat tatatttact gtagtaattt tatcaagata gagttccgcg atattttagg     94020
     tagtttgagc atattcgctt agctaccgta tactagctta gccctgatag tagtttttct     94080
     gaactgtaac aaaactattt caaattatgc gaacgcttgt tcgtttttga gtctttgtag     94140
     cgaatgtctg aaaagtccca tatctctatc tttccaatat ttccctcatc aaaaccaaca     94200
     taataggtcg tccgcgttta ttcttagtgt caactctttc ggctggttat tttgcccttt     94260
     tgtgctcgaa aactagaaat gctctagtta ttcgttgccc caccctatta aagggaaaac     94320
     actgaaaaat tgcaagaaga ggggtagaca aacctatgca cggaaaaatt actaatataa     94380
     cgttttcata ttacgtctct acgagggaca attagaaaac taaaattacc ccccattctc     94440
     cctgaaaaga ttgtttggtg tccttcacaa aaggggaagt gtataagggt ttcgtactgc     94500
     tgcttctgtg ccgttttcct ctcaaagatc tcataagaaa atactaacgg aaaaacttca     94560
     ttgttctcta aatagcacta tgaactatag aattcagtga gctggatctt cctggctata     94620
     ttttgctgat gggtggtaac tactggaagc gtaagatgat ataacataat ctatttttac     94680
     gcccaatgcc tcataatgta tgatcaataa tacgtgtaca gcatagagat gtcttgactt     94740
     tcgtgaacat agtattggcc aatgtccatt agcgtgctgt agtctcgggg aaaatattga     94800
     aaggttagac ttaaatgcgc tttgagccaa agtgaggatc ttctattcag ttcccccaca     94860
     tttatctccc taccaaaata aaaataacta ctacggctat ttactgacga cataagttgc     94920
     agtgacagcc atagaacaga gaccagccca gcaatgtatg caacggtaaa ctgtttccat     94980
     attagttttc aaccggaacc cactgcttgc ctcacttaac agtttgtctg ggaagagcac     95040
     attagtcttt tcttttttac gatcttccca atccgatttc aatatgtagt ctcacccctt     95100
     catttacatt cacaaacagg aaaacattga tcctaggtag ttttcattgc catcccctta     95160
     caatgccact cccccacaga gcttacttgg ttgtccacca agtatatctc aatggtttga     95220
     tcccggggaa tcagcatgaa aagaccaagt tacaacagaa tcccacgcca atctacggaa     95280
     aaagtcgact acaatagtca aataatgcta ccagtaggct ttttttcaat aattgcattt     95340
     ttcagtttgt actgcttttt gttactcaac actgtgaata taatcacagt tagaaacttt     95400
     cccttaagcg aatcctcata caaactgtcg gtttatattt ctatgctttg taacttcaat     95460
     agttctcact agtgttcttt cccattattt tgactatgct gttattttaa tctttcatcc     95520
     cttgtatgta ccccctcccc cttgatttgg gacactatac gttactgaat ttctaggcat     95580
     atgctcgaga ttttccatac tgtagtcata aacaaagatt aatgacacga taaaagtcca     95640
     aagatatggt atgcgacact aagatgtgcc agctgctaca gcacagatct cccttatgac     95700
     ctaccaattt actatttctc acaaatcttc cgcatcaacc gtcttttcct ttacttgtaa     95760
     gtctcttccc ataccttcgc cccccttgtt tgttttactt gggacatttc ttaagatcaa     95820
     tcagtgctta ctaccccctt ccaaataact ggagctttag actctatttt gctatccttg     95880
     atttgcttgg tgttatgatc atccctttcg ttctctaatt ctcatttgat ttataaagaa     95940
     acaagttcta ctaaatcagc ccatctaaat tatttcccca taagaaagct aacttggttc     96000
     tctggcggaa aataatttta gacctcatta gagactcacg gtattctatt attacaacaa     96060
     atctattttc tattgcaatc agtaattcat taattgaata agagattgag aatcttttga     96120
     gtaatccaaa actaagaaat agatatatcc ttggaattac aatataacag aggaatacta     96180
     attataacca gagagcgctc atcggcaagg catattaata acgaaaaata atctcgcgtc     96240
     tgtttgatat tactcaagta gcaatcacaa cgcttaattt tgttattacc gagctatgac     96300
     gatggaactt ccctcgatca acagcaccac tagcatatct gataatactg atttgagaaa     96360
     ctattatgac aaattattat tcactaatgc aagtggtaaa tcattgaatg atcttccccg     96420
     caaagcacat gcggcgcaac aaataaacaa gaaagttaat gaaactattc atgaagaaga     96480
     cacagagaga gcaccaagaa tagatttcat tgaagggttt ggccatagcc caagagcaaa     96540
     tgtgccatta tctcctcctc aagaacatgc tagaagaaga tctatatttt ttgagaactc     96600
     tttgccccat cataataata gcagtaacga tcgtaacgag aatagaagcc tgggtggaaa     96660
     tatgacacta agtcctgata tgatgctaac accattaaat tcaggttttg ggagtgcatt     96720
     tggtagtgct aatattttca atgaagccag aaggtcttcg tacatcgcag attcgttaat     96780
     tcataatcag aatatacatg aaggtcaaaa cttggagaaa aatggaacca tccaagatac     96840
     ttattcaaga tatgcagtaa atgccgacat gaaaagtcct acctttaata atcaccaaca     96900
     acacttcgat aaccctacaa gaatggagtt atttggtact ggagattatg tgagccgccg     96960
     taattcacaa ccagctggtg ccaaccagtt ccaacaaagc cagaatgcta accagtttac     97020
     agatgggaat tattacaaga ataccaacgg gaacaatttc caagcacaat acccttatga     97080
     ttactacgca tacaatcaac agccacaaca aactgcttat aaacctacat atgactataa     97140
     ttatggggtt agacaacaac ctcagcagaa tccaaattat tatccaaata ctcaagtggg     97200
     tggtaatgac agtggtgata acggtttagt ggtaattgat agcaagcagt tggcgtcttc     97260
     ggataagcta tacgacttat atcaggaatg tggttccaaa tacttttctg ctaaagaagt     97320
     gtttgagttt atggactatt taaaaccgat gctagaggct acatcaaacg agaatgaact     97380
     aagtaatgtt accaaaagcc gtctttacaa gttcctgggg ttcttgaaga gctgtaactt     97440
     gaattataat cctcaatctg aagcctttgt tacggcaaat atgaacaata gaagggggaa     97500
     gggcacagcg tcttcatacc ttcattataa gcctttggta ttgggtgctc taaagaatgg     97560
     taagctggaa ttactgtcaa ttcctcaaaa cagtaactta gcgctcaaga agggtgatct     97620
     agttattgta gatggtgata gaggaaaaga tttgattctt gtagtcgaac ctattgtgga     97680
     tttaaacctt gctttgatta ttaacttttt gaagaaaaaa atacactttg attcattgat     97740
     aacaaataag aatcaacatt atcctatcga aaagtttgtc aaggctctaa tcgactctac     97800
     aaacggtgtt ggcgacgaac taaaccccaa actttacgat attatagagt taacgcagct     97860
     agtagttcct tcaaaacaag ttttgagatt tgcaaattcc tgggaggtca caacaaacct     97920
     gcacaacaag tttcaggatg agttgaaggc tctacatatt gctcaactga agttacggtc     97980
     tttaaacagt gggttaaacc acaatcaccg caacaacagt ggtaacagta cggagagtaa     98040
     cagttcaagt ggcactcctc ctaacgaatc tacagatact tctggagaca aagccgacga     98100
     aatgtctcag aaagtgatta acaagcaatc gtgtacccca cgtttgaaca ttaagatatt     98160
     gaatgccgaa ttccaatttg atagaaagaa attgacgttt tattatgttt gtgaagagag     98220
     gaatgacttc agagaattga tcaaggaact gttcaaattc tacaagacta gaatttggtt     98280
     atgcgctatt cctaataatt tagaaattga tagaaagtac tacgacccta accgcaaaga     98340
     gatggagatg taccagaaga tgatgcagca atatagtgcg gatgattata acaatggcaa     98400
     tgacaacaat agcaacggtg tgaaggacgg tcttgttgtg gctcctcctt taaagagtat     98460
     agagctggac aacttccaga ttggtgtgta tactgagtta gtagagcact tattcaacac     98520
     tccggtataa gctgaaatgc tatgctattt tttttttaat tttgtaacta atatggccca     98580
     gacttgtcta atatcagatg caaaatgagt tttctattgc agcctgtttg gcatgtcaca     98640
     tatttttcct attgttgctt atattcccat tattgagcta gagttttatg aaacttttta     98700
     tgaaactgag cttattgttg aagaaaccga aattcctgtg gcctcggcgt agaaacctgt     98760
     tattctcaaa tccaaacaac aagttgtatt ttttttttgt tgttcttttc ccgcctaata     98820
     cttttgaagt attataataa tgaaacgact ttaacgaata tagtttttat aaatataaat     98880
     aaatttctta aaaaaaatat tgtacataca cagactgagg ggcggaatgg ttggctatgt     98940
     ttctcgaggc agtgtaatag tagatgttaa aaagagtatt gggggaacaa catatcagca     99000
     tatacatata aatatatata ggtatgtgtg tgtgtatata tttatatatt taagcgtttt     99060
     cggcgaagaa gaagttagca gccaaaagct ctagcttgtt ctccttggcc cacttgtcgg     99120
     cgccgacggc aggctcgccg tatccccagt tggctctatc cttgatcttt gtcagctggg     99180
     aagagggcgc gttctgtctg tacagaagga acacgtacct gtgcttgccg gtgcccttag     99240
     gaggtgccgg ccccatgtac tccaccaggg tgttgccgtt tgcgttgagg tcggcgcaga     99300
     caaactcgcg ggagacgccg ccggcggcac ctgcagccga ggcgagcttg ttgttaggca     99360
     ccagctgtat gtctgttctg acgtagtggc agtactcgga ccacttgtgg tccgtgcggg     99420
     aaggcgcgtc cgggtctgtg aggaccacga tgaacctgtc gttgtccggg tcgctcacgc     99480
     cggaggtgga agtgtaagtg atctcgggca gcgagctggc cattgggacg ctgatgtcgt     99540
     tgccgagggt tacggagttg ctgtgtgggt actcaatggt gaggaacccc tgtggctcaa     99600
     agtcaggaac cacatcgggg atgacctcgt gcttcttcaa agggtctaca atagcctgtg     99660
     tagtgttgac gctgtagttc atagttgttg caatgtgcgg ttgtaagtgt agttgcaatt     99720
     gtaacggtac accagcatcg acctaacacc ccccccttcc aacaactaca tacctattta     99780
     tattgctata gtaaggggat attgtatatt aaagggtttc tcgtattaca ctttgcgggt     99840
     aaccccgcaa agtgtataga aggtaaagca gggttacccg caagtattgg gaaagaagag     99900
     agagagttac ccgcaacgca tcactgtcaa cgcaggaaac caacacccac ttcgtacaac     99960
     acacacaaaa actgtggcgt cccgcataaa acggaattca ggcacccccc accaagaaca    100020
     taactgcaca cggcacacgg cccgatagaa actttgtact gcgaaggtgc caatgcgcag    100080
     agtgagcgta ctgccaggga aagacacagt ttttcggttg cgatgccctg gacgggtagt    100140
     agtgcgggcg tctctgagga ctgaccgttc gcatcactaa aaaattttca gtttttgcgc    100200
     tgcgctgtgc tgtgcgcact actgtatgct ctgctgtatg ctgtgctgtg cgctgtgcgc    100260
     tgagtgtgcg atggcccttg tgaaaatttg tgtatgttcc cttctgtgct tatggctgag    100320
     gaaagtgaaa aaaaaaaaat ttgagctgaa attctgaaat tctgaaattt ttcactatat    100380
     aagcttgcaa tggcccaaat gtcaattgct gtcaattgtt caagccgata gaacataacc    100440
     acacacacat acatcacatc acaacgtaac aatggctggt actttcttgt ttacttctga    100500
     atccgtcggt gaaggtcacc cagataagat ctgtgaccaa gtctccgatg ccatcctgga    100560
     tgcctgtctt gctgtcgacc cacactccaa ggtcgcctgt gagaccgctg ccaagaccgg    100620
     tatgatcatg gtcttcggtg agatcaccac caaggctgtg ctggactacc agaagatcgt    100680
     cagagacacc atcaagaaga tcggttacga cgcttccgac aagggtttcg actacaagac    100740
     ctgtaacgtc ttggtcgcca tcgagcagca gtccccagac attgcccaag gtgtgcacga    100800
     ggagaaggac ttggagaaca tcggtgccgg tgaccaaggt atcatgttcg gttacgctac    100860
     tgacgagacc ccagaaggtc tgccattgac catcctgttg gcccacaagc tgaacatggc    100920
     catggccgac gccagacgtg acggctcctt ggcctggttg agaccagaca ccaagaccca    100980
     agtcaccgtc gagtacaagg acgagagcgg tagatgggtc ccacagagaa tcgacaccgt    101040
     cgtcgtctcc gcccaacacg ccgacgaaat ctccaccgag gacttgagat ctaagatcaa    101100
     gaccgaaatc atcgacaaag tcatcccagc agacatgcta gatgagaaca ccaagtacta    101160
     catccaacct tccggtagat tcgtcatcgg tggccctcaa ggtgacgccg gtttgaccgg    101220
     tagaaagatc atcgtcgacg cctacggtgg tgcttcctcc gtcggtggtg gtgctttctc    101280
     cggtaaggac tactccaagg tcgaccgttc tgccgcttac gccgccagat gggtcgctaa    101340
     gtccctagtc gccgctggcc tatgtaagag agttcaagtc caattctctt acgccatcgg    101400
     tatcgccgaa ccattgtctc tacacgtcga gacttacggt accgctacca gaccagatga    101460
     cgaaatcatt gaaatcatca agaagaactt cgacctaaga ccaggtatct tggtcaagga    101520
     attggacttg gctagaccaa tctacttgcc aaccgcttcc tacggtcact tcaccaacca    101580
     agaataccca tgggaacaac caaagaagtt ggtcatctaa ttgtaataat accatttaac    101640
     gtatttttga tgcacagctt tctttctatt gtacctgttc ttttcttttc aaccatccca    101700
     aacaaaccga gaaaagtatt tgtttgactt acaaaataat tgaaccccat tttgcatttt    101760
     gagagtttgc ttttgaaaag atggaaaaaa aataacttat attaaagata caaaataaac    101820
     aaaaaattgt ttcaacaaaa tttcacttcc aattctcact aatttttcca atatatcgga    101880
     cattattttg gtattctaag gcaatcttat tcattcataa ttaaataaaa ctttataaac    101940
     ctttgttgat ttgctcaact caaatcatgt atattaataa aaacttcaac ttttttagta    102000
     acaaaacaaa tctgtcttga gtattgtcat gcatatatct gttgttatat aggatttccc    102060
     ttacctctac atagtgttta acaactctaa agccttggtt aattcgtcac gcgctgtgga    102120
     tatgtcctcg tagttcagtg cactaatagc atatttagca aatcgctgta ttttctctat    102180
     cttatctgct ttatccatca tattcgccag atcattcttc gtgtatgttg gtttggaagt    102240
     ctctagctct tccagctctt gttccatagg agttgaactt gtgtgaacca caggctccac    102300
     tgcatcgtcc ttttcttcca catcggcatc actgccttgg tcctcgtcac ttgaatcgac    102360
     aaatgctggg gtgtccaact tcctagacgg tatgttagcg ggtgtgtcgg gtaatccaag    102420
     gttacttggc tcttcactac caccattttc atcggcttgt gatctgtaaa gatcatcagg    102480
     ttcgttctct gagtcctcat cagccatctt aagcttattg attaaatcgt caacatcatc    102540
     ttcagtcacc gcattatctt gtgaatctcc taccaacttg ttgacttcct cttcctcgga    102600
     tttatcaagt ggaacatcat tagattcatc atcacctccc aaaaagtccg catagtccaa    102660
     ttcttgaggt ttttcctcgc cggactcttc cttagctgta tcagtaacaa gattgtccag    102720
     ttctttatcc aattcctcat cattaggctc ggcctcttgc ttttgcaact cacctttggc    102780
     cattttactc aaatatatct tacaatattt tactctctct gctactttag acaaatcttg    102840
     caaatcagac tgccaaagat gaatgacaca tgtaaacaga tcaatgcagc accacaaacc    102900
     acgcttgagt gtcagatccc aaggcccatc ctgaacctgt tttaatttat cattgtacaa    102960
     tgacatcgca aaattcagca tgtaaaccat ggctttcttg ctgtcctgca gcagtacttt    103020
     cactccatca gcttcagaat cctcagaacc tgtgacttcc tgcttgaagg tctcaatctg    103080
     gtcaagcaac atcgtagcag cctctgtaac ctcatcagac cgctcgctca gttgcaaaag    103140
     cttctccacc gcatacaacc gcaggtaata cgcaaccact gcaagcccag ctcgctccat    103200
     gtcctgcgcg gtggcaacta accgtactga tccactatcc atcttcttgt gccgttatcg    103260
     tttcgacctc tatgccaatg ccctactata tacatcttca tgctcatccc cagtcccttt    103320
     tatgcctgcg ataaggtttt gcgttggaaa cgagcttctt ccaccttgaa gcgaacgcca    103380
     gaaagtttag aatttcagaa gtttgatgga aagaggacaa caatacaact tctttggaca    103440
     tatagaaact gttcaacaga atcaattggg cactacaaag gtaggacttg caagaaaagg    103500
     tgaaagacat ttgttcataa tagtggtttc atcgaaagtg cgatcgaatt acatcgagaa    103560
     atgatagagt tgagtaggcc tgttgcgaag ctcgggctga acccgtttag cctccactgc    103620
     gacgctgccg gtggtgtgtc ggtggacgat atagttgtta tgctgcggtg gatcgaggag    103680
     agcaattttg gcgaagtttc tagcgaacgt gttgcacaat tgcgtgaaca tgtcgagtca    103740
     caatcgagtg aggataaagc cgaagtattg gcgaagaata atgtgatggc gtcggaagac    103800
     gggtatgtga gcaaagacac gagcttgcaa gtgatgcaga aactagggat attagaagag    103860
     tttcaacagg atttagatag tttcggcaaa gaccacacaa ttgaagataa ccacgaaaca    103920
     caacagaagc aagaggatat tgagtcaagt agccatgata ctgaaagaag tatcaatgta    103980
     acgtctgatt taaaacaaga agatactgaa cagttagctg acgccaaggt cgatggccat    104040
     gttgaaaatg gtgcggacgc tgatgtcacg attaatgaag aaggaaatga tgatactatg    104100
     aaggtcgacc aagatatgac agattcgtca gtgaaaaaac gtggcaatgg attgagtaac    104160
     atggacctcg attttgattc acaaagagaa ttggggtctc cattgaaaaa aatgaagctg    104220
     aaacctacct cgacatctca aaactcttct ttggatacct tacatgagga tgatactgaa    104280
     gagattaaaa atttggcgga ccaaccgatc gtgataacta cacatgatct tgaaaaggtc    104340
     aatgatacac cgataacttt gcgcaccgct gaccacccat cagatgcagt cgataacgat    104400
     caaaaactga aactagaaac gtttttacaa aggttgttat tcccagaggc acatgagtca    104460
     ccatcaaaac ttggttcaaa aaatggcaat actaaccctt ctcatacttt tgaaaatgca    104520
     ttatatgaag tcgatttaag tatgcctcag gtaccactga acctgaacat tcctgcagat    104580
     gagcatggca atacaccttt gcattggtta acctctattg caaatatcga tttggtgaaa    104640
     gaattggtca agcatggtgc aagtagattg ctcggcgata atgccggtga atcagcatta    104700
     gtgaaagctg tgaaatcagt aaataattat gatgccggaa cttttgaaga gttactggat    104760
     tacctatacc catgtttgat acttaaagac tccatgaata gaaccatttt acaccacatc    104820
     gttataacct caggtatgtc acgttgcgct attgcggcaa aatattacct tgatatactg    104880
     atgggatggg ttgttaagaa gcaaactaga aaactcgatg gcacacccga ttctatattc    104940
     cagtccattg acttgaaatg gtttattaat aatctattaa atgcacaaga ttcgaatggt    105000
     gacacatgct tgaatattgc tgcaagactg ggtaatgtat ctataattga tgccttacta    105060
     gactacgggg ctgaccctgt tatttctaac aagtctggat tgagaccagt agactttgga    105120
     gcaggaactt caaaactaag aggtcaaaag ggagaaatga gccaacctaa gataatgtca    105180
     ccagcagctg gtaataaaca ggtaacagaa ttaagttctg tagacacagg aaatctgata    105240
     cgagaattag aaaccttgtt gaacaaagtt aaaaccaact atgaggatga agtgtatcaa    105300
     tacaaaaata agctagaaaa acttcattcg cagttaaact cacagaggga gcttctggcc    105360
     acttctagag acagactggc ccatacaaag caattaaggg atgactatgc tctactgaaa    105420
     gaacaattga tgaatataaa acaaggaatt gctgaagaag aagaaaactt caggaaagaa    105480
     agcgagtttc ttgggttttc atcagaggag gcatctaaga ttgattggaa ttctagtgaa    105540
     tttgacgcgg atgaaccttt cagaattgat ataatatatg atttggtgga acacaaacta    105600
     aatagcactt ataaaggaaa cctggaggaa ttattaagcc aagagtctgt tgaaagtatc    105660
     aaaaagtcat taattgctaa tgcaggaagt gaggataagt tgaaggaaca gttggcatca    105720
     agcctacccc cagcgcctct attgaaagcg agacttgagg catatcgtaa aaacgatgac    105780
     cacctccaag acgttttagt tggcataaag gagaaaagaa ctgatttgga aaacaagttt    105840
     agaagggtgt tatcactttg cttgaagata gaagaaggaa aggttgacga tatgttggat    105900
     ggcctattac aagcaatctc atctgaggac cctcaagaaa ttgacacgga agagatgcaa    105960
     gatttcttga agaaacatag tgattgagta gctaatttat tatttaagac cttcgtttgt    106020
     actttacaga gatggataat ctatacattt aattttttaa tgtcaatttc attatttgtc    106080
     ttgaatgcac ttacattact agctaccaaa acataatata attttatgaa tgtcacttct    106140
     aaaatgatat aagtaaatga taccttcata atttttaaat ataattaata tgaacatgta    106200
     ctaacaacta acaatttatt tagctggttt cttccaaaag tactgcttat gtgtctttct    106260
     acatgacctt aaatttgatc taccaccttt taatgacatg actagtcccc tacggtcatt    106320
     atcagagtca ttctccaagt catagaagta ttcctcatca agaggctttc ctgcagcatc    106380
     cttaccctct ctgtagataa taccaacgca tttgatatct cccaataata cgcgcaattc    106440
     attacgtgac aattcggctg ttttactgtt aactgattgt aattggaaca atggagtctg    106500
     ctgtatattt gcaaatgcca agtgattcac taggacgttc ttaacattct cgatatctat    106560
     tcctttaacc tttagttgct caatcacctc ttccttgctt agtttctttt gctctttctt    106620
     ggcttttttt ggcttgttca ggacagcgct gttttctgat tgctcaattg gtctcttgtt    106680
     aatggatttc ttacttagcg cacttttaga tttatcatga tgagcgattg gagattctgg    106740
     caagctaaaa acgttggcct tagaattatc ctttcttggt gcctttggtg agaaagcgct    106800
     cagcttgaaa gaagagcttg gtgtcgcgaa tttgggttta ggtattccga aaggcttagt    106860
     attgccaaaa tgatgtaacg agattggtga gctaggttct actttgctca acgcttgttg    106920
     agactcagag ctagaactgg agaactcagt taggtcagag gttgactgtt tagtttcctt    106980
     tagaactggc tttttgataa tgtagctatg tgtctttctt ctcttgacca cgtatatgat    107040
     accttctgcg cccctgaaat ctataactgt acctttgaca tatgggatga tcacactctc    107100
     gttttgcaac aaagtgaaag aagtcaactc gacgtcaata accagttttt ctgagaagta    107160
     gggcacagta gcactattgt ctttcaagag taagtattct gcaccttcgg agtccctgat    107220
     gacacctttg ttctctgtgt tgtacttgac cagtttgcat tgcaatttct tagggagcaa    107280
     gacaactaga ccgtttgagc ccaaacattt cagcttgatt tgctttgtct ttggtaagta    107340
     gttcacaaga gcatgctttc tagatatctt caacttgctt ggcagaacca cgtcgcagga    107400
     tgctttacga ccgatagtta gcggttctgg gcggtcggtg gacaatttga taagtgttct    107460
     cctcttgggt ggagcgtaaa ctggtaccag tgtagtggca gtagaagtgg cagacgaagg    107520
     ggaagtggta gtgccgctta gcgaggagtc ggcaattctt ggtggtgatg tgtgtaaggg    107580
     tggactgtca gttatatcac gcgtgtgtct cactggggag gaccttccgg tacttgacga    107640
     tgggaatggg gttggatagt catgggattg cagctcaggc ttctttggtg gcaatggagt    107700
     tactttgaac cctttctcgg tgtaatcgcc ttctgagtgg aagaacggat tcttctcggt    107760
     agtgctcctc actggagatg atggcgggaa ttgctcaaac atgggtgact tgtttagcgg    107820
     tatgcagata gaagtctttt ttttgaagat atctctactt ttctacaata acagcaattg    107880
     atatatatat ttgtaaaggc gtcaacaata tatttggagc agttggatgg gatagcaact    107940
     gaaagaaagt tttgagagcc atgagagaag catgttaacg gttttacgcg taacactaca    108000
     agcatcaaga gcacactaat gaatatggat actgatgttg aggattgtgt gagtgtatgt    108060
     gtgcttgtgt atgtgtgctt gtgtatgtgt gtttgtatgt gtgtgtttgt atgtgacacg    108120
     ttattatggt ggtttttaag gtgcgtttgt ttacatttgt tgacattttc cagtgctctc    108180
     cgtgtgtgtc tgtgtgtggt gtctcgcatc gaaactgaca aaaagtcgaa attctgaaat    108240
     taaattcgct ttaattcctt ttcgcgtttt cgcgtttgcc ggaccacaaa ggttccgggt    108300
     aagttttgca taaatgacat gtggatgtag taattattta cgagcagtgt gtgtattcca    108360
     catgtgatgt gcgtatcaat gcatcgtgtt acttttgtga cttgtttttg ttgatggggg    108420
     agggttatgc acccagacac cctgaagtct cttttttgtt tcttgtgggt gtgggtgtgg    108480
     gacggggaga cggattctgt gtttggtatg gagctggagc tggagctggg cagctggaaa    108540
     ggtttaggtg gaacctggca gggttactgg cagtgagcaa caacgatcac tgagtctggg    108600
     actggtgtgg taccgggtgg cgctgggtgg taccgggtga tactgctgga aggggaaggg    108660
     aggtacccct aggctgggga cggaggtgtg tgatggaagg acgggggtag agggaggcta    108720
     gagtaccagg cgtgtgcagc ttcactacgt tccttcccaa cggggactga ggtctgagga    108780
     cagaggactg agaactgagc agtccccccc ccagatgtga aaaactgttc tggacaaaaa    108840
     tgaagtgaaa tttcaggtgt actagttgat atatatgaaa tagcgctact atttattggc    108900
     acgtatagta tttatttttg atatttgcaa tacaaagtca ataacagatc aaatataggc    108960
     aaacatgggt agtatgtagc aagaacgaat ttatgagcga gccagcacca gctggtattt    109020
     tgagtacgat gaaatatgaa ggactttact ccaggtggga agtgaaattg ggaatacagc    109080
     gcataaaaaa gtggccagat actgataaga tatacaaatc gaaactacaa actatgttat    109140
     ttggtgagag cagcaaatgt atgatagctg agggatatca ttggagcgta ataggacttg    109200
     tgacaatgca tgaaatgaag cgaattaatg tatcatgaag catcatgcgc accagattaa    109260
     agattgagaa gctgactatg caatgggact ccctgaaaca acattatatt tctaacttct    109320
     ctggaaggaa cttaatttca tcaatacaaa taagattatg aatttctgtt actaacaatc    109380
     aattattatc aaacttttac aataacgcca atgttgactt tttacatgaa ctgaaactga    109440
     aactgcacta tgaataccga tctagaggac aaaaagttat taagtaccaa tggaatatta    109500
     atagaagaga atcccgtaat atgaatgcat gtgaattagc caaatctcga agatgatcat    109560
     atggttatgt ttcagcgctg tggaagaagt tgtatttgga tattagtgag aatgataaac    109620
     ttatgaaaac agagggtact ccatctttcg gtaagcgtca caacaagtcc cacactttgt    109680
     gtaacagatg tggtcgtcgt tccttccacg ttcaaaagaa gacctgtgct tcttgtggtt    109740
     acccatctgc taagaccaga tcttacaact ggggccaaaa ggctaagaga agacacacta    109800
     ctggtaccgg tagaatgaga tacttgaagc acgtcgctag aagattcaag aacggtttcc    109860
     aatctggtac cgcttctaag gcttccgctt aaataaatta ttcgatataa taacatttct    109920
     attaatcatt atattataat ttcgttgtca agatcacata agcgttgtca ttttactaaa    109980
     cttgttttaa taaacattta aagtcattta ggcaggcact tttattagca tatactttgt    110040
     aagtagttgt ctaaaagata attatttttc ttttataacc aaaggaaggt ttctagcaat    110100
     gaatcgctca atgcaatgct gtgcgattgg cgggtgcatt caaagataag tactgaagca    110160
     aaaaaatatc tcagggctta ttgatcccaa taaaagggca tcaacaactg tgtatacaca    110220
     atttctaaac tgttataagg agtctatgtc ttgctaaata acgtaaaact gatatttatt    110280
     cagccagata agaaatatgt attaatattc ccttcagcct gtcgcttgaa gaattgaagt    110340
     acatgtatct tcatttttta tacttacgaa atgtgttgaa tccgatacgc agttgttcca    110400
     tttacaggca attggtgata aatgatatat tataatatgt tacagcggca aaattttgtt    110460
     atttttcgag gttttactta tagttacctg ctctgaagag ccgattgata gtgccgttgg    110520
     cagaatctgt gttatatccg gtgttatttt gttgattctg ttataatctt ccaatcttgt    110580
     tgactattga agatatactt ttatccagga gcagtattag ccagatagga cacgcatata    110640
     gattcatagt tgctagcatg atattcacgg attggaaata gccctccaat agaggttatc    110700
     gatgctggat caatattttt ctatgtatag attgatcaaa attgctcagc cgttatcttt    110760
     gttaatgcta acttgttctg catagttgag gactgttagt ttgtattttg tgttgcgatt    110820
     aagaatggtc attttacatt ggaggtaaat gaattacgat gagctgtggc taaatcaatg    110880
     aagtacgtgt tataatggcc gcaacataga taaatattgg ccatatgtaa tcaatgatac    110940
     aaattttaat cttgactttg gaattgattg atcttgcagt gattgagggt gtattatgaa    111000
     ttgcttataa tacactcaac gcgtggcttg ttaagtaaag ttatcacagt cataatgaga    111060
     tggaaaagaa acaggacatg aggtatttga taaggtttat tcagccaaga aatttgtgtt    111120
     tgacttaaaa ctaattacct cccataaggc aattggatta aaatgcgttt ggaacagcat    111180
     atttgtcatt taccgaccaa agcatttttc agttcatgga attgagtagt ttaatataga    111240
     tgcagattgc tagagtcaga aggaccagcc agattacaac agggatagaa tttgagtaag    111300
     tatagctact cccccactat acattgacgt agagtgtaga tatatcgaaa gcagtagcca    111360
     gctggagcta aaatctttgg tcacgtggca tccttgcaaa cgcttggttt tgaggctaat    111420
     gcccctccca gtaacccagg atgctggtaa catgaaacac cctacccggt cagtgtttta    111480
     gcttttattg cttgcgttat attttaaccg ttataggtat gcgatttctg tgacttgtgt    111540
     gaagtggcca gtactgtggt tgcatcgccg ccgcacatgc gcctagcagt tttcatattt    111600
     gaaacatggg ggggagtaca cctggaataa tatggggagt cttacaatta cagcaaggat    111660
     atacgtttca aatactaaat aagtctggaa ggtgttaagt ctccagtatg gggtttttta    111720
     atcagttggc tctgtttttg gaaatggaag tatacctgtt attcaagtaa tttccccatt    111780
     tgtgcttcaa ttatgttcga tagctgagac atgcgcactg aaacagctat ggaccactgc    111840
     tatctatgcg ataagcagtt ccatacagta ttgttttatg gttgcacagc actgtacaca    111900
     cttgtgactc gtatacgtta gaatgtgatg tgccgaagca gggtaacttg tgctgggagc    111960
     cctcatcgaa aattttcagt tttttgttcg atggcagtgc gattccgttt ggcagagaaa    112020
     ttagcgatga gcttagcgat gagtatgtca tatttgttga ttcttgtttc aattttgtag    112080
     ttaagtcttt gtatgtatgt ttttattgtg tttcttgttt aacttgtttc ttgcttctgc    112140
     agtatctaca atagatagaa ggataaaata agcgatggtt gaagattcca aggcccgtat    112200
     cggtggtccc aataacagca gtgttaccaa gaagcaagag cccaggctgt atgttgtgct    112260
     gtgtgaggct agtctggaga cttacacttc gaatgaccac aggacctcgc tgctgaactg    112320
     tgacgaccat caaggtattc tgcgaaagat gggcagggac atcgctgagg ccagacctga    112380
     tattacgcac cagtgtttgc tgacgttgct ggactccccg ataaataagg ccggtctgtt    112440
     acaagtctac atcctgacca agaagaacgt gctgatcgag gtgaatccat ctgtgagaat    112500
     acccagaacg ttcaagagat tctccggtct gatggtgcaa ttgttacaca agctatctat    112560
     caggtctatg gagagttcga acacacattt gctgagagtg gtgaagaacc cagttacgaa    112620
     atacctgcct gccgactgcc ggaaggtcac tctttctttt gacgctgagg tgatgaggcc    112680
     gcaggagtac cttggggata agcaatcagt atgtgtattt gtgggggcga tggcgagagg    112740
     ccacgactcc tttgctgatg aatatgtaga tgacaaaata gctatatcta actacccgct    112800
     ctccgcctcc gtcgcctgct ccaagttctg tcatggcgct gaggacgcat gggccattat    112860
     ataatttaca aacccacacc gaggactcgc aaaattaaac tgctgcgcga atatgtccca    112920
     aatattttga tccgtttctg gggcgttcca agcttctgag agaatgacgg agagtgtatt    112980
     ttgtttgagg ccggtgccta attgggcata gtatgtacga aatgccataa aagcgttcat    113040
     aggtcttttc ttactgctgg atttcgattt taaaacattt ccgatggaag tattgaagtg    113100
     atgagatatg aacttatcta tctcccatga tgtttcaata tcgatgatat tgatacctga    113160
     ctcaaatgag ctcgtcagtt tcatcctttc ttctctaatt cgctttagta acacagggtg    113220
     agggggtggg atctgaaact tgttcggttt agttaacagc atgttaagac caaaggagct    113280
     ctttgtggaa ctacagccca gaaaatcgga gtgtttttca ggatattttt ggcttctgag    113340
     tcttttattt gttctaaccc tgaattttgt ggcagtatac ttcatagtca gtgtttcagt    113400
     taacattagt agagtgactt cagatattgt acaactgaca taaaggaatg gttaatttct    113460
     gctcattaat catgttaaca tggcaatttt ttgggtttct tttatattaa ttctcttgga    113520
     tatgagactt gtgtaagatt aatatagtat ttacagtatt ttaccatatt aggtaaatat    113580
     gatagacagg gagtgtagtt ttattaaaat tgcaattttt aggcggttga acctcaataa    113640
     atttatataa aaggaacgga atgaaattca gtctgaacta gtgaatatat atgtggttta    113700
     aaaataccaa agtacattat gtcaaagaaa tcaagaatta gtattacgca tctacttaat    113760
     ccaatacaag aagaaaattt aaaggaaaaa ttgcaagaga ttaataacca acttatatca    113820
     ttgtgttcca gtttacccaa aagacagtcg ctcccggggc cgtcgtccga tatcctaagg    113880
     ttcctatcga gaaacaactt ggacccacaa gagatagggt tgatcaagac aacctatcga    113940
     ctgtctactc ttctgtcaaa actacgggag catgagatcg tattcaatgt ggttaccaaa    114000
     gaccatctgc ttaaaaaagg cgtccccaat cactatgccg cttcctatcg aggccaccgc    114060
     ttcacaaggg aaaacgtaca gatactagag acctggtacc gcaaccatat cgacaaccca    114120
     tacctcgacc acaacagcca gcaatatcta gcacagaaga caaacctctc aaaaatacag    114180
     atcaaaaact gggtagcaaa cagaagaaga aaacaaaagt caatttacat ctcaccattc    114240
     agacctacct tgatggctca aaacagcctc gacacttgac tcaaacatat acatttctct    114300
     ttgtcttctg ccactacctt atttttctaa cctggaatta tcttgaaatt gtttcacaat    114360
     ttcaagaacc acacacgcac cgactgaccc acacaagaga tcaccacctt cgaaataaac    114420
     tttcagtcaa aatgataacc attcttatac atttttagaa cccgattcta ggttcatcac    114480
     ttcttatgta aattacccaa aaaacaccaa aaaatttcgg aacctgctac agtaaattgt    114540
     cacgcgactg gaacctttgc caagaactcc cacatcacca acatacgcac cgctcgacac    114600
     catattgact acaattagct ccctttatac acagctatat actttaccca aataccatta    114660
     aactccaata aatccaaatc ttttttaaaa tcgttgctaa gtcccgaggt ctcgactacg    114720
     caagaccaac gctggcaaaa ataaactcta aaattagacc actactgcaa cttacatcat    114780
     aatcacagga aagacgccta aatcacacat caataattaa tacaactgtc aatggattct    114840
     ccgacaagcc agtatgataa tggcgcatcg ccgactttac ccctcgacac gtctttccag    114900
     accgcgtcct tccacactgc aacctctagt cctacaccat cgcagcaatt ggacgcgcaa    114960
     gacatatcaa aagagataga gcaactgagg ctttaccaag ataataaacg tatttccttc    115020
     acaacgcctg tcgtgaatac atccccacta cacctgccgc cagacataac accaagagcc    115080
     gaccaagttc agccggaaaa ccaacaagga tttgtatctc acggcctcgg tatatcgctt    115140
     ccgcagccta ccgataacac caacatcgat gacacgatta ccagcatcga tcccgacatc    115200
     acaactaaac tacaacctga ttcacccgat cgcacaaata actcggttaa gtccaaacca    115260
     gacgatttca gcctttcgca cttgttcatt atcgctaacc atgagttcga cccaagttct    115320
     ttacaaaaca aagaagatgc ctcaatctgc ttaccattca aaaagaacga tgtagcattc    115380
     gtacacgtcg tagacgagtc cggatggggt gaagttacac ttatcaagaa caatgaaaga    115440
     ggctgggtgc cattcaacta cttccaagat actgtacatc caactacggc tgcataccca    115500
     gcaccacagt acttgaaatc gcgtttacca ctggagtcat tactatctgc atgtgcacag    115560
     tttctaacac aacaagatgg atcggaaaag tttaaacata aatattttaa tgatataagg    115620
     gacggcgtca aaaccttgct agaattaact aaatgtgtct cgagatcaga tgaacttgtc    115680
     aaatctgtat ccctaatacg gagagcgaga aaagctcttc tggctgattg gtacgacctt    115740
     atgatgaaag ctgaccacta caagaaaacc tcccccagtg cagaaaatat aaccacatta    115800
     atacaactaa caaataaagt caccaacaaa gcattcacat tttacaacgc atggagtacg    115860
     cacctatcca ccgattcaag taagcatgat tccagatatc atatattgaa caacccatcc    115920
     gataaaaaag aagaacttat ctctcaaaac aactctatag aggccagttc caaatctacg    115980
     gtatcaaata atcacgccaa ccaaccaaca gagaaccaga tatcggagaa ggccaactca    116040
     accactttat tagaaccacc ctttgcaatt gcaagactta ctgaaataca taacttaatt    116100
     tttcagtata ttggccttat actaggacgt ctgcaaatgg ttacgaacaa tcctgcagga    116160
     tatgaaacct tagaatcggt aatacaccag ataattatca ttttaagaga attactctat    116220
     atcagcaaga catgcgcata cataatgcaa cagaaatttc aaaaagttga tcaagaccca    116280
     tttaacgaag acttggacca gttgctatca atggtatcag atatggtttc aacaataaaa    116340
     gtgttagtga ctatgtcact aaatacatct attcacaaag aggatactgc tactattgaa    116400
     gcccaacaac ataagctgat ttcaattgtg gcaagtatga cccccttaat caataacaca    116460
     gtcctgcaat gccataacta ccttcgctta attggtgact ttaagcttga aacctctaga    116520
     tcatatatgg atttccaaaa gattcgcata aatcctcaac atctgataaa tagaagtcag    116580
     acaacttcaa ataatgacgt atttaaatct gatttccaaa gaaaatccat tgatcttttt    116640
     gctaatgata aggaaagata taaaagagtt actagataca gtactatcac ccccttaaga    116700
     gaagatttct ttgatgatca taatctaatt gaaggctccc cagaaaaaaa gtcattcgcc    116760
     cgtgattccg tatttctcaa atatcaacca actgactcag aggctgaaag ctctgcattg    116820
     gtgacaaatt catcagacaa gctaagtgaa gaagacctta tttacgatag caataatgaa    116880
     ttaataacag ctacctgtcg tggcttggtt tttaagctca ctgatgaact agaccatcca    116940
     agcagctttt ttgtttcaac atttcttctt aactttcggt cattcatgaa atcatatgaa    117000
     ctggtgaccg aactaataaa tagatttgat ttagcggata tggaaaataa acttagggat    117060
     aataaaccca aaggcaaata ctctaccacg gcttctaaac tgaaaaacag acgtagattg    117120
     atctgttccg tttttaatga atggatggaa agttactggg attacaatac cgatttcgaa    117180
     tgtatatcca caatgataaa ctttttcaat gaagggatgg ctgattatct acctagagaa    117240
     tcaaaaatgc taatacaaac ggctgcaaaa ttgattttaa aattcaacga actcaaaaaa    117300
     aataggcagt tgactacaac ttactcccag ttgtgtccaa ttaatgtttt aaaaaataat    117360
     ggcggctcga tgatttctca aatctcgact gtaacaacgg ctacaaataa atcaatacta    117420
     actatggatg aacgcttaat cgatgaatat gaactaacac atataccaca ccaaacagaa    117480
     gatgacctag cgcttccatt accagtgttg aatcttggta cattttcttt gataagcaaa    117540
     gagaacactg agcaaattca taatttggta tacaaataca gaaattattt gaatgaaaag    117600
     aattacgatg attttacaga caaaacctca gatgagattt tgaaaatctg gtttgagctg    117660
     aaaaatcacc acttctctaa ctccgattta tccactgctg ctgaattcag cttagtgatt    117720
     ttaaatccat tagaagtagc gaaacaatta actatccttg aatcacttct tttcatgaga    117780
     ttaacgccat tcgatatagt gaactataaa gcaaattcta caataacatc atcaaatgtc    117840
     gctgccatta catcattcac aaaccaactt tcacaatatg tgatgaacgg tattttaaca    117900
     cctagaatta acgatgctac aagaacaaca atcttgaaag cctggttaag aattgcacta    117960
     tcagcccttt atttgagaaa ttttaattct gtggcttcta ttatgacagc catccaaaat    118020
     cattctatta cacgtttgac tggtgtatgg caacaactat cgcgaaagga cactcttcta    118080
     tatgagtatt tatcaagaat aattcatcct aatcataatt tcaaagtcta caggcaaaag    118140
     ttgaaaaaaa tcattgacga ttcatcacaa ggctctatta ttccagtgaa atcgcatgtg    118200
     cctgtcgtac cttttttcaa tctgttctta caggatataa cgttcataca cgagggtaat    118260
     tcgacgttca gaaatcctga ctcattcaga ccaaataagc caatcaatgt ggataagttc    118320
     tacagaatta ctaaaattgt aacaactatg caatttttcc aagtcggata taatacgaac    118380
     agtagtgagg atgcaccaaa aagggagtcg ttttttagat tgacagaaga aatgggtttg    118440
     gataccaaaa atatagcgag tgtaccgctc ctacaagagc ttattgttta tgagctatgg    118500
     aaggtcaata atgtcttttc tatcgattct gacagagctt accaattgag cttacaaata    118560
     caaccaagaa actaagtaac aaaataagag catttacgcc attatggcag ttgtaatatt    118620
     attaattaac tcatgcataa caaacagact tctaatataa taataataaa tcatataata    118680
     tctaataatt taaattcact ttttgaaaaa agtatgaact aaaaaaatgc ttccaaccag    118740
     atttgaactg atgatctcca cattactagt gtggcgcctt accaacttgg ccatagaagc    118800
     ttacttaatc gttgttagtc ccaggtattc acactatcca agtatacacc aattttgaat    118860
     caaatgaaga acaaaagtag acatataaca gcatcaaaat attcagtcga catactaagc    118920
     tcaaacattt caaatagttt tcattcacat ggatttacta ttcaaatatg tttattttga    118980
     ttaaacttta tattgatgct caaatgatct ctactttata catcaataaa atgtattttg    119040
     cagctcatac taaagttatt ggttcagcat actcaataat caatattcaa aatatcgatt    119100
     aaagtttgta aaattatact aaacctgtat gacctttaca aactgcgatt tctaattctt    119160
     gcgtgaataa ggctatataa atatcgtcct tttttttttt aatgaacagc atctttatta    119220
     attatccata atgcttctta acataaatgt ttcaatacca attcagtgat taaacaatcg    119280
     acataattaa taatgttact actacattat atcaactcca tagtttataa acatcactta    119340
     taacgattac caaaactggc tccctcgatt aggcgatggc tcaggctcaa taacacctaa    119400
     catactcata tagtccttct ctcaaggatt tagtacacat cattgcataa gtaatcgaca    119460
     taattactgg tttattaatc ttagagcatt gagccattga agtatttcga gatttcctag    119520
     aaattctaaa tttcaatcaa caacacctgc aaaagttacg ggacacattc attacatagt    119580
     tattcctcaa ttcaattagc tgatacaact acttcagtta ccaacatatt tcattttaca    119640
     atatcaaatg tcagtaagta acggcaacga tgatgctgag caagcattag aattttatcg    119700
     taaggccttg aactttaatg tgataggtag gtacgatccc aagataaagc agctcttatt    119760
     tcacacaccg catgcatcag tgtacaaatg ggatattgaa agagatgaat gggcaaaact    119820
     agaataccag ggtgtactgg cgatatatct aagggacatc ggaaatgggc aggacttcct    119880
     tccaccacag gacagtacta tggatgcaag tgttctagca ggatcaatga cccaaggtaa    119940
     cgagaactat gggcagggtc taatgctctc tggaagggat atatataatt acggtttaat    120000
     tatactgaac agacttaatc ctgacaactt ctcaatgggg attgtgccga ataatgtcgt    120060
     aaataagagg aaggtttttg attccattga ggatgcagag aatcctcttg agtgcatggg    120120
     agtagaggtc aaagatgaac ttgtaataat caagaattta aaacatgaag tatatggtat    120180
     atggattcat actgtcgaag accgcaaaaa tgtatatgag ttaataaagt atttgctgga    120240
     aaatgagcca aaaacatcat tcgcttagga atcagtatga tagcatgcag cccctaatat    120300
     ggtagatttt tataggtcat taacttagtt gtattataac ttctctatcc ataattttaa    120360
     ttttgaacag caattgaact accgtatata tatacaaatg cttgaagcaa tctagtcaat    120420
     ttacagaacg aattataggt gaataaaaat aatatcacag attaggaagg agaacctgca    120480
     gtacctggag tttgagggac gtttggagta ccaccttcac tacctgaagg ctgcttcttc    120540
     ttagttggcg cctttttcct cttgggagca gcatcgccat ctgcagtttt ggctttagtc    120600
     ttacgtggct tcttaggttt aggagctttg tcacctgcag cagtacttcc tcctctctta    120660
     gtgccaccct ttgctccttt tgctgcagcc tttccttttc cagtgccttc tgtggaatta    120720
     cctccctgcg gcattccatt agaactgccg ccattttgag gagttgtcat cgaaatacga    120780
     gcattgtagg cagttggcag catgttatta gctagagcct gttgcttcct tttctcttta    120840
     ttgatcttcc attgctcaat aaattttaac cgcctaaatt ggttagtctc actattcatt    120900
     gttcctccta aggaagcagc cgcagccgca gctgccatag ccactttact ccccgtactg    120960
     ttgttattgg atcccttcag tccattttct attccaccta cagcatcatc atcctctgca    121020
     ttttcattgc tacgtttcat cttctgcata gcattcattg caactattgc agcaaaagtg    121080
     gcacctgtgg aagttgttgt cctctcattc ataatcaaca tcagctgttc atattcagat    121140
     gtcttttgtt cattatcttc atgttcagga atatggtgta caactccttt cgtccttgct    121200
     gcggtacttt cgtctctatg ctggtggata atacccttaa cgttctcatc ccaatatggt    121260
     gcagtaaata actcatcttc aagtttatct ttatgttcgt aaggattcat ggggacactc    121320
     aaatcaaggt tcctttttgt tagggttaaa agctccgatt ccaattgctg gtatacggta    121380
     tcggaaaacc tggaatggtc agcataactc atcaagtcat aatattgtga caagtcattt    121440
     ggacgtaata aagtcctata cactctgggt ctcttatatg tttgattgga atccagcttg    121500
     gtgttttggt tttcccctgg tttagattgt ccaggtgttt gtgttagggt agtgtttcca    121560
     cttttttcag cgtcttcttt catattgcca actgcgccaa tttgattctt taagttagac    121620
     gcagcaggac ttccagtgac aggtttcggg ctttccattt tgatagagac agcgcctgct    121680
     tgccccaaat tacctgggtt tccactatgt cccgcggatg taacagcatt agggctctta    121740
     tgggggctac cgttcgaatg gtcttgtcct ttagtatcac tacgtatagt cacatcaact    121800
     gtgtttgtgt gatcatatac ttgtaaaatt aagttgcctt cataaaactg tatgttacaa    121860
     tctcgcaaaa cctccatgat cgcataaggt atccgtcccc gcgctacata ttccagaaat    121920
     tcacgcaatg tttcgttact tttgtttaat atgagaccat cacttgtaag ttccggattt    121980
     ttctgctgtt gctgtaacct cgtatttgca ggtgcacaaa ttttataatt attctcgtag    122040
     atatgaaact caaaactagg tctgtattgt tcatacttct ttaaaagttc gttcggagtt    122100
     tcaacaaagg cataattcct ctttgggcgt gggttgtgca tcatcaatag ctgattaaat    122160
     tggttttcgt agttttgtag tgctatttgt ctctgatgtt gcgcttgctg tacttgctgc    122220
     tgtcgaagca acattttttg ttgtaaaatt tggcgctggt ttagagcttg tccattcatg    122280
     cctgtcggta tcccagttcc agccggtcca cctggcatac gtggcatttg ttgtccctgg    122340
     ccacctgtat agttaccagg accattagca ggaccagttg ccattgagct gggtgtagcc    122400
     ccggagccta caccagaacc aggtgaggcc atattaactg gactgcctgg tgagccaacc    122460
     ccattcactg cgacaccaag catgcttttg tcctgtccat agttcgggct cccgttcatt    122520
     atcggaagca gctttcctta cctttggtgt ctataagaaa tccctaaagt gaatatttcg    122580
     aaaggaagaa aaaaaaagac aacaaagact caactattgt tttccgcaac agtttatata    122640
     ccaaattatg tgtactatcg caatatccac agtcaaatca gttcaaatag gtgaacgtta    122700
     cggtgtctcg taatgtttaa acttcccgtt tgtaaacagt gtactccacg agaattgtca    122760
     ggcacggcag agaaaaataa tttgccaatt ataatgctct atgtttctta tattagtgct    122820
     ataataagct gtcaatatcc tttctcttgc accctacact gatcatgtca agaagaccgc    122880
     attcagaagc tcagcgctca tctcttccag aatcatcgga tttctgagga tttgaaagag    122940
     aggcctatta tattgttata cgacatacta tttgagtcac atgatatata tatatatata    123000
     tatttaaatc atttgtgtct tcgtagtttc atgaacttct attgttcgtt atacgttgtc    123060
     ttctatggga gtcgcagtag tataactgaa cctgttcaga taagtgtact tttatttgag    123120
     tttgatttat ggtataggtt tattgggttt tgccgtcgac tgcaagtttg agttacaacg    123180
     tttgtatgtc attattatga aacttcaata acaaaacata aaaaatgcta aaattaaaaa    123240
     ataaaaactg cttttatatg ttctttatat ttaaatgtca tattatctat ttattattac    123300
     acgaaagatc cttacaattc tttttttatc tagaagagac catcgtcctc atcatctcct    123360
     gcactcatct tagcttcttc ttcatcactc atctttgctt cttcatcttc actcatcttt    123420
     gcgctgctca attcctcatc actatccgca atgaattcct ctgatagagc tggcttctta    123480
     cgctttcttc cgctagttac ttgagcctcg tcctcatctt cggatcccag ttcaccagca    123540
     gcactagcct ttttaccagg ctttgattca gagcgttttc tcttctttgt accggccttc    123600
     ttcttcttgt ccttcttttg tggcgaagca ccaggctcat ctccgccaaa atcaccatct    123660
     tcttcggata gatcatttac gtccttttca tctaccatgt aagattcacg ctcctccatt    123720
     agtttacgag cctcctcttg caatttacgg aactcctcat tcttcttctc ctcggctgct    123780
     cttgcttctt cctcggcctt tttgcgtttg gcctcttctt cttctccagc tttggcttgt    123840
     tgtattctag cttcctcaat tttcttgttt tggtcttctt caaacgcttc ctgttcaata    123900
     acagcacgtt ctagcgcact cttcatcgtc gtctcaccca attgaatacg ttgttccagt    123960
     tcttctttag agacagtctt gaagttatcg ctctccaaca actccttaag aagaacaagg    124020
     gcttcactta gaccaactaa tgcatctttc atacctgcag aagtacgaag cattggacca    124080
     gttcttctta gagtttcagc aatctggaag tgtaaaagtg caacgttata tttaagaaca    124140
     cctaggaatc tcagattctt gaagttagag gtcgattctg tctcgagagc tgctgatgcc    124200
     ttttctagag cgttttgaaa gaattggaca gaacgctctc tcatacctct agagtaccat    124260
     gcacgagcaa gcaggtttaa tactcttgac ttattcatac tagaattatc agtacagaat    124320
     ttcttcaata caaactcata tgcttcaatg gccttgacat actcacgcat atctaataga    124380
     caatgagcta tattcacatg aacatcctcg ttttccaatg aatctcttac tttccgaaga    124440
     atttcaagag caggtcccat cctcttactt tcagcaaaca ttatagcaat accttgagca    124500
     gcaaaaacgt tcagtggatc tagttgtagt accttctggt atagttgggt tgctttcaag    124560
     aaagattgct tacttttctc ttgatccttg gaagatttac tgtgacgtgc atcccgggct    124620
     agagtaacat acaagttagc caaagaaata agagcgtatt tatcgtgtga gtcatacttg    124680
     accaatgtgt ctctattgaa agcactttcc ttggcgttat tttctgcaac tgcacggccc    124740
     gtcaattctg aacgcttcaa aaaccaacta tagaaggcac gaacttcaag attatccttt    124800
     tcagattcaa ccaagttttc aacttcttcg cttaatctct tatattcatc agagttatct    124860
     acaccagtct tctctagtgt cagatataat tctctaactt tggctgcaac atgacctgga    124920
     tgtttcccca gaatagatcc atagcgtgta agagcagtgt ttgcatcact agcttccaaa    124980
     atacgagcat cgttatagtt caaaacaagc ttttctgcgc catcattgga actctgagag    125040
     agacgaccgt cagccaatgc aaggtatttt tgtgcttttt cgtaatcacc tgtaataaaa    125100
     tataaacagg atagattgtt tagtacttct agaggtacac cgttttctcc atcaaagaac    125160
     tttatattct cgatagcctt ctctaagctt tccaaggcca agtgatattg actttgcagt    125220
     tcataaagtt gtgacattac aaggtgtacg cgcggcacag tcatctgatt tttcttagcg    125280
     gcagttaatt taatatatct gtctaagaaa tgaagagctt taccaatcat cttaaccagt    125340
     tctgcaccag taaggttctt ttgcttattt cctgtgctgt cgttattttt agccgggtca    125400
     gcaatacatt ttgcagtgta cagcatacca agaatgtagt tcagttcctg cacattctcg    125460
     ttcgccttgt ataaactctc aaaggttagt atactctctt ccaccaggct gttcttaatt    125520
     tgagtttgac ccaggccaag tctagcaagc aggttatttt cgtcacgctt taaactctcc    125580
     tggaacatgg taaacgcttt cctatagtca cccatggcgt agcttgctct gccacaccag    125640
     aacaatgatt cggagtacac tgattcagga gctagaaatg atagtttgga aatcttctgg    125700
     tcatgtatag tgataacctt ctcgtagtca cctttaaaga agaagaatgt ttgaagcagc    125760
     actaacagca ctggactttc ctttgagttt gtatatacag tgttaaggtc tgccaatgcg    125820
     gccgcgtatt tctccttgaa atcttcatca ttttcagcct ctgttaatga gttatggaat    125880
     ttacccaaca gaaccagtat cgatgcctgt ttattgtttg ggtcaagttg cagtgccctt    125940
     tcccatgctt ggatggctag cttataatcc ttcagttgcc aaaaacacat accaatacca    126000
     attctagggt ctggtttcaa taccgggttg ataaccagca gttcttggaa aagcttcaga    126060
     cttgccacgt agttcttctt ctggtacatc agctttgctc tcagcaggat gaacattgcg    126120
     ttgggtttac ttatccgccc ggtacgttta tcttctgcgt agattgactt cacaaacagg    126180
     tcgcaagtct ccaaagcctt gtcgtagttc ccacgctcgt agtacaggtc gacggttgcg    126240
     agcatgttcc cgacccaggt ggggtcgtaa ccgatggcgt cgcgcaagtg cacttctgcc    126300
     tgcgtcaatt cgtgctccct ggtctctgcg ctagtggtgg actcctttgc gagcttcaag    126360
     tgcgcccacg tcaggaaagt gtgcagcgag gccttgcctg cgccctcgaa cacgtccagc    126420
     gccagctcga tcagcctgat cccctggcta gtcctgccct ggttgcaata cgcgatggcg    126480
     atcgtgagcc agtgctcctt gtcggagctc tcctccacca gcagcgtctt caagtccgcg    126540
     gcgtcatccg gcaggtctgt ctccaggtcg atgctgacca gctcctccga ggccttcagc    126600
     gggatatcca gcgagctgct ccactccatc ttgggataca tctcgttcgc taccgagctc    126660
     atttctctac tctatctcaa atatcagatc tctaaaagtg aaagtgaaag tgaaatcaaa    126720
     caccaaggcc tttctaatcc ggtacaaatc ccaaaaaaaa aacactcagt attccagcaa    126780
     aaaagctaag aactcaattg ggtttatcaa tatatagccc cttttcaccc aattcccaac    126840
     agttatagta atagaaattg cgagggcgct tactcttgca ctttgctccc gctatgtatg    126900
     ttggtgctac gccctgggcc cgccctccag tgggggatgg ccaaaacacc ttgaaaaccg    126960
     cagaacgtaa cgactgtgaa ttcagttttc cgagaagaaa aatttgtaaa aatgttaccc    127020
     ggacttacgt acataggaat gaaacatgtg atgtaacgta tgaaatgtta caaccatgtg    127080
     accaagtacg tacaagtaga ctacaatgca tctgactagt acgtatacaa ctactaaatc    127140
     tgctttttct gaaaaaaaaa tttttgaaat tttgcgatga gctttgggtt tctactcctc    127200
     cccctcgttg tgcggggtgt tctacggaaa agcatttttc tcaaaaccgt ataccgatga    127260
     gcagttactg gtacaagttg atatgatgtg atatatatct gatatcaagc tggtacaagg    127320
     tattacaagg tactacaaat tgatacaagt tgataccaaa ctggtactgt gcgatggtag    127380
     agaagaggct gtttattggg aatttgaagc acggtgtcga ggagtgtctt gcggacttgg    127440
     agcaacggtt caaagcgttt ggtgagtatg ttggttccgg ccaggatgtg tttgagaggc    127500
     acaatgggtt tgcgtttgtg accatgcggt tcgaggatgc agaggcgctg cagcggttga    127560
     agagccggtt ccacaaggtt aagttcaaag ggaaccagct gattgtggac tatgccaggc    127620
     ctgcgtggtc gcaggagcgg gagtcccagc aacgtgagga gcagaagcag tcacgggtcc    127680
     tggagaaacg ccagcgtaag aacgactggg agcactacaa gaagatggag cacatcaacg    127740
     cgagttggag agacttgaaa gaagtcgtgc cggggcggat gagagagtcc cccaggagca    127800
     gacagggact gcgaaacatc accttcaggc tgaacgtagg cggggctttg aaagtgtata    127860
     agtgctacaa gactaagctg tggggctacg agcgggacaa agacacaaga gacctggtac    127920
     acaaattctc taaccacagg ttctggaagg acggctctga ccacgttgtc gaaagactgg    127980
     actatagccg tagtcgcggg gctctaaggt gggccaacat ggatgaagaa tggagaccat    128040
     acctcgagct gcggaacaga aggcggcccg caactgctgc tggcttggct ggtgaagcac    128100
     ttgactcatc tggatctacg ctagctacct cgacagtaga tgatctagtg gacgctgacg    128160
     agtctgatat agagcaagag aaggaacgta cgaacaatat attagcccag atgatggact    128220
     cattcgattt tgccaaaccc atggcgttag acgacgaaga cgctggaaag ttgcttgatg    128280
     cagagcagaa tcgttcttct gctaaagata ataggaatta taagagtgaa accgcaccag    128340
     aaaatgcaga ctactatcag gaagaagaaa cagtagcaga agaagcagcc caggcagacg    128400
     gggatgacag tgaagaattt atccctactt ttggcgccag tacttctaac aatgacaatg    128460
     atcaagacac acggaaagtg attgaaggaa ctataagtaa cactgacact ctaaggacgc    128520
     tgttcaaccc tgaggtcacc ggtgaggcat cgggaacaga ggctgctggt gccacattca    128580
     aactgattaa cgatggtgac caagatattg accagagcaa gaaccctgaa ttagcagtag    128640
     aggatgtcca agtacaagaa gaagttccag tagccgaaac ccatactaaa caacgtcgta    128700
     acctgttctt ccctcatttc gagtcgcctt tcttgcaagg tcaaactcaa ttgagcaaga    128760
     tacaggctgg tcaacaggcg gatttactcc agacgtggag tgacgatttc tgggccaacc    128820
     gtggtctatg gatgaaggag atgaaacaga agaagagaga cgcactaagg aaacttcgca    128880
     agaggaaagg aggcgatcac aatgtttttc ttttatagat agcatattgt atatatacca    128940
     ttttgcatta ttccaagata tactaccatt aaaactcatc atatttttca ttatattata    129000
     ctactatata tacatacatc ccagcggaaa gagttgcaac tttctataat tgttttctat    129060
     aattacacta gagcacataa tcctcttatc cttacctggg gaattaatat aaaaggtgag    129120
     gctttattct ttatggattc atttgatatg attgattaac ttaaaactat cgtgttatta    129180
     tttaatcatt gttagttggg taacaattca agcattggca ccgaacttgg tggccatctc    129240
     gacagcagca gcaccccagt cttcaccgtg gttgtgcatg gtcttaccct catcgatacc    129300
     ggctctggct agggcttgct cctctgtcag acaagtcaaa agaccaaaga tcactggaat    129360
     atttatcttg tcctgcaggt tcatgatagc ttgtgtagta gagtcagaga tgtactcaaa    129420
     gtgcatggtg ctacccttga tcaagacacc aattggaata acaacatcca atggctcacc    129480
     cttcttagcc tgcttttcag caaatctctt ggaaccgtat ggcaactcaa aagagcccgg    129540
     aacagtttcc actataatgt tctcctcctt gacacctagc gacagcattc tgtcaatggc    129600
     acccttgacc aaagcatcaa tgataacacg gttccaacga gcatggataa taccaactct    129660
     aagcttagaa ccgtcgtagt tctgatccaa ttgacccaat cccttaactg ccattgtata    129720
     attatgtatg tttgtgtgtg tttcctgtta ttcgttcttt tttttgggct tctcaatggg    129780
     aaacatgtaa ctgaatccaa tgacaaccca ctgatgttat atactctccc aaaagaacca    129840
     agctttgccc tcgaatccat tacgcaatgc agtactaata ggagcaatct tcccttccga    129900
     acgggaagcc cccaggagac acccttctta cgtaattatt atgggggaag agagaaggac    129960
     cttccatgtg cttctatttc gtggactggt atgggtatac cgaggctgtc tctctatatt    130020
     ttgatagttt ctggcattgt atcatcttct tactatccaa cagtgactta cagctccagt    130080
     gcttcattct agagttcata ttctgctcgt tttacataca aattcaatag cggtctttgt    130140
     gatagtttat acatcgagaa aaaaaaaatg ggcagagggt ggggttattt aataatacat    130200
     atcctgacta ttctactagt aaaactctgt gtcgttctgc accatgttgt ctctggcgta    130260
     ttgggagcca cctttggtgt ccttcgcctc gttcgtgtcc tcttcttcgt cacctttgtc    130320
     ctctgggtcg ttgggcacat tgttcagttg cacactaggc gcgtacttgg tgttctccag    130380
     gttctggaat atgcccagca gtatcttgtc caggtactct ggtgtattta cgttgtacat    130440
     gttggatggt ctgacgtcca gcttgtaatc ggggccgtag tactcgtagt actcattgta    130500
     cggtagttct tggtctagca ccacgttatt cagtagccct gtttcgaaac accacgtcct    130560
     agcaacgttt ctcattgtgt aaccaccgcc accaacgacc atcatgggga taccaaatga    130620
     tttcacgtag ttcacacagt tggcgtgtcc ctccatagat aaattgaaac aacccagacg    130680
     atctccggaa agcgaatcac caccacattg caacaccacg gcagatggct gataccactc    130740
     catgatcttg ccaatcacgg gttcaaacac tgatctgtag gtagcgtcat cgataccgtc    130800
     cctcagtggc acattcaccg cgtagtattt accctttcct acaccgatgt ccctcagttc    130860
     accagtaccg gggaagaact caccgtattt gtggaacgaa caagtcatga ctctgtctgt    130920
     tgtgtaaaag gcctcttcca caccgtcacc gtggtgcaca tcgatgtcga tgtagagcac    130980
     tctagggtgg tacctcagca actcgattat tccaagcacg atgtcattta aataacagaa    131040
     accagacgcc tccgacttct tggcgtggtg cagaccaccc gcatagttga tggcaacgtc    131100
     acacttgcct ctgttcaacc gggcagcgcc ttccatagac ccaccacccg atatgctaca    131160
     atactcatac agaccgtcaa acacgggaca atcgtcaccg acattgaact tgacactctc    131220
     tttcttgaac atctccaagt tgtccggtgt aacacgggac aagaagtcga tgtactcgtc    131280
     cgtgtggaac tgacacatct cctgcttcgt ggccggcttg gcccggtata tctccatctt    131340
     cttgtacagc ccatagttca taatcagcga gtgcgtcatc cttatcctat gcggcttcat    131400
     agggtgtccc gcaccatagg catagtttcc aacatccgca tcatagaagt aggccacacg    131460
     cttcttgtca ttgggcttca ccgtgatcgg atcaaacggc ttcgactcat acaccataac    131520
     tccctatcgc tgtattaacc cctctggctc aacaattcac tgctcatgga accaagcacc    131580
     aggatcaaat actcactaat atagcagcaa catctgagac ttcagactgt ttggagctcc    131640
     aaagagcatt tttgccaaat tcccaggtca tcgggaacgt cgcaggtttt tcctggctaa    131700
     caggcagttt tgaaatattt atgggcatcg catcgcatac atgaaggtgg tacttggtgc    131760
     aaaaggagag caacgaggag cccaagacag aactaataat aactaagcaa catggtggta    131820
     atgcccggcg atgagttggc gctggaccag ggaaagcccg tggtcctggg ccctggtgtg    131880
     tactgtgatc cgcagacgca gacggttgtt cctgtgaatg caggtgtgcc ggtggtgaag    131940
     gagagtgcca agaggcagac tgtgtatgtt gagtacaact cgaagaggta tattccctct    132000
     gtgggtgacc tagtgatagg tgtgataacg tctacgttct cagacagcta ccgggtgtcg    132060
     ttgtcgagtt tctctaactc ggtgtcgttg tcatacatgg cgttccccaa tgcgtccaag    132120
     aagaataggc ccactttgaa agtcggtgat cttgtctacg ctagggtgtc gtctgcagag    132180
     aaggaacttg aggccgagat agagtgcctg gactccacga cgggtgaaag cgcggggttc    132240
     gggctgctgg aaggcggcat ggtgatagat gtaacgctgg cattcgcacg ccgtttgctg    132300
     ttcaacgaca acttcccttt actcttgctg ctctcgaaga gaacacaatt tgaagtcgcc    132360
     atcggtgtga acggtaaagt atggattaaa tgtgacgaag tcaaatacac aatggcgtgc    132420
     ttcagatcta taatgaagtg ccaggaccaa ccggtatcac agtacaagga tataataaaa    132480
     caagagttcg attctttgcc aaaggaagaa gactagcttc ctttcgcttt tcacttaagc    132540
     aatatgcatt aaaaacaaca acaaccgtgt acactaagtt attctacccc ccacccctac    132600
     caataggtag tatatatttt ctagaggaca agcatttaat tctttcatgt agtaccttca    132660
     taatagcatc tatttcatat ataatgaatt attcacatta aacatactaa ttgctagtga    132720
     gactggatgg gtgaaaaatt gcatttgaaa attgcgatgc ccatcgcaat gatataggcg    132780
     taacggacaa cagtcattca aaatagcgat atatgaggtt atataacgag tgaatagctg    132840
     cttcaagttt atacaagtaa aacagggatg tccactcaaa tcaagagaga gaaaccgatt    132900
     aagaagcagt tccagaagaa gaaattcgca gacttagcag ttcagggcac caataactca    132960
     tcgatcgcgt cgaagaggtc tgtggaatta acctatctac ccaaactagg cgtgggaagt    133020
     aatgctgaga aactacaacc aggtaagcca tacttcaggt actttgtgcc caaaaagatc    133080
     aagaggtcgc cttgtatcaa tagaggctac tggttaagac ttcatgcagt cagatcacat    133140
     atagaatcta ttctcgattc ttgtcaggaa aacatcacaa tcatcaatct gggttgtggg    133200
     tacgatccac ttccatttga gatgctggat ccacaaaacc cacaatactc tcgttactca    133260
     aacagactga atttcattga cattgactat ccagatctgc ttaatataaa atctggtgtt    133320
     atcaaagaaa caccagaatt actgtccatt attggtggta tcgatccaac tgaaactaat    133380
     atgatcatct ctgagcgata caaaacaata ccgtgtgatt tatatgatat gcctgctttt    133440
     gaagcgctat tgaagagcga aaatcttgga catccaaaca ccatcaagat atttattgca    133500
     gaagtctcgt tagcttatat gaaacacgag aaagcagacg atattattgc aagctgttca    133560
     aaattcccaa atagccactt tattatgctt gagcaaatta ttccggttgg tgagtatgaa    133620
     cctttctctg ggagaatgtt gaagcacttc tcaaagaacg aatcacctct tcaaacggta    133680
     acgaaatatc aaacaatcga atctcaaatc gaaagattta gaagatataa ctttacgaat    133740
     gtaaatgcag gagatatgtt ccaattgtgg aattcactat catctaatgt acattctaaa    133800
     atcgaaaaca tagagccatt tgatgagttg gaagagttcc atttattctg ccaccattac    133860
     atgatttgcc acgctacaaa caatgaacaa tttaaattca atgagagcat taaatttaga    133920
     gaacctgaag tactacccag tttacctatc agcggactaa ggatagatag tattgacaaa    133980
     ataggatttt ctaaaaggtt tggttcatca gtgatatcta aagatagtat aatatacact    134040
     ggaggtgcat ctccgtatag atctgacgaa gcagatgtca taaaccttga agaatgtacc    134100
     atagagactc tttcaaatat gaaattaccc gatgctaggg tatgccatag ttacgattct    134160
     ctgatggacg gcaagttaga catattaatc ggaggtagaa aagctccaca tcagcccttt    134220
     aatgacgttt tcatatttga gaagcaaaca gctagttggg aaaaagtagc aacattagat    134280
     tatccaatat atcgacatgc aacgagctct ttaagcaatg ataagctact tctttttggc    134340
     ggtaactttt gtttaaaaga accattctta accattacag tgaaaagcga aacgcaaatt    134400
     gtggtcagaa gtatcaactg tcctgattct attaaatcaa gtattggcgc agccatgtgc    134460
     tataatgaag catcaaacga tgtgataata ttaggtggat cttcgaatgg aactgaagtt    134520
     tcagataagt tgatcatcat gtcctatgat gacaaatctg agacattaac agtcaaaaaa    134580
     gaagttacaa atgatttgtt taaaagatac ggtagtaaga taattcattt aaccgatgat    134640
     gaatatttgg tggttggggg tacttcacct gaccgcttat ttgacgctag caacagcata    134700
     attacataca attcaaggtc agacgaaata aagtctgtta gaatacccga tcacatatgg    134760
     caaggtgatg aattaatgct agttgggttt gagctccaga agttaaatgg taaaataata    134820
     atttttgggg gtggtgcaac ctgttacggg tttggctctg taaataatag catatacagt    134880
     atagaaaaat agtcattaga attataacgt gaatttgcag cctatatttc catctcatat    134940
     tcattcatcg tcatttcaat aggtaatgaa tatctgtcaa tgcaatcatt tctcaaatca    135000
     agtgcatcta ttgaactagc tcttcatcgg catcactatg gtcttagttt tcgctaataa    135060
     ttgccataaa cattaataaa aataacagag atggttgata caccctcgcc aatgccttcc    135120
     atatacagct aattgtatga ctctgacagc ttaaaaggta attacgagcg agggtgtttg    135180
     caaacaaatg aggaaaatat gacagtttac ggaaactaat ctgtgataaa ggaatgtaaa    135240
     aagtgtgtct aattggaagt tattagcgag ataagagatg acatgaagat tatttaaaca    135300
     ggcatcgcaa tcaaacctaa gatattgcta gccgtctcta tttcccctct cccttacttt    135360
     ctatcatatc ggataggaca acaattatta catccaatta atatcatata ccaaggaaac    135420
     gatgtacaag agatatttct ccacctctct caaaacaaac caacaggctc taaagaagat    135480
     tcttgaagag aagacttatc aagtaactac ttatgcaaga ccttctgatt tatgcatcac    135540
     aagaggcctt aacgccaagt tatttgatga tttcaacaat aaggaataca ttgattttac    135600
     tgccggtatt gctgtgacgg cattgggtca tgcaaaccct aaagttgctg aaattttgca    135660
     aacccaagct actaagcttg tacattcatc aaatttatat ttcacaaaag aatgtcttga    135720
     tttaagtgag aaactgatag aaaagaccaa gaaatttgga ggccaacacg atgcatctaa    135780
     agttttctta tgcaattccg gtacagaagc caatgaagcg gctctaaagt ttgcaaagaa    135840
     acatggtatt actaaaaatc ccaaaaaaca aggtataatt gctttcgaaa actcattcca    135900
     tggccgcaca atgggtgcac tttcagtaac atggaataag aaatatagaa caccatttgg    135960
     tgatcttgta cctcatgtgt cattcctgaa cataaatgat gaactatcaa agataaagga    136020
     ctttatcaat accaagaaag acgaaatcgc tggtcttatc attgaaccta ttcaaggtga    136080
     aggaggtata tttccaattc caattgagaa actggtagct ttgaaagaaa tatgccaaaa    136140
     gaatgatata attgttatct atgatgaaat ccaatgtggc ctaggccgta ctggtaactt    136200
     atgggcccat gcagctctac caaaagctgc tcatccagat attttcactt cagctaaagc    136260
     gttaggtaat ggtttcccta ttgctgccac tgttgtgaat gaaaaggtca acaatgccct    136320
     gcaagttggt gaccatggta caacttatgg tggtaatcct ttgggatgtg ctgttagcaa    136380
     ttatgtattg gatgttatcg gagaccaagc gttcttggac tctgtaacaa agaagggtga    136440
     attattgaag aagggtctat tgaagatcaa ggaacaacac ccagacaaga tatccgatgt    136500
     tagaggttca ggcttgatat ggggtgttga gttcaaggac gctccaggtg ctattgtcca    136560
     aaaagccaga gaacttggtc tgttggttat cactgccggt aaaactacag ttagatttgt    136620
     tccatcattg actattgaag acgaagtagt agaggaagga ttaaccattt tcaacaaggc    136680
     agttaatgac gtcttctcaa aataagaatt attctggcat tttacaacca tactttttta    136740
     atgaggcatg aaaacatcgc ataattttat tttttcaagt ctaatgtaca taaagattat    136800
     atagcattta tagataaaga catgttatat ccaagagtcg ttcaagccct tgagaggaat    136860
     tgattctccc agcttgatgt ttaattgttc tattcagggc atcgctatga gtttctcggc    136920
     acagaaagat aagatcggtg ttaattatga aaagtccgca gccatttgaa aaagttaggg    136980
     aaatattaga gctgatcaga tatgcgtcaa tccaagcagc atcgacacat tagttaacct    137040
     attaaacatt ataaaggcaa aacagaaata agaactatct gataagaaag ttatagcttt    137100
     tttctttatt atattccgaa gcaacgttaa agaaatcacg caaagaagac aaatagccat    137160
     atatcctgtg agaatgctcc gctatcaaac aacgggattc agtggatacg gtgtacaata    137220
     ttcaccatac tacgataata tactagctgt gaacactggg tcaaattttg gattggttgg    137280
     gaatggtaag ttattcatac tcgaaattga taataatggt gtagtgaagg agaagaattc    137340
     gtttcttaca aaagactgcc tatttgactc tgcatggaat gaattgaaac ccaatcaggt    137400
     agttgtggca caaggtgacg gctctttaag actatttgac actactttac agaaatttcc    137460
     cattgctatg ttccatgaac atagcaaaga ggtttatagt tgcaactgga atttagtgag    137520
     taagtctaat tttgtcagca gttcgtggga tggccaagta aagatctggt cgccaaacag    137580
     gaaggcaagt ttaataacgt tctccccaca ccctatcgat gtctcaagag ctttagataa    137640
     tttaccggaa gtttcgcaga gggataaact ttcaccaaat caagtagctc aaaatagaaa    137700
     ttgtatctac caggcgacat tttcgcctca tgatgataac cttattttat gttgtgcggg    137760
     aaactcatat gtaacactat ttgatcttcg acaaaaccct ggaaacaatc aaaagaactt    137820
     tattgctcat aggggaaaag gtgccctctc atgcgacttc aataaataca gaccaaatat    137880
     aattgcaact tctggggttg ataacagtat tggcatatgg gatataagaa tgctacctaa    137940
     ctcgtcaaat caacaagggt ttcagacagg cactttggtt aacgaaattg ttaatgcaca    138000
     cgatttggcg gttaagaaag tttgctggtc acctcaccac tcagatatac tcttatccac    138060
     atcctatgac atgtcttgta agatttggaa ggatgtatct gtacagaata atgtaccaac    138120
     tggtaagaca aacggctctt tactatccaa tggacttctt tcaaacttca aacaccacac    138180
     cgaatttgta tttggtgccg attggagttt atggggtata ccaggatatg ttgccactgc    138240
     tgggtgggat tctaacgtat tcatatggaa cggcctacaa tagcatttat caagcgcaca    138300
     tatcttttga ctgttaatag tataatatgg aaggtttttt cgattttgcg ggtagcaatt    138360
     attttattaa tgtatttaat attcgtaaca atatagagca attattcttt tatgagatcc    138420
     ttaaacaatg ttcatcataa tagttggaca cctaataata ttggaaatgc caatgtctaa    138480
     cgctattatt cagttatatt gtttgtgatg tagatcctat gacttgctac gtacataatt    138540
     ataaaacaaa cccttctaac tcggtgcctt aactgctgtg ggctcataat cgtagaagta    138600
     cagaaccact tattatggta attgtatgta gctcatcgca ataaatctaa gttatttacg    138660
     tttctcaata gtagcttaaa tctagataat cctactcaag gtgatttgga ggtattttac    138720
     aactcaattg attgactgag agaagcaaac cctatttctt tgagtaccag ggtatcacaa    138780
     tcaaggacaa gtgcatttgg ttgagaaact aacttttggt agaaaatgtc tctgccactc    138840
     aaacctttga cgctagattc taatagcaaa cagttggata gcagacagaa gaagttttgc    138900
     tcaaatgttg aaaaggcaat taagaaattc gatttggtga acgagtgggc ggattacatt    138960
     gccagtttgg gtaccctttt gaaagcatta caaagctggt ctcctaaatt tcagaacgtc    139020
     aagtactttg tcccttaccc atacgatgta agtagacgat tatcctcatc attgtcacct    139080
     tctttacctg caggtgtgca tctgaagact ttagaagtat acacctacat ctttgaaaac    139140
     attggaattg aagctttggc ccatgagtgc aatatatgga taccaggtat cttaccttta    139200
     atgacatatg cgtcaatgtc agttcgatct agagtaattg aactatatga taattatatc    139260
     ttaactctgc cgtcagaaat tttgaaagtt attataaggc cattattgtc cagtttgttt    139320
     cccggcttag aggatgaaag tagcgagtat ctggatcaaa caataaaatt aattgaaaca    139380
     ctacaggaaa accttggtga tgattcacta ttttggcaaa catgcttttt agttatctca    139440
     acatacagtg atagaagagc aggtggcttg gtttggctga ccagaaaatt tccatcacta    139500
     aatgctatac cacataaaat cgccgaacgt aataaaatca aggtcaatag tacaggaggc    139560
     tccacaaata gcatgcaaga tagaaagaag gtaaaggaag atgctttagc tactttactc    139620
     ccatcagcaa agaatttagt cacccctgaa cctggccttc taataaggtg ccttgtcagt    139680
     tgcttagaac cagaaaacga tattcttatc aaaagaggga tacttgatct acttttgcaa    139740
     cgagtaagaa tagactcgcc agttattcaa gtattaatca gtcccgaaga caaaaaactt    139800
     ttaattatgt cctgttgcaa gacaacatta aataaggata tgtctcttaa tagacgtgtt    139860
     tggaattggt gtctcggatt ctcctcttca acaaccagaa gttccaatgg gagtaccaca    139920
     agtgttaata gtggagcttc agataaagga gataattctc aggataagtc gaatgaatac    139980
     tttaggacta atggcctttt gtgtttgaag caaggtatag aggacctgct ttataatgag    140040
     actgatgttg ttactgcttt caagctatgc atatcaataa tggacagatg ggagataggg    140100
     tcgatgataa ttccaaccat attcactaat ctattattag cgagctataa aatgaaagaa    140160
     aatgaattag taatgaaggc agctggtgtt ttttttgatg cagtagaaac aaatataata    140220
     tggggaaatg ttatcaacca cttttttatt accaatgata tcttcttaat acagtttgtt    140280
     atcaataatt ttaacatttc gactgatgag gaaattattg ttaatcattt accgttggta    140340
     ctgttaagct tattaaccga gtatgagata tttgctgaac ttgatggcgc caaacaaaca    140400
     cagtattata atttgtgtta taacatattg actgtcattc cagaaagagc ttttacaacc    140460
     atatcaaatt caactgttat ggacatctcg cacatttcgg acggatcagt aattgaggct    140520
     ataaaatgct actatggaaa agtatctgat ccatcttcgt ttatgatttc tgatgcaaat    140580
     agcattgaaa gaccgtatag catggaagtt atgacagcgt taatactaaa caaaaccaca    140640
     aatattgtgc tgtctcaatt acacaaccaa ttacatctca atgatgctac aaaacttttc    140700
     atatacactt atgagaagat cccagagtcc aatcaacagg ccaaaaaaat tgatactatt    140760
     gatgatgaat tgagtaacac agtgtttgga agcttaaaga aaattactga aactgatatg    140820
     gaatatatct ctggacttgt agatttattc ggaaattatc tgtgcaagcg tatggatttt    140880
     attgaatcca tcaaactttt aaatttgtta gtacagtcat tatggccatt cttgaaggta    140940
     cccaaaagtc aagaccctgc tataaggtgc cttgaatcaa ttgaaaggtc tatcccaaca    141000
     gactatgtgg aatcggcggt cgcaaatgcg tttgcaaaag aggaatcttt gaatgttaga    141060
     attgacgttt taaatttact atggattagt ttgccacaaa cgtccaccct ctacattaga    141120
     cccttggaaa ttatttttga tgagctaaat aactcacaaa atccatacta tctgtctgtt    141180
     tccaaatgga tttattcact gaatacggct ggaaccatca ataatttatt tagaatcatc    141240
     atgaatcagc tttctgaatt tgaatttttc aaaagagaca ctattaaaga gactgatgat    141300
     ttggacatgt ttacttaccg aatccagatt attaagaatg tactcagtac taataaccat    141360
     tcaattttaa aaacttttgc ttctgaaatc aacactactg ttatgataaa aacactagga    141420
     aatgaggatg tttctacata taagagctgc tgtgtggcca tcataataaa ctttttaaag    141480
     aagcaaaata acacccatcc tagaagtatt aggagttcat tagttttact cgatttgctg    141540
     ctggacggtt cggaggcgaa cttcaaagaa attgtaatat ttcttttaga aaaatcatca    141600
     ttctatattt cgcaagggga aattgaatct gaattgattg ccgttgctct aattgatatc    141660
     gtttctaagg tattgatgat atctcatcaa aatggaatta aactggatat tttcgacgac    141720
     aatagtactc atttgaagta tattgattat ttagtaacca gtgtttccac catggaaggg    141780
     ccattcattg ttacagctta tgttaagtta ctatccgaga gtatcgcata ctttgagaac    141840
     tcaattttta gaacgatcct tccacttact gcttcaatgg tccaatgtat aggaagatta    141900
     tttgaaaagg agaaggagtc agggggttac cttgaaccaa tattgctttt gctaggagga    141960
     ttagaggagt tattagaggt atctcacggt tttttaacag caggtgaaaa agacaattac    142020
     tttggtaata ctgcaaaatc ggatttttta cagtcagttg tatcaaacgt tttctcttcc    142080
     gaaaacaccg ccgtagatat aaagattcaa ggtgagagag atgtgatcat ccagtctttc    142140
     aaacaagtta ctaatagtgc ctacagaatt tggtcttggg ctcacatcca atctagaata    142200
     tcattaaaat caaatccatc gaattcggga acacacgcaa actataaatt gaaatttggt    142260
     gccaaaaaat tattggagaa attgtacatt ttggaaccac ttgaaacact agaaacttta    142320
     ataagcacca ataaaaatga aacaacagtt cctctaatcc aagccttgga tggtaatcgt    142380
     cctgccttaa ctattccttc ttacttttca agtatagtcc tacgttgcaa caaaaattcc    142440
     acggtaaggt tttcctccaa tacttcttcc aaaacaacaa catttaaagg aatgaaatct    142500
     gatccatccc ttctaaataa attacatgca gatgccatta tgcaaaacct actagactat    142560
     gtcaagacat tggagaatac ggcaatggag gatttttatg gtgactatat tttattttta    142620
     aaagaggttt ctaacaatca atatctatac aaaaatgttt gcttacaggt gatggattta    142680
     tgcgttgtta ttgcggataa actttcaagg tccaagtttg gtgaacaaaa aagaccaaga    142740
     aaagatcttt ctgatttgtg cttcaagtat atccctgctg cagtagaagg gctggcaaag    142800
     agtaaagaaa actacaacca tattttggaa actctaacaa aggttactag aaatataacc    142860
     ttacttctca atgaaaatga atctggtgat aaggttcatg ctgttattac gtctattata    142920
     tcaaacattg ttgtaccaca tttgaaaacg gaggatgctg tttttagcat gccagaattt    142980
     atgtctcttc ttactgaatt ggtaaaagtt agtggtcgag taaagctatg gagacaagtt    143040
     atcggagatg cattcaatga tgacacagta cttattgaaa tacttcaaaa cataaaatgg    143100
     caagatatca tatttaaatg gtcagattat gaggaacata agtacaaact tctttctgat    143160
     ttgacaatgt tagtaactac aaaaaaatct gccttggctc caaccgcaat ttcttttaac    143220
     tcttggggtg attcagaaga caatacaaaa aagaaaaatg ttttaagaat agcttatctt    143280
     ctcatgatta gtccaaaaga ctactacttg atgcattttg aaccgcttat ttcatatgca    143340
     ctatctactc tttcgtcaca ggaacatact ttcaagtccg aattctgggc attgttgaga    143400
     gtaattttta tgaagttttc cttatcccat tttacctcaa cttggcctct gatcagctat    143460
     gccttacaaa caaatcttca agagttttat gaaaatatcc aaatccaaaa tttcactaac    143520
     ccagaggcca catttcagtt atgtaaaacg cttgatcaac tattagcaat gaatatagag    143580
     ggtttctgtg ctacaaatga atggattttt attattgata ccataaactg tatttacaag    143640
     acgaactcat atgtcgcctt ggctgattca attgcatctt gcaaagaatt tgagataact    143700
     actatggatg atctaaattt atcgaagaac atatcttcgt tcaaaccatt attattggga    143760
     gttcacaaaa ttgacagaca taaccagtta cgcagttttt tccaaaacct gagctacgtc    143820
     cattatgaaa gcacttatat gatggtcaag tttgatacaa acgaattctt gaatgatact    143880
     aatagtgacc tattatatct gataaaaaaa tcatgataac ttagcatttt agaaacgcaa    143940
     cctctatttt ttaaaatata atacagatat atatttttgc tctaatatag acccgacttg    144000
     tttagtgatt tcagtcactc gattacatgc aaagcgttct aaatgtaatt tgtatttcat    144060
     ttaaaacatt tttggagccg tattactaga aatttgatat catagattct tcttctggaa    144120
     gcgataaaca cttaatattt cccagcccgc cttcctttgt tctatcaatt tgatatccca    144180
     aatttgttcc atccttttag ctatctcttc cggcttattt ctggcacaaa ataaaatata    144240
     tgctaccccc ctcaaagaca atattgcttc taggttgtcg agcactttat tagtcacgtc    144300
     cattccatct tcacccccca acaacgccaa gtccaaccat ttatcttgat catcggtttc    144360
     ttctggaata gtaggtacat cctcagcagg tacatatggt ggattgaata taagaaggtc    144420
     gatttctcta gttctaaagc tgctcgtgag atctgcctgt acaggctcca gatatgattt    144480
     cttacagtta ttgatatctg ccgtggttag agtagattct aaagcccatg gatttacatc    144540
     aatagcatag tacaaattca agtgaccagc gctcggaatt gtattttgca tcataaatgt    144600
     agttacaata cctgagccca caccaatttc acatacaaca ttcagggact tactgaatct    144660
     gtcagcaagg tattgtcttt ccttttccag aatatccaga agtaagaaag aatcttctga    144720
     tggttcgtaa accttttcat aatcgcattt cacatagggt gtcggaagca tattcggcct    144780
     tgagtatatt atcttagccg aggactcagt aagctctaag ctggtcctaa actatagctt    144840
     gatctatgta gtttaaatct taactttttt tgcgatgagc ttgaattttg tcattttatc    144900
     catttctctt cctttgacca aaaaaaaaag gaaaacaatc cttacttcga acaataaagt    144960
     caataataaa agtagcacac cagtatgtgc tagaatctag gtgcattgca tttttgatat    145020
     acggtggatt ttattgaaag cctgttgtgg tactttaaag tgtgtcttat tttttatagg    145080
     aattgcatta ccgaaacaaa acaactccaa aaatactagt tttagaaagc catgattatt    145140
     aaggtgaaaa cattgacagg gaaggagatt ccagtggaag tgagtggaga ggacaaagtg    145200
     taccacataa aagagctatt ggaagagaaa gaaggtattc cggcatccca gcagagactg    145260
     atattccacg ggaaacaaat gtatgtatat ctagcaacag taaaggaact cggttcatgc    145320
     atcttttgtt ctgtcttact aacgagaaaa aacgacaaat atctagagcc catcgtgtgc    145380
     taggtatgag cccaaattaa cagaaataat gacgatacga tatccaccgc taagttatca    145440
     gatggcatgc aactgcatct ggtgttgaca ctgagaggcg gaaactgaag atagatacaa    145500
     cctgtatttc taaagtatat agtaaataaa gtcgaaagat tctggtattt tttttttttt    145560
     agaatagatc tcttcgaagc aattttttct taatttattt gcctgtgcct gcatggcatg    145620
     tatggaacgt cttgtgtaat tataattgtt aattaaacgc agagaaactt gatagcgtaa    145680
     tcgaaggacc ctgctttgta ttatactatt ttccctgcat gcaactcttg atctgttcga    145740
     cggtcccaca gacatatacg tacaggtaca cacccttcca ttgctaaaga aaccggttag    145800
     atctgagaac tgagaaataa agacaaaaaa actcaaaatt ttgagaaaat tgctacagga    145860
     tattctgagg gatctaatat tatcctctgc gagagtttct gttgatttcg aatttcaaag    145920
     ttgatagtcg gggcatatga atatcccgag gcaagtcctg ctccacaccc caatctgaac    145980
     agggaaatta cggaaaagcg aaattgtgct ctgcggtaca ttctgcagga taaaaacaca    146040
     gagatgatct tctaaagaag agaaagcttc gatttcctgt taaattagca caccccctcc    146100
     atctaaacat ccttgtgagt cctacgcaat tctctctgga gtaagtgtgg tttttttggc    146160
     attactcggc aagtgaaaat gaatttctaa gaatcggcag cagagattgg gggatacact    146220
     tcggagattt cgaagcttcg attctgctaa tgtgcgaagt agcgaagtag cgaagcagcg    146280
     aagtagcgaa gttcatcttg attgcatatt tcaagggttc ccttagatga ttcggcagca    146340
     atggctagtt aaggacattt aaatatggta agaatgacta aacctaatga tgagtcttcg    146400
     atgagggagg ggtgggggga ggtgaagatg gggctgttgt agtaaccact cagtagatat    146460
     ataaagtata aggttgaata ttatcttggg tattggttcc aagaacaata ccaccgtaag    146520
     tgagataaaa taaacaacac tatgaaatta ccgtcagaaa tacttgatat tatagcaagc    146580
     catgggctgg atagttgcaa gacctcgata gcttggtcgt atgtttcctc atacttcaga    146640
     gatttggtga agaagaccgt gggagttatg cttgtgcagg atggtggaca ctcgcctttg    146700
     gaggatgagt gtgtgcgacc cgatattctg gatttcaggg tgttgctgca caagaatcgc    146760
     aacatgcttt atttgaactc agacgaaaat gctaccatta ggtcgattga atgcttccta    146820
     cagaatttta aaaatattgt tattgtaata caatcagata ggagctttag tgaccctctg    146880
     gcctcaacgc taaatgaaat agccagacac tgtacaagtg gtacaaatgt atgtataatt    146940
     tactctacaa ccacaaattt cctgagtaaa ctatatttca gggagtttgg catacgagaa    147000
     gataaactgg tactgtcaga actacacatt attggttcaa gtgccctttc aaacaatgca    147060
     gatctatgcg atgtggacac cctttttgaa accacgtaca tttatgagat tgataatctg    147120
     ttttccctaa gcgttaaaca ccagcaccac tctcttattg ctcctcagct aacaactatt    147180
     aagcagctta attataatga ttcaatgtta aatatcaatg ctttccttaa cgattgcaca    147240
     aatctagaga tgatcgactc catgaggttc cctttgagcc cgaataatga gtctgcaggc    147300
     cagtacattt taccttcatg taaagtcttg catctcaata actttaattc aggggttaaa    147360
     taccctacta taaatggaaa taacgtcagt ctctatctaa aaatttcccc agccatacga    147420
     ctttcagacc cagaattttc aaatctgatt tttgaaaaca ttaaaaagct cgaaattgac    147480
     accaatccct ccatttgcca tcatgttagg ttcatgaatt gcaagttccc aaaacttaag    147540
     aaaatatctt gtaactcttc cattatatcg tgggatgatt taaagcaaag tcaagcgcca    147600
     ttgacttcgt tgaaaattaa tttaaactca tttgaacagt tgcaatggct tacaaactgc    147660
     ccatatgatt tgaaaaatct ggatattact acattgaata aaaaaattct agatttcaat    147720
     aacaatacaa acctttatca agacatgaaa attgtggcta aaaatgttaa atttcaactt    147780
     gatagcatat ggaaagcttt cattttacaa aatgtttttc taacaaacta cagctcaata    147840
     gagcaattaa caatatgtct tgatgaacat gaactttatg agtctatcaa cgactgcccc    147900
     aagaatctca aagagctcgg cttcaccaat gatggtgact gtattctaat tgacatacca    147960
     tatataacac atttaacact ctttgaaact gtggcccaaa aaagtttgtc ccaaaattac    148020
     agtacccaag ctgctgcgac aaaaagtctt aattctacaa ataatagaaa attctcttat    148080
     ggctcagata tcagtaacga ttatggtttt agcagtgacc tcgcaccggt tatatctcca    148140
     tcactatttc gctggaataa cgtaataggt gtgaataacg aaagcataag aaaaaatagt    148200
     ataatatctt tcgatgagcg gtactcttat tcaaaacgca gaacatcttc aatgagtact    148260
     acatcaatgt tctcacgttc ttcatttcca tatataaatg atgaggtaat actggatgat    148320
     gctattgttt tcaaatttaa tgacaaaatg cccgatatat ttacaacagg attaggggcg    148380
     ctggaatccg ctttattcaa ttttgaggat ttgcgtgaca aacaactagc caatttacac    148440
     attatttatc aattctcaca accagaaggg atttataatg aaggagacgt gactggcata    148500
     ctatttgaat ctatatctcg cattattaac tatccctacc atcttaaatt accaagtatt    148560
     ttgatatcga atttacatat caccttcaaa gtacctactg aatttgaatt atttgacagc    148620
     aaagctttag aaacagttca aagcttactt atccagtcaa agtacaatgt caaagttgtt    148680
     aacgagctag attttcatgg taacaaatcg cacacagaat tatgttttca aaggctatga    148740
     ttattttctc atgtatatat caataaaaaa aaaactacat ataatgcaac agtcaataat    148800
     atatcatcta taacttagac actaaatcat cactttctct acctttttga gtattagaca    148860
     aacttctttc ttgtgaaggg ttttcatttt cattattgtc ggcatctatg ttattatcgt    148920
     tacttaattt tacctttttg ttagagttgc tttcctcttc taaattttct cgtttaccgt    148980
     tcagtttact ttgtttataa tctcttgctt tagccagtaa taatttatgt ggctcattaa    149040
     acacttcaat cgattttttt ttccagtcac tatacttatc ctggaaatag gattgattac    149100
     tttcttcaaa tagtcctttt aaaccctttt cttcattaat accgcttaat ttgaagagat    149160
     aaggccctct caacaacctt aatgattgcc aactttttac aatatcaatt tcatttcctt    149220
     ccgattgtgc atatttatct tgtagttttt ccagaacctc atgtggtact agtttaactt    149280
     ctttgatatt tgatattcct gtctcaattt tccatacatt atttatttgt ttgttaccca    149340
     ttttcacaaa accaaacttc ttaaaagatt tatcaatgtc tggtactaca atatcttcct    149400
     ctgtgatgtg aaaatcatta aattgtttga aaccattcat ttttaatttg tgaaagcaac    149460
     tttcagataa ttctaaactc tctatcatat ccaaaaactt cttatcttta ttaccgtaaa    149520
     accttttaat tctattgacc atgagatgct tggtgaatgt tgatgctttc tttatatttt    149580
     gtttttccat atcatcaaat gagatactat gagctgcttt gacctttgag atatttgtat    149640
     taaagaagtc ccttacctca tctgattcaa tcaattgtgt aataatatag ctggtgaaat    149700
     aaacttggat cataaattgc tttctgaaaa tatcattctc cagtgtcata aattgatcaa    149760
     ataaagaata ttcatctgta gttgacatgt ctaggggatt cggtacgggt aaatgtttaa    149820
     ttttatcata aatagattga aattcagaca tcgaagatga gttaagttct tcaaacaatt    149880
     tgctagttct caaatattca ggtaggccct cttgtggttt agaaggaatg aaatagtcag    149940
     ggttcagctt gttattaata atattaatct ctttgagctc cttttttatt ttattataaa    150000
     aaacttcctc taattccaaa atattgtcaa ttatggttga aattacttta tcaattttaa    150060
     ttttatggtc caatgaagac gatagaaact ccaaaggtgc gtaaataaag ttctgataga    150120
     caagctttat gtcagaaaaa aaactctctt ctttggactg tcctctataa ttttctgtcg    150180
     tttgataaat attccaattc gtggtactat tcgacaactt agcaatggaa cctgttctat    150240
     taaagtttga ttcctcttgt attggcaata agtctgataa aaaggacaac catttctgtt    150300
     tcacttcatt catgactggt gtgtttgaat gtgtgcggta tgataattcc attaaggaag    150360
     tattccatct tcttagcttt tcaaatagtg gctgcttata actaatcaaa gttgtctctc    150420
     ctgaattatc atctttcaat gtatttccca atttaaacca attgattcta ctctctacat    150480
     aatcccagaa taggcaaaca tcatcaggcc agttaagcat ttcaacaacg gtagcaaata    150540
     actcatagta taccagagaa cactgagaag tgtcactcat aaactgtctc atatggaaac    150600
     aaaaatccaa taatacagaa catactttta agttttccgt taatttagag tgctcattct    150660
     tctgtgccgc ttctatggta tcatcttcgt caccttcttg ttcttctaca ggcaatagtt    150720
     tttcaacaac ccttttcaat acgacttcct taatcaactc tacatctgtt ttatcaaaac    150780
     tatcagataa tgttatcaat gaactccatt tcagatcttc aggatcgaat tgtccttgag    150840
     caattggtgc agtaagcgca tcattgcatt tctcagcaat atgactaaaa agggacagca    150900
     aacgctctga ttccttgtca attatcgttt ccattaatgc tttgacttct aacaatgaaa    150960
     ttaatgaaat tggtagctgg tctacccaaa ttcctgatcc atatcggtcc caaatttagt    151020
     tcaaaatcat gtaccattat gttgacacta tttatcgttt tactaatttt tcttaatatt    151080
     tttttagcat ttcgggatgt aatcacaatg ttagaaaata taaagtcact gatattagtt    151140
     atcagacata ataaatttat atatctctta atctttagtt aaggctatct acagctagtt    151200
     attataatag accaagactg ccggaaatgg cgtttgatat tgatcatttt caccatccac    151260
     cgaattcttg agaggcagta attataggaa ttggaatgtg gcaggaaaat tcctctcctt    151320
     ccatagtttc tttggcatga aataacctac ccttcttatc ttcataaaat tgttctaagt    151380
     gaccatcttc aataggtttt tgtattacaa attttagaag caccatccat ttgtgttgga    151440
     aaatatcaga tttaaattga ccagcaatat ggtttgtcgg agtcttagag ggactcaact    151500
     tgaacgagat tgatgtgaag tcatcaaaac ttatagagtt atcgactgca acagtttttc    151560
     cttttggtct tgctgccttt gaagttttat caacagcaaa tcgaggattc agtagtacaa    151620
     aagattgaag tatggcagaa ataccagtta ttctagtttg cctctcatcg caatcatcta    151680
     aggtcacgga tatatcaata tcatctgaag tcataaagaa tggttttgaa aaaactacct    151740
     ttgcaattgt ttcaccattc ctgttaattt gatatgtact ttgtaagtta gcaagttgtg    151800
     ggatcatcgt gacaccatca atgacatacg actccacatt atattgcata ttaggagtgt    151860
     tctgtagttc tgcaatgtga tcacgcacag agtcacttct cttcctcgta accacatact    151920
     cctcattttt gtgttcctcc tcaagttcaa tgtcaggctt ggaatccttg tctttttcgt    151980
     ctttatcaaa ttgaacctcg actaaattat ccacaagctt atcaatatca tcatagtttg    152040
     tctctttatc actgataatc ttaataaagt tttctttcat taaagataat ctctcaggtt    152100
     caatatcatc aacaactgtt gggtttgagt tttttctttc aaaattaata gatagtctcc    152160
     tttcatataa cgagcttctt ctttcaacag aatatctcct ttctaaagtg ttagagacat    152220
     ggttttgtgg agcagatgct cttcttatcg aagagggtga tgacttaatc tcctttactg    152280
     ttccagaacc ctgaataacg gcagggcgat ttagaacaga tgaggcctgc ataccacctt    152340
     ctaatacata tggtgcaatt gaaataggaa cttttttagc aataggaata agattaccat    152400
     caacaacacc agttatacca aactcggcat cataaagaac tgagagaaag tttgaaagca    152460
     tgtatgttgg acaaatttct ttattcaaag gttgagactt aaataagaaa gtttttgctt    152520
     cccctggttc taaattgatt tcagagaaaa ttaaagtttg tggaatcaag aatatcggaa    152580
     cttgttcata ctcggcatta gaattttctc tatcattggc tcccatagag atgttagtat    152640
     catttataat cttttcatct tctctatacc caaaccgcaa gccttctgtt atattagcgt    152700
     attcagaatt aacatattta tcagatttgc ttatagattc ttcatttaac tgttttgcag    152760
     ttgaatcggc atatgttact cctaatagct tagaatcatt tgatttgaag gtacttttat    152820
     ctattatgga attgtcgtat tgtaacttac cacttacctg taagtagcaa gagacaaaat    152880
     ttactatgga gttgaatttc agatcttttg tcagtctttc tctgcttttt tctagcaata    152940
     ccaattgttc tttgacatct gtgatcaatg ttaaattact atcagttgca ttttgagcag    153000
     actcatcacc attcttcttc gaaaacatat ttcttagtga ccatttactt tctggtattt    153060
     cattttctaa gatttcccta ttttcctgtc gtatcctctg tattttccca ttcaagttat    153120
     ttagtgtagt ttccaaatgg tctctttctc ttagagaccc caaatgcttt atcctcacaa    153180
     taatcgatat gggttcccct gcaaaaaatg gattcgattc atgtattagt tctaccttaa    153240
     cattatcagt tatgtaaaat gcatcaattt tgtgaagatg cattttgact caatttagat    153300
     atcctgatct atccctaaaa ttatttgtaa atcaataacc aataacacaa ttgaattaat    153360
     agccaccaaa aagagataga cctgagacaa taaagaaagc ttaatattta cacaatcttc    153420
     agatttagca gcttgtagca ctttattgat agttttgaac ccaattaggc ataaacagta    153480
     taacccttac gaaatcgcaa ttgcaacagt cactaacaat aatctgcaaa atcttgttac    153540
     caaaaattaa aacacttgat tttccaaact aaggtatggt tgacaataca acagaaccct    153600
     ataatataat aaaaagatta gaattgcagt aaaagttact gcttgtctac ctacctgtta    153660
     tcctttaaaa aactcacgat gtacttttca ttgattttta catcaagttt agtagagata    153720
     tccgcagcaa aaaataattc ttccccgcca ggactcgaac ctggaatctt ctggttcgta    153780
     gccagacgcc gtgaccattg ggccacgagg aacaagaata tttgtttatt tcagaatttg    153840
     aattgagatt tactaagatg tcttactttc gtatttagac acatattttt tatctatatt    153900
     caaaatttgt ttatcggtgg atatattgtt gtatattgac acatcttaaa gatattgttc    153960
     gccatatatt acattccagt cagtattaat ccatgcatca ccattcctct taaaccaaaa    154020
     ccgtaactaa ctttagactt accatagata atcctatgag aggtgttttg atcattaaat    154080
     tttgttcttg ttatatcata taaaattgtg gtatttaata ttgtatgcct tttacatgtt    154140
     tattattggc aatctataaa aaaaatgtga tatagatgta tgctagattt tcgatttgtt    154200
     gttgaattct tctacaattg cagtattgga cttaatcctg gttagtagtc agaaaaaatt    154260
     gccaagcttt tatctcaatc gactttaatt gatgcaaata tccttctgac gaagaacata    154320
     ctacatatga aaccgatagc acctgtgaca atacatgtta ggaatgagat gaggaatgag    154380
     taaccaacat aaagcacgat cgtggcgaaa ccgcctagtt tgaattgagt gaatagaata    154440
     gaatgaatga aaatgtagat agagcaaccc aaaccaccga tgaagaaact tctccattgc    154500
     catgtccagt tctctgaaca tagcgcacgg taagtaataa tgacgttgat taaaccagtg    154560
     gtgaaagaga agagaacaat tgagaacaac aagaaaccaa acatgtagaa tatcttattg    154620
     aaccacaaac ttgagtaaat aaagtacaat tcaacagcaa tcgaaccaaa tgatactaaa    154680
     cctccaatta atgtggctgg cacagtcttc aggaaccaag gttggaaagg aatttgtctt    154740
     ggaatctcat tagtctttgt tgggtgttcg tcccaattac atttcttgta cgagattaga    154800
     gaaccagcaa atgctaatgg aattgagaag agaatccata ggaaaaccat aaaaactagt    154860
     gttgccaatg gaataacatt cgatgatccg acgaagtata gcaaaacatt cataaatatc    154920
     acagtcaaga atataatacc tggaagcaat acaggtgtca gaatcatgtt agccttccag    154980
     tatggacctt taaaaaactt gtaaattccc atggatgtgt aagaaccaac aaatccaaaa    155040
     attgcataaa acatgaacat tgcagttgga agagaacctc tggaacttgg tgatagaata    155100
     cccagagctg atagaatgat tgaaagaaag atcatcaaaa acaattgaat accagaacca    155160
     accagtacag ataataacat tgagttcttt ggtgtacgga aaacatcacc atggaccaat    155220
     ttccagccgg aatcctcttc gaattcatct cccaggttga attcattgta acgtgagata    155280
     tctgacttca aagcacgtag tagtgaatgg attgcaacac tagataatag taatacaata    155340
     acggaaaagt tgatcaaaga aaaccattgg atctttggat cgtagatatg taagtatttg    155400
     tcccatcttg tcgcccatgg tgtatcagaa ggagtaaact taacagaata tgtaaacata    155460
     acctcattgt ccttattctc atccaagtgt agtttatgtt gatttgctaa cgcgcatgat    155520
     ctagatttat aattatctaa ggaaactggg ttcacaatga caccaactac tctaaaatca    155580
     ccatttccac gatcatgata ttcaacttcg atatcgaagt gattggcgaa tactggcact    155640
     tcaacattgg taactatgtt gtcaacgaca ttcttggctt cacgtacttc taaattagac    155700
     aaatcaacaa ggttctttgg acttctgatt tcaatgtcgg taaaatcaat gatatttttt    155760
     gcatcacgtt cagataattg aagttctttt tcagattctg agacaatctt accaccaaca    155820
     gcttgtctta cttctacaaa acctaattcg aaaccctggc cgtagaattc agtgttagtt    155880
     ctgctgtcat gcagttttct tgcagctggt aaaccgtcaa tgagccagtt ctgcatgaag    155940
     ccattcttga tcagcttgtt gataaacttg gcatccttgc ctggtatggt agtcgaacat    156000
     agctgtacac actcgttgtc ctcaagcatt ttgacgttaa atggagagtt atagatcttt    156060
     tcaccaaaga taacagagcc tagagactcg ggctgcttct cgattttttc aggctgacag    156120
     aaatgtaatt tctcgttata gtagtcgtaa gggtacaaca tcctcgcctt atcacctttg    156180
     atctcgttac catcatcgtc tacatgctgg aagtttaacg agggagttaa gtggttcacc    156240
     agtaatggga tagcatctcc ttgcttataa gtccttggtg cagcacctgg caagtagaaa    156300
     ccaagtgtgg acgccacaaa cagcgacagt accagcagtt gtctaaccat ttcttcttga    156360
     aaaaaagcta atacttgttg tgtgctttta ttacaataaa tacaacaaat aatttaaaga    156420
     aatataacta aaacagatac aaataattga gactaaaaac aaataaggtt caagacattt    156480
     ataaataact catcacttgg ggatcaaatt gtgaagaagc ctaaacaaaa acaccaaatt    156540
     tttatcattt atagagccaa gctctgaaga aaaaaaaaag aaaaaaaata aatttgaatt    156600
     cctataacaa aatgacgaca atttgactag caattcttgt tgttaaactg gtaattgatg    156660
     attatatcaa actatgtgtt gcagcaggac ggcttattcc tattcattca gttctggtag    156720
     ttgataatac atattggtag gtacatccct atactatctt gacctagatt cgaactgttg    156780
     atttatttgt tagtgttttt ttattgccag ttgacaaaga gtaaaacgac aaggccatag    156840
     acacatagta aactggctcc aaactagtct caaaattttg gaccccgaat tggatgtact    156900
     tgaacacgta gatgtcacgt tgtatagctg attcgcagtt aagatttcga caaaactgaa    156960
     ctgtacagct tggaggttga ttcaataata gcgcatatca actgtaatac gcaccgaatg    157020
     tgaccaccag taatataatt ctgtaacgca acacattatc ggtgatcaag ctatccctgc    157080
     acatatcctt ggcgattgag tagcaagtga gggcggatcg ttggctgctt taatcaggct    157140
     gctgtaaata aaacaacaac aaaaaaacaa ctacaacttc gatataaact ggatatattt    157200
     tcattgatcc tgcttttgga ttagtaatag catatcttta agagatggtg ttttcctatg    157260
     agcattacat gaacctgatc tatcacctgg atgacgccaa tgagacagtg ccgtctgata    157320
     ttgccaagcg tgtggtttcc aatgcaatgg caccagtcat aacagtgaca tcgacggttc    157380
     tactcgacag acacattgaa gaaacatacg ggatcgattc tctgtatatg ttacttagat    157440
     tttttggtgg ttgtgtctct gatagggatc aagcaaatga agttaaattg gggacagatg    157500
     gtttaaaagt aactgaagag ggtgtagaaa atgagaaaga cggaacaaat gggctaacag    157560
     taccgcgtca gactagagta cggagtaatt ctaatagttt gtatcaaaga gatgccactc    157620
     agtcgcaata tgtgcgattt accaaacctt tagctgattt aatcaacaca caagatgcca    157680
     atgacatgct ctttgattac cattcactgg aagtatatct gcaagaatac ctatcagtag    157740
     tagataagaa atttagcccc catattcctc atcatttgct aaaaacctcg atctatcata    157800
     gtttctttgc attagccata tcatcgacct caaagctgtc gccttttgag tgttttaatc    157860
     atccaattgt gtcgctcttg gcaattgata tcacaagaaa tgaagactac gagactgctg    157920
     ctgaacaatt aaaagagttc aagagtatga acaataatat acccagcttt ccctcattta    157980
     taaatacaaa cgacatatta ccagtatttc tgctttgtta caataaagat aacgaaactg    158040
     agttcgaaga atgccaaact ttggccggaa aattgaagaa acagctcttt gttgaaagca    158100
     taatacttcc cctatggtca acagaattta ccgataattt ggtagtttcc ttgcatcaac    158160
     cggtgatgtc atctattgag gaaattatgt tcttcttaca aaatcctgtc gatcataaac    158220
     tacccctcaa gcttgtcaat tgcatttatg accaaattga tatgatcgtc tatgatttaa    158280
     tgaaaccttt tatgaagaga aaaatgactt tttgggaaga gactattttg accccaagaa    158340
     agtcattatt tcatggagca aaatttttta aaaagtttat gaacaaatcc acacaagctc    158400
     tatcacaacc aaactcgctt ctgaaagaga accatggtag taattatcta tcctcgactt    158460
     ctcctgaatt cttgatgagg aagcttgcgg attggtccat gatggtgtct gacttcaaga    158520
     cagcttatac aacatatgaa tctctgtgtc aagattttga gcgtatgcca aaatacttag    158580
     catcatgttc cgaatggtgc gcagtatctt tattaatggg tgctcaaaat attgttactg    158640
     caaaaatgct caagaacgag atcaatccag caatagaaag agcactagga gcatatgagc    158700
     tgtgtgccac ggaatcaaat gcacatagaa aatttggaga ctctgacgat ttgagtgcac    158760
     ctgtcagaag ttatgagacg cgttgcatgt ttttggcttc agaactattt ctttcattaa    158820
     gtgatacttg gacttcaaca ccctttgcaa tcgcatattt agagacaata ttaaatgaat    158880
     gtaaactagg acccttatct gaaattatga tttgggaacg actaagtgat tgctatggta    158940
     tgagaattga cccaagaata aaacatagaa ttggaaatct tgaattatta cagaagaagg    159000
     aggaaaatat ggatgatcct aaaaatgctg atgtctttac cacagaggat atactttcaa    159060
     aaggtttaac aaggaataga aaggcagctc tttttaagct tattgcagct agaaaatggt    159120
     gtgaacaaaa acaatggcga gaattaagtt ggtgtttaga tgatttagaa tcaacttact    159180
     ccgacttaaa atgctttaat aaagagaatt tactgtatac acgtctgagg aatgagctta    159240
     ttgctgctag acaagacatg tagcaggagt cattaaaatt gtttctttat gcatattata    159300
     aaatactttt tgtacataaa ttccctttgc atcacataaa ctactattag tatagtattt    159360
     atttcctaat tattacctaa tcgcattttc aactagttgt ctgtatgttt gctgggtttt    159420
     tgccatgtct aagaatatct tatgtttaac attgattaat ttcctttcaa tgctgtcttc    159480
     agtggcagga aatacagtcg taccatctgg tgtcatgttg ctcattgttg accataataa    159540
     atcagctcct cctttatcag aattgttctt acttgacgaa taagccattg cgccaaggat    159600
     tgctgagcca aaaacaacag cactatctat atattttgga ataatcagag gcaaaccggt    159660
     acagttggca ataagttgca ttaatatgtt attacgacat tgaccaccag acatataaat    159720
     ggctttaatt gtgtgtccag cattcattaa agtgtcgatt atatgtttag tttgatgtgc    159780
     aataaattca cacgctgcca gatatgttct agccaagtca tccattgatg tatccataga    159840
     ttgacctatt atggcagccc tcatattagg gtctgcaatt ggtgacctat ttccatggta    159900
     gtctccataa agaaaaaaat ctttcgtcaa taaaagtggt gtttccaggt tattctttct    159960
     tgacaactcc aaaatgtagt tgtttaagaa cgaaaacttg tcaacatttc tctgtttgac    160020
     taaatttgaa agttcatttg ctgatggatg aatggatagt atgtgtgcta gtaatgcgcc    160080
     tgtaaaactt tgacctccct ctgcacacca gtagtctgga actaaaacat cacgataagg    160140
     accccaaact ccgggcacaa aaattgaagt ttttgataga actatatgac aggttgatgt    160200
     gcctgctacc gcagccaatc ttccagcaca ctcttctata tccaccactt ctttattatt    160260
     tggaacttca atagtagaag atgctacagt gcctatccaa cctgcataag catcaatgat    160320
     accagaacct acaatacaac ctgggttaat gtttgtagat ttgataaatg actcgcttac    160380
     cgttgagagt tgattaccgg cgtatgtaaa gttaccgctt tcatttggac caccaagtgc    160440
     attaaaatta gattgcgata tctcttccaa tcctatctta gttaggaact cagttgacca    160500
     tcctttactt gaaccctcta ctccttttgg caaaaaacct tgcttacaaa cggcagaaca    160560
     atatgatctt gtgttaaccc ccgatgccat aaaagtcaaa tagtctggaa ggtccataaa    160620
     tactagcttc ttgaactctt cgggtgccat atgatttttt agccatttga tttttgggat    160680
     ttccatctca acagacattt gaccaccgac gtattttaaa cagggatcac cactcctgtt    160740
     aatttctttg gtctcttcaa tagcacgatg gtccatccac ataattatgt tctggttgtt    160800
     gttatcgaaa tttggtccag cagcgacagg ctcgaagcta tctttattta gaacaactag    160860
     agaacaagtg gcatcaaatc ctattccgag aatgtcaccg ttattgacat tggagttgcc    160920
     aatagcactc ttaacacagt aacatacagc atcccatatc tcattggaag attgtgttac    160980
     atgtccgggc agtttctcct ccttacttat atctctagta gccatggaga gcattgcacc    161040
     ttggtcatcg actacacaag cacgaaccga cccagaacca acatctacac cgatataata    161100
     tcccattttt atttcctgat agttctatat taacttctgt ctgttaaatc taatcagcaa    161160
     cagctccaaa caatgctatt atgcaccaat acttatcaca ttaacattat agatatttga    161220
     tgtgctagct ttcagttgcc attctcgatg cttaaggaac ccgtaaatca ctatgacgta    161280
     atttctgatc tcgtcaagtc tcgaggccat tcatgaaggt cccagagtca agcagttagc    161340
     cgttggtatt ggtaacggat tttaagttcg atatcctgaa tgatatcaaa atttctgtca    161400
     gtgctgtcct attcagctat aaaggctttt aaatgtgctt attcattctt acagttcaaa    161460
     tatgacacat catgccggtt tttgtcacta caatgcgtaa atataggaat attctaagtt    161520
     aggaaagtag ctttgttagt ttttattcta tgtgctatag aaataagtgt gtattatgtt    161580
     tatcttcgat gctcggatta attacatttg gagctcatct ctcctagtgg gaaatctcgt    161640
     ataatgctta gtaatcagtg agaagaaggg gagctcatct atcccagaaa agtataaaac    161700
     aagcgtttct tactcaatgg aatcacagga gcttataaaa aaatgcaata caaagttaat    161760
     gtgtaaatac atcaattaag gatatgacag cttttaaagg tgttttgcat aggtacacag    161820
     agaagaaagt tgcgtttgag tttgacccca tcgacaatga taaagttgtt gttatgattg    161880
     gtggtatgac tgatggtctg ttgacggtac catttgtgga cagactaggc gctgccttga    161940
     ataaatgtgg ctttggttta atccaaattt aaatgaagag cagttacagg ggttatggta    162000
     cttcatcgtt ggatgaagat gcaaatgaca ttgaggccct gattaagtat ctgaaatcga    162060
     aggaaggagg tgcaaggagg aaaataatac tcatgggcca ctccactggt tcacaagatg    162120
     tcttacatta cattttaacg aagaatagat acgggatcga tgccgcggta ttacaaggat    162180
     cctgttccga tagagaggga tttgtggatg atgtggggga gaatgtatac acaaagctaa    162240
     atgtcctccc caagagactt gttgatgaag gtaaaggaga tgaactattg tcttcagaat    162300
     actcaaagta tatgggagga acaccggtta cagcatacag atggtgctct ttgatgctga    162360
     aaggtggtga cgatgactat ttttcaagtg atctagatac agaaacaata aagcagacaa    162420
     ttggcaagat tgacatacca ttcctagtgg cataccctga gattgacgaa tttgttccaa    162480
     aatcaattga caagatagct ctgttgaaga gatgggaaag ttgtagtcaa acccagttct    162540
     ggtcaaagaa ctctggtttg attaaaggtg gcttgcattg gcttccagag cctgagactc    162600
     aggactattt ctacgtaatg gttacaaaat tcattgaaga gttcaatcta tgaaatttgt    162660
     accagcatca tacaatttta tttcttggtt tttttttttt atcaattcct taagtgatgg    162720
     caacaggaag agatatatag ctgttattac tagcattttt tagatatcga taattgattt    162780
     aaagcaagtt tatgatgtat ataagtcgaa ctgctacaac agaattatca tctgaacgcc    162840
     aaattcatcg caattgttgt gaagaaaaga aaaaaaaaag aaaatttaaa aacaaagaca    162900
     atatgcgatg agcagtgatt tatttacttg ttactcaaag tgaatcatta ccgaataaga    162960
     ctcaaatagg atcagagtta ttttttattt aataagctgt gcttgcacaa agcgattgaa    163020
     agtttttttt acttatttat ttactgaccg gtcttaagaa ctatggtgaa aagcgccaag    163080
     aagactggga cgcaagatgt cgatgctata atgaaaatga atggtaccaa ccttccctct    163140
     gaaagaccaa agtttgatat agatggcttt agagcaacta agaggcgacc tgcggggaca    163200
     tcaaatatgt ctagcacaga attggagctc tacaacaagt ttgtaatgcc agctctagat    163260
     gagacctatg aggattatct ggttggagaa gatagtacta ttgatgttga ctttctgaaa    163320
     cgtggtgaaa aagatatgag aagatttgca gaaggtctag caggaaaatt aactcaggaa    163380
     acttacactt tacttatgaa caacaactta acaatggaaa ctgtgatgaa agcgatgaac    163440
     atatggccac caaatgcagc cgaaacaaaa tattccaatt taataaaacg gttttataag    163500
     gataaggaag gaaatattcg agatgctaaa gtggataata atattgtttt ggagcctgat    163560
     aaacttttta acttaattct aactgcacat ctaaaaaatg gccatctgaa aacagctgtt    163620
     ttgtttcaat gtctgagaga ggtatatgca aactgtacaa gagattttgt acaaacagca    163680
     ttattttatt gtaatcgctg taatccggat aggtacatta aaccaataga aaaggtacgg    163740
     catagaaata tcaatgaaga gttactaccc ttagaaagag tacacataga agtgtttgct    163800
     ccgtttgaga aagaagaagg agatataaag caagaggata gtcaaaatcc atacataaag    163860
     attgaaggaa aatattctca tgtattttat tgtagggatt ttaggactag atatgtctgg    163920
     tgtttcccgc ttaagaatat gaaatttaaa acattagttg acaacattgc tacttttttt    163980
     atgacggtgt tgtatgatcc acctatattt gttgagtcct caactattga cagggatgat    164040
     ttaaaggaga tatttgaact gctggcctcg aaatacggac taaaacttgg gctgggattt    164100
     gccaacttta ccaagtttca tgctcaaggc ataaagagat tcaagacaca tttgcaccgg    164160
     gcaaaatccg aatgtgccga tgattggctc atgtgtttaa aacaaggcac ttactctgcc    164220
     aatcgtgtaa tagaaagaca actaggtaaa gctagtaata tcttattcac agaactaatg    164280
     ggccaattcg agagggatat gaggaaaaag aaactaaaat acatcgagca atccttctcc    164340
     gaaaatatta agacatatcc taaatcagga ggttgtatat ttattgaaca tgttcaggac    164400
     tacgagaaga caatggaatc aatcgatcgt acaggtactt ataagagcgg gagaaaggct    164460
     gatcaattgc cagcagaaga cacaccaact agccacgaac cagtggccaa tactacagca    164520
     attaataaca gatcaactaa agcaaacaaa ctaaatggtc cgaacttgag gaaaaggact    164580
     aaagagatca ctgagatacc aatgagtgac agtgacgatg acgaaccaaa atcaaaacga    164640
     aaaacaagat caaggacaag gaccagaaga taagcctata atgtataaga gaacataagt    164700
     atgatgagaa ttaataatct attttgtaat aatacttcaa aagcattgct atatttatga    164760
     catttatatt catcatatat gacgaacgtg cagggtgttc aagcctttga agtggccggg    164820
     ttctcagttc aagacgcata caaaatgact atgacaacga tatttcgaac atactttagc    164880
     tcttgaatgc tattatacat agtaaacagg tcggtttttg ttataaatta cttagcgtta    164940
     gtttgctact atcgaaattt tgattagaac aaagatgttc aaatttggca tagggctttt    165000
     cagaaatgca ccagtgactc tcaaactaaa catacaaaac cgtccgatat ctatgctctc    165060
     ttcctcattt ggtgttctga gaccaatgaa tctcacacca ggtaatggta tgattggaaa    165120
     aaactctgtt agtttgatta gaaatgagat cagtagtggc acttcctttt catccattct    165180
     aacattattc ccactacaaa ggagatggaa atccagaggt aacacatatc aaccaagtac    165240
     attgaaaagg aaaaggaagt ttggattctt ggcaaggatg accaacaaaa ggactgcaaa    165300
     gataataaag agaaggaaag aaaagggtag atggtacttg acccattaag tgatgaagaa    165360
     ctaactggag aagaatattt tattctttgt acagatgcat agacaattca atgttttatt    165420
     attcctagtg tctcaattca agctgtaaat aaatattttg agtgtgccat ataattacgt    165480
     aaatataatt tcagaaacta actaacagta ttacaacatt aatgaggtta tctgtattga    165540
     atttggaatg ttaatgtgag tgcatattta catgcgtatt tctatttaca aattgcgatg    165600
     taacagtagt agtaaaacat gaatgagtca aaatatcgtt aagacattta ttggaaatcg    165660
     atcacgatac caggtcctgc tgtggtcgaa atggttgttt tgcccagtat acttggcttt    165720
     ttggctactt gagaactaac actctgcttg aaagcgtttc taacagcaat aatattctct    165780
     aatatatctc tatcactgaa attgcaacga ccaacactaa cagataatga attaccacgt    165840
     tgtctgaatg aaacttgtcc taagttttct tcaatcaaag aatctaggtc ctcgccaact    165900
     gtattttggt gttgcttctt taagtttggc attaaaccct ttgggcctaa tactctaccc    165960
     agctgactag caattgttgg aaaaatttct ggtgttgcaa aaactttgtt cacgccgtcg    166020
     acctttatct taccgctctt gatgtcagca atcatatctt ctcctccagc aatcttgact    166080
     tgcttcgagt atttactctt caattcatct aatttttcct tgttagagct aaagattgca    166140
     attttcattt gtttcagtgg gtgggggaac aatatatttc cagccaatgc agcattacct    166200
     ttgtcagcga caacaagggt agtaactgtt attgtttgat gttgggtagg tcttccaacc    166260
     tcggcggatc ttagatatct taatgctaat ggaataggca tatataatgg gtgtatattg    166320
     gctggcttct ttgcctcagc tttcttcagc gccagtctct tcatttctct ctttttggct    166380
     tgttcttttg ttaatgttgg ggccgcagcc tgagggattg gggcagcctc agttgccaaa    166440
     agacgtctcc caaacaatgc agagttaaaa ataaccctat tggcattaca atacctgacc    166500
     ttggaaccaa ttcgtagcat ctttgtattc gaaaagcaat caaaattctt ggctaaaata    166560
     tgaattgttc actactcaat atggattcgt gccaatatga aaaacagcct tatcacggaa    166620
     tgtatagtct tggttagaag gacagttgaa tcaagagaat aggtccaaaa accaagagaa    166680
     ttgcgaccca atattcgtta gaccaaaata ttgtttcaat taaacttgtg attactattc    166740
     tccatggccc gtcctgctca atttacgatt tcacgaagcg gttttttgaa ctgttataaa    166800
     acaatactta cccggacata ttattggaac ttgatggcaa tatgacatac tgaatagcta    166860
     ttatcgttga ttccattact agatatcgag gaaaaatggt ttgttaaatg tctataattg    166920
     ttatatatga taatgatata tgccagagga ttttatttcc tttttttttt gttcttcagc    166980
     ttgttttcaa aatcgatcca tttgtttggt attcccaaat cattcaagta agacatgata    167040
     agttgcccat gagggccttg cacttgcact tctgctgttt tctttgccga tgaagtggtc    167100
     tcaccaattg tcgtggaacc gctacatttt ttacgtatat cagctgcaaa ttcctcggga    167160
     tcgatttgga atacttcaaa gttagacact tttgtaataa ctttacgacc aattttcatc    167220
     tcagtaacaa tattgatttt tggtggttcc cccttcaaag gcgtcttggt taacggtgtt    167280
     tgctcattgc cagtaattct gaataagtga taattcttgt tgaaattgtt ttgcaaaact    167340
     ggttgtaata tgttggctct tggaattact ctacttttcg tagcctgatc ctctttcttt    167400
     ttgtatatca ttgtcattaa catatcatcc accagtacac atttcttatc cttcttatct    167460
     actaaatcct tcatggtgat atacttattg atgagttctt tgatttctgg ttccatgtat    167520
     agctgtttca atgggacctt attgctagaa ataaagtctt tggcaaggtt tataggtttg    167580
     tacagagtaa caattttgat tgtagtcttg gcattaccac cttcacttcc tgtgtttgaa    167640
     ccttgattac caatgacagg gtatggtaga aattgtttga tttcatcttt atctttgtta    167700
     acctccacaa tcgtaagatc atcaccaaca cctttcaatt tcaaaaaacc ttccttctca    167760
     aagtgcttga gaaattttgc ggtcttcttc catgaactct tcttgatgtt cacctccgca    167820
     agatttgttc ctttgggtag attatggttg atatgatttg agacaaaatt tgacgctgag    167880
     gtaggagtct ctaatttagt atcctgagaa atagtataat aaagtgctct agtaataaaa    167940
     taatcaatgt cctctaacct taattcgtct aggacctcag ccatatcatc caggtttgat    168000
     ttctccttct ctgtatcact gttagactct acttttgtct catcttcatg tatatccgcc    168060
     tccagttcta attcttcgga gctactgctt tgtgtttgta agagctctgc ggggggctcc    168120
     tcttttactt tgaaaacctt aaagagttcg tcttccaaat gatgaacaat ttgcactgca    168180
     acaccagtct cacctataac cctcgtaaag cttggcaaat tcatttgaac aatacctaca    168240
     gcaacaatta gattaggagt ccttttgtca gcaatgccac atacagtgcc tacagttagc    168300
     ctctcgtcaa atggtggtat agtaccagaa atcatcaagt ttgccccatt aaatatgtga    168360
     tcttctaaaa caattgaatg agttaaaact actggaatca aattaggaca tctccaacaa    168420
     gccaaaactg tcgggtacag cttctcatca tgcttctcct tgaaccaaat tggtgcattg    168480
     ccctcgtctg tataaatggt acctatagtg gtgatccctt taaagttggt ttgctttata    168540
     gtatttgaac caaagctgta ttcctcgttg cttgtttgta ttctacactt ttcttgtaac    168600
     ttcttccttt cggagttctt cagattgctc agcgccttga tatgcggttc ttttttgaac    168660
     atttcctgtg tcttttggtt tttataggga ttatatgcta aatagaactc aaagtcgcca    168720
     ccttatactg ataaactgat aacttaaaca tctataatgt cttataatac atctgcaaaa    168780
     aattcctcga tgagctaaag tagtgaaaaa taaaaatcaa aagcttagca gcgatgatct    168840
     aagttaaagt agcacagaca atggtatatt ttcagcacgt aggtattagt tgcctgagta    168900
     aattgacacc gatatacttc tgaacagctg gtataaggtt gcctggtctg tgttttgtat    168960
     gaggctgagg tgaccatggg tgaagatata gttttggatc gttttttaaa gtacaaccct    169020
     aaatatggtc tatttggaat gaatgaggat aaccattctc tggtgattag gagaacaagt    169080
     gataatgttg gaattgtgaa gataaatgtt cggaatattg ttcttttatt ggattatttt    169140
     tgggatccta ttgatggtaa atatttagcg ctgtttctta aggatggtag tgtcaggata    169200
     tatgacatat tcaatggtgg taagcttatc tcttttctta gagtccttcc cgtggtcttg    169260
     ggatccaata agcccagttt agactgttgt ttgtgggata gaattattat accgaagtca    169320
     ggatcctctg aattgagaat acccaataac gatcttacag aaagcatgcc gacactagtc    169380
     aaatttgtgc aggacgcaaa gcagattgat attataccta atagaagcat cacaaaacta    169440
     tggagatcaa ttggtaacaa tgagaagaag gtagtagatg ttcatctagg atacagttgt    169500
     tctagcgcgc aggtaacaat attgattaac ggtgaatacc tgatagaaaa atcagttagt    169560
     gatattaacc aaatacaaaa aaaaatacct atcagtctta ataagaagga attttgtgaa    169620
     gcaatctatg agatacattt tgatgattat tctagattac aaattgactt aacaggtatt    169680
     ttactgaatg atgataaatt ggatttgata gaaacacaaa ttaaaatgac taatcatttc    169740
     gatcttatta aagatcattt caacttgata gaaaaatcgg tgctagctcc atattatgaa    169800
     tttctggaaa gtattggtgg cataaatgac ttggatgtac tagaaagatt attcttgatc    169860
     ggtgagttag atacaaaact tggcaattgg ttcaaagaaa ctattaatga aaaaaaccta    169920
     aaaaagtggt ctcgattagg aaacgaattt tactccaatt ttaagcaagt tttgattatt    169980
     gtttttgttc caatatgtga aagactgatg gtgttgacta acagaatcaa tggaatgata    170040
     aaaggtatcg atttgcaaga aagccaggaa acttctttat tggatattag tgaattgcag    170100
     tctttcttga atttggtact aaaactctta gcagaattaa atgaagatga gacatatttt    170160
     aaacaggatt ttcttccttg gcttacagat aaagtatatg aaagcattaa caatgagtac    170220
     aaaagtgtat tttttaaggc agaatatggc aataataaga gaattctaaa tataataaaa    170280
     tattttgagg ctacagtaat tgaaattgat tattcattaa gaacacattt aaacaaactt    170340
     aaagatgaaa atgagaaaat aatcaattta tttcagaagt tttcaaaaag tagcttgaaa    170400
     acatgtttgt cggaatttga aaccaagttg ttcgaaccca aaaaggctgt aaaattacta    170460
     gcttgtgaaa aaatatgcaa cgatgtttgt aattatgtgc aggtgctaat gtctaaagat    170520
     tatattctgg aaatattatt ggtagacgcc gttacaggta ctgttttgtt gtcggaaaaa    170580
     tataatagta tccagaaccc gtttggttac gaaataacat tagataatat catatcatgt    170640
     acgttagtgg gcaccgaaaa ggtaaataaa gatgatacat acatgcaaga cattcttgcg    170700
     ggaggaaatt cattggttca agaaaatgat aataaaatag agatatatgc agtgtttgga    170760
     acagcactgg atgttgatat tgagaacata attcaggtaa agcttcatcc gcctaaaata    170820
     tcattgaaat taagaaccgc ttagcattta ttatatgaag aatcagagat atctgatttc    170880
     acttaattgt agttgctttt ggcaaacaca atgatagtaa tgattaggct atggtaaaaa    170940
     tcaaaccgat atttttcttt cggttgattc ggtagggaca taagatctcg atgtagcact    171000
     aaatagcaag aattaataac gaaatataag taccgtttta cttaaaaaca aattagtatt    171060
     gtgttggtac catttttatc tgttgctatc attaatggta aaatgtcaat atgctctgta    171120
     atattgctga gacatatttc tcgagaaatg tcaccaacca acgaacaaag gaatttttga    171180
     ccaatgagaa ggcgatcctt gatattaatt gtttaattcg aataatgtaa aagaagtgtc    171240
     tattgaacag aggcagtgca ctagattgct gtgggttcat tgttatcgag ttgcactatt    171300
     gcactatacg tatattaatg aggtctcgct gcctctcccc gcaatccccc actctcttcc    171360
     tctttatttc cgtaccaaag acaaagcaaa ttatagcaca tttagccatc ttcgataatt    171420
     tgtgaagaca atggaagttt acctaaggat cctcacaaga ctttgtcatt gtagatgtaa    171480
     gggcacggat tgttcccttg tgttgccccg taaagcaatc tctctgagta atcccctccc    171540
     ttgtaattgt ccctttgtct tcttcaattg gttttgcagc cagtataccc tgtggtaagg    171600
     ataggaaggg caatctttcc cctttgacct ctcttcccat tatctctagt ctacattagc    171660
     agtggtgcat acaatggcag tatcggttat aatggggagc tccttttgta gttgacttgc    171720
     tttgttggca gagccatgga ccaatcccat tcatcgaaat agcaataatg aaattgctac    171780
     tgtaggacaa aaagaagtgc tagggtgggt gaattgctat taatccacct tatgcactac    171840
     tattgataac tgtaggaagg ggttgagaca aacacctatt cgatttgcac agcctattgc    171900
     attttagtat ttcctgattg ctattctagc gacaggtatc atcctctgac agaaatcaag    171960
     tttcgaaggt atatataaag aagaaaatgt agacacttcc tgttaagttt tcgaatttgt    172020
     aaagactttc cttcttcgat cttttatggt tttttcgata ttatttagat acttgcaagc    172080
     catcaaataa tattacaatt aaatcaccac ttaaaaatgt ttagatcagt cggaattaac    172140
     agaatgagat atgtcatgaa ctctagtatg acaagatcgt tgtcttctac tgcaaggaca    172200
     caagctcaag gccgtattgg tccttcttgg actattgctg aaataaaaag attaacacct    172260
     acacttattg gctgggcgtc atttctaaca gttactttag gctggccatt tggtatttac    172320
     ttctggaaaa agccaaacta aaggatttaa acaaaataga atagtaataa attataacag    172380
     cgtttcaata ttcattccaa ctatagaagg acgagactgg gttaaatttt tgaatctcaa    172440
     agggcataca tgttttttgt tgatgctcac gtcctcccca gccccatgta ctatttaaca    172500
     ttctttaggt taggttaata tattttcagt ataactaaac tgcattagaa taaataaaat    172560
     ttaattaata ttcaacatat aacgttttca aatcaaaaca ttgttcgatt gttgataggt    172620
     gaaagaggat aatatacgtc caattattat gaagaatgtt taggcctttt gtttcattag    172680
     ttggagtcga gttaatcata aaaagatgat aatgcatttc gtataattcc cttttaatat    172740
     atttcgccga gagtattatg catatataag gttacatttg cggcccgagc aacataattt    172800
     cttattttga gaatttaatt tttataagat gaaataacaa gtatgtcgta tgcagcaaat    172860
     tatgtttctt ttcctgatgg acgggctttt ggtccccagt tcttggttgg gttttcctgg    172920
     tatctaacaa tttttagttt tcttaacttt tcaatgctac cactggtttc attaggtgca    172980
     aatgaaagtt tttcaccata taattggtcg taatgttctt tgttatcttc taggtatttc    173040
     aaaattctgt atccaatacc cttttccggc atatcttcta agtttctgcc ttgatagtcc    173100
     tctttgttct catgacattt tttcatcaca taccagattg catcccatgg agcattagtc    173160
     ttaattgtag atggttgagc atgagtcaga gagcattcaa atccaaggga acctaaccca    173220
     gcagcaatgg ttttcaaagc tggaacctgt agcttaatta atgaagataa tgtgttcgga    173280
     ctgaaataaa attgtgatcc gtcatgattc agttcgttct tggccaacgt tagcatacct    173340
     ttaattctct cctttgtgcc ataaacggta tctttctctt tgaatctttt ttcgttaatc    173400
     tttagtactt cctcaataaa ttcatggtta tgaagtggac ctgcgtacat tgggccagct    173460
     agaaggcttg ttccaccaca gaattgacac ttggagtcaa ttggtggtcc ttgagcaaca    173520
     gaaaatttgg taattgtctg ctgcttcttt tttctactct gtttatcaac tttccttccc    173580
     aatttttgat ttgcaaaaga accgcattga gaacaatggt atgtaatcat tgtgttagac    173640
     tgcagttctt tgaccttgat tgggcttgtc ttcactttaa caaaaacacg aacgtagaag    173700
     tcaatactca aggaaagcaa tggctcaacg tgctttttgt atttagcggc gctttgatta    173760
     agtaagttca acactaaacg caacgcactt tcatgtgtag catcatggga aaccatattg    173820
     acaccaccat aaagagcaaa gcacttctct gggtaaccat tacctgccag aacagagaga    173880
     tcagtgcatg tcactagcat taggccgtct tcttcaattg attgcaaagc ggcatcgata    173940
     aatggggtaa cagtaccata tggatcaaga tcaatcacat ggtacttctt attatcagac    174000
     ttgtttctgt acatcaggac attagcatca tcttggttag cagttacaat atcttgcacg    174060
     ccattgtaat caatattcct ttgaatggat ttcactgctg caggcagcag atcattggcg    174120
     atgatctctt tgacatgcgg gatctcctta gcatacctga tggctcttag tcctgtggcg    174180
     gacaaggctt ccagtatcgt gatgtatctg tgctcctcgt ccttgggatc cagtttacgt    174240
     ctcttggctt cgggttccga tgatgtcctc ttcctctggc ggtgactctt caacttactt    174300
     ccgtacagat gatcccacgc ctgtatgcaa gtgacactca ggtctctgtt gaactgctgg    174360
     atcgggttgt agaacacttc ctcttgctta gggaacagta tgtcggcttt accctcggta    174420
     acaatggtga aatcacttgg atcaacggcc actgctggca attgaccttt gaaaaggttg    174480
     ttgcgcacct tggaaaaggc agccttcaac atagcagaca tggttgcgac agtttgggtg    174540
     gctctggtct gaatcgctcg cagttggcca gcatactctc ttataaagag ctcatcgcag    174600
     caatttttca aatcccgatg cccttcgaag tttgcaaaaa attgaaaaat tttctataca    174660
     aggactcaca acttgtatgg ctaagtgtgt tggcatcggc agcatccgca gtatccgcag    174720
     ctacattggc acagcactgc attggcgctg gtacttaaac tactcgaacc cccaagagac    174780
     cacacttgaa ttgccagtgg tgcttactat ctaagcccgc cgcgccagac aactcgatgg    174840
     gaatcgcata tatagaacaa gttatttagt ggtagctatt aatttgtagt cagacgatat    174900
     ccattgtcta aatgaaaaat gactagacag caaaactgga tatgtgttgt gtccaacagt    174960
     cattttgtat tggttctctt tcttgcgtaa cgcgttgttt gaaatttcta ggaaattgaa    175020
     aagagtagta acaactatta aggattggga ggtagaactg gggtcaattg tatacttttt    175080
     gagttggcta cacgggtata aggaaccaga acagagttta tagagataca gcgatgccac    175140
     caaagggctg gagaaaggat gcgcaaggta actatcccac cacttcttat atgaaggagc    175200
     aagagaatgt gacgatgcag gatctgttat tccccaggag tgtgatcatg gcgctggcta    175260
     aggaagtacc tgagatgcag cagcaacagg tgcaggtgca ggcggcagag aaaggtgagc    175320
     ctgtggagaa gacgcccgcc aagaagctgg ttgtcaccaa ggatgcgtcg atggcgctgc    175380
     aacacagcgc cacagtgttt gtgaaccacc tgctgatgta cgccagagaa ctagccaagg    175440
     agcaagaccg ccgcagttgc aacgtcgacg atatactcaa tgctctggag cacatgggcc    175500
     acccgggctt gaaaccgctc gtcgccaaca gactagatga ctaccaggag gcgctagagt    175560
     ggaagaaaca actgaaagca cagctacaga tactgaacgg agaagccgag gaggagccca    175620
     acgagctggg cacatacgac cacgacaacg agacggacga tgaagaaata agagacgagc    175680
     ctgaaaagaa gctgaaagta gaaccctagt gcaaaataag cctatctcct ttaaggaaca    175740
     aggaaataac tgtataatag ctatagaact aatctgtaaa cacttataaa ggccactaca    175800
     caccttccat cgcaagtatg gcgttatttt aataatatgg cgttatactg acatagcgtt    175860
     ataagtcaca tgtctaacaa tgtcctcaaa attctatata taagaagcaa gaatgctagt    175920
     ctctagagca gagagggctt ggataatgtc cacagatggg tttgtcctcg caagaagttc    175980
     atgaaacaaa tattcagaag tcagtctggc tctttcaccc ccgcattccc ttttcaacgc    176040
     ttcacttttc ctttctgaat cccattggga attgctcatt ggaagggggg gtgttcgctg    176100
     ttgatgatta ttgcttgcag ctaaatttaa gggtcctatt agtgtgtaac aagttattag    176160
     cattacatcg actttcgaaa tccacagtat atatatcttc gaatcctgat ctctatatag    176220
     cgaacgtttg ccagaacagt tggcagcaat aaagaccgca gtgaagctga accagggaaa    176280
     aaccttatgg ctagctcaca atttcttttg aaaggatgta tggagctgtt ttaatggatt    176340
     cagatactag aaacaatgaa ggcaagagtg gcaggaggcg ggactctgtg tccacgacgc    176400
     ccaggatgtt cagcaccaat acggagcaga ctggagcgca gatcgacact gcccgggaga    176460
     agcattccaa gagctcgcag cccagggtgt tccacaggaa gtcgctgagt ggttgggact    176520
     tcatggagac tgtaggggct ggctctatgg gtaaagtgaa gctggctaag aataagaaca    176580
     gcaacgaggt ttgtgctata aagatagttc accgcgctac aaaagcgtat atgcacaagg    176640
     cgcagcagtt accaccacca gcagatgaga atgaggcaaa ggaaaggcag aagcggctga    176700
     ataaagagat atccagggat aagaggaccg ttagagaagc ttcattgggt caaatactgt    176760
     ttcatcccaa tgtttgtaag ctatacgaaa tgcaaacgct atctaatcat tactatatgt    176820
     tttttgaatt catatctgga ggacaactac tggattatat tattcagcat ggctccttga    176880
     aggagaatca tgccaggaaa gtttctagag gaatattaag cgctcttcag tacttgcatg    176940
     ctaataacat tgtgcatcgg gacttgaaga tagaaaatat catgctctcc aagacgggtg    177000
     aaattaaatt gattgacttt gggctctcta atatgtatga tcctaggaaa agtctgcaga    177060
     cattctgtgg ctcactttat tttgcagctc ccgagttatt gaaagcacat ccctatttgg    177120
     gaccagaggt tgatgtttgg tcttttgggg tagtattata tgtcttagta tgcgggaaag    177180
     ttccattcga tgacgaaaat tcaagtgcac ttcatgaaaa gatcaaaaag gggaaagtca    177240
     catatcctca gtttctatca attgatgtaa tctcattact ttcaaaaata ttggtggttg    177300
     atccacagaa gagggctact ttgcaacagg ttgtaaatca ccagtggatg ttgaaaggat    177360
     atgatttccc accacagtct tacctaccaa gaagggttcc tttaacagtg gatgatatta    177420
     acattgatgt aattaaggaa atgtacagat ttgaatttgt tgagagtatt gacgcagcat    177480
     acaaaactat tattgatata ataaccgagc ccgaatacaa acaattggct gatcaatatt    177540
     gggaattggc agacaagtca tctttctctg aagattcaaa gttttttaca gatgacttca    177600
     aagaccctac acaggcatat catccattga tttccttata ttacttaacc ttcgagaaga    177660
     tgcaacgtga tgcaaagaaa gagaataaag attggctatc taccaagagt tctgagataa    177720
     caaattctga tgttgggtta aacaaagaat ataaatttac tcccaagaag atggaaagca    177780
     ttcagaaaga gcctagccct tcggaacttt tagaggaaca gggcaacgtt acaccagaag    177840
     acatatctcc tcagatatca aatgataaag aacagtctcc cattgcaggt caaagtggct    177900
     caaaggctcc taggtcaagt attaaggctt taacaaacag agcagatcaa tcagcgcaag    177960
     ttggaaaaaa tgcaggtatt agtccaaaac cttcggtaga aaacacagaa aaatcaggat    178020
     ttacaaacat attcaggaga ttttcccaac ggcaccaacg tccatctaat attaataata    178080
     gcattgccag caagaacaat aatattcgca cacacactag agctgtatca gattatatgt    178140
     cagttgctcc aaatgaactt caaaagccag tggaaattgt cagtcaaaac ttaccagatc    178200
     tacctacaga tgcaaaattg attatagaaa agactaggaa tagctcaaag aataagagcg    178260
     acgaaaatga aaccttacaa ccagtgccac acgccaaggg gaaaaaactg catccaactg    178320
     caagagctaa atctgttggt catgctagaa gagaatctct aaatttcaca aggcccgctg    178380
     tggttccacc aaatatggct gatatagaag aagtggttga tacaggattt ctgcaaacgc    178440
     cagatgaaga aaaattggtt aaagataaag catttggaga agctttatct aatacaatcg    178500
     ttgaagatct aacagatgat gagattttaa aggaggcatc aaaggctcca ccggggagca    178560
     tgccatctat tgattatcca cgtaccttat ttttgaaagg attcttttct gtccaaacta    178620
     cttcctctaa accactccca attgtacgtt ataagattat ttcagtactt aaaaaacaca    178680
     acatagaatt cgttgaagtt aagggcggtt ttgtatgttc taaatcccct acagttacca    178740
     ttttgaatac caaaacagct cctgaaaagg ttgatgttta cagcggatat gataatgatg    178800
     atacacctga ctggtcttct caacagtcac ctaaaagtat gaatgacgct cggttagtat    178860
     tttctgactt ggataagagt tctaatcctc atttgactga gggacattca aactcttctt    178920
     tgaatgactt tgaaaatgat aatttatcag ttggaggaaa aggtgattat ttagataata    178980
     ttcagggtcc gagggcgaag gttatggata gggcgcctat taaatttgaa attcatattg    179040
     tgcgtgtcag aattgtgggc ttggctggta tacattttaa aaaactctca ggtaatacat    179100
     ggatgtataa ggaactggct actagaattt tacatgattt gaaactctga tatgtacttt    179160
     tctaatgata actaatgatt catttgagta cattacaaat gagttcggcg ttaaattact    179220
     tttctgctgg tcaggaaagg aaatcgtcaa gtaattaggt atgttagatt gttatgtatg    179280
     tttattatta tccctttcat aataaagaac tcgttgagcg tcactatgta gagtataaag    179340
     tgtatttgta cggaatgtat ttaaaccagt attgcagcct aacatacagt cagtagagta    179400
     gcttaggagt ttaataattt ttcgagcttt tcattggcct ctaataaccc tttgatatca    179460
     ttcattacta ggcctaagag tttatacttt ggtattcttt tatccaaatt tggatgtggg    179520
     gtttctatta atttgattag atcatcaaaa gcattttttg aatgggttct tctgagtttt    179580
     tccaatctaa catgcttcca ttttcgtact tttgccatat cgtgtctaat atcagcgggt    179640
     atatcatcat ctgatattac aatacctggg agctcaatat tttttgtagg ataatccttc    179700
     ggtactggta ttttttttat tttatggttt gttgtaagat ccgtattttt atagtcttct    179760
     ctattatgga caatgtcaga tgagtttgaa tttttatgca gggttgaatt aattctattt    179820
     tgtgtcacat caatagaaga attgcatttg ttattattta taatttcagc gctgagaatg    179880
     ttgcccttgt tattcatatc ctcatgcaca gctgctttgt catttccaat tttgaaatct    179940
     atatcatttt tatcattgtg gaaaggatca gatgcgacca ggttatctaa gaagttctct    180000
     atcgcatgtg attcatatga acttagtaat tctggacttt taaagtgatc atctaatcct    180060
     ttctgaggaa aaccgaaatt gttatgtagc ttttcctgga tcattggtgg tattccaata    180120
     ttttgatgat tttcgaaagg ctgagaagta aatattggtg atcttgttag aaagttttgg    180180
     ctgatcgtag gaagatgtgg actttcggtt agaagtcttt gtgggctggt caatttcgat    180240
     tcgtaaaaat gaggtaaaac actaccctca aatccagtat gtttactcct aatgccatcg    180300
     aaattataat aggacttttg attgttactt atcccatggt tcgtagtatg tccatccaag    180360
     ctgaacattg actttgtatg attatccggt gaaaaaagaa tattattatc gtgaggtgtt    180420
     ttgattaggt ttgtattggc gtattcataa ggtgttgtgt tactcataac attaggtgtt    180480
     gcaggtttaa taggatctaa aggaggtaag atatttgcaa taggagtact tacttcttgc    180540
     tgtcttggac ccttgtgcat aaattgtaat ggttctgatt cttctaatgt accgcttaac    180600
     atctgatatg ctgtctcaaa gtcaatatca ttaccctgtt cgaaaagatc aaatagatcc    180660
     tgactagaag aaactccaga tttctgatga tcctgcatca tttggttcgt gtattaaatt    180720
     aagcactcac aaagggactt aattagtcat ttaaattctg ccgttcttga actagaaaac    180780
     tattctcact agttctctgt tctgttctag ttggtagtac ttgtcggtca caattgatag    180840
     ttttggtagc caatgaataa ggttttaact aataagctaa caatgtacca attgcctatc    180900
     gacctgatcc ctaactttat tagcgaaata tacgtaatta tggctgcttg acgcaccgac    180960
     aaccctcctg ttcccttcgc taacagcacc gataacttgt tatctgatgt attgttagtt    181020
     atatatacgg atatcgatat cttaattgtt caatcctgta tcattcaacc attcaagtct    181080
     tgcgatcaac catataaatt cacatgtgag tgtaatttct ccctttgttt gttagcagca    181140
     tttccaattt tttttttttt tgcaactttt ttttcagacg ggcgatagct taggctcatc    181200
     gcaaatgcac gatcacatgt gaaaagttag catatttagt agtccgttgc tgtaaagaat    181260
     ccaagtcaaa gtaatcgaac tcttttcctc aggaacagaa tatgacaatg ctccatgggt    181320
     cattcttttg caattgttga gaaattggga ttagacaatt gttgtaattt tctgcatgtt    181380
     aatgagagtc acctttggat gactgttagt cagccaagaa tgttgtcaac tgagaagcaa    181440
     agtcggatgg gttatccagg aataagttgt ggccggcgtt tggtatatct atatattttg    181500
     tttcaccgtt gaatatctgg gtcatgagct ttccaccgtt tttattcatc cagtcgtact    181560
     ggccatacat catgattaat ttcgggactt gtagttgcga tacatggtca agcaatggat    181620
     cccttgctag taaggaactt gtcaataatg aagtaaaaat ttgggaagtc tgttctggta    181680
     agcctcccct tccatagaat gtctcgaagg tgtagtcttt gtaatcaatt gaaggtactc    181740
     tggcgtatgc agaccggatg tagttccaac atagctttgc acctataggg cctaaccacc    181800
     ttagtggttt cagttgtttc tggaaaagat agtcgttgag cttgaatttt ctatcataaa    181860
     acatagagtt acaatcgttc cattcccttt tgtaaattgt tctgctatgg aactcattgt    181920
     taattgaata aatatttctc tcaacaccaa gaggagagat caatcctaag gtgttgatat    181980
     tagcagggta ttttagtgca taattgaaag ataaataacc gccataagaa tgagcaacca    182040
     cgttaatctt gcctagctta ttatcaagcc tccattgctc gattcggtcg acataatagt    182100
     caagcaattt ctgtaatacg taccggtgat gagcagaatc aataacataa ggcagctgaa    182160
     actcgttgcc atcatcaata ttttctatct ttaatggtaa tggtttacta acttctaaat    182220
     caagagaagg tgtaaatgac aaaccattcc ctggtagatc aatggtatac aagtccttga    182280
     tgtctctgtt caagtatggt atgcttctaa agaaggctgt tgaagttgca gcataaccat    182340
     gtataagcac tgttggtgtc ctgacctttt ttgctaaatt gttgtggaaa tgccactgat    182400
     tgatctcatc gaagagaatt ttgttgctgc tatgtcctgc aatttcaata tcgcccatga    182460
     tgcgactctg tagcatcttt agcttgtcaa aagtctcctt cttggtcttg aacaaatgac    182520
     ctgcccaaag cttccatccc gatcttgctt cattgttatc agtgctattg gcaggtttaa    182580
     gtattctgga aatcaccctg gtttcaaggt tcttttgttg ctggcacagt ctcaaatagc    182640
     tactgaagtg cctgacctgc gaactatttc taaccattgt acattaatct tggtgtctag    182700
     tctcttttat ggactaataa atattattga gatgtttttg ttgtctcacg tctatttgaa    182760
     tttcgatgta gaagtcaatt taaaggcttt ttgcaaagta atttgtctta aaagatcgat    182820
     cgatgactac atcaagccat tcacaattgt aagtactaaa cagcacaatg ccaatatatg    182880
     gccaatttaa gagatgttgt tatttctagt atttatcttg gtggtttccc aggtggtgtt    182940
     gcttcttttg tctccccagt ttagagacaa gtttatattc agatggtact atgatgaagt    183000
     gtacaagccc atgatactgg acaatagcag gtatcgaatc aagttttatg ttgttcctgt    183060
     cttttacctg tctgtttaca gttatatggt gtacattttt tactcaagaa cattcgcaat    183120
     tattagtcca atgctgacat caattgaaac atatgtggta ataccattaa tgctgatttt    183180
     accgctcttt tttggatcca tgtcaatgat aataaagcca gattcatcga atgcccatca    183240
     aattggaagt gagaaaagat atccatacga taacttatta tacttcccac aacatgaatg    183300
     ccgaacttgc aaacaggtga aacctgccag gtcaaaacat tgtacagtat gtaatagttg    183360
     catatacctg gcagatcatc attgtgtatg gattaataat tgtgttggta tggggaacta    183420
     catgtacttt tactcattcc tgtgttcaaa tcttttgctt ttgagttaca gtttcattag    183480
     actcatattt attcaattta acaagtctgc ttacaacaca acacccactg gggagaaatc    183540
     tttgctgata ttatcaattt tatgtggctc atttactgta atactggctg tatactgtta    183600
     tttcgtgttt gaattagtga atagtggcat gactaccaat gaaaaggata agtggcagat    183660
     ggtccatgat tatataaata ccggagactt agtgagggac ccagaaggaa aatacttcat    183720
     taaataccaa aatggtggaa ataattatga gttttacagt acggattctt atgatggcac    183780
     tcagtataca attgtcgatt actttacagt gaagtcacca gcggaaatca cgaatattta    183840
     cgataagggc aacttcatta ataatctgag agagttcatc gggtagttct tcccatttat    183900
     atagttattt acaggtatct actatttatg catctaatca acttctcgat tatcatgatt    183960
     caattatttg ctaaggcagg gaatgtcatc tcatcgcttt cgcttaaaga atcgagaaat    184020
     aaagagcaaa tacctgttat aagttcagaa ttcagcaaag aggtgtgttt tgcctaagtg    184080
     agagcagatt tgccgatagt atagcatata attaacgcat ttggatactt acgagtatag    184140
     tactcgtgtt cacaattgtg aagcatagta ctcaatacaa acttggagca acaaaagtcc    184200
     ccattaaaga agcagaaata tcgaccgcac gcacaagtat tttaaaacta gatggtagta    184260
     ctaagtggag aagacctcca tgattcttct acctttggta aatcactgtc tttacgagtt    184320
     gatggtggat ttaacgctgt ctcaattaac ccatctggta gggatgtggt tcttgccggg    184380
     aggaaaggtc tatttataat cgatttagat gatccctttt caccaccgag gttattacaa    184440
     catgtaactc catggcaagt ggcagatgtg cagtggtcac ctcatcccgc taaaccgttc    184500
     tgggttgttt ctacttctaa tcagaaggca ttgatatgga acttggcaag gccgtcaact    184560
     gacgctattg agcatgtact gcacagtcat tcaagagcaa taacggatat aaatttcaat    184620
     ttccagcatc ccgatatatt ggcaacttgc tcaattgata catatgtcca cgcatgggat    184680
     ctaagaagca catcgcgccc gttttacacc accagtgcat ggagatctgg agcatcgcaa    184740
     gtcaaatgga atcatatgaa ctcaaatata ttagcctcgt ctcatggtaa tgaattattt    184800
     atatgggata taaggaaagg atgtataccg cttaaaaagc tagatgctag tagtagcatc    184860
     aataatattg atttcaatag atttaatgaa actgaaataa tgaccagtgg aaataatggt    184920
     gaagtaagaa tttgggatta ttctaaatct gagggaagtg aatgccaacg agtcattaac    184980
     actgactttc cagtttggag aagcaggtat ctgccatttg gacgtggttt ttgtgtaatg    185040
     cctatggttg gtggtaataa taccgtttat atgatgaatt tagatacaga agaatcagaa    185100
     gactctcata agtcaaaatt gcagcctatt tatacattta aaggtcatac ggatagagtg    185160
     actgattttt tatggcggtc acgatataca gaagataatg gtatggaata tcaactagtt    185220
     acttggtcaa tcgatcgtga tctgcgccta tggacagtta atgacactgt atatgaaaaa    185280
     ttaggttacg atcgtaaatt gaacagaaac actgtcatta acgaatacaa atatcaaagc    185340
     tataacaagg tcatctcgcc tgcacatgaa accggtaagg gttattatga taggataaaa    185400
     gagaactttg tctcaaagtc aggacttcgt aaagataata actttagtca tctaacttgg    185460
     ttgtctggta ttaggttgaa tcaaaatggg ccatctgagg acctatttgt tgcacataaa    185520
     ttacagagtc ttggtgaaga agttagtgcg ataggacata aattcccaaa gattgtcttc    185580
     gaaaggatat tggtttctga gagagagatt actgtgacta tgagtgggcc atggtcagag    185640
     gatgacccag aggaatacat atttctaagg ataacagtaa attttccact gggatatccc    185700
     gatgccggaa actcgcccac cttcactgtc gaagaaaatc ctaaactaaa gcccacaatg    185760
     aaatcaaaac tattagatgg actgtctaat atagccaaaa tatacaccga caaaagcata    185820
     tactgtttgg aaccttgttt tcgttatgtg ttaggtgaag atgtgaatct tcaagagata    185880
     gagcaagatg aagaaccgct acttaatttc gaaatagcag accatcttga ttttgatgga    185940
     tttgagaatg agaagtcaac tgatatcgac tcaaactact tggatgagag ctcctcggag    186000
     tctgatattg cggattattc tgatgatcta gaccctttgg ctggtccaaa gaaagtcttc    186060
     caacataatg ttaaatttga cagtacacct gtacctaatc aatgtggagc agtatggaca    186120
     tcttctggac aactactatg ttttttcgct tctgaaggaa caccagaaaa gaagcagcaa    186180
     aacttgatga aatatatgca gagagatata attaggcatc ataaggtttc ggattattcc    186240
     ctaaataagg cacctcccaa aggattgaga ttgctgaaac aatccaccca agatacagaa    186300
     tctgccaaag atgatagtag cttgaaatta gatgtagatt cacaaaataa ttcagatgat    186360
     tcttatgata gttttgaaga tgattgggat gacatcttaa ggaatgatat tgttgtcaga    186420
     aataaatttc ctgttttaca aacctccttt cctaaagcat ttaattcatt gcattcggaa    186480
     tcggctaaaa cagcagaatc cataaaagtg aataagaatc ttatatcact tgttgatttc    186540
     aattacttga ttccagataa aagagagctt gcgctagaat atagggtgat ggatgcccta    186600
     cctgaagaac tagcaagaca aaacgcatta attgctgaaa aatatggttt cgaagacatc    186660
     actcattgtt ggcaaatatt gtctgatttt cttttatctc aagagactga tgatccttac    186720
     acatttattt gggataatga tcccatgaca attaaatggt ttgtaaagga agcagtatca    186780
     tattttgaga aatgtaaaaa tgtgcaaatg ttggcaatga tatattgtat tatttgtaac    186840
     aaaagaatgc aacgaatgag aaaaagaagt caagaagagc gaatagagga tgctggaaat    186900
     gccttaggtg taatatcata tgaagcagtt agaaatggag ataaaatgaa tggcaataca    186960
     tcaaggtcga ttagtagctc tggttttaca aggaattcaa atgatagaat gccaattaaa    187020
     aaactacatt ctcctgatgt ttcttctatt agttcaggtg actattttat tcataatcat    187080
     aattggaaca gaaataggct gccggacaca aattcgccat tatctaatcg acagctcaat    187140
     aataatggag tagatagcag cgcaataaca acgtttttac cagaaattac aattcagctt    187200
     attgatgatg atgttttaga ggcagttaat gatcctctct ataatttctt cgatgaggct    187260
     gaggagagaa aattgaagca ttatgttttg cagtattctt ctcttttgta ccagtggaat    187320
     ttgcctattg agagagttaa ggttttgaaa gccagtacaa ttaaaaagga agaagatcgt    187380
     tatctaacaa attatactga ggaagttggt atagagtggg taagaaatga ttgtggtagg    187440
     gaagggctaa atagatgtac gtactgtcat ctaaaagcgc aatacagcat atttgtgtgt    187500
     ggtaactgtc aacatgtttt gcatttgaaa tgttcaaaag aatggtggaa cgtgtctaag    187560
     gaatgtccaa caggttgtgg gtgtaactgt ccaaatatgt tcgatgtagg ttaattttga    187620
     tcaattgcta tatgttggtt ttagcaatca caaaaacaaa cctaggggat cttattcaat    187680
     agttgggatg tacgacttta ttgaagctac ggttccagta ttgcaaactt gattttcgtc    187740
     tcaatatttg aatacaaaat atttaattaa gcatatatga ctacatatac atgttgaatc    187800
     acacaggatt tggaagtatt attacattaa aaacttatta gaagttttac ctattgatta    187860
     tcttttcaat gccattagag aggcaatgaa agtcaggatc aatcttgaac gaacttcgtt    187920
     tatatcttca ggtaccagcc agattagagc acccaatttt ctagcaatag aaatggcaag    187980
     tctggcattt gcatacttct cctcatcact atttccaggt gcaacaagat cgtagttcac    188040
     ataacctggt gcaataccat ttaatacatc caataggaag tgagcatttg atagggaatc    188100
     gtctttgaaa gatctaacat cagaagactt accacctttg gccacttgtt ccttggccca    188160
     ttttagtatt tcactgtcac taatatcttt accgcttgat gataatgttt gcatagtgtt    188220
     gacaatattt ctacgcatta attgccagac caaacctaaa gttaatagtt tagaaccatc    188280
     gacaatgtca gcaccctcaa taccaaccag tgaaaatcct ttagctttcc ctaattcaac    188340
     tgcatagttt gtgttttcta gtgccttgaa tcttgatagc tcgctgccat tcgcaggtct    188400
     ttggtttatg tgctttttat cgacggatcc aggcataacc atatcatagg cctgtaatag    188460
     gaccagacca tctttcaaat cttcaaataa tgaaacaact ggtggatcaa catctaagga    188520
     gttcaaccaa agagtgaata ctctggcctc tctttctcct tcagcatcaa aatcctcaat    188580
     ttctggagcc tcagtttctt caataggatc taaccctgga tgagtgttaa acaaatgtgc    188640
     aacaaaggcc agatttagct tagggttacc ggcaaccaat gaacttggtg tcaaatactt    188700
     tctacagcct agcttatcgg cgttatctaa aacttgttca gctctctgta gcagatcgtt    188760
     agtttgcaaa ggagctcttg agcataactc tggggccaat tggttcaata agacggtata    188820
     gttttgacca tcagaaacat cttgcgaaaa gttggatacc cttctttccc aattagcctg    188880
     tttcaaatgg tagttgaacc aacgtaatag aatttgctct ggaggtaatc ttaggaattg    188940
     ttccaaagtc tcatcttctt ccagtagtct atatagttct gggtgaagtt tgatgtcaat    189000
     tttacttaac aaacctcttc ttataatttg ccagataagg cctagaatca aatgctcctt    189060
     accatcgata atatcctctg aatgaacatt aacaacaacg cagccgatag ctttagcgga    189120
     attgatgacg atatttgcat tttcactggc ttggaaattg tttagttttt ttcctgcttt    189180
     tggccaattt aagactctgg tatcgatagt atctggaaca gaatcattaa tcaacttgga    189240
     tagtactaga ccatctctac attcatcaaa taattggaat gtatcggttg ggaagggcaa    189300
     taagtggcca atatcagcgt caccagcaag gacactattg atatgctttg taaattcacg    189360
     cctttcttct tcattaatgg tatgggtggt accagtagta gaaccaccaa caatgatcct    189420
     gccgtgggct gcagatccct tatgttgtag tccactatta cctaagccag cagttggtgc    189480
     agaagtttct accgtatcta cgttgaagct ggtttgtgga ggagcagctg ttttcgattc    189540
     ctttagcttg gcaatcagtt caacatagtc ctccaattca acgtgccctg aagcgtcaac    189600
     attcacatgc ttcaaagttt ctctagcttc gtcataggta gcctcaccat cctttgcaac    189660
     tgcctctagc acttgttgtt tctccaccca ccccttgtca tccagatcaa tagccctgaa    189720
     cttctcgatg gtggcaaaca tatcttcctg agtcaaatca gggaactttc tttgcaatct    189780
     gacaatattc atatctgact tatatctgct atcaataacc ttctctctag taactagttg    189840
     cagcaactat attcgctttt tactcaacgt ctagataacc tagtttgttc gttcaagtgt    189900
     ctttgagaac gtctattttt gcttctccca attgacacac acaacaatat agatcaatcc    189960
     agtaattgcc ttaatacctg gtaatagaaa caaccaaaaa cgaccgaata taaattctta    190020
     taatacctaa ttaggcccga aatgagctcc tttttatact catccccttt gtcttccctt    190080
     caaaaatttg tctctttttt cggtgtgaaa gcctcctata cgtccaatgt gatgataata    190140
     ccataacgac ttctgaagtt attcactagt ttcccatgac ttatatgtag tgtatttgac    190200
     taccaagcag tgtacctgga aaatactctg tggattggga gtagttatta atagagcttg    190260
     attggtgtac tgtttcttgg cttttgatgg gagaagtgaa caaaaattag gtaaccttca    190320
     atagtggccg gattaacgat ttctcaacaa tttctccagg tattttactc tttcttcaag    190380
     caaacgaact gtgttctcta attgatctat tctggcatct gggctggttt ttaccggcat    190440
     tggagccttt ctttctcttg aaatatgctt gtttgcgttg gtcatggatt cgttactgtc    190500
     gcggcttggc gttctggagc tagattgaga agagcctggt ctaggttgag agggcacttg    190560
     gaatcgcaca cgcttctcat tgtttttgtt ctctccttct tcttcttgtc ttagcctctc    190620
     agttagattc cttttcttga ttgtagttgc tgttgatggt acagaccgca cgggagaagc    190680
     tctaatattt ctcattcttg aaagtattct actagacgac ccatcaccac cagttctctt    190740
     ttcattgctg aaagttatct tggtgggtga gattgggatc ataaatgtgc ttgttgtggg    190800
     attcccaaca cttcttggta tccctggttt caccttattg acgggagtgg cactgacaat    190860
     atccttggga tcaaactggg gtctgtccaa gctctgtgta aaagaacggt ccttcagaaa    190920
     actcggcgac tgcagcctct tcggagtctc gtggatcgcc gtagtcagag gcgcattgtt    190980
     actcttcttc ggtgatatcc tgctggcagg tttccaaaca acactatccc tcttgtttga    191040
     gcttctcttc tgcggagata tgctcaacct atcgaacaca ttcctagtat cccttccctg    191100
     gacaacattt ccaatatcgc tcagtggtct gtccatcttt cgtagaattt taagcccctc    191160
     actgtgtttg ggtatatcag gactactata caccaggtct acaaagtact ttaaagcaac    191220
     tgatattcat atacagttca ttatcacacc caacccgagt tctgactatg tttgtttaca    191280
     tctcggaatt tcctgatctg aattttttgc gatgagatga cttctgagta ggacttagcc    191340
     agcttgtgta ggagcagtca actgtattat taggttttac tgttccataa tagtattaat    191400
     taatattgtt atatagatgt tataatcata aagagctata tttttatatg ttgtgtttgt    191460
     caatatcttc agactggtgt tatattctaa attccatttt ttttatattt tggtagaata    191520
     attacatata cttgtgtttg cagttataaa cctcttgaat ttctataata ccacaaatgc    191580
     tttctattac ttgatatgga atatttacat attataattt atcttattct attaattttt    191640
     tttaccacaa tattaggtgt ttaataattt ataccaaccg gactagtgta caatgctttt    191700
     tttagttaca gtttttttta ttacttcaaa ttcagttatt cggagtcttc tttgaagtct    191760
     ttattttgat cctgcttctc aggatcctct tcttgttgcc tcttgatatc ctctggtttt    191820
     ctaatgtcaa cttttttgtt ggagacgaac actacacata cgactacaac ggcgaacata    191880
     ccgagggcca tgtagaaaac attaatgatg gaatcactga tgatgttacc gatagctgat    191940
     gtaggcccgt caaagtactc tctcctggca atgattaggt tgttggcgct agtctcgtag    192000
     ccaccaggta ggctgacatg tcttttcttc atcaaattaa tcgcagatgc actgaacacc    192060
     gtgtcacata gaacagcgcc ataagcttgg ccgatgttct tgatgaatgc gttcagcgtt    192120
     gtcacagcaa taaaatcata tctgtacgtt ggtgaggact tatctagtaa aatctgaaca    192180
     ccaataatac tactttgcat aatggcaccg aatgtcacac ctggcagaat tagtagacca    192240
     atctttttag cgctagaggc atgattgtct aataatgtca aaagacctgc accaatgata    192300
     cctgtgacac cactaaagat agcaattggc ttgacatatc ctgtcttact gttgacaata    192360
     ccacttgaaa caacggtaat aaccacagga accacagtag caataagatg aatggcagct    192420
     ttccatgcag tgtcattgaa aaccaattgg aagtattgaa taatgtagtt tgtctggatg    192480
     gaaaacgcac aggctacaaa aaatactgca atgttgaaca accagacacc tggtttctta    192540
     cagatattcc aggacatcag tggctggtaa tgtggcacag tcttcacagc ttcaaatttt    192600
     gggtaaataa agaagtcgta gacgaaggcg cccaaggtga acagaatacc taacacgaac    192660
     attgagattg ttgagccgga gttccattta tatttattac caccaaatgt gaatgctaac    192720
     aggatcagga cagatcctag tgtcatgaac acaaactcca caatatcgaa tctgtaaaac    192780
     aattcgcggg ctatgattct ccaagtccca gggtatctta atttagccaa ttgaacacca    192840
     acagacttga caaacctcac ggcttggcca cctaagatac tcaataatcc caatctgccg    192900
     tttccgacaa cctcatcttc agcggtgtct ttgttgacta cccatttctc cgggttgtag    192960
     aaagtcagaa acaagaagaa ggccagacca ccaacaggca gattaatgta aaaacaccac    193020
     ctccaagtca catgcgttgt gaaagcacca ccgaggaatg ggccgaccac tgaggcaata    193080
     ccgaacgaac tgctcataac cgcgatgatg agacctctgt ttctctcttc cacaagagtc    193140
     gaggaaatga cgaacaccag tgactgcaca ccactcccac cgatacctgc aatgactctt    193200
     ccaccgataa gcatgtccat agagttagct agcgccgaca ccaaggagcc gacttcaaaa    193260
     ataacaatag ccgccagcgt ggaagtcttg aacccaacca aagtagcgat cctaccccag    193320
     atcaggacca gcagtgcatt tggcagagag taaccagtga acagccaccc gaccttagag    193380
     tagtccccga acttctgtga cacttcctcg ataatcgtcg acacggtcat cacatccaaa    193440
     gcggctagga acaggcacag caccagcgac cccagcggcg cccacaattc cacaccagtg    193500
     gggaaccttt gaccaaaggc attagtgcgc actggctcct ccttcacaga ccctgtggac    193560
     accgaactcg catcgccgcg agtatccgca ataacactat ctttatccat tgctagttat    193620
     ctgatctgtt ttcctggagg gtcctctctt cccccaatcg cagatattta aggaatgcat    193680
     atgagcttta tatactctac aaaactccca tcacaactgc tattacacct taaagcgtaa    193740
     atcagccgtt tatgtaagac aagcaatgta attaaacaaa ccgcgcaagt gtctgtgagg    193800
     tttatagaaa gtaatgtgtc aaaacagagc aaaacccagg cttgtacggg ctgttgtcag    193860
     tggagtacct acacaaagca aagaattact gtcggactgc aatggaggaa gcccgcgcac    193920
     cagagagaca acggccgtcg ccatgctgat ctcttgccct ccgcgtctac ttctgcgcag    193980
     agaatttacc ttagtagaaa gggctctttg ctgtgctccc ctctgcgcgt cttctctagg    194040
     gatgtcacat gaacaatgga tgggaaaagg aaactcgcat cgcgtgcata tcgggcgaag    194100
     ttaccctgat atccgcggcc gacggaactt ttagtccgtg ggccgtgtgg ctacaggaac    194160
     cgccgcaggg aattttgaaa atgcgcggag gatctacact tttacattta agggttaggt    194220
     ctaggtttag ggctaggttc aggactaggt tcagggctag gtttagggct aggttatttt    194280
     aggtttgttg tataggtgaa aagggatttt agggtaaggg ctttcattta gggttttgtt    194340
     ttgtgtgtac taatcataac tctgtggtgc taaagctgga agtacattag actttgtata    194400
     atgactggca ttgattaggc ggggcaacgt tcaggacaga agtgaaacga aaagatatag    194460
     atggatgtgc gcgaggctat acagcaggag gctggcgcag agactgggtt cgctagtgtg    194520
     acgttcaatc aggatgagag ttgttttagt tgtgccaatg agcaagggtt tctggtgtac    194580
     aacacgtttc ccttgtcgct gaagctgacg aaggagttca aacagacgcc tgagcgcgga    194640
     gctgggatcg ggtactcaca gatgctgtac agaaccaact acattgcgtt ggtaggcggc    194700
     ggacagcggc cgaggtactc gctgaacagg gtggtgatat gggatgatct ccaacagaag    194760
     gagagctttt cgctcaagtt catgtcaatt gtacgtaagg tggttctctc ccgtgtgcat    194820
     cttgtagtgg cgttggagaa tgagctgttc atctatagtt tccactcgac gccgaagttg    194880
     ctctgcccgc ccatcaagac agctcctttc gggccattcg atttcaaagt agtcactata    194940
     gaggggaaag caacggacca ggccaaggta acaagcctac ttgcgtatcc ttcggccaag    195000
     ctgactgggc agttgcatgt agctgatctc tctaagctga ggagcaatca gaataataac    195060
     caggacatgg cactgacctc ggaaagtttc ctacccacaa ctattataaa agcacacaaa    195120
     gcacctatac gaaatgtaag aatcaataac caaggaacca tggttgctac tgcatcgaga    195180
     aaaggtactc tgattagaat cttcagcact cataatggta tcctgttgaa agaattcaga    195240
     agaggattgg atagagcaga aatatacgac atgtgcttca gcccactggg gacacgactg    195300
     gctgttgtct cagacaagca aactctgcat gtttttcaaa tagctccgat ggcagaaggg    195360
     acactgaatc ctgcgaatcc tgaagatcac caatccagcg gtagcaacgg tcatattaag    195420
     gctaacacta accaagtaca tagtctaagg aacatagttc caacgtcctg gaaaccaaaa    195480
     tacctggact ccgtttggtc tatgtgcaaa gtgcacctac gaaaccccaa actacgaaat    195540
     aatgttaacg accttgcatt taatgaggat agatgcacca tcgcttggtg tcgacaaaac    195600
     agaagccata cctttaagaa cgggaatcat tttaatgaaa acgaggagaa caaattggta    195660
     ttggtatgga aaaattcaag aatctgggag aagtacgtca tacttgagaa agaagctccg    195720
     aattcaaatg atggaataaa aggtccttcc ccattaacgg aatgggaatt ggtaagagaa    195780
     tcatggagag aactttgatc gaacttcaac tacacaattt gagtatctac ctatatatac    195840
     tatatatatc aatctaatca cggtcaatgt aatattaaga atataatatt cgtaacacaa    195900
     accttctact atgctgtgct ctttccaaaa taataataaa aacaacgtat atactattta    195960
     catcccattt agcgtttcga ctaaaatctt atttacatcc gggtttgttt catcataaac    196020
     atagccgtgg tagttttttt taaattgttt acaatcttcc tgcgtgttaa accgtataaa    196080
     tttgaaggtt ttggataagt ctctattcca gtacatatca aatgaatgca caatatcgta    196140
     gaaagaaaaa taaggctcca actgtttgct ttccatcggc atattccata caacagcgca    196200
     ttttttctct atctcatgta ttctctctat taggcagctc agctgtggtt catctgatat    196260
     tgtttcctgg gtcatttcct tattgaccac atcaaagtac tgtttccgat ccaagtaagc    196320
     ggcctctaag ttccgacagt atttccggta gattagctca tgacgctcac ccaaatatga    196380
     actatgttca tcctttcctt ccaccaatgg cctccatcgt acccttaccc tgtttatcgt    196440
     tgagtcctta gtgatattaa gatagtcccg tagatcaata tttctattaa acaataacag    196500
     atattggtcc ttaaacgtga agtatttggg atcccgccgc ttcaacagat caaacttgat    196560
     agtttgtggt gttgacgtca tgctcatctg tcgttgtgta acaagtttgg caaaatcagc    196620
     atacgtcaac gatggatcat agctatcata cgccaatgcc agcaccccgg gatgcccaac    196680
     tacagaggcc ttctcctgct tcaacagttt ctcaccaact ttccttatat tcgtcccatt    196740
     aacacctttc aacactgatt caatcagttg cttatggctc gtcattccga tagtatacgc    196800
     accacactga atgagttatc ccgcaaaaga aaaacagcta acaataccaa atgtagccaa    196860
     atgtgtagca cttgctgtac acaccgttca cttggcacag atacccggta agtatactgc    196920
     tagttgacca ctatgttatc ctaagttgag aagcccattg aacagcacaa tatactctct    196980
     aagtttaccc gcagttcacg tacctaatga cacatgggca gggaactggc agtattggca    197040
     gtatataagg ctcgctgaaa aaaaattctt tcaattcctt gtttctctca atattggttc    197100
     attcgtggtt atttcttttg aacatatggg gtcgaggggc ctgctacttg ggcctgtgtt    197160
     gaatctttag tgcctcttaa aacgggcggt agaggggata tgcaggcttg ggtgccggcg    197220
     gtacgacttc cggttctaac cattgcgagg cggaccgtat ttaatacgtc ttttcttctc    197280
     cctcaccaag tcatatgctt ttcctgtcct tcattggaga gggaaacgtg tgacaatggt    197340
     ggggaatcag gggggaaagg agaggtatgg gatttatgtg gacgatcaac atcgagaagg    197400
     ccacccgcat gcggtggcta acttatatcg aacatggttc ttgcctttta ccagaaccat    197460
     ccgggtgttg tctccatttt ctctaaaaca ggtagcgctg tccttgggct tcgtccttgt    197520
     cctccgaact ggaaacttcc ctcctaactt tttggaacct cttctctttt tgaacttaga    197580
     ctgtttcttc acagaaactg ctgggctaaa accttttttc aaattaaata tcaactacgc    197640
     tctctgatag ctaatatcag agaaccacct ctctcctgtg aatgagacca ttcacagcgc    197700
     gtagtggttt agtgcacaaa atctgtatat agaggtgatg tatgtacata cgcagcatcg    197760
     aaagtagaat gtgtatcgcc cacggatact tcggtgatga agttttggta tattgccttt    197820
     ccttacgcaa caaaaatatc cctggggtac tctccagcgt ggcagcaagc gtagcagcaa    197880
     gcgtagcagc aagcgtagca gcgaggatag cagaaaccga tgttcgcaac tacatggaag    197940
     aatgcataca cacatcacaa gagaaacgcg acacgtaaaa cacgtctctt ctatacttct    198000
     tggttgaact gatcctagtt tcttactgaa acacccgcac aagtcaaaaa attccaacaa    198060
     ataatttgtt atttttttcg cgtcgcactt tcttcataga gcacttctct actggcagta    198120
     tactacttcc atatacactt gccaagcaac ttcaacttct atgctgccgg tagttttggc    198180
     gatgcattgt gttcttcgat gctacagcca ctgagttatt ttattccatt caagtgctca    198240
     ctactttgaa gtagtccctt tgatggtaac ggtgcctaac ctttgccctc cacataaact    198300
     aatagatttt tggcgtttta cgtctgctag agcccataaa caattgctag ccatgagaaa    198360
     agtataaaaa tagaaaggca ttactagctg atttgcactt ttttgcttct cttgaatcag    198420
     gccaaggttg gaagaaacct ttcgagtgtt tgaacggttc cgaacaacaa ttgaacaaat    198480
     aaacaataag gcaaaccgaa aaccacgcat tattgtacca ctactatatt ccccatttct    198540
     atatatacac tgaaaatttt tgggagttct aggctaggag cagaattaac agatacgaaa    198600
     tcacgccgat agtccctcct cctcgtctaa taccttacaa gtcgctcttt aaccgccaaa    198660
     aaaatctaca cacacgtaat accaatacgt caccgacttt ttatttgtac cattcgctat    198720
     tgaattaact agaaaccttg tcgctcgctt aatatattat cccctccttc aaagattacc    198780
     tttattttac ctgtttttgc attaccactt gatcagtacc cttggatgaa atgaacacaa    198840
     ttggttttga aaatgatttc ttaagaccaa cgagcactat agctcctact tcaacaacaa    198900
     ctcttttcaa gagagatgat gttacaggct ctgactcagc tacttccacg tcttctgaca    198960
     gcgatagtag ctctacttcg acttctacaa aatgtaccgg tagtgcccaa tactgtgaga    199020
     aaccaacaga tgctcattgg aaagagaccg tgggtattgc cgtcggtgtg cctgtcggtg    199080
     ttattgtgct aggtttactc attgttctta tccttgtatg gaagaaaggg aagaaagaag    199140
     ccgatgagga tttggatcca gagtttcaaa gtgggagtga gtacttgcct tatatcagta    199200
     acgagaaaca tattggaagc tcatcaacga actcatcagc gggctcaaaa attgatgctc    199260
     catataaatc aagagcggat ccattccaac tacctgatgc ctctactgac tctttaagag    199320
     attttgctag aatggcacat gacccaagtc tagacaaata taaactagca acatcttctc    199380
     tgagaaataa gagcaacctt tctcttgtga ataatcaaac cagacacacc acgtctggtg    199440
     actcagagaa ggattcattt gattttgcca ataattctac aacatcaact ttagaggacg    199500
     aatcgacccc aattaagaag atgcctaata atgatgctga ggaagttggt aatgatacta    199560
     cactaaaccc atttgagtca gaagatgacc cagcagaaat gagacctcag attatcatta    199620
     ccgacagtga tccttcaaac gatgatgctc cactgactcc aagggaggag gaagacattc    199680
     aacgtattaa gagtatctac aatgtctatc tagaccagaa cggtaatcaa atagttgtag    199740
     atccaacaga tgaaaataaa ctgggcaaca ctgaaacagt ctccactgaa gattctgaaa    199800
     atattgaagg tttgggaata caaactggta ctggaataca agctcagcgt gcctcgcgta    199860
     tagcttcttc ggtatattct gagaatccct tggctggttc tgagaataag gaggattatt    199920
     tcaatcacaa ggatatgaat gacaatgtac aatatgacat gcaatcacag caacaataca    199980
     taccgcagac agtacagtac ccaaacaatg ggtttgtcta tgatcagcaa taccatgatc    200040
     aacaacaggc ttattatatg caacattatc agcaaccaaa tgctcaacaa atgatgtact    200100
     atcaacctcc aataaaccaa acttaccacc aataccaccc acaaacactg gaagcaattg    200160
     atgaactacc gacaccaacg gaactagcat attcaccatc ctatcactct ttgacatctt    200220
     tcaagaagcc tatgaaacag caacttttga ttaaaaatca gattgctact ttaaatggat    200280
     taacattgaa tccaattgac catccagaga tgttctttac tcaagatgat tcttattcca    200340
     aataccaaga aaagatcgca cctatgtccg gtaagcctag caataaaaac ccagcctcaa    200400
     atgtacctct accccaccat ctgagacaaa gtgttgttat gacaaaccct catgatctat    200460
     cattatcaac cacgcataag ccagcaggct ctttcagaaa ggtgcataat gccgctcaat    200520
     caccccactt gggcgttgac cctagatatg gtaacaatac ccgtgtgagt ggtttactgg    200580
     acgataccga cgttgtccaa ccagcaagtg tcggtgaaat tttgcctcgt cacggtaaca    200640
     acgacgacct gaggaaacag ctaggtatat ctcacaatta ccacattcaa ctctgaacgt    200700
     gaaataagac gcagcagagt taatcaagat gaacattccc attgcatttc acccagaccc    200760
     cattttcatg ccatccatct tagctacgat tattgatctt taccgtaacc actcgctaaa    200820
     tccaactatc atccatctac gcattagaag aagtctgtaa cattatttta tcatataaca    200880
     tagcatattc actgaaacta tttgtcatta ttttattcac ctcacctttg tctatcatgc    200940
     attgcaaaat tttcatcagc atatagccca ttctatagtt ctgtatcttt gctcatgtga    201000
     gcttgtatat acttagcata atatgtactt tcaaatgtga agatgcagtc gctgtagtct    201060
     gtattatact cagttatatc aatatcacat acaacgacga aactttccta tagagcaagt    201120
     gggagccaaa ttacatttta agaatcatag cgaagctaat aacgagcact gacttgaacc    201180
     atcactgttt ctgcttgcaa attgaaacca aatactactg ttggtgctta gcgataacat    201240
     taagacctat tttagcgaat ttgtacaaat tgcgaaagaa ggaattatat ctgttcagaa    201300
     gcctcgaaga ttacagtaag cacaacacgc aatggtaggt ttagtgacgt tcattcgaca    201360
     gtcctcgacg atgagggcca aactaatagc acgtagtgct gtaagtgctg tgcccctgcc    201420
     tgagcctgtg aagaaacacc aaccacaaca ggcccacttg agaaagtggc tccccaatag    201480
     gtgcggtgct gttacgcaaa aggttggtat gatgccttac ttcgatgaga agactggtga    201540
     gagaatcgca gctacaatct tacagtttaa caatgtcgaa gtattaatgc acaggcgact    201600
     ggacgaagat ggatatgtgg cttgccaggt tggttacggt aataggtctg ttgataaagt    201660
     ttcgaggcag atgctggggc attttgcaac attgaatgta aacccaaagg aaaaagtaac    201720
     ggaatttaga gtcaagaatg aagaagggct cttacccatc ggtacgcata ttaaaccaga    201780
     tttttttacc gaagggcagt acctagatgt tagatcggtt agcaaaggta aaggttttgc    201840
     tggtgttatg aaacgtcaca atttcaaagg tttaagagct tctcatggta cctcagttat    201900
     gcatagacat ggtggttcgt acggtcaaaa ccaagatcct ggtcgtgttt tgccaggtaa    201960
     gaaaatgcct ggtcatatgg gtgttcaaaa tgttactgtt caaaacgtca agattcttaa    202020
     ggttgatgaa gccaacaatg tcatttgggt caaaggtgct gtaccaggtc caaatggtac    202080
     ttatgtaaaa attcaggatg ccataaaaaa actgaaagac taagaatatc caaagactta    202140
     aatttcttgt atataaacaa taagtattct acaattctta ccctatttcc tttgaaaaac    202200
     attcatgaac ataatataca aaatgaacgt ttttttgaat tcttttaggt gaatgtggtt    202260
     atattataag attttataaa agcttcctag ctatataaca aagtgaatgt caatattgtg    202320
     atcgtggtac atgaaaaaaa agccttactc aaatcaatcg tcttcatcat ccaattctga    202380
     tggttttagt aaaccaccaa ttttagctgc tctttccttc tccaatctat gctgttcttg    202440
     tagagcgttt tctttctctt cggcaaatag gtaatccgtt gggtcacctc caacttcctt    202500
     aatttgaacc aagaaatccc ttaatgtacc attaaatttg atatgatctt tgtattgctt    202560
     tgttaaagca gtcaagaacc ctgtgatttg atcagcagac aaatgtggaa atacattact    202620
     caacatgtta gccaaatatt ggtttaagta cacttggttg gttgttcctt gaggtgcttc    202680
     gccatcttgg tatatattaa cagaaatttt attatcatag acaagcgata ttaatctcat    202740
     taacaaagtc gactgcttag agaaacctga tttgtgatca gaatcagtaa gaacataaaa    202800
     tgtttcgctc acaaaaataa agaaatagtt cttgtaaaat tcatttgcga atggtatgtt    202860
     acccatcttt tcaatgtttt taactaaatc tagcgcaatt tgtagaccat tgacctcgac    202920
     atctctattg ttgtgtttga aagcccaaca aatagaatca acaaacagtt tgaaggctgc    202980
     tggtggtaac tctaagaatg cagcaaatga cttttcattt atcactctca atagcttgta    203040
     aaattctact ctatgctcag ggtattccgt aaaatcctta ttgatcatat ttagtgtaca    203100
     ttcaaacaca ctttgtagaa ttaaaataac accttgtggg atcatatgac caactttact    203160
     tactacagta gtcatacaat tcaagacctc tgcatctcta gcatcaggga cgttgttcat    203220
     gtagtcttct aagactgcgt tcagtagtgg ttccaccaaa accttgacaa cctcctctag    203280
     atttttagct ttagagatgt agatctctat cagttttaat atttcccttt tgatggttcg    203340
     cagaccacgc actcttggag tctttgttgc aataagacct tccttagcaa cttgttcaga    203400
     tatcattgaa gaaacagctc tataaagttg cagcatgttg taatagatat ggcccaattg    203460
     agaatagaaa tcggcaccca ttgaactaca aacagcgaca ttagttttaa tgatattagc    203520
     aataattttg actgtctcag catccaataa aagagcaggg tttgcagtag attgctcaac    203580
     aatggcatcc catgccatat ttggaagttg cattagttca cttagtaatc tagttctttc    203640
     aactgtgttt ctctcttcag atataataat accacaagcc ttgtaaaatg tatgaacttg    203700
     ttgtggttgc aaatcagagg ttgttttctg gatctctctt atgattgttt gaataaatgg    203760
     ttccgattcg cgaggttgtt gaataacaaa gtgatactta catttttgaa caatcttgat    203820
     aaaagtatca caagccatat cttggacacc ttcgtgtgtt tcatgcataa attcaaataa    203880
     tttaaggata actgtacgca aaaagttcca gtgagctttc aaaaatcttg gatattggcc    203940
     aacaacatac atgatgtcag aggcaacaac agctttgttg tctttacctc ttttcttttc    204000
     agttagagca agcaaatcct taatgactgt aacaacaaat cttttttcag tatcttcggt    204060
     cattgtacca gatattgaac cgatagccca agacagagta ttaatattat gccaagacca    204120
     ttcggacccg tcgatctgtc tggcaagctt actaatcatt atttcttcag tgtcgattac    204180
     gtttagatgg gtaaggtaaa ccaaaacttc tctttgagat ttgtataatt gaattgtatc    204240
     tgattcttta acaaattctc tgacaatttc accttcgtca ttttccacca ctaaaacttc    204300
     ctctggcttc accatatttt ctataatgac ccacctcaat tgtgagcata tttcttcgta    204360
     gatgtgtttt tttaatggga atctcttcat aaattcagga ctgatagcac ctgatcctgt    204420
     cgaaacagcc tgagatccta cagataactg catcaatggg tttaattcat tagctggtaa    204480
     atgttgaact tcataaaata agtctgaaac caagttatgc cagtaatcca atgtcgtttt    204540
     gaatagttct ctttcatcaa tcttggatag ttgtattaaa tattgatgag cgttcagtag    204600
     tagttctttc aagttctcgt tactttctag taaagatctg tggtggctta aatacgttgt    204660
     caaaaacata gcaaaatcct gcagaaaaga ttgatcagaa ccatttgcag tagcataagt    204720
     tgatttcaaa tcggcagtca ctgggatgac atttgaagct atctgctgta acgtgttttg    204780
     gaagtattgg acagtttgtt gttgcattga gctattgtta tctggtagat ctaaactcga    204840
     tacttcggtc aaacatttta aagtcacgga tctagtatct gcagatgcta aaaactttgt    204900
     gctcaataac tccaatatgt ttgtttcata aatataacgg taaggaatcc agtgtaaata    204960
     tctgagaaga gactctagag cagctactat caatgaagga gaggatcctt gttccaaaac    205020
     ttggaaacac agtttgaaga tttgttcgaa ctcctttgac atggaagtct ttaagtgaag    205080
     agcttttgcc tgtgtcattt gttcggcaga gaagtcaaag acttcctcag ataaaagttt    205140
     caaaataacc atattatttt cacaaacatt aacagaagct gaagaactgc cgatcagttc    205200
     agggataaac tctggccaat tttggggcca ttcttgtttt agaatttgaa caagagtcaa    205260
     atcagactta ttaatcagat ttttttgagt ttgaaatact gtgtcatcct ggcacattga    205320
     gataatcata cctacaataa aatttctgat accaattcta tgttcttgtg gtaatagttt    205380
     ccatttagtg gtaatcaact tatctaggat actcaacccg atgaatttgg catgtggatt    205440
     ttgggaaaac tgcaagatct tgtctgcact ttgccatgca tctggatgtt cttgaaattt    205500
     cgttaatata gtctgagctt ctttctgctg agcacctgag ccctgataga aagtctcaac    205560
     cacttggtct aacagagtaa tatccaattc cttggagaaa tctaaaatac cttccattat    205620
     tgttatagct agccggttat tttttttgat ttttaaaact ctagtcaagt ttttgaactc    205680
     ttattcttat actgattata acaaaaactc agttttaatt gaactgcaat tgctcaagat    205740
     tgtttttttt ttttttgcgg ccccttatac agtgtcactg ccgattaata tgttgtcaat    205800
     caatagacta tagtaatcca gaactaaaac ttcttttcag tgattcagag gtggaacaaa    205860
     cacttgtaga tcctcaatta aacaaagata cggagagtaa tttgcgttgt acacctattc    205920
     cttgttagag atcaataaaa tagagcgata tgtagcacta aaatagaatc gactaatcca    205980
     ctataggtaa ttgaattgtt ggctcaaagc gtagattcaa taactgattg ttagatctga    206040
     tcaaacaaag tgagttgctt gcaagattcc gttgtttagc ttttgctttt gcttttgcga    206100
     aagtttaatt cttttcctta aaggacagaa aaaaaatttt gtttgcacga tgctgttacc    206160
     cggatggcaa agcccattac aatgataatg tcaccaagac tgaataaatt gtacagtaat    206220
     tgagcaacta gctggtcaat tgaccaagta atagatatat tgtttatatt agaagcatat    206280
     atagagtata atcttaacat tcttaatgca catgaaaact ttttaaagaa aaaaaaatgc    206340
     atttgattaa gtttgggatc ttgtatttgc tagttttgag taaaagacaa cgaaagaatt    206400
     gcaccttatt taaatatctc tgaatggatc cttcaattct tcatcagact gattgtgaat    206460
     attttccaag gaactcaagg aatctctatt cgtatattcc attacccgcg agtttgatat    206520
     ttgtatgtgc ggtggtattg gtctggcgtg gctctgtgga agtggtttcg aatatgcact    206580
     cgaattggag ttgtttcttg gcgaccatat aaaatcgttc acaccatagc tgactcttgg    206640
     ggttgtcact gattcaactg attcattcca agtttttatt tcaggaactt ttatgtttag    206700
     atccttcttg atactgtcct ggtctaattt gtaattgggt ccgtattttc tcttgaggtg    206760
     atgtttccac ctggtaacaa ccatatctaa aacgtccaca ttcctctcgt tatctaaata    206820
     tctgtctact ttgcccatga tgtataggtg gcgcacgtat tgatcaattc caagacactc    206880
     tcttggatca taagtggtat acagtggtac cagatccaac aaagttgaaa atttcatgta    206940
     gcccatataa gcttgtgtgt aatatacttc ttgaacaaac ctcctatact gtagtcttct    207000
     attcataata gattccatat taatgctgtc aagctccttg ttcagacctt ctaaatcaac    207060
     ttttacatcg taaggatcat tagggttcac ttccatatag ttcttgacta ggttcttgac    207120
     agtgagtttg ccctcccaaa ttttaaaaga gagagggcca ttaaatgagt gcattatctt    207180
     cggtagatac tcgaagtcca gcttaccagt accatccggg tcaaaccttg cccaagtttc    207240
     aacatatttt ctgatttctc ctctgttaac ttcagatttg gtaccacctt ttctgtatac    207300
     ataactaaag ttgccgataa tcagtgagat aaacatattc aagaagatgt acatggacaa    207360
     tatattccat gatatcaata gaatgtaagc atatgtttga gatccacaat ctgaataatt    207420
     acccttcacc ctttggctac aataaggttc tttgaccttc aaatcatcca ttatatagtt    207480
     ccagccttca ccaaaactac atctgaataa aacaattaat gcttttaata ctgttctgaa    207540
     attaatatta tctgtagtgt ttgggcctag cctagttaag ccaaaaattt gattcaaagc    207600
     aatagcataa accagaaaaa ggataaacca agtatatgtc agcgatagaa ttggtggaag    207660
     acttgccatg gcggtttcga ttagttcact taaagtatcg ttttgtggaa taataaacaa    207720
     aaatatgaca aggtggaaaa aaccattcac attatgatac cagatatatg ctcgatcaac    207780
     attgaatgat atcaaagtta gaaggaaaga tactatcaga atctgtattc gaattaaatt    207840
     ccatttgttc atcttgtata ttcttaagcc cgcgccataa acatggaata gttcttgtag    207900
     tagaaataca gtagtggaaa acatgaagta tacctgagaa taaagtaacc cagatccatg    207960
     gtccttataa gttaagctga gcagcattat aatgtgaata taagttactg tctgtaagaa    208020
     tatggcatag tagatattat tcttttcaac agcaatattg tacagaaaaa tgcggactct    208080
     cgaaatgtca tggaatgtgg gtatagctat tggtttggct tgagataata acttttgaga    208140
     ctccagccac gccttttctt cactagtaaa ataagcactt cctgttgatt tggcttgatt    208200
     gttcacaata aaagaaacaa acagattcaa aataaaaaca atgctcagaa aattgaacgc    208260
     tataataaat acggcattac ctgttgaagc taatagtgac gctggtttac caactcctgt    208320
     gctattcatt aagttgccaa gcaagtcggt ccatccttct aacgatatta tttgaaataa    208380
     agaattgaat gcgctagtaa aactgtctaa ataaagctct ggattgtcat aaactcgagg    208440
     catcatgacg ttccattgaa acacttcatt cgaaaattca ttaaagcatt catctcttcc    208500
     taaatcacca tcattgcaaa ctcctaaacg ccctctgaaa agattcagtc cccaaaccgt    208560
     gaatggaaac aaaagtgtca gggaaagtag gccagcctct aaaatttttc ctataccatt    208620
     aaacagcaca actttaaatg tttctctggc tgtgttactt atcgttaagc atctcaatgc    208680
     tcttagcgca gttaaacctt taaaaactct agatagattc ccatcattcc ttagaaatgc    208740
     gattaaatta atccacattg aaattaaaac gaagaaatca attaagttcc atggattcct    208800
     tgcataagca tttggtgtat agatgaaacc gtccgctact gttttgataa taaactcaac    208860
     acagaagatt gccaaaaatg cagcatcaac ataggtgacc caattctttg aggacatgtt    208920
     tcttttcatt ctgtaaattg gtgtgacgta acaggaaaat acaataagta gaactgttgc    208980
     agcagcataa aataccacaa acaaatctct ccatatgtga ttgaagtatg tttttctaga    209040
     ataagtatca gtatcatctt catagaattt gtaattatct gttcttttcc cgtaactagg    209100
     aggaacaagc ttttggcaaa atttacggaa tctatgtctg ggtgagaata agtagtagct    209160
     gtaattgaac atcgaatgct tttgtagata atccagcttt tcatcttcaa actcgttcag    209220
     ttgaagcata tagttccttc cattaagatc agatgtttca gaaaacatga tttcgttgcg    209280
     cttgtagaac ggattattag agtagatgcc aaattttctc aaaattggta tatattctgt    209340
     tagtctgact agtaaagtaa caatatcacg atcttgttct gtattgaatt ctttacttaa    209400
     atctcctaga ttttgtgcaa tattcataat tgctgttcct ctcattaaaa attgtttgaa    209460
     atctctagag tcttcttgac tgtcagtcct aaaaatcttc tttttgattc tcgctaacaa    209520
     actagcatgg cgaaatcgtt gtatcttttg tgggtaaata tgtttcagat aatgctttat    209580
     ctgcattggt ctcttatcat cctctttaac ttctaaactt tctgaaatta aggcaatgaa    209640
     aatattcaat atcactgagt ttgaaagaat aaaccatata atgagaaaga cagtagaaaa    209700
     gaatgccgac gatatgttag gagagtactg ttgaataatg tacaaaattg atgtccagtt    209760
     ttcagtcgac cctatgctgt acaaagataa gaacgaattg ggcagtgagt acattcctaa    209820
     aagttgatct tctatttgat cttgtggtat caccccttca aaatataatg ataagattat    209880
     ggaagctaag aaagtaaaga aaaaatagaa ggcagttaaa ttccagatca ttataccatt    209940
     acctagaacc tctttccata attttcttgt aaatccaata taaatcacaa gccggtagaa    210000
     cctagtaatt tgaaagaacg acagccaata gtaaccgtgg cctaaaagac cggcattagc    210060
     tagaattgtg attaccaatg tcaagatcgc aacaaaaagg tcgtacacat aattgaatcg    210120
     tgttaagaat ttccacatat tcggaatatg cagcacaagt cgaaaaatgg actctatgaa    210180
     taatactatt gttactccac gatcaattct taacagggtt gtaacaaaat gttgtgagct    210240
     agtatctttt atcaaacatc tcataataag atcgaacatg atcaaaataa taaagactgg    210300
     ttcaattttc tcataatatt ttaggcctct ctcagcccag ctagggaatt ctgtttgtga    210360
     tgcttttact ttaaaatatc tccaatatcc tagtgcaaat ctgataggcc aactttcatt    210420
     gctactttct tcaagctttt ttttcttgaa ttcttcgtga gctagttgga aagatgaaac    210480
     taatgctgcg attagtaaat tcatcatcca tatggtcaat acaaaaattg aaataataaa    210540
     aaacaagcac gcagagaact cgtcggaatt cattgtgtag tacataatat cagagaaagt    210600
     attagcactc ataacaataa atacaagttc cattgagttt attatgttat caaaactaac    210660
     tcttccatta aacgggttgg agcttgaaac acatttcgaa tattgtgggc acatgaaccc    210720
     tttagaaaca ggtccttccc taccatcctc aaaaatgtaa ttcattttct tctttgtaac    210780
     tggttctaag tatccaccac aaaactgtag ttgatattga tatctatcgt ttggattttc    210840
     aggattatac catacacatt gtcttctgaa tgaacctttg aagatttgaa cacccagaat    210900
     accaaaaaac acccagaaat aaacaagcat cgaaccgaca ttgatcaatt ggggcatacc    210960
     atatttcaaa ccacgcaaaa ttgatgttat acctgtatca gtatttacta gtcttaaaat    211020
     tctcatcgcg gccaatggtt tgaaaattct aatacctact cttttatcat aattgttaat    211080
     agacaaaaac attcccagcc agaaacaaac agaggataat aggtcgattc tattccaaga    211140
     agatctgcag aaagctctcg gacaattaaa ttttaaagat ttgctattgg tatcattctt    211200
     tgcagatata ttagccttca tattcctctg gattgtttcc ttttcacttt catctgagat    211260
     tacattaaaa ggaagaagaa aatgcactat ttttggacca tacttttttt taattaagtg    211320
     gtagagtttt gtgattccaa accgttccaa tagtgatatg tattctaatt gatgataggc    211380
     aaacatttgc gagtcatccc aaaacccaaa tgcaaatatt ttagcaatgt catttgaggt    211440
     gaacaaaata aaaagaatga aaatgatata gtctgaccaa tttctaaacc tgtagaggaa    211500
     atcaaaattt tcaggttcat agctcctgta cgctagtaat gctgttagaa atgttaatag    211560
     aagaatgtga gctatcttgt agtatttgtt taatagtatg tgggcaactt tatatctcag    211620
     tggattattg gggccaaaat accctaatga attgccatgc aaaattaatg gtggccgttt    211680
     cttggcgttt tcatattcat cgaaatcggg tagctcaact tctatcgaga cagtgtctac    211740
     gttcttatct ttttctaagt tgattcccag tccatgggct atggagcttg cgattattga    211800
     aggtctcctg gaggaatgtt ttgaaggtga gctgaaaagt ccaggttcaa aatgtaaatc    211860
     ttcggtacta tcatttcgga attgactacc agaacgtcct cttggagtta gtgtactttt    211920
     tatgtcgata ttcaatttgc tcttatcccc agcttcaagt tcatcggcag attcagtctc    211980
     ttgttgtagt tgaggaagcc atgcaaattt tttgtcctcg atggcacttt ggaatcctct    212040
     tttcatatct tcaaattcat ccatatcatc agcatctata atagatagga ctttcgcaga    212100
     tctaggtgga ccatctgtgc ttatcgatcg ccttctggga ctactctcac cactcttatt    212160
     agatctgtgt aagacattcg agcgcacccc tgaagaatga aatgatacag cagactttgc    212220
     actaggtgat ccaggttcat cgctactgct atactttctg gctttatcct gtgtatttgt    212280
     cgataatgat gtggtccgta gagatagttg tggtttttgc ttcgcattat tattacctag    212340
     tgccgacttg aataagttgg ctatcctagg ttcccatttc tttgaaggtg attccgcttt    212400
     tgatgacatc cccagtgagc ttactcgatc actatgtgca gtatcggtat tggagatcat    212460
     atcatcgcga tggctatgat catgttcact tataccatct agttcaccat catcaccaaa    212520
     agtaccttct agtctcctag gtgagtattc tactctctct tcaaaatcat catcattgtc    212580
     actgtaatca ccctcatcgc tatcttcata gggccctctt ttccttatcc ggcgtattgg    212640
     taaactgttg ctgctgctgt tcttgtcctc atcagaatca ggaggaacaa tattcacaaa    212700
     gggcggtaca aatccatcat cagcatcttg tgcctcattc cctggctcgt agcgctccgt    212760
     cagctgcctc ttcaccatcg gcattatcta tttggggagc tcagtccttg caaaacagga    212820
     ttaatttgtt ctccttaaca cgtttaaaac tggtatgtca attctctgtt gatcagtcac    212880
     aaatatatag atcttttata cccctgtacc gttactatcc tagcaacttt aatattgctc    212940
     gttatcaccg tagtgtagat caaattgctt attctgccaa aaaaaaattg tgagagaagc    213000
     gatgcacaat tgaatcacta ctcggaatgg tggctgataa ttgagcaaag tattgatggg    213060
     catggatgac actcgttgca gcttctattc gaagccattt tcttgattac agtagctcag    213120
     ctgtcttatt gtaggtggca ctcacttatt gttaattggt gtttcttctg tgggaagcga    213180
     tgagctatgt gttttggcca gagagtctta gaataaggga gcagcagctt ggagatgggc    213240
     cgctggttgc tgtagcattg caggtgaagg attcctatgt cgtgctggat atatgttatg    213300
     agcaggtaat aagaacaatc aaattagaga agccctactg cgtcgttgcc aagtcgtcgg    213360
     gaacagagcg gaaatgggtt tattcaattg atggaacgat tctggtttgg tttaaagagc    213420
     ccaaggtgaa acttatgcaa ttctactctt tggaaccttt gtccttggaa ttgccggaga    213480
     aaattgccag ccctgaacta gacccttccg cagacaaggc aaacgctatc aagctattct    213540
     ctcacccaag gtatcagaat tataaccgtg atataaggga cattatactg gttattaacg    213600
     tatactttag acagttaaag aaattgcata aggagtaccc gaaattatcc agggaagttg    213660
     taagttcttc ggcacagctt ttcgaagatg ttaaacactt tatctgtaaa acgtggattt    213720
     gggccttctt tagaagttct ttccattacc tgttattaat ggtaaattac atttctagct    213780
     ctgttctcgt tctactaaat aggaattttc cacaattaat caatatatct gccacagctc    213840
     agcaaataga tctacggtgc cgtcaacact gttacttccc agtacaatac ttaaagatca    213900
     ctaaaaatat acaattcaga gagcaaattc cacggtttag aagtaattct attagaagta    213960
     tacttcagtt aagagacgac ttaccatttg agaattatcc cgaatatatt aggatgtaca    214020
     atactatatg gttgattttt aacgatttat cctttggttt aataatttca gcttatatta    214080
     ctgagaatag tgaagctatt gttacgtcat tttcttccct gactagatgg ctattatatg    214140
     atcagctcag ggacttgact atatttttat caaacaatcc atttgggata aaacttaatc    214200
     aagaaatggg tgggttctta agtgaattgt ttttatgggt gatagatgta tcgtatttta    214260
     cctatataag atacttcatc aaggaagaga ttttcagacg attgttaaag gttctggttc    214320
     aagtttctta cgttattggg gcaacgttca ctcttgccat tatcattgat tttatatcaa    214380
     tcatatcatt ccctatatta attttctatc acatcagctg caagttatac agattacagg    214440
     ttaacataat ggtaagtttg ttttatttgt tttgtggtaa gaagaggaat gtcctaagga    214500
     agcgtgttga ttacaaatat tttgatcttg atcagttgct aatgggaaca cttctattta    214560
     tcattttgct atttttgttc ccaacggtat tggtctttta tgccgcatat acatcacttc    214620
     gtgtggtttt tttaattatt gaattaggtt tgcaatcctt aattgcgtta attaaccatt    214680
     tcccactatt cgccctattg ttacgtctaa aagatccaat gagaattcct ggaggcgtat    214740
     acttcacaac ctcctttaat caagatagga tagttatgag gatgtataat aagcctacgc    214800
     aaattggtct tatgtttcga ccatatcaag ccttaatgag aagtttatac aaaaactatt    214860
     tatcaccagc agcagtcaag catttgatta aaggtggtat aatagtaatg cagaggaaaa    214920
     acctctactc agttttgtac tcatcgttgc cggataaccc agtatcatct ggagaacttt    214980
     atgatggatt atttaataag tagttcttta tatagtttat tttaataatg ttattactca    215040
     aagcatattg ttatgaatat ttttaattaa tttagggtac aaacttatct atgatggatg    215100
     ttgtgaaaag gttatatgtg aatgaaaatc cttcatgtat tctgggaagg atcaatttaa    215160
     tatgtacagg ttttggattg tagtcaattg ttctttctga tagagtccaa agtctcattt    215220
     cttcttttta cttttctcgc cagcttccga tttctttgtc ttctttggtg cacctttacc    215280
     acgacgtttc ctggcgctca ccatcatcag cctgtagtcc tcttcagggt cactcatagg    215340
     aatgtcagag taaagtttcc gtatggttct gaatttaaca aagtcgggat taccgtaata    215400
     gctcgaaact gcagggccct tcagcctctg agagagaatc ttcgcacctg tacgtgcacc    215460
     agaagggtta aaaccttgat caaatatctt agcagatagc tcggcaactg ctaaaagtct    215520
     gctctttggg atactcatat cagttatctt tgttaatgag atagtaagtg actgggatag    215580
     tcgttactgt attataagtg atgcaatgta gctcctacgc aaagttcatg caatagccaa    215640
     tagcagtccc tataaaacga cttattatga gcgatctcta atggagtata tactgtaata    215700
     cagaacccca aaggattata actacttcac tcattaaacg ctatatgaat cggaaggatt    215760
     ccgtcactta cttctggatc tcgggaagtc gatagactat aacgtcaata gtgatgtgta    215820
     taccgctaca gcaagagggt gtatttggtt gatttattga gctgcaacgc tctttctatc    215880
     gttgtatttt tacttatctc tacttccatt atataccttt tataattgta tgcatatatt    215940
     caagtacaat gtggtaaata atacttgttg aacctcttct tttgattgct gcctacttct    216000
     aaggttcaac taagatcttt gtgcaaaggg agtttgtatt cataagggca tttcagttcg    216060
     gtacactatt ttgggttgta tgaggaactg aatatatgtt tctgccacct gagatggctg    216120
     gtatgtcatt gccagggata tctacgtgca tttcgacttt caattggcct tgagctgggg    216180
     cttgtgagct taacggattg ttcgttgtaa tattctgacc tgcaaaatgt ctggaacttg    216240
     gagcatggcc tagaggttgt gacatatccg ttgttatctt tcgtgggagc ataggactct    216300
     gagacatgat atccatgtat ggtgttaatg tcggcacatg ttggactatc tgtctgtggt    216360
     tccctggctg tgtcttggtt agccctctta aagcatccac tgcatccatg actctcacgg    216420
     aaggtattcg ttgcagttgc tggagatcat gttgagggtg cccatatgcg ggctgtgtat    216480
     tgagtggctc gggaacattc tctgtcacta aagacaagaa ctgttgtgtg ttattgccta    216540
     ttatgccatt tgtattgttc actagggtgt gatttggatt cacctccgtt gtattggttg    216600
     tattggttgt attggttata ttgtttgcaa taggatctct ccgccttctg ccgcttccag    216660
     gttttctgcc ttctctcaac gtcttaccct tacctggctt tcttccactc ccaggttttc    216720
     tgccttgcgc cagcgttttt gccatcttgt gctgataatc tgcctctctg gtaagtttgt    216780
     gatagtggat ctcgcccgtc ctcctttact ctctgcctta tctcgcaaaa tgtgggatta    216840
     agaatgtgct ctcttagtca atgtggtact gtcaactcga taacgttcaa tacaggtgga    216900
     aaaatttgga attcagataa tgtgtacttt tataatgcta gtggtagcgg ttagggtgtg    216960
     ctatggttct tctcttattc tagggtcagc tttttaacat ttaattgata tactcatcga    217020
     gttttttcat cgatttttca attttgccaa aagtgaaaaa tttcttgaaa aagtgtagaa    217080
     agctaggaga tgtgcgcata ataaccacaa gggaagcctt tacaatagcc cgggaaagta    217140
     gagtaacact gtagattagc aataataaag aggcactggt agccgtacgg tcaatttgtt    217200
     tattgtgcag ttatttctgg gatttcggat agccaaagac cgttctattt tggtgtaagt    217260
     gaggctaatt tataagagtg gctacctgtt gttgacatat actggtgaaa caagtaaaat    217320
     tgcttataat taagtgtaat atgccagcaa ttgaaagttc tgtagtgcgt ggtggtgttc    217380
     aggagaaccg tgatgttgat atcaaggaga ttaatagcag taacaggatg gactaccaga    217440
     tgggtgagct gttgaaaagg gctgttggtg ttcagttgca aacgattgac aaagatgtta    217500
     ctgtgactcg aatggcaatg gatcagcttg tgttgtttgc ggaagaccag ttgaatgcac    217560
     ttgtagatgg tttacataga atatcacttt tgcaaaggcg gcagagtata gctgtgtcgg    217620
     atttggaaat atggatgcga ggatacaatt tactgccgtc tgatttatat atgacggctg    217680
     aggaaagcaa gtttataaga gagaattaca gaaatgatac cagtgtggtg tttaaagaca    217740
     ttaatatcga caatccaatg gagtcagcct tggggaggat aaacattcag aataaagaaa    217800
     atattgagcc cacagataat gatgttgata ttgatgaaga tgacgattat gagttaatcg    217860
     aattacagca acatgccatg gagcaactat ttaagacaga tactgggaga ggtagaaatc    217920
     tgagatacaa acctggttgg cttccggact ttccacctga ccatacatac aagtatacgc    217980
     caagttatgt caatgttgtt aaacctgaaa cagaaatacg gcaaaagctg gttgaggaag    218040
     gaagattatc cgagaaggca ttggttaagt tgatgtcgaa tctggattcg ataagtacaa    218100
     cgaaagacaa tcaaaaaggc acgcatttga agcaagagaa taatctaata ttatctgagg    218160
     agtctaataa tttagaggtg cagtctatat caactgataa accagatgat gtggggagcc    218220
     ttgaagatat caataagcaa gatgacgata aaacgcaagg aaataaaata gaagtagacg    218280
     ctgagaacaa ggaccaagtt gtaaaaatag aagaaaacaa agaaagctcg actgaaaagg    218340
     ctacggaaac ggctacggaa acggctacgg aaaagcagct gagcgaagag gaattggcag    218400
     acctggaaat taaggcctta ctgtacagaa ttgagaataa taaggaatat ttgattgagc    218460
     caatgagggt atcattgtta aaaggtgtgt taaaagacct cgacagcaat ccaacgtcta    218520
     aactcaaaga ttttgatgtt gaagcatatg ctagacaaag aattgagatt gccaggagga    218580
     aggtagttga tttcgaatat gaacaactgt acctaaaata taatccgttg ctgagattgg    218640
     caaaaatgaa gtactatgat gctgaggaat cagattttga aactgaatat caaaagtgta    218700
     taaaaaggac aatggacaga tttaagagga acataccgat aatcaaagaa aaaaggaaga    218760
     tggtgcgcaa ggagagcatt aagcgtaaag atgagcttat cgctaaacgt ctggctacga    218820
     ttaaggaggc caagatgaag aaggaacagg aaattgttag gaagtcaaga gaaatggagg    218880
     ctattgaaaa tgctaacaag tttggtatat taccaggtga aaagcccctt gaagtgttac    218940
     aggatgcttc gaatgccagt actggggaaa gttctacaac aactgcacaa attccacaag    219000
     gagctccact tttggtcaat cctgtgaata gcacattggt tccactcgtc gattccgaga    219060
     aaccaaagcc gttggaagaa gtgcaaacca tagatgttat tgccaaggat gtggaagatg    219120
     acgatgaaga tttaggacta tttggtgggt tcaacagtag tagtgatgac gaagagattg    219180
     atcagaataa ggaaacacag gagagtccta caaaaaagac aacacacgtc aagtttgagc    219240
     ttggcgagag cgatagtgat aaggatatat aggatgtcct ctagtcatgt agcaatttcc    219300
     atatttcgac ccctccttgc ccccgccata ttcagttctg aacatataaa aacaccaatc    219360
     cactgtaaaa gggaagggaa atgataaatg cattgggtag gctatctacg attttcgtac    219420
     acagaagtgt gtatgtgatc aatcttattt ccatacgtgc tgctccagtc catgcagcca    219480
     ttagagcctg gaaagcgatg agttgctttc ctgacaggaa aatgaaaaat ttcagttaga    219540
     gaaggaatgt gcttctgcgt agaattctgt ggtagacatg aaaaattttg tgaaaaaaaa    219600
     aattttgagc caaatggacg aacttttgac caaaataaat cacaagttat acagtctctg    219660
     tgtaacgtgt tcgtgtttac taaattggga tgtgaagggt agtaagtagt ctaggttcac    219720
     tgcgttgtgg agctgggcct ttggtgtctt tcctgtagca gttttttttt ctttttttta    219780
     atcattccaa ttcaccactt agaataaaat aaatagacat tgtttggaaa ggaggtggaa    219840
     aaaaaaaagt tgtgagaatt caaatactcg ttactgtaac tttaagctgg tttatggact    219900
     agacagacga ttgatttata ttcaaaagga ttagtttcac attgcattgg atttgctgtt    219960
     gtagccaaca cgagccactt aataagcagt acgtcagttt ggtatttcaa ctggaattga    220020
     aaatatctca agcacttctg tagccaataa acgacttgtg atctggtcga atcagggatc    220080
     acagttgtaa atattaatta gcatacacga ttacgttgtg tttgttttgt tttgatttgt    220140
     tttgttttgg tgttaccttc atttctaata ctctgccaat tgtaatagca atagattcag    220200
     gtgtttggtg ttaaagttag catgatgatg tcaattccaa gttttcggga cttggcaaaa    220260
     ctgaggagga gtgctgataa taagagagga ggtgagtata gtttaccaat atcaagaact    220320
     ggttctgaag cgaccctttc aaaacatgat aagttcatag ccaagaagaa aaacttcaag    220380
     ttcagaaaac tggcaactgg agccataata gtcattgtta ttgtgtctat attcttggtg    220440
     ttcttcaaca ttgaagtaag cccgatatca ttgccttctt cattttacca caaggagtac    220500
     ctaccttttg aatttaagga tgccgcttat cacagttttg actttgaaga tattgacatg    220560
     gatattgtct caaaatttga ccaaggtata atgaattatc taatatccga gtatggtact    220620
     gaaaatcctt cagaaagtga cttagcagaa tataatgata acttacaaat gctgctagat    220680
     tctacagtag agaagtatga tttagggaac ttccaaggat cagctgatgg atttgaacaa    220740
     caagagcaca ttctagtttg tgtgccattg agagatgcag aagaagtctt gccacttatg    220800
     tttaaaaact taatgaactt gacctatcca cacgaattga tagatttagc atttttggtc    220860
     agtgattgct ctgaaggtga caaaacactc gaagcattgg aaacatattc acagttacta    220920
     caggagggta ttcttcctga tatcttggcc gacatggata actacaacaa gggtaagagc    220980
     aatgaaagta tacatttgaa atacatggag cctgattacc taaagcgggt aaaggctgcc    221040
     tataagccac ctttccatcc aaactattcc aagcctttcc gttcagttca gattttccag    221100
     aaggatttcg gacaagttat tggtcaaggt tttagtgata ggcatgctgt gaaggttcaa    221160
     ggtattagaa gaaagcttat gggcagagcc agaaactggt taatgtcgaa tgccttgaag    221220
     ccttatcatt catgggtcta ttggagagat gctgatgtcg aactatgtcc cggtagtgtt    221280
     attgaagatc taatgctaca ggattacgat gtcatagttc caaatgtatg gcgtccatta    221340
     cctaagtttt tgaattctgc tcaaccatat gacctgaatt cttggatgga atctaatgaa    221400
     gctctacagt tagctaagac tcttgatgag gatgacgtta ttgtagaagg ttatgctgag    221460
     tatccaacat atagagtgca cctagcatat atacgtgaag aggatggtga tcctactcaa    221520
     gttgtggatc ttgatggtgt tggtggtgta tctatcttgg cgagagcaag agtatttaga    221580
     gagggtgttc atttcagtgc gtttactttt gaaaatcatg ccgagacaga agcatttggt    221640
     aaaatggcga agaaggttgg cttccgtgtt ggaggtctgc ctcattatac tctatggcat    221700
     atttatgaac ctagtgatga tgacctgtta gcaatggcaa aattggaaaa gggcaagtga    221760
     ttcattatta cttcatacaa ttaatagaat ctcgatacaa cttagatgta ttcatattaa    221820
     tttcacgacc tcccgtgtat aacgcataat aagattcgac tacagcagag gagtacatgt    221880
     ctttaattac taccgtttga attcgtttct gatttatatt ttagtaaggt tttttttttg    221940
     tagatagaat agagcattta ctgtatgtta ccttataaca aaaaaacata gtttttatga    222000
     ttaggcactt ttttgctatc aagaatgagt tagccgtatt ttgaaaggca aatgcgatta    222060
     gaatatatgc taagttgtat cacaattatt taaattagat tctataagtt ctatacctag    222120
     aatatttggt catttcgcta tttctacaac agcggagtct ttttcattct ttctaccctg    222180
     tatgatttca ctgagcatca atgcaccact tataatacag gccatggatg caagcccaat    222240
     gcctaaataa aaagcgcctc tataaccttt tagaacatcc tttccatgat tatttacatg    222300
     ttgctcaaca acgcctgcta cacctagaca aaaggacatt gagtaattaa ccatagtgtt    222360
     tactaacgaa cccgccattc cttggtattg caacggtagc ttatcactaa gcaagataga    222420
     agaggccggg aaagataaat ccattccaaa acttagaatg atcatcatgc ctaaatggtt    222480
     tctgaaatac gtttggtgaa ttggcgttac actcataatg atagatccac aattaaacgc    222540
     taccattgac aagaataaaa taattgatgg atatactttc ttgattgtga atccaacaac    222600
     taaggcagcg acgatacccc agattaaaaa cataaagtag gtaccacctg cccagagcgg    222660
     ggtatagtgt cttaaattca attggaatgt aaaataataa aatgaaaaaa taccaaacga    222720
     accccatcca aaaaacagtg caaataatac aataatagtc ttagggcttt taagtacttc    222780
     cttaggtaga agtgggttac cattcacaaa atgaagctcg tagataaaga atgcaatcag    222840
     taaaagaaca gagatgatca acaggacgat taaatatgca gagtcccagc catctattgg    222900
     tgcttgattc catacaaagt ttagcataat taaccccaca acaccaagtc cagatccaat    222960
     ccaatccatc ttatgtccgt ggacattcgt tggaatagtg ttgggtatga gccaaattga    223020
     taagacaaag ttaatagctg cggtgatggc ataagaataa aacgcccatg gccattggtt    223080
     ggcatcctca gttccaatca aaccagagaa tacggcaccc aatgtggcac caataggagc    223140
     catacaaccg atcaaactga taaccatgtt tttcctttta cttccagcaa tgtatatgct    223200
     accaacaatg cctaaaatgt tcggcagaat taaggaaata ccaagacctt gaaatgctct    223260
     gctgacgata aaaaaagaat cgctgtgagc atatttagtt agaccgcata tcagtgacca    223320
     aactatgaga aacaggtagc ccactagtag cgtctttttt aatccgtata tatcacctat    223380
     tctaccactg attaggatga aagagcctga aattaatggg aatgcagcca ttaaccaagc    223440
     ctgcttaccg ttctgtgagt ctagagagtc tgccacaatg ttcatgatcg gctgtgtctg    223500
     tattgcgccc gcttggttaa gcaactgact cacaaagcaa gagcaaagaa acaagtattc    223560
     ctttaatgtc gagtcaaaat actctgggtt ctgccatttt tggttaccat caatcgcttg    223620
     ggtatcacac tgtttctcat cgacgatatc attgttatcc tgtttgaacg agcttccact    223680
     tgaagatgac gataaggtct cttgctgtac actatcagtt ccactcttcc ggaatattcc    223740
     catagataat tgtaaatata tttttttatt tccttatgac cttttcttat tatttttttt    223800
     ttgattatac tatcgaaatt gcagtattca tacacaattc tttccagcac aatataaaat    223860
     tgcttaaata atgaatattt aattctgtag agctccagtt tatactctta acaaaatata    223920
     tacatgtaca caattgtgcc actaatcaga attttgcact accagcttta tataaaaaga    223980
     agctaccaac agtgtcaact aattaattga cttattttta taattagttg gatttatcaa    224040
     tcgttattat gggtgcctcg gaagacacta cggagttcta ctgcgggatc agtctgaaaa    224100
     agcaataaag aagcttcgaa atcctttaac ttcaattttc taaaattttt tttttgacaa    224160
     aatgcgagct tctagaaggc atcgattgac aagaacagga cagagacacc cacacaaagg    224220
     agtgatctgc ttattaatca aatgccggaa tcgttgaaat gcttcaggac tttttaaggc    224280
     agtgtcacta tgtgtgtggg gggttctcct tccagcatga caaataagct tctgtaacac    224340
     ttgagagaag tcaatttact tttgatagtc ttgagggatt aagattcatt aaagcatgaa    224400
     tgggctagag aaggagacta ataatgggtg tctcataaaa tgaagacaaa cgccaaattg    224460
     tgtttgagct gcagaatgta gaatatctgt taggatttaa acacgtaatt agagtgctct    224520
     tcgttttttc tttgatttca aactggcgag tcacagaggt ttatacgttg tatatgtaca    224580
     atgcaattac gcaaacaaat aggatgtagg ttttcacgca atttatttga ttagaaacta    224640
     tagcatggta tttatctaat tactaagggg ctgaaggatc ttcttctgtt tctactgacg    224700
     caccgagaat atttgcagcg tacatgaacg tagagtgttg tagctgagct aagtactgag    224760
     ccatgacgtc tgaacctggt attggtctcg taggctgttg atttgggaaa ttattgtgcg    224820
     tacgtttata cttcttcggg taatccattt ttggtgcttg gccgtttagt ggaggcacat    224880
     agctgatttt cttataagtc atgttaatgg tagaaggggc tctgggaggt gcgtgagaca    224940
     ggtttgtctt aggtacaaag gtatctcctc ttgaattggt tgtttggtac ttacgatcac    225000
     tggaagatgt ttcctttgag gcactgtttt caaaatctga tatcacagat tcatcagaac    225060
     ccgagatatc atcgaatatt ggagattttt tcgacgataa acctatgccg ataggaccat    225120
     tactggatat ttgtgggtgg tcagatttat agtcattcga ctcaagatcc tgtttgacac    225180
     caccgttctc ctctgtagtt gtatggccac cactgagttt agattcattg ctgaaagtgc    225240
     gatctacgct aattccaagc gaatccaatt gaatactgtt cttcttttga gagagtaaat    225300
     tgtcctcttg cattttccgc ttctcttcca tcttcttgat tctaatatca taacttggct    225360
     tcttgacctt cttatagaat ttggatccct tgccagcgat caaatttttg ttgatattgc    225420
     cacaacggtc tttaccataa ttgattatga gaccttcata acggttgtta aacttcttgt    225480
     ggaattcttc accattgttg tgatttatat cttctactag tcttattgcg gatgcaatat    225540
     taataaaatt cacccagcag caatgactat ctttcaaata gtttatctgt tcgatttcac    225600
     cataggtggt aaaatcctta cgtaattgct cctgactagg aagtttgtat ctttcgtggt    225660
     actctttgta ctttggatca tttataaact tgtccttgaa cgcatactct ggtaaactaa    225720
     cgtatacatt tctgttcgcc ccgacggtga cggctaaagc aattgatttg ggaagaggac    225780
     cagattgatt accccagcca actcttagcg tgttaccatg taacactatt gggtctataa    225840
     atgagttagc acagaactgc gcagcagcag aagcttcgat aaaagtcaca aagcaaattc    225900
     tcttatcttc tatgaatttg acattttgta atataccacc tctaactaca ttgcagatat    225960
     cttccacctt tgatctcggg ttaatgttcc caatatacac tgtccggtta tcagcatcac    226020
     ctcccatggc agcagctatt ctggcagatg tattgagtct gtcctcaatg ctttgggtaa    226080
     taactttatt agtatgattg aaaggtgggc cagaaattgg ttcaatggga aacttgcctg    226140
     gcgcatcaaa gccacccaca gggagaccat tattcggaag cattacatgt gaaatggacg    226200
     gatcgatgta atttgaaaat ggagatccta ttattgagct atggtctgta agattgtcgt    226260
     gaaggtacat tcctgagtta ccttcagggt tcatcccatc atcgaatata tacatgctga    226320
     agttagttga tcctggtata tgatcatcat gtgatctaat ctctggtttg gggtaatcgc    226380
     ttctaataat ctttaagcat ttctcttcca gtttcaacga tgctaactcg tcagataatg    226440
     attcgagttc tctgtcaatc ataactgtgt tacctccgtt ggcaagattg acttcgctga    226500
     cactctttga gccttcagtt gagatatgtc ctaaaactgg agtagtagaa gattctctct    226560
     gcgatttaca accaggtaga gaaacgaaaa agcattcatt gacgctataa gtcattaaat    226620
     ttgcctttaa gtaatctagc acttctatag ccatttttat gttgatgaat gttaagataa    226680
     catagtttgc aggaaagtca tccgctgcgt cctctgcact tatgatatct acggcttcca    226740
     atatatacct cttgttatct ttgtcatcta gaaatggtag cttctcaaat agagcatctt    226800
     gttcaacctg tgaataaaac tctatagcaa ttgaacgtgt agcatcgtgg ctgaatattt    226860
     cttctccgag ggcaggctcc tttaataatt cctgtgacct cttaatgttg cgcttctcgg    226920
     tattgatatc cttgtcttta tctttgtctt tatctttatc ttcgtctgta acatagctga    226980
     aagatacaaa actcactgac agttttggtg acgaaagttt ctttttgaaa tctggtaatc    227040
     tttgtaagaa attgttgtag aaatctagcg ctgcttgacg cgacaggaaa ctcagttgca    227100
     agcagcaagt atctttatcc gattctttgt ccttggacgg tgtatcagtc tgttgaaaaa    227160
     cgtagacact ctccacctgg gagtagttaa tgattaatct catgaacacg gaaagcattt    227220
     catcattctt ttgcacattc tcaaacagca acgatctggt cttgtaagtg tcatcgccgg    227280
     agggcagcac cctgtagtta atggagatcg gggatataag tttcttcgtg acgtcaattg    227340
     gcgtcctctt cttgtgctgc aacttcttct tgccgtgaga gcccaccgag gagtccgtac    227400
     tgttcttctc ggccctcttc tgcgacatgg gcgcctgcga cagcgagctc cgcttgctgc    227460
     tcatgtaagg tgtgttgccg ttagactgca gcacaaaccc gctgttcctc ctgaactgaa    227520
     aggatctgtt gttccggttg tacccacccg cgagcagatc agcgttgttg tccctaggga    227580
     ggttagtggt ggagatcatc ggagagccca tcagcaagtg cgagggcagc agactggcac    227640
     catacgccgt gtcaaacgga gtcggtggca cattctggta tggagagttc atgagttgcg    227700
     gcggctgcgg gtgcgcatgc gcatgcgcat gcgccattgg gaagtacaga tcaggcacgg    227760
     aatagtaggt ctggggcaca tagtgcctgc cgtgcttctt caccttttca gtcatactcg    227820
     tatcctgttt agtatctggt tgctttccaa cttccagctc tgtacctgtt atatatccac    227880
     aaagtaaatc tttttttttt ttccttcctt tgaagagaga tcctttattt tttcctttgg    227940
     aggaactttt tcctgggagc tcctttgtaa caacctggga aatagctgga tttgcaagac    228000
     caacagcaaa aaagggcaaa aatggtatat atagacaaac tattgacaag acaaagaatc    228060
     tattagacaa agagaatgga gaagctggag ggagaaagac aaggaaagga ggaaaggttg    228120
     ctacaaggga aggccaccgt tcgggggatg ttgttgtacg gttcgttgtg gtgtatatca    228180
     tacttcatat atagggtagt gtgtaaaact agtatatttc taaggcgcac atcatggata    228240
     tgtggtctga tgggtactct cctgtgtacg gctgggagtg gttgtgcatc tgtgcatgtg    228300
     taggcatttg caagtagccc gcgatggcaa tgttgtttgc ggtctcgaat gttgcgggtg    228360
     tgcttggtct ctggttcacg tagaatatgt agtccagcag gccagcccat ttggtggacc    228420
     agctcgagag ctcgggttcg tggtggtctg cgatgtgggt ggggtctacc gtgtggtagc    228480
     cgatcgagta cagcgacgtg gcgcacaagg gcacgtcgtt gcatcgatca atcaggttgt    228540
     tcaccagctg gcgttgttcc tcggtagagt cgaactcatc gggtctcgga gtattccacg    228600
     gatcagtgcc ttggtcgtac tcgtactctc tcttctcttc ctcttcctct tcctcttcct    228660
     cttcttccat actgtactct ttgccgaggt tacgccgctc tgagtagcgg tacgcggtgc    228720
     tggcctctat ggaggtgcgt tgctgagtat ttagttgggc gcgtggctgt gtaagtacca    228780
     agtacgggac agagttgggt tgagagttga agtctccggt gaacatctta cagtagtcgc    228840
     ctttcaccgt gcctgcaaac tctagtatct tcttctttat gaccaaacat tgtcttgttc    228900
     tatcataggt accaaatgga tgccagaaca agtggaatgt gccaatgatg acccctgatc    228960
     tgctggttct tatcctattg tttcgtgccc ggaatgcatc agtgaaagcc aatgcaacaa    229020
     gcaggcccac attgtttgtc cttgtcctgg gctgtatacc agccggtgcc tctttgtcaa    229080
     attctatgtt catgtgactc tcaagttgaa acaactcctc cttccacgca atcataactc    229140
     catgactctt gctatcctgg tggaagtata ttgtcttgta tccaaatttt ggcagttctt    229200
     cagaccaaaa taagtcatat tggacatcgt ctatctcttg cagacagcag atatcggcat    229260
     tataatgctt gatctcatgt agcagaactt ttgacctcac aaaccatttc aatgcaggac    229320
     cgctttcagg aaacatctcc cttctgatca gggtttgtgc taggcagtta taagtcataa    229380
     tgctcagagg taagccacgc tcgtagttgt caccatgggg aaccagcaat atgggtctct    229440
     caataaactg gcactctgca gggaagtcag ggtccagtcc ccttgagagt agttcttctc    229500
     gcagtttctg cttcttcagc cgcctggcct cccgcttggc ctctatctct gccggcgtgg    229560
     catactttcc actggctttg tcatagccca tgtcattatg tgtattaccg ttgcgttcta    229620
     tcatagatgc atactatgtt gtgtattctg tagtcatact catcttctag gataaatact    229680
     ttatctagtg tatcaggagc gccagatagc cttagaagtt catacaccag gagctattaa    229740
     tatatgattt gctttagttg tgataccctt aaagctcatc ggtgattatt tctttttgtt    229800
     tctggaggga tccctgttgt accaagtccc tagatggcca ccaaaatata aatttcagga    229860
     actgaataag taacagataa caacacaaat gataatcttg tgcgatatag ctgttagaaa    229920
     tagtgacaat ttcaatacat agtctatcaa attcggtcgt tttatttaat catgctatta    229980
     agattctatc ttatgtatgt gtttccattt gagtaccgat acttataaat gctgtttcgt    230040
     gaataatatt atcttcttag tgtccatggt cgttgccacg ttaaagctac ctgttgttag    230100
     tcatatcagc aggcaggata tcgttgttgt tacgcctgga tatgaaactg ctctcctcgt    230160
     tgtcctcatc gtccgagaaa gcgatgctga aggaatcaac catcctgaag atatcgcttc    230220
     tgtcaagggc cttaccgtcg aaactcaaat caaaactatc gttagtagct gctggtggag    230280
     gctgcacacg ggagatatgc gatttcttct ttggtgtgtt gttgtccagc agatgtgttg    230340
     agatatcttg caggccggca aagttttcaa taggttccga gtgcaagaat ttgatcggtt    230400
     ggatcttgta gtaccttggc gtgtcaggtt gcaacaggaa cgaattatcc agtgcattga    230460
     catcttttga tgctaagggt gtagctaact tatacaccac aggaggtttc ttctgtttac    230520
     tcttgctgtt cttatagcta atattgacat tggcctttct atctgtgtta tcttctacct    230580
     tctgtactgg cccaaaatat ctgttcttca agttaggcgt ttcataattg cagggcgatc    230640
     tcggcagatc atcgatatct cttagctctt tatatttctt gccaggtccc gatagattag    230700
     cagttttact ccctgtgtcg atgttgttgt tcttgatagg tgacgatggc ataaccaggt    230760
     tcgagtttcg agggtttcta ttcagactaa ctttcttctt acgcccagtg gttggagaag    230820
     catgcacatg gttcggcagc atcaccggag agtacaagaa gggcgagaca ggattcgcca    230880
     tagcattcct gttactcatc ggaggagagc cgtatccttg tccatcgtag tagtaatagt    230940
     tctgatcata catgttcctt accagcatcg gctgctcctg aaacaccatc ttgttgctct    231000
     tctgcagact gctgtaactg gagccgggat catgatatgc agagccgctg ccattgccgc    231060
     tgccattgcc attgccattg ctgccagacg caatcttaga cccgcttgtc ttgttgttca    231120
     acgtcctctt ggtcggggaa tacataatat cccctttctg ccacgtactc atccttgtat    231180
     agctttggtt acgttcggat tttaaccact ataccaatga tattcgctca tcatacaaag    231240
     aaacaccgtc ttctataggg ttttggctct ctttatttgg aagggcaatt gagagaatcg    231300
     cagagtcata cagaacgtac gtgatcatgt gatttatcta caatatatat atacacatat    231360
     gctaatggag aagattataa gtttatacca tccgcaaact gtaccagtac agcattcggg    231420
     cttctgttta ctgtttgtga gtggtggttg aagatactac ttttgatttg tttgtatatt    231480
     tttcagtgag ggcttgtagt gctggatgga caagtgctct gccgagaaca cgggaaacta    231540
     atggacaaga tatggtacta taaaaccgga cttgtaatat tgctcttgta attctctcac    231600
     atctgttgag actagaagaa aagaacttgc tatccgagct ttgtccatcc aattctgtta    231660
     ctgggtggtt agagagacta gtatttcctt ttgacttctc actgggcgat cagtgttaga    231720
     actgatccgt tctagtggtc cgacaacgac cgctgcagaa gtcatatagc ccgcattctc    231780
     tttacaatga cttgcccgaa ttgtgtaacc ggagcctgtg aagctttcac cttccatggt    231840
     ccagcgactt actcttctcg atgctcattg ggtggatttt tcgatgttta gcacagatta    231900
     tcactcaaac atcaacaagg actcttcttc aagctgcgtt cgagtggtga gaagctacac    231960
     tctggttgac tgccaagggg agacggggaa tcatccatca gtacaaatcc ttagtacaag    232020
     gaaacctctc ggaaaacact acgtaatgtc ttttgctgca aatatcgtct tgccccttct    232080
     ttccttattt ctgcaactca atatcctcga gacacatacg atacccatcg attgctgacg    232140
     ggaggaattg gtatataaca attttcattt cgtagccagt cctgatactt ttcccaaact    232200
     cttcctctat tacagtaatc aggaattctt gggcgatttc cacttctgat ttagcatatc    232260
     cccgcaacca ccagcgtagt atatacaaaa ctatacagcc gataggtgga gtataataat    232320
     aacaaggaaa cgaaaaacac caaaccatgt tgagtgtgct gtccaagact acggttatca    232380
     agcgtgcacc gggcgctatt gcattgttcc caaggtataa ctcgacctcg tcgaagccca    232440
     aggagacaca aggtgttgag aagaaaggta ccggtcccac ttctttcaag actatgaaag    232500
     ttatcgaccc taactcccgc gataagccca atgtcgtgat actgggctcc ggttggggtg    232560
     ccatctcctt tttaaagcac atcgacacca agaaatacaa cgtgtccatc gtttcgccaa    232620
     ggaactactt cttattcact ccgttgttgc caagtgcccc agttggtact gtcgacgaga    232680
     agtctatcat cgagccagtg gtgaacttcg ccttgaagaa gaaaggtaac gttacttact    232740
     atgaagccga ggctacttct atcaaccctg acagaaacac cgtgacagtc aacgaggtca    232800
     gtgccgttga acaagtagcg ctgggcaaca aggagagcga gcaagagatc ggtatcgaga    232860
     gaaagagcga cgccgagatc aagtacgatt acttgattac tgctgtcggt gctgagccaa    232920
     acactttcaa catcccaggt gtggagaagt acggtaactt cttgaaagaa atcccacatt    232980
     ctttgcaaat cagaaagaga ttcttggaga atatccaaaa ggccaacttg ctaccaaagg    233040
     gtgaccctga gagaaagagg ttaatgtcca ttgtcgttgt cggtggtggt ccaaccggtg    233100
     ttgaaaccgc tggtgaacta caagatttcg tacaccaaga actaggcaag ttccttcctt    233160
     ctttggcaga ggacgtccag attcacttgg tagaggcttt gccaattgtc ctgaacatgt    233220
     ttgagaagaa gctgtcatcc tatgctcaat ctgtcttgga ggacacttcc atcaagctac    233280
     atctaaggac cgctgtctcc aaggtcgaag agacccaatt gttggccaag accaagcacg    233340
     aagacggctc cgttacagag gagaccattc catatggtac gctgatctgg gccactggta    233400
     acaagtgtag acctatcatc accgatctgt tcaagaagat ccctgagcag aacacttcca    233460
     ccagagcttt gaacatcaac agcttcttgc aagtgcaagg tagtaacaac atcttcgcca    233520
     ttggtgacaa cgccttctgc ggcttaccac caacggcaca agttgcacac caacaggccg    233580
     agtacttggc caagaccttt gacaagatgg cgcaattgcc taacttccac aagagcctag    233640
     cggagaggaa agagaaggcg gacctgttgt tcgaggagaa caacttcaag cccttcaagt    233700
     acacacactt gggtgccttg gcgtacttgg gctccgagag agccatcgct aacatcacat    233760
     acggcaagag atcgctatac accggaggtg gtctattcac tttctacatc tggagattgt    233820
     catacttggc catgctactg tcggcccgtt tgaagttcaa ggtcgtctct gactggttga    233880
     agctagcatt cttcagaaga gacttcttca aagatttgta aatacattgc ggttttctcc    233940
     tccccccccg tccttattga gccatcccat atttatttgt agtaagaact acgtgtcaca    234000
     tgcacatagt atgtaagaaa aatgtataac aagtatatat atatatattc ccccacccca    234060
     cacccatttt ctgttcgatt gaacagtatt taaaagaatg cacatgactt ttacttaatg    234120
     gagactactc gaagaactgg ctggccttct ttatgttttc ggacaccagc tggtgcgact    234180
     cgttggagtt gttgagcact atgaagcaga ccatgttgga ggacagctcg ctcacgtata    234240
     tgttgtcgtt cagcaccagg ttcttgaacc cgctcttgag cttggtgcag ctctccttgt    234300
     agttcttcat gatgctgctg atcttctcga accgtttggg gtcgagcttg tcgatggtcg    234360
     tacttgttgg ggcacttgta gttgttgttg ttgtagttgc agagccgggg tcgttgctgg    234420
     agcatatcac gagacaagtg gtcttctcga acaggatgat ctcgtaggcg tccatcacct    234480
     gcttcagctt cttgaggttc gactggtgca cggacatgtt cggtatcagc gagcacacga    234540
     tctgcgacca cgcgcggtac aggctctcgt cccagatgga cgttgcgaag cccacgaggt    234600
     ccgggaaccc gtagtccgcg gaggtctcct tcagcttctt catcatcagc cggaacagct    234660
     cctcgcgctt gtccagctgc accaggtcca tcttgtgcag cagcacgaag atcttcgcgt    234720
     cggggctgta cttccgcagc tgtctaagcg cccgcgtgaa gatctcgatg tccttcatca    234780
     cctcctggga ctccacgtcg aatacgtgga tcagcacctg caccatctgg aatatgtggt    234840
     ccttctgctt gctgaagtag ttctccatga acacgtcctg gcccccgcag tcccacaggt    234900
     tcagcgtcat gttccccaga aaccgcaggt gcgagtgctc cacatccatc gtgacaccca    234960
     gccggcgggt gtcaaacgca ctgtagttgc tgaagatgat ggaccgcatg ctcgacttcc    235020
     cggacccgga acggcccatc agcagcagct tcttccgatt cccgccgtca tccattgtcc    235080
     ttctgtactt ctgtccttct gtacttctgt gctatgagct ctgtgctatg aagctctgtg    235140
     ctatgtgctc ttgcgtgctt ctactgatac tctgagatta ctctgtgatt actctcagat    235200
     acaactgtaa tagaactcta ctctcagata caactctact ccgagataca actgtaatga    235260
     cgcccacaca aaccgcagca gacaacctca ggctattact gaagctggag ccgcttaccc    235320
     ctcgcctttg tacggcagaa aagggcaagc ttcgctgttt atatacacag aacacgtgag    235380
     attcagggta actacgcaca tggggtaccc cgagaagcac tagacacaga cacagaaggt    235440
     aagaaaccct gcagggaact gaaggtaaga aaccctgcag ggaacggaag ggcaaatttt    235500
     ttgaggttta gccgaattcc tcttcacagt gaagacactg agagcacgcg cagggatgag    235560
     agagaaaacg tgcgtccgca atccatataa gtgggaagcg ggctgaagaa agccccgcag    235620
     tggaaatgtg attgacacac agaacacaga aaacgttgct acggagaatt ctgcggggac    235680
     ctccccccac gtgtgggctc acaactcatc cgctgcagca aggcactggt gcgctaagac    235740
     tactgctatc gctactgcta tcggtactgc tatactgcta agactaagac taagacgagg    235800
     actgctgcta agactgctaa gactacaatg tgcggaaaga ggggcccaca tgcacgtgtg    235860
     gtcctaatct aatactataa gctcatctct aatatttcca attagtatgt cgatgcaggg    235920
     aaaaaaaatt tgtatataag atggagggta ttggaaggat aaactaccgg atccaagttg    235980
     ctaacccaaa gacccacaaa agaagaataa gccaaaacaa aggaaataat gagcagaaac    236040
     gagaaggacg agatcgaagt agacaccagg gagaagaaag tccctgtgca catcacggaa    236100
     ggtggtaaca tggccttcca caactacttg aacgatttcg cacacattga ggacccattg    236160
     gagagaagga ggctggcttt gcagaagatc gacgagaggc cgttcggctg ggaccaagtc    236220
     cgtaccattc tgatcgcggg tgtcggtttc cttacagact cgtacgatat cttcgccatc    236280
     aacttgtcta tatcaatgat gtcctacgtg ttctggcaag gtaacatgcc aaactccaca    236340
     cagacgctgc tgaaggtctc cacctctgtc ggtacagtca tcggtcaatt gggtttcggt    236400
     accatggccg acattgtcgg tcgtaagaag atatacggtt tggaactgat agtcatgatc    236460
     gctactacca tcttgcagac caccattggc cgttccccag gtattaactt cccagccgtg    236520
     ctgaccttct accgtattgt gatgggtatc ggtatcggtg gtgactaccc attgagttcc    236580
     atcatcacat ctgagttcgc taccactaag tggagaggtg ccatcatggg tgccgtgttc    236640
     gctaaccagg catggggtca gatcgcgggc ggtctggttg cgttgatcgt tatccgtgct    236700
     tacaaaggtg atttgatcta tgccaactct ggtgccgagt gtgactacgc ctgtcaaaag    236760
     gcctgtgacc aaatgtggag aatcctaatt ggtttcggtg ccgtcccagg tattatcggt    236820
     ctatacttca gattgaccat ccctgaatcc ccaagatacg ccctagatgt caaggaagaa    236880
     gttgacttgc catctaacat tgagaaggtc cgtgccactg ccgacgatga gcacttggag    236940
     gacctagaaa gatcatccac tgttgtcgaa gacggtatcg tcgtcccacc accaaagaag    237000
     gcctcctgga aggatttcag aagccatttc ggtaagtgga agtacggtaa gattctattg    237060
     ggtaccgccg gttcttggtt cgtgctggat gtggccttct acggtttaag tttgaacacc    237120
     gccattatct tgcaaaccat tggttatgct ggttccaaga acgtgtacca caagcttgac    237180
     gactccgctg tcggtaacct gatcttgatc tgtgctggtt ccctgccagg ttactgggcc    237240
     actgtgttta ctgttgatac cattggtaga aagcctatcc agatgatggg tttcatcatc    237300
     ctaaccgcgt tgttctgtgt cattggtttc gcttaccaca agatcagcga ccacggtctg    237360
     ctggctctgt acgttatctg tcaattcttc cagaacttcg gtcctaacgt tactactttc    237420
     atcgtccctg gtgaagtgtt cccaaccaga tacagatcca ctgcgcacgg tatctctgct    237480
     gcgtgcggta aagtcggtgc catcattgca cagaccgcct tgggtactct gatcgaccac    237540
     aactgtgcca gagacggcaa gcctaagaac tgttggttgc cacacgttat ggagatcttc    237600
     gcgctgttca tgctgctcgg tatcttcttg acgttgctga tcccagagac caagagaatg    237660
     accctggagg agatctctga gaagtaccac gacgaagtgg acatctccaa gctggcccca    237720
     gttactgtcg ccgacagcac ttcctcgtcc tctgtctcac acatggtttg aagaagagat    237780
     agggcctact tgcacagcat tcgggaattc ggaactttgg tatttctgag tttcaaaatt    237840
     ttacaattcg aacacattta taacaacctt gcactataaa aagacatctg tgaagaagtt    237900
     tctaattcac ctcatttaat tatatagatt ttgtacacta gaaccctatt ttaatttatc    237960
     attcatttca gttcagtaat atgcatatat atggtataac atagcgatat ccattgcagc    238020
     ttggtacaga gtagtaatga gatagcagga gagtgaaagc aatacagtat tctatcacga    238080
     cacgacaaga tcacaccacc cccacaccgt aaaacaatac aacacgcacc aaaacctgcc    238140
     ccgcccctgc ccattttacc cccgaatcgg gaaatatgta aacaaataac aagaagaggg    238200
     atcactatac actacaacac atgccagtac gtacatcaag atatgtgtct ggtctgtctg    238260
     tgtgcaaact gagaggaatt gagctacaaa acgcgaaatt gttagtgttt gactcagaaa    238320
     ctaccgcagg agtgtacatc aggaaatatt ttctgtcttc tcacagctgc tagtgctaaa    238380
     cactaacaca agtccaaaca tctaaaagct gaacgcttac cataagctct acaatacaaa    238440
     aagatactat tacttactcc caggcatcga gcaagttaca acagcatcaa agtcgatttt    238500
     gcacaaatga gagaggttat cagtatcaat gttgggcagg ccggttgcca gatcggtaac    238560
     gcctgctggg agttgtactc cctggagcac gggatcaggc cagatgggta cttggaagaa    238620
     gggctgacga agcctaaagg tggcgaggaa gggttctcta cgtttttcca cgagactggc    238680
     gccgggaagt acgttcccag ggccatatac gtggacctgg agcccaatgt gatcgatgag    238740
     gtgcgcacgg gcccatacaa ggacctgttc cacccggagc agctgatcaa cggtaaggag    238800
     gatgccgcca acaactacgc gcgtggccac tacacggtcg gcagagacct gctggacgat    238860
     atcctggaga ggatcggcaa gatcgcggac cagtgtgacg ggctccaggg ctttttgttc    238920
     acgcactcgc tgggtggtgg tacgggttcc ggtctgggct ctttgctgtt ggagcagttg    238980
     tccatagagt acggtaagaa gtccaagctg gagttcgccg tgtacccagc tccccagctg    239040
     tccacctccg tcgtggagcc atacaacacc gtcttgacta cacacaccac actggaacac    239100
     gcagactgta ccttcatggt cgacaacgaa gccatctacg acatgtgcaa gaagaacctg    239160
     ggcatcacca gacccagctt ctcgaacctg aataacttgg tcgcccaggt ggtgtcctcc    239220
     gtgaccgcat ccttgagatt cgacggttct ttgaacgtag acttgaacga gttccagact    239280
     aacctggtcc catacccaag aatccacttc ccactggtct cctacgcgcc aatcctatcc    239340
     aagagcaaag cctaccacga atcgaactcc gtgccggaga tcaccaacgc ttgcttcgaa    239400
     ccaggcaacc agatggtcaa gtgtgaccca agaacaggta aatatatggc cacatgccta    239460
     ctgtacagag gtgatgtggt aacaagagat gtccaacaaa cagtggctca actaaagaac    239520
     aagaagacta tccaaatggt ggactggtgc ccaaccggtt tcaagatcgg tatctgctac    239580
     gaaccaccaa cagctactcc aaactcccaa ttgtccgctg tcaagagagc agtgtgtatg    239640
     ctgtcgaata ccaccgccat tgctgacgct tggaagagaa tagatagaaa attcgacctg    239700
     atgtactcta agcgtgcttt tgtacactgg tacgtcggtg aaggtatgga agaaggtgag    239760
     ttcacagaag ctagagaaga ccttgcagca ctagagagag actacattga agtcggcgcc    239820
     gactcctacg gtgacgaaga attctaattg ctcagaatta tattattttt ttttccctcg    239880
     cgttcatttt tttttttgat cctctctatc ttataccatc atgtatcacc ttcttttttt    239940
     ctctctctct aaccaacttt tattttctaa tttttattcc ttctatttca cgtcaaagcc    240000
     ataatagcac acgaatacct agggggcctt tattaaattg tatttcttta ttttttttgc    240060
     ccgccgtgcc ctcaattcag aaatttctac tttctactta ttattatatc taattttttt    240120
     tttcctacta tactttctac ttatttagcg taatattaaa tcgtgttaat ccttcactcc    240180
     ggtacttcta gtactaatcg ccatgccttc acatatccct ctaccctggt ggacaatatc    240240
     ccgttgctag aaggtggcga ttcttagcta aagtcaacaa aaatcggtct tagtgattat    240300
     caatgttctt tgtccttcgg atccttctcg gaacattttc tcactaatct gaaaaattgc    240360
     aaaaaatagc tcatcgcaaa ggttcacacc atataataaa ggtttgaata tatctggact    240420
     ctctgcttag ttcttttcat gatctacagt ttacaaggaa tcaatcgcgc cagactacaa    240480
     cagcaatgaa cgaggaccca gttgtttaca agaacatatt agatgagcca ttacatggct    240540
     tgtatatccc aacggcattg tttctggtcg gtactgccat catgactgcg ctttctggtg    240600
     aatggaggat cctgctggcc ttgccagtgt tgggtctcct aattggtgct agattctttg    240660
     ctgctttcaa gagaagacgc tctctatacc cagacaagtg gacttccttg gagctcgaag    240720
     accagacatt gatctctaga aacaccgcga tttacagatt caagttgaag accccattag    240780
     aaacgatcga catcccaagt ggacaccatg tacaagtcag agtgttcatt gatggtaaag    240840
     aagaagtcag aaactacaac ccaatcagca cgagattcga aaagggccac attgatttgc    240900
     tagtgaaatc atacaaggat ggtaaagtct ctaaatattt tgcctctatg aaacctggtg    240960
     aaactgttga cttccgtggc cctgttggct ctttggtgta caagccaaac acttacaaga    241020
     acatcggtat ggtatgcggt ggatcaggta tcacgcctgc tttgcagatg ctaaacgata    241080
     ttataacggt tccagaagat ctgactaagc tatcgctaat atactgcaat gaaactgaaa    241140
     aggacatttt gctgaaagaa gaattggatg agatggctga aaagtacccc cacttcaacg    241200
     ttcactacat tgtctctcaa ccaaccggcc aatgggaagg tgaagtcggt catatttcta    241260
     aagaaacaat ggtaaaacat ttaccacacc cggccgatga cagcagactg ctgatttgtg    241320
     gtcctgaagg attcactcag aaggtttttg accaagctaa ggaaataggc tggaagatgg    241380
     actacacgaa gactaaaggt gatgaacaag tttttgtgtt ctaatgcaca atacagactt    241440
     ctagaataaa atatccaccg gaaggttttt tgaaatgtac cattgctgca tctatacttg    241500
     gcatcatgat caatagttag aatgcatgat ctaacgctat ttttataccc attcatgcca    241560
     ttacattcgc tgatctatag aattataaaa gcaaaactaa ttagttagtt attatgtaat    241620
     taatatcaaa gttactgtta caatatttcg tcctctaaga acatattccg tagcatgaca    241680
     cagtctcaat tgatctcgtg tcagcatatc aagcttgtgt gagataacaa ttacattaac    241740
     aatacattat ccatgtattc agaaagtact gcattcaaag gtggaacatc tgcaagttca    241800
     tggagaagaa ctggcttaat tgtctgacaa aatttagtac ctggcccctc attatcgtta    241860
     gaaaccaggc acaagaacga agctgctacc tttgatacgt cagataaatc gtctgtaaat    241920
     gtgattgaag gaaggttttc ttgtttggct ggtacaatat tatctccatc tttgaatagg    241980
     aatttagaag tattcaagtg ttgttgcctt agcaattctg cagattctct aatactgatg    242040
     gccttgtgtc ttggctgtat tccctttatg atgaatcttt tctttccagt ttctggctct    242100
     gtaaccacca ttgctgatgc atttctaaag gaattcgaga cattttttat aaattcaaca    242160
     gccggtaaaa gtttcctcga actttcacgc agttttggtc caaatctgga ttcatatgcc    242220
     ctccaaagcg caatttgagt aaattctgca tcatccattg attcaaaaca acatcttagc    242280
     caggtagtcg atctcaatgg ctcactcatc gaaagtagtt ggttgaataa ctcctcatca    242340
     acatccggca cttcttctgg tgccggaggt cttaaacgtt ttattaattt gacttctgta    242400
     tgctttagag tttcgtattg cggtaatttg acattataag ttaacagttt tggtatgata    242460
     gatataaaaa tggaaaatct ttttggatcg gagaaaagtt cttttattct ttggtttcct    242520
     ggaaggatat attgatacaa gaagtctaac gaagcgatga caagttcctc atcacattcg    242580
     atcaataaga aacagacaat ttgtgttaac gtatctggat taatgttatc cacaacgctt    242640
     tcttcatctg ccttagatct aacaagtagt ctagagagtg accttaatat cgatatcacc    242700
     attgatctat ccttagtgta acccaaaact tttaataacg ctaggaagta aggatcacct    242760
     ttcatagcag gagccatgta ggaggacatc gcttcaatca gatccagaga gtagtgtatt    242820
     atttcgttca gataagaggt gttagactca tagacggtcc attttggatc ataatctgcc    242880
     aatgaagcat atttctgcaa cacgaatagc aagaatttct ttattggttc atatctaatc    242940
     aatgcttgta cagagtcctg gtcctgggcc aagtttctta ggatcaaaag acaatttaaa    243000
     cctgcctgta gtttctccat agctgacgca ccgtctatca aaggttcatt aaatttgttt    243060
     atcaaatcaa ctagctgctc aatgaaacgg ttgaatagag gcagaagttc cttggatttc    243120
     tgtaagttga tcatgtatgg agctttgtta ctgtatgcca gatatttctt caatgcccat    243180
     ttaatctctt ctgggatacc acttaggagg gacatacgca tccggctgag atcatcaaca    243240
     cctctggcag tctcctttgg gatgttttgg aagatgttca agttagccag cgagtacgtc    243300
     ttgggatcca cactcatagt cgtgttgttg ttgtgctgcg attcaacatg cataccgctt    243360
     gactgctctc gactgacacg tatgggaatc gcgctgatgt gtctgaaacc ttccattggg    243420
     gcatcattct ccagcccgtt cacgctacct tcacgcaact gctgtacttc atagttcata    243480
     ccagtattat gaaacatttt ggcctggcta ttctgctcac taccttctta tacaacctaa    243540
     agctcaattg gcactgtaga aagctctaag aaaaaaaacc aaagttaaaa gtagcaatgc    243600
     acagtgatgc tggtacaatt atacttgtca agattaaggc aagtgcaacg atatgctact    243660
     aatagttgac tatattttgg tgtcttagcg tttgccaaaa gttgcgatga gaaagtttcc    243720
     cgggagaggc ttggtcccgt tgtacgtaca cactagagct ttataaagcc agctaataga    243780
     gaataaggac tatacccaag ggtattagcc aaaagacttg ttaatagcga ggtagattct    243840
     tgggtgtttg acatattccc catttctatt aaaatcctgg attcgataat tccctatgca    243900
     gttcttcttt tcttctgcat gcccatggga ccaacttaga gcggtgttgt agtatgaggg    243960
     gaggaccacg tagacagtat tacatacaag tgccttgcag aatgcactac catgggcata    244020
     tgcttttggg caaaagaaaa gaaaaatggc tagaacagta gtagtatacg tcatttttct    244080
     tctgagactc atacccgatt gtaaaattca ttgcaattaa tttagaattt acaagcatct    244140
     tcgatgcttg taaatttagg gagttacttt gattgctaca acggatcata tgttgagtct    244200
     actagcacag gtaattgggg gttgttaaga atctgtattt cccttaaatt ccaaacacat    244260
     ctacaatgcc caaggacaca aagctttggg cactctaggt tgctgaaagt ccttatagtg    244320
     atgcccatcc ctaatacaaa gaattatgga ataattgcaa tattaattag ttaaagctaa    244380
     tttaataaaa taaagtggat tacgggcatc tccctaaact ctaaaatttt atcttgaaga    244440
     acttgtatat aatagttagg attcttttgg tattttctta ttccttagtt ggtagtataa    244500
     ggattttcca ttgcaaaatt tgcttataac atagaaaagt ttactacaaa gttcttatat    244560
     tctaggtaga gaatttttac tgggagaata taacaaggat accaaataac tacacagcaa    244620
     actatgaaac tagttggagt ttatgctaca acgttagcag tgctggtctc tgttgatgct    244680
     ttgggcagct cagatggagc catcgccaat attagaaaca agttcaccaa gcgtgacttg    244740
     tcagagtatg tcaacgatta ctctgatgac ctagctcgca gtttctccaa gagcaaagat    244800
     gagttgatca aggaacttga agagaagtgg gagtctgcca aggatgccac tggctacaac    244860
     aaccaagggt ggtggaacac ctggggcagt gaccagtacc aattcccatg gctaggcggt    244920
     gtcgattccg ctaaatctaa ggccaagaag aagtcttccg aattgaagaa ctggttcttt    244980
     gactcctggt ctcaggactc gctaatgaag ttcttggcca agtacgactt gccccacgag    245040
     gccaaccaat ctaaggacca attgatcaag actatcaagg acaactttga caccatctca    245100
     aagaaattgg aagtctctgg ttactatcca tcctcctcat acttcgatga ctggtctaac    245160
     aaggatctac aggactggct agaccactac aagatcaagt atgatcagac cacggacaaa    245220
     agggaccaat tgatgagcct agttaagaag aatatctaca aagtctctga ggatgtggac    245280
     aacaagcgcc ttgacctttt gaaccaactc gaccttgcta agctggactt atttgacaag    245340
     gcaggtgaga tcaagggcac tgtgttcgac acctggaact ccgaccaaat tgagaactgg    245400
     ctgaagagcc acggtgtctc agtcaaggag aacgccaagg atcaagccga ctacttgaag    245460
     aacttggcct caacgcatgc caacttgttg aaggatgatg tcgagtggta cacccaggag    245520
     atgcaggaca ctgctacacc atacttgaag aagtctgctg acactgcatt gcaatactcc    245580
     aagagtagtt tctggaattt gttctcattc ttcaagagga agactggcga gaccgttgat    245640
     gctgtgagcc aatatggtat ggacacttgg gacagtgcca aattgaaggc gtacctggac    245700
     agctacagag tgaagtatgc caaggatgcc actgagcaac aactgcgtga cttggctgta    245760
     tccaccaaga acaagtggtt caagagccta ccaaaggaat acactgacga ctttgttagc    245820
     tggttaaaga ccaagaagaa caacatcgcc ggccaaggct ccgacacata cgactacatt    245880
     gtcaacgagt tgaccaacgt gcagaagggt gctgccaaca tgaaggacga cgtcgccaac    245940
     aagttcatgg actccttcca aggctggtcc acggacgact tgactcagta cttgaagaaa    246000
     gttggtgtga acgtcaagca aggcatgtac agccaggacg agctcgttgc catggcccgc    246060
     gagaacaccc agtggctgtt cggcaagatc caacctgaac catggtacaa gagagccgca    246120
     cgcagagtct ccgacacggc ctccatggta tacaatggtg tgctacatta agcatctcaa    246180
     gtttttacat tacttttatc tttgtctctt attaatgatt acaaattttt tttttttaaa    246240
     tatgtagttc atatctcaat aaactcatcc aaataacata cagttttatt ttttctttct    246300
     ctcaattata agcatatgat ccatgcgtat acgggatatt ggattgcatc ccatcatatt    246360
     acaaaactat tttccaaggc atgatttgta aaagattatt tgtaagagtc gagaagtcat    246420
     tactaaccca agtgatgtct ctaccttaaa cagtatcggg tttaacacaa tgcaccggcg    246480
     aaggtcccct cccccagggg gaaagcattt cagagagttg ccttgttcag aggcaatttt    246540
     gacatcttga atatgatcaa tacgatgcct tgatccctca aagtctgaaa aaaatttcac    246600
     tttttcgctt gtacgagcag tttaggcaga gcaggaaaaa aaatttataa tttcccttta    246660
     gcaattgatt gcatctatta aagaagggct taacataact taatatttaa ttagtatgta    246720
     aatttatatt tttgaagttg ttcataccca ttacaatact agtaatctga taataaagat    246780
     aacatataaa caataatgga tactcagaag gaaaataagt gtcactgtga ttgtgaccta    246840
     ctgctatgga gaaacccatt ggaaaccggt aaggttttcg gtaccacttt ggttgctttg    246900
     ttgatcttga agaaggtcaa ccttttgact ttcttcttga gagtcggcta cactattctt    246960
     ttgtctactg ctttgctaga gttctctact aagcttgttc tgggccaagg tctagtcacc    247020
     aagtatggtc caaaggactg tcctaacgtt gtcggcatga tcaagcctgt catcgacaac    247080
     gctttgaagc agatgccagt caagcaggcc aagatgagac aattggtctt cgctaactct    247140
     ccaaagcaga ctttcaaggc tgctgttgtt ctatacttgt tgcacaagtt cttctcctgg    247200
     ttctccgtct ggactatctt gttcgtcggt gacattgctc tgttcacttt gccattggtc    247260
     tacaagactt accaaaagga gatcgatgct gtcgttgccg aggtcttgaa gatcaccaga    247320
     caaaagaccc agaaatactc taaggtcgct tgcgagaagt ctaagccata cttggagaag    247380
     ttgggcccaa tcagcaagat ggtcgagtcc aagttgaacc aagtcaaccc accaaccgtc    247440
     tcctctgctg ctccaaacac caccgctgct aacatcgctg cagacatccc aatcaacgag    247500
     aacagacaat acgacaacac caacaccatg gaccaaggta tctctaccgc tgctcaaatg    247560
     atgccaaaca tcccagaagc tcacccaagc gccaccaagg aatttgacgt cgaccacttg    247620
     aaggatgaat tgaagcaaag cacccagcac ttgcaaaacc aattcgaaca aaaccaataa    247680
     atgatctgag aaaaggactc attctatttt tttttgaata ttttagattt aaaaccctcc    247740
     agcactgata atttattctc gttgttcttt ttcacctaca aacttgcatt actcttgaaa    247800
     tcctcatgac aaggacaaca attcggtaat tttatctatt ggaacccaca tacttcatct    247860
     tggaggctga ctatatctct caataggcat ttgatatgtc ccttgatgtg attacgcata    247920
     gaaaaaaaga aacacttttc cagaccgtac agtcactttc caagtctcat atgctagata    247980
     tcttccccac ccattctaaa tattattagg taaagaaaaa cacaacacaa tatagaaact    248040
     tgaacaaaaa tacatatata atattatgtt ttgctataca attagatagc aaatagattt    248100
     atgcactata caaaacgaac tggaaagtta acatattaat taagtgttta tatcttctct    248160
     cctctttttt aactaatagc attgaaataa taaagtaaag aaatacacag aagagtttct    248220
     attatggaag agtttaagat tgactatgtt catgagaaaa tttcatcgaa agcagacgta    248280
     gcataatata aatcagaaac aataataaca aatcgtattc acatatgaaa aataacaata    248340
     aataaatcta agaggtaata cttttcgcaa attctcttat gattactttt ctggatagag    248400
     aatgtaaaat aaaagaatta aaccctcaga tattcatgct actgaccctt tgatgaatgg    248460
     taataggaat agaaaacaaa ttaaaaaaaa ataataaaaa atagtcttat tagaattagg    248520
     aaaaataaca caaacaacaa aaaataaaaa cattcattct ttacaatcta taataaagaa    248580
     tcattagata ttccctcaaa aagtcgttaa aaaaacatgg tatcgtgtcc attaagatta    248640
     ccttattgat ggcaatggcg cctaccacat actaagtggt tagagcatat taggtaaaat    248700
     catgaaaaag aaaaaaacca ctgaaacaaa taacctagcc cggtatttat gcaaaatgga    248760
     aatgcatttt ttttatcttc atttatactc tcatttataa tttgacacca ctggaaactt    248820
     caagttggtc gataactggc tcaaagacgt tagagttcaa atcctcgttg ctgaaagata    248880
     gttgctcttc agtccataga tttggttctg ggacgaagtt cttgtcaccg acacccaata    248940
     gaccaccttg catttcccaa tctctgatac gtggcaattg caattcatta aagacatcat    249000
     cgactgcagc aatcaaaata tcagatagat cgtttgtgtg acctggggta ggagtaattc    249060
     tcaatctctc ggtaccacga gaaacagttg ggaagttgat agcttgaaca tagatgcgat    249120
     gcttttccat tagaatatca gaggcttgct tagccaaatc tgggttacca attagaactg    249180
     ggacaatgtg ggatgggtta ggaataactg gaatgccaag atcatgcaaa cctttcttga    249240
     cgtatgcggt gtgcctttgt tgatcttgtc ttaagttcaa gtgagaacgt tggaatctga    249300
     tggcctcagc agcaccagcc atgacagctg gaggcaaggt agtggtgaag atgaaacctg    249360
     gggcgtaaga tctaacccag tcgattagct tgctcgaagc agcgacgtaa ccaccaacag    249420
     taccgaagga cttacccaaa gtaccggtaa tcatatcaac acggtccatg actgttctga    249480
     gtctaccgtt gtcaccttgt ggtggagtgg cgatacctgc aacacggtgg gcttcgaagt    249540
     cacaatgctc agcgacaccg gcaccatgtg gaccgtatag accgacggca tgcacttcat    249600
     ctaggaaagt tagcgcaccg tatttctcag ctaagtcaca tatcttgttg atgtctgcaa    249660
     cagaaccagc catagagtag acagactcga aagcgatcaa ctttggagta gactttggat    249720
     acatctgtag catctcctcc agctgagcca agtcgttgtg tctgaagatg tgcttaggtc    249780
     tgttggcgtg cttaatacca acgatcatgg aggcatggtt tagttcatcg gagaagatca    249840
     ccaagtcctt caccttttga cccaatagag agatgacggc atcgttggca acataacaag    249900
     aggagaacac tagagcacct tccttcttgt gcaaggccgc tagctcagcc tccagtctca    249960
     tggttggaat gttgtggccg gcaatgtttc tggtaccacc tgcaccagca ccgtacttgt    250020
     cgatggtctt gcgcatagcg tccaagactt gggggttctt agacaaagcc aagtaatcgt    250080
     tggaacacca cacagtgact ttatcgtcct ctaactgacg gtgagccaag gggaactcct    250140
     tcgcaagcct gttgatgtta ttgaagtacc tgtacgactt atccagtctc ttcttggcca    250200
     actcgctctc gaagtggcct tcaaagtcaa agggcgtctc ctgggtacca tgggcagcaa    250260
     ctgtagaagt ggcagcggca gtgttagcgt tggcagtggc agtagatgct agtctcactg    250320
     acctcgaaga aacaatgcta tatgggtacg agaacgatgg cctcaccttc aacacaggac    250380
     ggaacatcgc aaaacagaac aagttaatac agcgcttttg tatgtgctat actctcctca    250440
     gaccacagac aaaggaacag ctcatcgcaa tctacttttt atacaatttt ttttttcagt    250500
     caagcccatt agaataattt ttcaaccttc ctgtcattag aaaagtgaaa aattcttagt    250560
     cagagcccaa acatgaagca acgacaaaca tcgcaaacag caacggagga tcgggattgg    250620
     acttacgagg tccagaacaa ggtactctgt ctaagttgaa cgaaagaagg caatcatctg    250680
     agttgtcact tgcattgaat tagtttaagc tttttttccc cgtgactacg aaacgagtta    250740
     acttctattt tagaatcttg caacattgtt aacagatatc actgattgta actgtaagag    250800
     aggtataaag gcagttgagt tcttccccct cacacacttc cgtttttatt gcagcttagt    250860
     agtggcgaca gatacaaatt gctgaatgtc gttgagtgta ttagtctatg gagatgatcc    250920
     atttgacttg ttcctggcat ggaggttctc gctagcgaag agcattgagc tctgtgtcgt    250980
     tggtagcaag tactcccagg atgttacggt gcggaccagg cagtatggga acggtggttt    251040
     gcaagtggac ccgaccaaag tgtttatgag tgttggcgat ttacttgaca gcagaggcaa    251100
     cgcgggtttc gatttggtgt ttgtgaatgc tgcagcttcg tcgctacatg cattatccaa    251160
     acgggtcaac gaggtgttgc ctttgttcaa caatacaaac acgaagcttg tgatcaacga    251220
     gtcaagtgcc atcaacttac aaaaatttgt cacagaagtg gtaggaacag ccattccaca    251280
     tcataacata tttggctacg taactgacta tgacctgagg tttacaatag actctaattc    251340
     tatccaacat tacaccaaag caggaaatgt taaactatgc gactcggctt ctgacaatag    251400
     catcctgttg gggtctacgg atattgacca aaggactgga ggatacacca cacatgcatt    251460
     aaacctactc caaactttta caaaattgtt ttcaaagctt ttaccaaatg atacaataag    251520
     cgattgcaac aactcctacc agcagtacca aactagtcag tggtcatttg ctataccgaa    251580
     aatttgtctt gaaccattgc tgattattct cgaagaattg aatccaacta acctaagctc    251640
     acatatatta tcaaaaccgt tgatcacagg tttgataaac gaagtcataa cgatagcatc    251700
     tcgttttgga gttcaactgc ctcagagata ttcctcagaa accgagattt tgaactcttg    251760
     gccgacatta ttccaaaatc agaatactct tcctactaat gtccactatt ttgctcaggg    251820
     acaaaacaaa ttcatcaatt ttgatgtggt tttgttacaa ccgatcctac tcgcagatga    251880
     cttaaacatt aagacaccat atctggaatt tctgtacact atgatccgtc aatatcaaat    251940
     tttaaatgca ggtaaatcga tatggtttca aagatcggat actaatcaaa aaagctcaca    252000
     aaatgaacag ctcttggaag aaaagttaca gaagttgaat gaagagcttg cttatcaaca    252060
     aaactatgct aaagaactga gtacaaaact tgatcaagac gaaaagaaac atcaggacga    252120
     attgaatgca ttgaaggcta gactaaaaga actagaaact caaagtagaa tgagtaatac    252180
     cagtatttct agaggatcag tgatggctga tgatactcta tcacaaccta tttcaaagtc    252240
     aatttcagaa tcgagaatta atggattaga caatatgtct tatttgaagg aaaaagaatt    252300
     agaactaaag agaaaagaac ttgaacttca agaacgtgaa ctcagcatga aaaagaagtc    252360
     gttaagttat gagcaaccac agaccaccaa cccacagcag tatcacatga tgagaaaaca    252420
     aaaaaataat tcctcatcta ggataccgga cttgggtaat aacattccca tctcagataa    252480
     tcgtccatat tcaaacggct cagtaaacaa caatccatac tacaataata gcagaatatc    252540
     ttctggccac agtatcccat ctgcttcaac caatgttatg aacaactatg tcggaaataa    252600
     caatagtgct ggcgggtacc ctcaaggcca ttttaatagt aatgtaccac tgaaaactac    252660
     aagtagaaag aatagacctg taacaatgca tagctttaac aatgtaccag gctatactag    252720
     taacgattac ggtggcagaa tgatgggtaa ctattctacc tctacatctc aaagcaggtt    252780
     taactctctt tcaagtaaca caatgcctat gatgcaaggt ccgaacagta acatgactac    252840
     ccctagacac gtttcaaacc cattcttcaa cggcaaccag caaccaagtc aaccaaatca    252900
     accaaagaac atgcctgttg ttaacagaat attaagtaat cagaacaact atcctactaa    252960
     taatgggata gcaccaacta ataatactac tgcgattacg tcaagttata acacactacc    253020
     taactcacag agccagcctg cgaatctaaa tacttatggc tctagggaac ctattcgctt    253080
     tggtaattcg gctccacctg tccaaactaa ccaaagtttc aataataaga acgtaaatga    253140
     tcaacagggt tcaaataata ctagtaatca atacttgaat gtacagcagc cgccatcgtc    253200
     acaggctgga actgtgacat cagagtcgag accagctagc tcgcaatcag gaagctttat    253260
     gaacctctca agcaatacca ctgcgcaaga tgttgcaagt gaaaaaactg atactgataa    253320
     aaagaagaag aagaagcggt ttggactgtt taagaggagc tgaaaagctt ataatacatt    253380
     aggaatagac tatataatta gcattcgaac ataaatttca ttaatacata taagttttat    253440
     tttcaataat taacgactat tgatgatgtt acaggtgcac ggtaggtagt attttcattt    253500
     acttcgttct cgtggtgata tctgattgtt tcttttatca acatggcata aaacagtatc    253560
     gaaatgcctc tttagggcat cttttctagc aaacttcttt ccacaattca tacatacatt    253620
     ctcttgttta ggctcatggg aggctctttc atgctttctc aaatctgtca acttgtcata    253680
     gcttattcca caaatattac aagggtatat tttctgattg cttcgccttc ttgtgtgctt    253740
     accattgtca tataggtaat taggcggctc tatcgatgca gtttttatac cagacttctc    253800
     tcgtcgtact tgcgccgtta tactaggaat tatttgctcc acatgatcat ccaaagacat    253860
     tggtattaaa tgtggtttga tgtgaggcac cgctacttct ttgttcatgt ttgtcagtct    253920
     caatgtcaat tcatggacta taagcgatgg cgtattacca gcattgggtt gaaatgatgg    253980
     agatctgaca taattgatgg catcagcagc aaggcgatag aatgcttcat cttcatcaac    254040
     actcgggagt ttattcctca ccatactttt atgagttagt gttaatttcc agtgtttata    254100
     gacattaatt tacttattca attcagtaat aaaatttgaa agaagctata taattgttga    254160
     tttacataca tggaaccata tatataaagt aacatctcct agtatactgt atataccatc    254220
     agctatcctt tggttgtcaa ttgtagtatt tttaaaagca taatagtcat tctaagaatg    254280
     tgtaagagaa caagatcacg agtccactta ttgctgtgga gggaaaggta cctattagca    254340
     gcagaattac aactataaga agaagcaaga tggtaatcaa gttgtaaaat acatctgtag    254400
     caacaatcag tgcatgttta aagtgtggaa ttagaattaa ggatctgaaa agaatatcat    254460
     atgggagggg cattagatag gatcattctt ctgattatta tgctctacat tgtacatact    254520
     gtgtagcagt caataaattg aatcatatct acaaaaatat atccagggcg tgggaactag    254580
     atactataat ccacagttca gagtcaacgt gagtttcacg tcacgacctg taacaagctg    254640
     tgtatcgaca ttggaaggga aaggccactg caataaccaa ctctcaatgt tagagtaaca    254700
     taatagaaat cgaacccaaa cccatcacaa caaatatcta aattttgctg aagcacgctc    254760
     tagccaaata tatggtgcta tactcttact tccagcaaac tattatcatc cactatatta    254820
     cactttggtc ttacacattt ctaatcatgt gacctaaacc cgccaaagtg tgtgttgtcg    254880
     ttgtgttgct gtgttaatga ctctctatct tttagttcct ttttcataca cagaaacttc    254940
     agtaggaggt ccatatttac taaaaatcgt gaagaaaaat atttggcaac aatgtaatta    255000
     gtataagatg atatggaaat ttgcacgcga cctgcttact atcgtgctgt acgttagctg    255060
     tataagtatg tacggtgata ttgtgactat acgtacaaat gtatataaaa cgcgatgagc    255120
     tataataccc aaatataaca acaaacaata tttgaatacg tgactatatt agcaactggt    255180
     tgggattagt gctattgata cacgaggtgc ttttagatat ttcttttgtc cttttacatg    255240
     ttattgctat attgatcaat attatgaact gatttggatg gatacaaagt acatacacac    255300
     ttccaaataa gaaaaatgga actggaagac acgtacgtgc cgaagttgaa ggatgatatt    255360
     atataccgga agctgaatag actgaaagtc gatcagcttt gcgagttatc ggtgaaatgg    255420
     actaggaaat ttggcgctgg cagccaggat cccattagtg tcgaggaagt gaaacaaact    255480
     atcgaaggct acctagcaca acaggtcaat aaaaagacgg tgattgcaca aatgatgtat    255540
     gtgtactggc ccatggggct caatgcatat caattggcag agatagactg tatcttgctg    255600
     atggaaagac cagcgaatta ttcatggaag tccaaatatt tgaaaaactc attaacagga    255660
     cagaatagca atttctcaat gaatccaaag aaattcgtct cagctcttaa aaatgaacta    255720
     actaaattat acctcacaca ctttttctta tgccagcatg ctgtacttcc tgtgctaatc    255780
     ctgcgaatac agtcatatga tacaaataat ctctttctat catcggtcaa aagaaacaga    255840
     atcatactaa atgaagagat atttgaacag aaactcataa aatcaaaaga gaaccaactg    255900
     atctccagga aaccatacta tcttgtattt ggcataaaca cgcccttcat aatacattcc    255960
     ccagagaatg atatatatgc atccttcatc cacgactgta tagaaagagt tctctccttc    256020
     agggatccga taatactcga ggagaagacc aaaacaccaa tcctaaattt ggaaaaaatc    256080
     ttaataatcg acggtccttc tagatatagt aaagcaatgg gccaatggag taaatatgct    256140
     gaaggacagg ttgaaacaac gccatttgga gatatagaga gccacgaatc atacaaaggc    256200
     agaaggatac tggtaaggaa gatacacgac ttagatgacc ttgatgaggt gaatcatgaa    256260
     gatagagata ccaaaagact cagactacag aaaaatatga taaggtttaa agggtcagag    256320
     aacggtatta tccatgaaaa gatttttgag ataaaaaaaa agattgataa agtctacaat    256380
     ttaagtcaaa aacagtctaa tatcttactt tcaaaatata cctctttgct acctatgaaa    256440
     aaggcacatt atactgttac taatgataat tggtctggac cttacaataa agaagatgag    256500
     gatgtagata ttgccattat tgagggcgaa tctgataaag gttcccaatc aatttcacta    256560
     aaactaattg gcaatgatat ttttggtggt ctgcatgagc tttgtgaccg taatttgatc    256620
     gatattgaac acatgcctgg ttggctgaca ggtgaaaatg gtgcatcttc tggaataatt    256680
     aaaaataacg aattcaccgc aactgtttca ccaaaatccg gaattattta gtatttgctg    256740
     tggttaattt gattgtgttc tttctataaa acatatatat gtatgtatat gtcaatatat    256800
     tctgtaatag tactactaat ggaacgataa caagaattaa ttcaaccgaa agttagcagc    256860
     atctagacca ttataaagtt aacctttcta gtgtttgcca tagatgtatt cacaggacaa    256920
     taagggcatt taaatgtgag cgaaccattc tttgacaatc tatcaagtgc cttctttgag    256980
     ataatgtgat ggcaggccag cgaatatggt ggattttcaa ctgttgtttc ttctttgaga    257040
     acaggacata taaatatcgg atgaaagtga gaaagaaatg gaggcaactt aacatcgaat    257100
     ggtaattcat cttcagtggt ccaacccaca tgtgctgtac tcctgatatt tttatatttt    257160
     atgaaaaact ggaaagatat tataccactc aagacaatca gaaatagagg tgagtgatga    257220
     gggagattca aatatgcgca atactccatt gtaaaaatcg acacgcattt gtccacctgc    257280
     tctttcaaaa tagcgtcaat atcagctact ggcttaccta ttacactttt agtcaaaagt    257340
     ggagctattt tttgtattat gtcgtttgct ttgtcgttaa agtttcctct gggcagaaca    257400
     ttggtaatgt atttgaaaga ttgtaatgca tctccttctc ttaaaacctt taaaaactca    257460
     agaatatata actggaactg cagatctttc aaggtcgtta atccctcttt cgaaatcgtc    257520
     tctgaataaa tttgatcctc acttacatga tttatccaat ccaaacatct gtgagtactc    257580
     tgggtttgga tgttttgtat gacttcaccc atatcaataa acttatctga catttgcgga    257640
     ctgacaccat atagactctc aagataattt attaatacat ccttactatc cataactggt    257700
     aaagatttca tatgataccg gcaaatatga tatcctatgg cttccttgac gtaactatga    257760
     gcatcttctg gtaacttgtt aagataaatc tgatctatct caatctttgt aagtctattt    257820
     agaaaatgct tatgatatcc agtcagagct gattgttgta acttatggct ttttcttatt    257880
     gaatgctcga actgcttatg actcctgttt attttatcta caatcaagtc cttctttttc    257940
     tgcgactttt tctgatcttc aatgtgcccc tcctcacaat cattaatgta tttatttaaa    258000
     tgtgctctaa gtttcttcaa ttgtaatttg aactcttgtg tgtcttccag acatttctct    258060
     atgtgggtga gccttctcgg ttgttcatct tcctcaaatt gacggtagaa ctttgcgtat    258120
     tcgccttcca cactggcgag taacttagac attcttgcta acagcagcta gtttagtact    258180
     gttatctaat gattaactgg cccccatatt ggttaatatt gggacgaaag ttagattata    258240
     tatatactga attgcttaga ggtgcgatta ttgtttaagg gctaaaatcc gattgatagt    258300
     gtgggacgac tcattgttaa agttatagag tccttgcatt gaatcacaac atcgagcaaa    258360
     accatgtgaa atgaaatgat agtagatgtc tattagtaat gcacagcaat tagttgctag    258420
     aaatactatc tgatcgttat agttgaagaa ttaaaatcaa agcgaatact tttaaatata    258480
     aaaacagatc taaataagtt aaagaataaa tgaatagctt atagtcaaga gtagggaaaa    258540
     catgaattac acgtctgtgt taggtgggct gcaataatgg gaaatgcatt ctatactatt    258600
     ttttttgttg tgaagtttgt atgaactgaa aagaagaaaa tcaatcgaac cgtgtagctt    258660
     atttcataca ttatttcttt tctgcgaaga attggttttc gcaggcagag ataatggcag    258720
     gaacaacatc agcattagcc aaagtagaca aatcacctag ttggtctgct tcattggaag    258780
     cgatctttct taaaactctt ctcatgatct taccagatct ggtttttggt aggtctctga    258840
     ccaagataat acactttgga gaagcgaatg gaccaatttc acctctgact tgtagaatca    258900
     actctctacg taagttacta ggagtaatat gttcagcatc accttctggg gcatcatttt    258960
     gtaggtagcc ttccttcaat gatacgaatg caataacagc ttgaccggtc aattcgtcat    259020
     tgataccaac cacagcggtc tcagagatat tctcatggtt aaccaaacag gcttcaattt    259080
     ctgcagtaga taacctatga ccagagacgt taacaacatc gtcaactcta cctctgatcc    259140
     agtagtaacc atcgtggtct ctaccagcac catcacctgt aaagtagtaa cctgggtatg    259200
     gcttcatgta agtgtcgaca taacgaacgt gatcgttcca gacagatcta gccatggatg    259260
     gccatggtga tttaacagct aaaacacctt cgacatcgtt tccttcaatt tcaacaccag    259320
     aaactggatc aatgatacaa gcatcaatac cgaagaatgg aagagtggta gaacctggtt    259380
     tggttgggat ggcacccgcc attggggcaa tcaaatgaga accggattca gtttgccaga    259440
     aagtgtcaca aacaacacaa ttgttgttac caatcttttc gttgtaccat tcccatagtt    259500
     caggagaaat tggttcaccg acagaaccta ggacacgtag ggaggacaag tcgtacttgc    259560
     taatttcagc ttcaccaaca cgcttaatca atctcatagc agttggtgca acgtagaagt    259620
     gggtggcctt gtgacgttcg acaattctcc agtatctacc gtaatctggg taagctggtg    259680
     tagattcgaa gcagatagtt ggtacaccta gcaacaatgg accgtataga gcgtaggtgt    259740
     gacctgtaat ccagccgaca tcaccagcag tgaagaaaac atcctctgga tgaacatcga    259800
     agacgtactt agtagtcata gcggcaccta gcaaataacc accagtagtg tgcacgatac    259860
     cctttggaga gccggtagaa ccagatgtat atagtaggaa tagtggatct tcggcatcac    259920
     atggaacagg tggtagatat gatcttctct tgtcagcttc ctcgtgcaac cagaaatctc    259980
     taccagcctt cattggaata ccttcagtac ctgttctctt gaaaaccaaa atacgagaga    260040
     cttgatcgac accgttcaaa ccttcatcaa cgattttctt caagtggaca gtcttaccac    260100
     ctctacggcc ttcatcacaa gtgatgacaa ccttggaacc agcatcgact acacggtctt    260160
     tcaaagaacc agctgagaaa ccggcgaaga cgacagagtg gatggcacca agacgcacaa    260220
     cggccaacat agcaataata gcttctggga tcattggcaa gtaaatggca acagtgtcac    260280
     ctttcttgac accccagctc ttcaagatac cagcaacctt agatactctt ctcagcaatt    260340
     caccaaaagt gatggtatag ttgtccttct cgtcgtctgc ttcatagata atggcaggct    260400
     tgtctgggtt ggcaaaggcg tgtctgtcca cacagttgta agaggcgttt agtttaccgt    260460
     ttaggaacca agcgacatca ccttgctcta gagaaccgta cgatacttta gagaatgggg    260520
     cgtcccagtg caatagttca cgagcctttt cactgaagaa agtctctggg tcctcaatcg    260580
     actgcttgta aagtctttca tattcggaga tgtcctttat gaaaccacct ctgcttggct    260640
     ggctcttgta gaaatgctct ggagcttggc gagcaacagc gttctgtgct tcatgcacag    260700
     tcttatgttc ttttaatgtc atttatatta ttgccttgtg gtcaagtttt tgtaattgac    260760
     tttttcactg tattagaaaa aaaagattac cgagacaact tacaaacttc tataaagcac    260820
     aggaagtcca aatgcgaatg caattgacag tacgcaattg ataaagaatc gcttacagag    260880
     tttgcaactc tatatatatc aacatgtgaa aactgaacct tttttttttt caactgtcct    260940
     cgggccgtcg atgaaaaaaa atatagtgtg tgctgcactt gtgtgtgact ggactaagat    261000
     ggacaacaat tgtaagtagt gcaccaatcc tgatagagtg agagagacac cagtgtatga    261060
     cggccagcac ttgtggatcg gaattagtat aatcgcgagc actttaccaa ttgaatcctt    261120
     gtagtagaag cagggcagtt catcgcactg tgcaaatggg aaaaaaaaga aagaaaggtt    261180
     ggtctcttgc aaatggcctt acaattgaag accacaagca acgattcttc tctgtgggca    261240
     cgattcgaca aagtacaggg acggaaggga atccttcaga ccaaagttct tgcagagtaa    261300
     cctggtagag aactatgatg cgtcatgttg cccattcaat ggtaaacact gcccaaaaaa    261360
     aacacatgat acatttgatt ctcttatttt gcgtgggtat tatgtgatcc tgtaaatgac    261420
     aaggaacaaa tgctcgtatc ggactgaagc aaatgccagt agcaccaaaa tctattttga    261480
     tttggaatat cgacacttct ccccgtctgt ccgaaaggac agttttcaca gacaagcacc    261540
     aagcaaataa cgacctctgg ggggggggga cttgaaagaa tttcacaaga cttcagttgt    261600
     tatgatatgt gaaaggcagc gaaacaggct ttgggacatt tctgaccttg gaagtaaaaa    261660
     ttctaatacc tttgttgagt ttggaacaat ccttagaaaa gcagtgtctg cgttttttcg    261720
     gagatagcag gttcaaagct caaggagaac atccaaatag gataaatgcc aagtttaaaa    261780
     gtactgcaaa aaaagccaaa aagtagcctc gctattctaa ccgataaaaa tttcatatgt    261840
     aaacctgtag ctactcatgg caggcgatga gatgagatga ggttggaatc aaaggaagat    261900
     cctttaaacc gatctatttc ccagtgaaaa aaacccaact acttcctcta taatcagttg    261960
     caatgacact taccgatagg aggctaggac cgataaacgt gatttaaagt atacacccca    262020
     ttgatccgat tacaatggca tgtttggatc atacgccgaa cagatagaca attgacgcca    262080
     attccatgac tttgaaatac cagaccgaaa aaaagttaag tcttagttat atcttatata    262140
     tatatatata tgcttctgat atagaacact tcgtgttcat cgaggggact ttacgtatag    262200
     ttggagtacc acaccccaat tttactagca cattcttata tcgaagtcac tcctacaatt    262260
     ctctccaaat tttattaaac ataacaagca aatctcgaga agtttccagg tgtaagtgac    262320
     tttataatat caccagttgt tggggtaaag gtcatctatt ttagtaactg ctaaacagca    262380
     acagattctt accgttatga ctgagtattg ttgattaaca gattacaagg agtagataat    262440
     gtatcacgtg tctatgccct atataactta gctatcctta taggtatcca gactactctt    262500
     ggaagctgtt gaagtgtaca atccacttcg gattttctga ttatcgaagt gcctatttta    262560
     tatagtacat tctcgttaat atattcatcc tatatgatat gactctcgag ccaagattcc    262620
     tggagtagtt cgatagcagt gggtctcctc tggtaatcaa gctcgaaggt cttcctgata    262680
     aaatcccttc cttgtggaga ggcccaggat ggtatctccg gtgttacatt tgtacctatc    262740
     ttgaataatg cctgcatctg tgagaaatct ggatatgggt gctttccagt aaacatctca    262800
     attacaacac atcccgttga ccatatatca gcttttgaag tagtagcagt ttgttttaca    262860
     acttctggag acatccaata cacagaccct tgcaaagagg tcctcttatc ttgattctcc    262920
     tggtttagtg gtgaaagttt cttggagata ccaaaatctg tgatcttgac acaacccttg    262980
     atatcaatca gaatattggc acccttgatg tcacgatgta tgatattttt cctatgcaag    263040
     taggcaacac caattagtat ttgccttgta aaattgacaa tcaacggctc ctcaaagggc    263100
     ccgtaattgc ttagcattga tgaaacagaa ccaccaggaa catattccaa gaaaatattc    263160
     aggttgccac cttcttgaga tgacccataa tatgttacta tattttcatg ctgcagttct    263220
     ttcaacaaac tcatctcgtg ctgtaacgca tcaatcattt tccgatgcaa gttagttgaa    263280
     ggtgcctttg caacattttt ctctgcattc ttatcttcaa catttgcatc tgctgtagct    263340
     gcaatagctg gcttaatctc gacttgctta acggccatta actcaccagt ctgtgcattc    263400
     ataccaagat atactgtccc aaaactacca gaacctattc ttgcaccttt gagccagttt    263460
     tttggagtaa ctatctttgt aggtaaagaa actgtaccgt gctcttcatc agaattcata    263520
     taataatcgt ctatactctc tgtctcttcc attaatttaa tcttaccttc attatcctcc    263580
     tcttgtggtg tggatggtgg tattacttca ggtttagatg atggtgcatt gttgttgtcc    263640
     aagctttgta gtagagccat gtcaaccgca ttggagtgct ttaatagaat gtcaccgaca    263700
     cgatttgatt ctgaactgat gtgtctagag ttgttgcttt tcatacttat tctagcagat    263760
     tgacggtagg actctctcag ggccttttct aacctctttg tatccgcatg tgggaaatat    263820
     cctgcaatat ttgtggatat aaactcacta ggaggtcttt ggtcaaatat tttccgtagt    263880
     ttatccttac cttccttatg tatccttaat gtaccatcct gagtaactgg ggtgtttggc    263940
     atgccagatt gtgcatcata ataggattca atatgattga gtgctgttat agttttcaga    264000
     tataatttct ttgatgcatt gatcgctcta tcagtcggag tctgatcctt tgacacaaat    264060
     atcagcctgt tcttctctac acggtcattg gaatggcaaa ttgtaactag ttcaatatca    264120
     tagagtaatc tcagcacgtt ctttgaatag tcaacgataa aaacatcata gtcggaggat    264180
     tcttgagtag tttgcccatc tgtattaaca gccagaagat tagaaggtag ccttttaatc    264240
     aaacgcttct ttatagagtc tgcattgaag catccactaa tattaacctt cttggctgac    264300
     ccatcattta atataaatat aacacaatgc ctctctgtta tgacttcttc attaatattg    264360
     gtactggtag tggacagttc actaatattc gaaattagct cttgcagttg ttgaacatgc    264420
     ttcgcatcat cttttggttc ttgcagtttc tttgattcct ttaggattct gatcctatca    264480
     ccaagcttct tgaccccaat ctcgagcaaa atatctcgat ctatgtgcat gaggtcattg    264540
     atgtcagtca agctgtattc ttcaaacaag tctgcatatt gagagcagcc tgctctttct    264600
     aaaaactcaa tatgggacat gagatataac actcctcagt taatagatta taatgaagat    264660
     tgtagtattt gagtagtata gtgtagtggt aaagattgtt cctaatataa tcagtactac    264720
     tcatccagta ccttaacact attactttta ctattactga agaatcatgt cttcggaatg    264780
     ccaaaattca cattcgatga gtacgagatg atgtatagta aaggcaaagc ccacttctta    264840
     aaacagctat aaatagcccc aggatatcaa ctgatttata ttcctatttc catagttata    264900
     tccatactta agatcaaatc ggttgtttaa tataaacctt gagattaact atagaaccaa    264960
     gtatgagtga cggtaaggaa gataagccca ttaaggttac acttgatagg ggtggcaaga    265020
     aagttgaata tgacatagag aagttcagaa accctcatag agtgatccca cagcggattc    265080
     caaaccagca gacaacaaaa gacgttcatg gtaaggaatc caataatggc aatgcaggcg    265140
     ggttgctgca aaatgatgga cacagaccag gcaactaaat actgcaagta atcaattgcg    265200
     catttctaag aaaggtaaaa ccaggcctcg agccaattct ggtcgtagct agtatatcta    265260
     caataattgc tggcaatatc atgtgagtgt attgtgttgt attagtgtca tattgccctt    265320
     taatggtttg tatgtacgcc agtatttcat tttaaaactg ctagcagtgc aggtatttgg    265380
     ctagttgatg agactaatgt actgaagtaa caggcacgtt aaaaaataat tttctctgtc    265440
     aagatcagat ccttgagctg taacatgtca agttcatcct ccctatgtgg tcaataatgt    265500
     ttaaaaattg tatagaatat atgaggttca taaccctagc aataagatac tagagcgtag    265560
     cataagctgc taatggcgac actgctggcg ggcagtaaaa gtactgatta tacttgacat    265620
     ggcagaagag gataacccat ttcgcaagcg atgaacctaa ttaactaact attttgatca    265680
     attagatatt ttcgtgtccg tgaagttgct ttgtgcgcta ctttctctgc agccggaaca    265740
     ccattatgca tgaaaaattg acaactgtaa ttgtaacttg tcaatcaccg atgagtcttt    265800
     gtttctaaac agcagactat ttatagctga caatatgaat taaaatataa tgcatagctt    265860
     ttattatgat agtgtgattt gtcataaggc tttaccattg ttagccacag aggtttgatt    265920
     agacacagtt accgttatct taggtggtac atagaagtca attgttattt atgaggctcg    265980
     ggaggataat atcgagacgt aaggtgtttt tccttttatt tactgggtta ttggttttat    266040
     ggctcgagaa atttgtgttg aatatcagta agtatcacca caacgatgaa ctgaaagctg    266100
     gttatgacct taaagttctg gatactgcca gacaatggat ggagcaatca aatttgaaaa    266160
     atatcaagca tgatgatgtt atggttgtga attatggaac aattaaatgt ttccacctag    266220
     gtaccaaata cgaaagatgt ttgaagccca agcatttcca caataaacct agaatagtga    266280
     cgaactctat aactgtgaga aaggatttga gaggatccta tggatacaat ttaataggta    266340
     tatccgagta tttctttttt gaagttgtta ggtttgatga attcttgtta tacggtaaac    266400
     ctttggatgt acttgtattt gatgcgacgc caaatttaaa tctgggtgct catcatatac    266460
     cctctgcaac ttttaaagaa atatccttag gtgaaatact aagagataac ttctttgata    266520
     tcatatcaga tgtgaacatt ttatttggtg aagatgctgt cgatcctaga ccaaactggc    266580
     acttggtcaa aagctctcct tacttgtctt ataagcatcc ttctttcatg tcttatatga    266640
     aactgggatc gcaagaaccc gaatacacaa aatctaaagt gctagtcaaa aaggaacatg    266700
     aagatgatgg atttaagatt gttcaactgg ctgatctgca tttaggagtt ggcaagaata    266760
     gatgtctcga tgagtatcca caccatgata aatgtgaagc agattcaaaa acattaaagt    266820
     ttgtggagga ggttttagat atcgaaaagc ccgggtttgt tgtgttttct ggcgatcaaa    266880
     ttatgggtga taggtctctc caggatagtg aatctgttct ttacaaggct gttgacccag    266940
     ttatcaggag acgtattccg tgggcaatgg tttggggaaa ccatgacgat gagggaagcc    267000
     tgtctcgttg ggaactctct aagctggcga tgaagttacc ttactctaga tttcaaattt    267060
     ctccacatga tacaaaagat aacacattcg gtgtaggaaa ttatgcacat cagatattct    267120
     acgagaatga tcctgaagtt gctgctttga gtttatactt tatggatagt cataaatatt    267180
     ccaagactgg gaaaatatac cttggttatg actggctaaa agaggaacag ttggaatata    267240
     tacagtcgtt atatgaaaga ggtatgaaat cacacattaa agaaaatata cacagacatg    267300
     cggctatgac attcattcat atcccactcc cagaatactt aaatctggat tctaaaaagc    267360
     gtcctgggga atctaatgaa ttgattggca cttttaagga aggagtaaca gctccaaggt    267420
     acaactccgg tggactagtt gctttagata aaatcggagt tgatgttgta ggctgcgggc    267480
     atgatcactg taatgactat tgtttgcatg atgactctac ttcaaacaaa aatatttggt    267540
     tatgttatgg cggtggagct ggtgaaggtg gctatgctgg ttacggaggt acagagagaa    267600
     gaatccgcac ttacaagttt gatccacaaa ctggtaaaat aacaacttgg aaacgattaa    267660
     atagcaaacc aagtgagatt tttgattttc agatagtaaa ggactgagta atatgaccta    267720
     gatactgtgt aaactgcatg atattttcat taaacgctct taaggcaata tggaattctt    267780
     ccttggattt agttgatcga gattctggga aactcaaacg atacttacga cccacgatag    267840
     tttcactacc ttgaaataca atatcgaaag gaagttttct ctgtattatt ctgtatgaat    267900
     atattacgat aaataatgaa taaaatccca gcattgcatt tatgattttc acagattttg    267960
     gatactcatt atatctgtcg taaatttgct cgatagaaac tctttcaaga ttcttgcaaa    268020
     actcttcaac ttcgatctcg tcatcatcaa actgaaacga tattaagccc acgtctttat    268080
     caaataagaa agtattcttg aatacattta ttaattgaat caattttttt ttctgtaatt    268140
     tctcaatcgc ctctttggcg tttgatagct ttgagtaaat attagcatat tcatccctgt    268200
     atgtttcaat attgctgtca acatcattta gttcattccc atcatccaat tcagaaagtt    268260
     gatcctttag cctctttaac ttttgtctct ttatctcaca tctactttca atcattttta    268320
     tgttttcctg atatgtatct agtattccag tgcctatatt atgtgttgat ttaatcagcc    268380
     tctctatctt gtttgtggaa atctgctttt cctccaccat atcgccagta tactgagtga    268440
     gttttgacaa tttaactaga gaattaaatg gacacattct cttacgattt ttattgttca    268500
     tattagcaac ggggcttatt tgtaaaccag tataacgaat attcttatta gggagggcgt    268560
     accatccatc tatcatttct atcataggca aattctgttc catggtaatg tgatcatctc    268620
     tttgattacc aatgtaagtt aactcatcca agttcacagt gtgcattgca acaaaacacc    268680
     atagctcatc ctcatcatgc ctcagtaaga agctcggaat cttcgcagct atctttattt    268740
     caaacagcgt gcacaactca aattctttag gtatgactaa ttctgtgaaa tgcaaggacg    268800
     acaatgatcc agtctccaat tcactgacat agaatggctt tcttgatcta gtgtcctcca    268860
     atacaataaa gcatggaata aagcctaccc ttgagccaat ttttttagac tcatcaatta    268920
     acgatatatt gttgacagag atggacttca aatgtcgaag atgcctcttc aatagatatt    268980
     gtggcatcta aagcatatat gttgttttga ctctctcctt tacctaattt actcagatat    269040
     tggctatcaa agggccaaga taatagtatt tcagtttttt attcaaaaat aaggttctct    269100
     cgcctgcgat gatctgccaa ttgtgataac cagatcaata aaatgaggta gatggtctta    269160
     gtatatacag ttcatattat tgtgatataa atcaggatac ttctttaaga aatacacaca    269220
     catagatata tatttgcttt tttatgtttc tcgcatgctc caattttgct aagtccgagg    269280
     aatatttgat caattataca tctcaaacat ttagtttaac ttcagcatcg ttgatgtatt    269340
     tttggaatgg ctgcaaggcg ttcttaacat ccttaccaac aaatttttct gtttgttgag    269400
     gagctctacc aacaaatgta gatggatcta gcaattgatc caattcattc cagataggct    269460
     tgaaaaactc attggccttg acacgttcga tcaggtcatt gtcaccacct tgttctttta    269520
     ccacagcagc agcttggtga gacaggactc tgatttcttc atgcacttct tgcctagaag    269580
     cacccttttc gaccatagcc ataatgatat tctcagtagc catgaatggc aactcactct    269640
     taattcttct ttcaattacc tttggatata caactaaacc tgaagagata tttagaattg    269700
     tagtcaacaa gatatctgtt gttaggaaag cacttggtaa agagattctt cttatagctg    269760
     agtcatctaa tgttctctcg aaccattgga cggaagcagt ttggacagca tcactgaata    269820
     gagagcccaa atgtctagcc aaagaacaaa cacgttcaca acgcattggg tttctcttat    269880
     aagccattgc tgaagaacca atttgggatt tttcaaatgg ctcttcaact tccttcaagt    269940
     tggctagcag tctgatatcg gtagccatct tgtgggcact ggcagcaaat gatgataatg    270000
     gtgcaagaac atcaatgtcg atctttctgg agtaagtttg accagtgact ggataaacag    270060
     tgtcaaagcc tagaagttca gtaactcttt catcaagttc ttcaactttg tcatgattac    270120
     cgtgaaatag ggccaagaat gacgcttgtg taccagtggt acctttaaca ccacgcaaac    270180
     caatatcatt tctagctctt tcaaagtttc tcaaatccca tagtagttct tggatccata    270240
     gagttgctct cttacccaaa gtagttaatt gagctggttg gaagtgagtc caacccagaa    270300
     ctggtaagtc cttgtactct agagcaaatt tagctaaacg gttgataaca ttgacgagtt    270360
     ttggaataac aatatcgtat gcatctctta ggaagattaa atcggcattg tctgtgacaa    270420
     aacaagaagt ggcacccaag tggatgatac cagccgcagc aggacatgtt tcaccaaatg    270480
     tatgaacatg ggccataaca tcatgcctga caatagcttc ttgttcacta gccttggcaa    270540
     tttcttcatc tgtaatttcc aagtgggcct tcatttgttc aatggcctca tctgtaatga    270600
     catcaagacc taattccttt tcagcaatgg ctagattcaa ccataacttt ctccatgtag    270660
     agaacctgtt tctcaaagag aaaacagcag acatctcctt agaagcatat ctggacgata    270720
     gtggggtagc gtacttatca aactcagaca ttttcaatag taaattcctt ttattattat    270780
     tccaataatc aagttaatgg gagattatgg tgtaagaata gcaaatttga ctgcaacttc    270840
     gaacacaatg ataaaaacgg tgccgatgat ttacttgtaa ccgtaagtaa aaactaatca    270900
     aactctatga agaaattgag tttcttacaa gtagactaat tgcaaataga atacagagcc    270960
     tatatataag agtttggaat tgaataatga agagttaaag agagtaatag attaatatta    271020
     gaaagatcca gataaattaa ttaaaagata gaaagtaaat gatgagctaa tactacaaat    271080
     tgctaatgct acaacgaagt ttacccaatg agacacactg taaatgttag ggtggggcct    271140
     tcaaaaaatt aaaacgagta cgaaatgaaa aataaaggat aatttaaatt gcattaatgg    271200
     atgaaatttc gcagaagtag aaattaaggc aaaagactga gcaagtttga gtagagaaac    271260
     tactgcacaa tgattggcat tgttacttta gaacctgact ctgtcaacag tactttggaa    271320
     caaaattatc aaaaattcca agtgaaaaaa aatggtccaa aaaaaaaaaa aatgatatga    271380
     tgagcaagca taggattcaa gtgatgagct ccgattgtga gtgccatcgt cctgcattac    271440
     ggctaagaag catgcataaa tccattgtaa tagaaatcaa gttaagtact ttctgccaaa    271500
     cgatgagaca tgaatgatgc tgaaggcctc aatgagtgta atgatgtatg aaataactgc    271560
     gttactgaat catcttcatc cttttttgtg gtttgtgctt cttctttatc aaattcctcc    271620
     tcttccactt gttcgatgat gtttctcgta tttcttttgc ttctttttcg aatcacgggt    271680
     attacttcct caaattcctc ataatctaac ccatctttag atgaatttgt taaggtgttc    271740
     atcgatagtg ttcttacaat accggaatcc atgagacgct cattgatgct aacactagga    271800
     ccagtaaacc aaagtatctc ttcctttgtc cttttcctcg gcattaaggc atcctctttc    271860
     tgtcttctgc tttggttaga tatatcggat gtttgcaaca caccagtatt tttagtgatt    271920
     gacagcggaa gtacgtatga atgtggcaag gatactatct gttgcccaag gcgagtatgc    271980
     ttactagctt cattggctat tttgtctgca attgtagcgt ggctgtattt ggccgcttct    272040
     aaattatgtg tgatttcacg ttgtcgttga tttgcaacaa actgtgccac atgtctagag    272100
     tgaagatcgg atatattgag aggtcgattt gttttgttta gattgggtat tgggacattt    272160
     tcctttgcca gtgaaaacgg cagcgatgca ctttcattat tgttaaattg atagttattc    272220
     tcaatgtgat tatctctcat tgtgtttagt tttgtatggg aaggagtcat acgagcaaga    272280
     tttcccattc caccacttac aataatcgtt cccatatcat tgtcaatctt accctcaagt    272340
     ctatctttag gatcgttagg tctaataata tgcttaggac aatcgtcaga agtagagtac    272400
     tcacctaaat cgtctctatc tagttttgaa cgcatataga cacctcccac aattggtgga    272460
     gcattaggaa cacctaatgt aggatctggt actgggtccc tagttgttga gtttggaggt    272520
     agaagatgtc ttatcggtga cggaaattta aagaatttcc tacctgtaac aggaattgtt    272580
     tgctcctcca catcacgtat ttcctctggc aagcacgctc tccatgtcct aattttgttg    272640
     aaagccttgt cagattcatt atacctatac tcacaaacaa acagaggacc atcaatattg    272700
     atatctgggt ctcctctttg gtacctggtg aaatgtacga catagcattt accctgtata    272760
     tcagaaactt tatgatctct atactgtcca gatttaacta cttcggtctt atagaataat    272820
     ctatcaactc tgtgaacagt ttgttctggt ctataatacc agcatgcatt aagccattta    272880
     gtacctgatg ttccctcact ccaaaacttg aatatctgtc ctacgattgg cttagattca    272940
     tcatttctat ttttgagaag aacccaatca ccaacttgat atgttatgcc atttacaatg    273000
     acttcatcta atggacatcg aaattctcct tcgggcatgt aatcggtatc tggcctagac    273060
     aactcaaatt gtgctagctc gttaaaagat ttttcaaatt tgaaagagcg cttcagctca    273120
     tttggattat ttttgttgta tgttctataa tttgaaagca ttagtttgat atcattatga    273180
     aacccctcaa agtctttgta ttttcttgtt tttactttct ttcttatttc atctagagat    273240
     attggattcg atattattga gtaatactgt ggattgtaat ttctatccgg tattttctca    273300
     aaagaatcta acaatgaccg ccttctttca tcaacttcct ttcgaattac ctttaagaca    273360
     tttttcattc tttgaacgta tggcaaatct atgattggag gtctacctct tttcacgtat    273420
     tttttgactg gcttctcgga atggcgtaac cctaaaggat gaggtgtacc ggatggagat    273480
     ggcgagaact tagcatgcac gcgcctttgt ttgtaccttc ttccggaatc ggtgtattca    273540
     tcatcatcat cgcctttacc ataatctgta taatggtcat catcacctgt ttcagtatgg    273600
     acctcattgt tactgtcata cgaatcggtc gtgtagcctt ctttattact agttttacga    273660
     gtccttataa gtactttgtg cgatttagct tccttttcta gcctttcttt gcgttcaagt    273720
     tcttcctgtt tctctttttc tttgattaat agcttttctt ggaattcttg gtagcctggc    273780
     tcatccggtg tgggccccag atatggtaat tctagcttag gatatttttt ctttaaatta    273840
     ggatagaccg tttcattaat aaatttttct agcgtcaacg catatttata gatctctgat    273900
     tccttagtgt tgtaaacttt cgcattccac ggtatatgta ctaggtcgtc cataaactgt    273960
     tgagcattag tataggttgt cagcctcttc ttaagagtgt ttatagatat aggtttcttg    274020
     atgacgtcgt aataatctgg gtaatctttt cgtggaggta aaacagtaaa cactggagat    274080
     atatttacat tttcctcatt gataacattg tacaatctca gatattccgg tcgaagattc    274140
     tcttgtagtt cttttgtgtt ggccatattt attgtcttct tatgtgtatc ttcctgacca    274200
     agttaagtgt atcaatattt tcagatttaa atttttgtct tttctgcgct taaaaagttg    274260
     cccgatggat tcgatggtgg tctatagttt gagaaaagac agttaacaca gagatgggag    274320
     taatgaattt aattgcgaga gtaatggttt gtctttggta ccactaagag ggcaactgac    274380
     ataaagataa tagccgggta ttaaaacttt tcttgccaac tgacactttt gagaaaagct    274440
     gtttatgcct aacacgaaaa aaagtcaagg gagcttatat attgaagtca cgtggtccat    274500
     tacaatagat atgtattcgc aaattgtaat gacatatcca ttaattcaaa tgcaaaattg    274560
     ccatctatag tagagttgct tatttgtaat ttgttttgtt tttagattta aaaattcttg    274620
     ctaggttaaa ttatctatat tatttaaaga atgcaaagaa tatttgattg tatataaatt    274680
     acaaataaac aaaattacaa tgaaagagca gcaaaagaga agatattagt cttcgggaca    274740
     atggtgtgct gtgatactat tagatgcgta gttgattcca ctatataacc atagtgtgta    274800
     ctgtgaaccg tttacaacct aatggtcgct tcccgttcaa atttcgctat cgagtagtat    274860
     ttcttcgcaa atgtctcgaa actgacgttg aaaacttgat ttttataaga aattagtaga    274920
     atattattaa agtaaaatgt gagttggcat ttttgtttta tcttgttttt ggattatgat    274980
     aacttattcg tgagatattt tgtgcgattc cttactttct tggtaatcta gcacttcgat    275040
     atcattagag tggatattct ctccatctga agaatcaatt gaatcgtcgc ctacttcact    275100
     ttctgggact ttaatgattt gcattctcca gaacccatca tcaccaagta cttccttgga    275160
     ttccaatctg taatggcccc atcttggtag taatttggcc cataccaacc agtagaaacc    275220
     accaaacgcg aagatacccc aagcgaccac acagtgaatc cagtatggag cgtgctcgta    275280
     gacgctttca ccgtgggttg gtgggatata tggagcgacg atcaggtaaa cattagacaa    275340
     catgaagaaa gtagtaatga agacgccggc cttaataggt gggttccatt caatcttgcc    275400
     ttgtcttctc tgccagtaga tccatagcaa acccgcggag atcacgaaat tgacaatgtt    275460
     cattgggtaa gagatcaagt tcaggatgat gttataagcg tcacctggag gaggagccaa    275520
     gatagtgatc atacaaatga tgaaatgttg gaaaaggcca accattgggg agttgaaagg    275580
     cttggatgta gcaaagaaat tggagaatgg caagacacct tcacggccaa gttgttggat    275640
     aattctacct tgggagaaga tgactgacat gacattaccc agggcactta gaccaacaag    275700
     ggcagcggca actctcttag catgaccacc aaaacagata tcgaagaaat cagcggccaa    275760
     gatcaacttg gaagagatca gtttatcctt tggaaccaca gcaaagtatg cgatgttgac    275820
     aaagatatag atgatggcca aacagatcaa agaagtaggg cctgcgatct ttagagttct    275880
     cactgggttt ttgacttcac ctagggcgta atttacgttg gagtagccga cgaaggacca    275940
     gatgacattg tacaaggcgt tgaccacacc gtaagcggta gccttgttgg taccttcgaa    276000
     cgcgttgtgg aagttatgcg actggtatcc gtgcttcaaa ccacctgcaa gggccaccca    276060
     gccggtgatt gagatgaaga taacgatacc caacttgaag acaccgagca cattttggat    276120
     gtacagaccg gctctaacgt tgatggagtt gacagcgaaa cagaagaaca ccacagctac    276180
     accaatacct ctttggttcc acttagtcac ttcggtgtta gcggcggtca agaacatcac    276240
     cgcggtgtta actgagttcc ccgcggccca acctaggaaa aaaacatagg acgcatacat    276300
     gcatgtgatg aaaaactttg gtttcttgaa gatggcttcc aagtagttct tctcaccacc    276360
     atttctcggt atagcggtac cgaattccat gtatacgtat agacctgcca gggcgatgag    276420
     cgcacccaca gcccacagga tcagcgccag accgatggag ccgctcagag tgtaaatcgt    276480
     agaagaaacc gcgaagacac cggttcccag cattctgtta cagatcaacc caatacatga    276540
     gataagaccc agtcttttct caccttggtc cagctccgtg gcgaactgct gtccagtctc    276600
     gaaatcagac gtatcatcct cagacttctc cgaggacgag aatttgtaat tctctttgtt    276660
     gaagatattc aactgtgaca agaaatcaga cattgtatgc actgttttct gttctgtttt    276720
     actatttact atgttatctt tctcttctat acatctacac attttgatat caatgttgta    276780
     atggatatct gaatcctata tatattaaat ttttctttgc attcacaaga cttatcagca    276840
     acttcctgac aatgccacag ttcaaagcca ttagactcta tagtcctttt ttaacaaaat    276900
     ttggatgaac atagatgagt ttcttttgga tccaaaagtg aataattagg actcatatct    276960
     caagtacgtc cctttccgat caccgacaat cattatgggg gtttatggta gagacttttt    277020
     tcactgatgc ttcgggtagg acgtcccgaa cccattcata gcccgatgaa gtgaatccac    277080
     agcacatctt taggactttc taagatccac atctctgctt tctctgatac cacagttttt    277140
     catctctggg cagaacttga ttcacttgtg ggtttgcaag tgtctatcta ttggtgtctg    277200
     taactgtcaa ctactatatg ctactatatg ctactctatg ctactgtctg ttactgtctg    277260
     tgtgtgtgca tcttccagct tcggagttaa acacttccgg gtaacataca cagttttcag    277320
     agtattacca gattcagcct ggataccagt gcagttcgag cttctacagt tctgtgtgtg    277380
     tgggggtgtc ttccatctct gccgggatag ctattgctgg ggagagaggt tagagggaga    277440
     gactcccccc taaaccccac acacatatac tcatatacac aatactatta atgcaggcca    277500
     ttgtgtgaag gataaacttg gcaaattgtg ggtgttcgct gtctgtctct atcttttact    277560
     gcagttcttc cccagctgta catctgctct ctgcatccct ggtgccgtgc ccattactgt    277620
     ggaaactata cttctgtgtg tggtacctgc tatgtgtggt acctgctatg tgttggatac    277680
     ttctctactc agccatcgta ggacagcaat aaagtgccac ggctagttcc ttattgggat    277740
     agtttacctt gttacccgga gtatcttgtg gtacgttata tcgtgactta tacgtatttg    277800
     atgccttgat acttacgcaa gtaatatcaa ttctcagctt aaccactatg ctcctttatg    277860
     tcccgctttc tcatgctata ttcaaagtaa tctcaagtac caaggatatt tgtttcattg    277920
     tttgtgtgtt tattttttct tcaagaatat agatatataa aagctaaaaa cttatgaaat    277980
     ctttcaagag tgtcaaaaaa aaaaagctat aaatgttcgc cagaaacacc aatcactgat    278040
     tgaatgaatc ctactgtagc aatgacagct gtagctacag cacgtacctt gatagactgg    278100
     gtctctctcc tgacaacttc gtcggccttc tgcttctcaa agtccttctc ggcttgtgca    278160
     atggtcttct caataccgag atcaaccaca ctctcgctta gttctccacc gttctctgca    278220
     ccaactgctg ctgctgctgc ataggatatc tctgctttgt ctgaagtctg ggctgcatct    278280
     tggcctactg gtggagggct gtgcttctca tcggtgatct tggtctcctt caagttgcgg    278340
     agttgcttca accagtatct cttggacagg aacatgtata gcgatgtggc aggccctgtt    278400
     agtgccgcgt agaccaggta tgggtgtcta gcatacccgg gcgagctgaa gtataccaga    278460
     ccaaagacaa cagtcgcaac aacgtttaga ccagtgccca ctttgcacag caacgtcctg    278520
     accaagtcgt gcttggaatc attggttgga gtgactctgt cgttcacaac cagtagtgtg    278580
     cccgcactca cgatacccgc atataaccct agcgaggaaa tagcaatacc tttagtaact    278640
     gttaagcatg tagacatctt tgttattcgt gacttctata cactgtttaa ttttcttgcc    278700
     ttttcaatgt atgtttcaag atatatcttt gttcagtaag aatattaata cctatatttt    278760
     atatacccca gctccagtat aattattact gaagtccaaa caattaatag tcaactaccc    278820
     cccttgcttc ccggttgtta ttagaaccca gtaatctgct cttcacctcc ctcatcgccc    278880
     tgaacaaatt aaaatcccta aaaaaataac ctgggaaagg ctaattcgat tgctaacaag    278940
     agacaagaaa tttgacgtac aatgcaagac actttctctt ttacggtgct aagggtatga    279000
     tgaagtgatg acaagggcaa ctatcgggtt aatgagacac tctcccttcg tattcttgac    279060
     ttgcgggtct tacagtatct caagaacact atcttttatg tcttatggtc ccatgatctc    279120
     taatatcata aagagctgca aaattgcatc tgagatatac tctcagctct ggtatacggg    279180
     tatgtcattg aactcctagg tatatttcag caaatgtatg ttgtgactaa gtacaaattt    279240
     attaatatgc taaattgtta cattaatatt tccattttgg ttttagatag atattaaaaa    279300
     tagcaaataa aagatcagaa acgccaaact ccttcaacta acccaaggga tttccctgtc    279360
     gggaactcgt tctgctccat acttgtcgca gtgttctctc aaatgtgagc atacgcattt    279420
     tggaggttta ccgaccttgg cagccaaatc atcagcattc caatctagga atttggcgtc    279480
     ggaaccatcc cgcaatatct ttaaaatata gtcaaggacc cctctcacag tcagaatgta    279540
     actagtgcaa tcagattcac tgaaggacag ctccatgtaa tcctcgtatg aatcgttttc    279600
     gtgatcatgc gatataatgt tccatgatga aatggagttc ggggacatga cgttgacatg    279660
     aaccataaaa ctggtctctc tgtcccatcc tagcacttcc cggtcaaaat gtaaagcact    279720
     ggatagagac agtagattgt atttaccgtc tttctcttcc attataacga gatgtggtct    279780
     atagaaatca gtagccccac cacatttttt tatatggctc ttgatcatgc caacccagag    279840
     tttccgacca tctagttcag gtataccttg tggcactcgg ataaatgagg acccacctct    279900
     caaatccttg aattcaacct tcttgagact gtctatctcg tttgccttaa acacaaagat    279960
     gcaccttccg tcatcaagag aacagcgcaa tattgtagta ggaatcatgt attgaatcac    280020
     atgaacgaac ccacgggatc catctgagga agcatcaccc tcatgaaaga atggagtcca    280080
     attcttttgt gttccagaaa tggagaatgt tttgtcgact agcggcacga taggattgat    280140
     tttcctgtgc ggtagtatca caaacatcaa ccttctatca tagtttttat cattcatgtt    280200
     gtatgccact agaggttctt gctttccatc tgtattcgtc ctaacaatta cctttgggtc    280260
     ttcaggaccc ataaagtcca agttcccttt gtttttgaat gggatatcta gaattgttgg    280320
     gtagactcta aaatatttat cagtaagttc ctgtttctcc tcctctgcta gcattgctct    280380
     ctcttctcta ttcttgatac aagagttggt atcggcttct tggtttgact ctataccacc    280440
     ttcttctacg ttggtatagc aatcctcttc aacgttatac ttctcatcta tggctttcag    280500
     ttgttcctcg aaatcttctg gtgtctctac atctaggtac ttgatacgtt ttccatacag    280560
     ctcattccaa tctttatcaa atgcttgggc ggtaatcaac gatactgacg ggtgtgctct    280620
     gttccttccc ttagatatga ttaatctgct gaaggcaaca tagcattgtt cttgctctag    280680
     ccattctgcg gtggttccga acataaacca cttattcttg aacgttgatt ctatgggctc    280740
     atctcccgcc ataccttcca ggaacttata tatccttgcg ttggtatttt tgattatttc    280800
     attaaatact ttaaaattgg gtctaatggg gtacgtgaca ttaccatgct ctagcatggc    280860
     atcatgttct atatgtttgc acgattgcaa ctcatctata tccgttggta tgggacgatt    280920
     ccccagatag ttgacaaatt tgaactgttt gtaatccatc ttcctgaaat tactcaccat    280980
     gtgtgctaac gtcttgcggt tcttccaaga catgtcgtgc gaaccctcag tctcgcaggt    281040
     agtattgcgc gatgtggata ttgtcctctc gtatacatcc ggtattgtac tcagcgacag    281100
     cagacatagc acagagacta tcgcaagcac caccagcctc cacgtcacac gccaaggttt    281160
     cttctcaccg aacaggagag acatagttgt ctttgtcttt agctgtttta tatataaaga    281220
     tatatatatt ttatactgaa gggctcttat taattgcaat ccccaaggac taagctaata    281280
     ttcaacctta ttatattata tttgttttca taaatagaga cagagctttg ttcaagaact    281340
     aggaagtact tttacactcc ccatggggca atattgaaca gtaaagcaaa caaaactgac    281400
     tctattgcga tgccctctgc actttaagga aattggaccc tcatttgact gcacagacag    281460
     aatttactga tctacggttt gaatgcagcc aatgcaaaaa aaaacgctcc tacggcagtt    281520
     tgtctcggag ttactttgca acaatgtttc cacaaaagat aaggaacaca caaagcaagc    281580
     agctactacg gtttctgaga agcagcagaa ttattgttca tttccttctc atactagcac    281640
     ttcttccttc cccttccccc ccccacctta cagtaaacgc cccctagcaa acgacccacc    281700
     agtcccacac aaacagcgat ttggccctgt gcccaccatt gcccagcttt cccaaccgtt    281760
     gcgttccact gcaccttaga taaaccgcag aggagatctg gtacaggctc tttttcgaag    281820
     gaatgatttc gcaggtgagg aggtgaggag tggggtggtg agctcggtac aatgagcctt    281880
     ctggaccctt ggaagggaaa gcagcgtcat ggcatttgtg cttcctgctc ctacgccaag    281940
     tggactaccc gaatacaata acagctataa atacacgttc tttgtgctga attaagaggg    282000
     tcttgggtct agattaagta tttatatact attatgtcta actttttaca taaattactg    282060
     taaccataat ctctttctct attattttaa gctcacgtct ttggacggag tttgccgtac    282120
     gcctcgcaat gctctctcag atgggtgagt acacaggccg gtgcggttcc gagtctgaga    282180
     cccaaatcct tggactccca atctacactt tcactgtctc ctagtacttg taagatgtag    282240
     ttcagcatgc ctctaaccac aataacacta ctgttacaat ctgcctcact gaatgaaatc    282300
     tccatgtagt cttcgtactt ggaatggaca tgcgagacaa tatgccacga tgcaattgaa    282360
     tttggggaca tgatattgac gtggtacatc gctgagctgt gcatatccca gcttagcact    282420
     tcacgatcaa agtgtatcgc actagagtac gacaagatat tgaacttgcc atcagtctcc    282480
     tccattagta ccacatgggg tctatagaat tgagaagcac ccccacagtt gtttaagtgg    282540
     ctcttgatga tactgatcca gaccttccga ccatttagct caggtatctc tggtacccgc    282600
     ctaaatgacg tcccgcctct caaatccttg agctcttttt gtaacttatt gatcttctcc    282660
     cctctgaata catacataca caccccatca tcaagagagc atctcaatat cgttgtaggg    282720
     ataatatgta atgcaacatg aatgaaccca cgagacccat ccttagtaac atcaccatcg    282780
     ttgatgaaag gcgtccagtt cttctgtggc ccagatatac tgaattcgtc gtcaatcaag    282840
     ggcactatag gatttatctt ccgatgtggc ataacggcaa acattattct tctatcgtag    282900
     ttgtcatcgt ccatattata gacaactacg ggttcatgtc gtccgtctgc atttcttctg    282960
     ataatgactt tgggatcttc aggacctcta taactaacct ctcccgttag cttgaatggt    283020
     atatctaaca cagtaggata gactctaaaa tacctatcaa tcagcatacg tttctcagtt    283080
     tcagcaagct cctttacatc atcactaatt ggtgtgcatt tacttgttcc ttcagagtta    283140
     atatctgatt ttgtataccc accatcctct tctcttccca gacactcctc aacaatgtta    283200
     tacttggcat ttattgcttt caattgttca tcaaagtctt cgggtgtttc aatgtctaca    283260
     tatttgatac gtttgttgta caactcattc caatctttgt caaacgcttg ggctgctatc    283320
     agtgatactg acgctcgcgt acgagtgtcc cagtcagata tgataagtct gctataagaa    283380
     acatagcact gttcttcttc tagccattct gcagaagatc caaacatgaa ccatttttta    283440
     gcaaacgtag tatcaatggg cttgccattg gtaagctctt gtaaaaactt atataatcgg    283500
     gacttcgggt ggttgattga ctcactgaaa actgtgtaat ttggaatgat gggaaccgtg    283560
     gagttactgt attccaaact ggccttgcta ttataattac aaggttcatc ctgattgaac    283620
     ccagatggta tcgcttgatt gcccataaag ttaacgaatt caaatgttct aaatacctta    283680
     tttctgaaat taccaatttt ctgatctagt gtaatctgct gcgctaaaag tggatcataa    283740
     gttttggact catcagtaac ttttcgctgc agagaaggag attccctgta catactagga    283800
     attctgccga gaattagaag ccatagcacg cttgcaatca ctagcaccaa taatctccta    283860
     gcaaaacgtt tcctagatac atttttctta aaaacagaaa gagctcgcat tagtcatatt    283920
     atattatatc agtatacgcg aaatttcatt gtcataatag ttgaactact tgacttatga    283980
     aaagaactat tacaacaaca ttcaagccac tacaagaata gaaaaaatta taaaataagc    284040
     agtgtgtatt tccactcact cgacttgttc tactcaaaca acccccaagc ttgatgggtt    284100
     atagacaagt ttgcatacct aattactgtg tgagtgagtc taattagtgc ctgaagtggg    284160
     atgatatgca atttaagcac ttccgaaatg tagaattaga gaaaaagtcg tataaacagt    284220
     gccaaaaaat tgttgttgcg atttacccaa aacagtcact gtattagatc ccagattcca    284280
     ctgtagttga tgcacggatt cgattggaag aagtaaaaaa aggaaacccc attgtctttc    284340
     ttgcataaga attagctcga accttttccc tgaaaacaag aggcaatata gaaacatgtc    284400
     tcatctacca tctcaagcta tgttaagtca gtaaagctac agtatgtcta taatattgat    284460
     aggcatcaga gtggccattc atattaatag attcttaatc gtccaagttc tagtttttga    284520
     aacaaatcta acttcttggg tgattgtaac ctaatctata tcaacaagtt taaaagttac    284580
     tagtgtaagc tgttccttga taaattagta attgctgggc tattctcttt tactaaacga    284640
     agtcagatcg acatcaactg ttgaacaaat gctactttgt aaaatcatgt gtgtagaaca    284700
     acaaccattg gaggtgtccg tcgaattttt ttttttatag catgattgca ggagttgaaa    284760
     gtatatttct taagttatat aactatcaaa ctcaattgta ctttaatgca actgacgaaa    284820
     aacgaccgag aagaacgcat ttacgagcca attcttaatc tttaacctca ttttgaggat    284880
     gattcatgga caggtatcat ttactcggtt ctttatgtag cgctccatat tctttgcaat    284940
     gctctttcag tttagaaatt acacattttg gtgctgttcc aactcgaata tccaaatcgt    285000
     tagagtccca atccaaatat ttggcgtcag agctgtctct caacacttgc agaatatagt    285060
     ttagcatgcc tctaacggcc agcacataac tcttacaatc agattcacta aacgacatct    285120
     ctatgtagtc ctcataggaa tcattttcat gatcatgtga aactacattc caactcacaa    285180
     tggaattggg ggacattata ttgatatact tcattgatgt ggttttcata tcccaactta    285240
     ggacatcacg atgaaaatgt gatggactgg aaagagatat aaagctgtat ttgccgtccc    285300
     tctcttccat taagacaaga tgtggtctat aaaagtgtgt agcacctcca cagccaatta    285360
     tgtgactctt gatcacacca agccaaagtt tgcggccgtc aagttcaggt attccttgtg    285420
     gtacccgaac aaaggatgtt ccacctctta aatccttgaa ctgagatttc tttagtttat    285480
     caatcttatc tgctctaaat tcataagtac atttaccatc gtcaagcgag cattttaaca    285540
     ccgtaatagg catgatatgc tgaacaatat gaacaaaacc acgagatcca tctgctacag    285600
     catcttcatc acgtataaaa ggtgtccaat tcttttgtgt ttctgagatg gaaaattctt    285660
     tatcaaccaa tggaacgatg gggttgacct ttctatgcgg cattaccata aacatcaacc    285720
     gtctatcaaa atttttatcg ttcatattat aaattactaa aggctcttgt tctctattgg    285780
     catttcttcg tattatcact tttggatctt ctggacccat gaaacgcaag tctccagtag    285840
     tcttaaatgg tatatctatg acggttggat atgtacgaaa gtacatgtca ataagctctt    285900
     gtttctccat atcggcaagt ctaattgatt cttcacttac taatatacat gattctgacc    285960
     cgtcaggatc gctctggggt tctaagtagc tactatagtc ttctctttta ccaaggcatt    286020
     cttctgtaat gttgtattta gtgtcaattg atttcaattg ctcttcaaag tcatctggtg    286080
     tttcaacatc taggtatctt atgcgctttc cgtaaagttc attccagtcc ttgtcaaacg    286140
     cctgggcggc aatcaatgaa attgaagctt ggtcacgagc attggcctca gagagtatca    286200
     gcctgctata aacaacgtag cactgttctt cctctaacca ttctgccgaa gaaccaaaca    286260
     tataccactt tttcttgaaa gttgattcga taggttttcc ctttgccagc ttctttagaa    286320
     agttgtagaa ccttgaactt ggctggttca tggaatcact gaaaacttta taattgggaa    286380
     tgataggaat agtaatgtta ccatattcca actttgcatc atgttctata tgcttgcatg    286440
     actcaaccat gtctaatccc tcaggaatgg cgcgattgcc cacatagtta acaagatcga    286500
     actgcttgta ctccatcctc cgaaagtttg tcaccatatg agccagcgtc gtcttgttct    286560
     tccatgacaa tgcatcgtga gacccagagt catcggaagt ggtattgcta gacatgaaca    286620
     gagacttacc gtacatgtcc ggtgtagtac ccagcgatag caagcatagt actgacacta    286680
     tcgccagcac aaccagcctc caagtgaaac ctctaccaag tctcttctca ctacgaaagc    286740
     taaaggtccc cattatatat tacacatgac tttattattg tatatgcaag caacattttg    286800
     aaatatcgat agaaatacat tcgggagaaa gagcaattgg tatatgtata tatatggtgc    286860
     ccccacgagg aagaattcca atgttttatt agaccatatt tgcaactctt tggccagatg    286920
     atatgccaaa gggtttatca acataattct aggtgtcaaa cctaattgag tattctgtta    286980
     aggtggattc actccatatt gaactagtag cacaaagtac aaggttagtt ccaaccacaa    287040
     acaaaggcaa tcagcatctc aaaagataag aataccatcg tgaagttttt aagttcaatc    287100
     cttcggtttg tccaactcta actataatta tagaaattgt gctgggctgg tgaaagacag    287160
     caggcacatg gaaatctacg ttatcaatga aattccaaaa ggtgagtgcc tttagcccca    287220
     ctgcgaaccc acactataga attctttgtt gtccacctac cgcaacagtt acgccagccg    287280
     ttactatgtg actgcgaacc aactgaatgc acaagatatc tggcgagaag gcacgctgag    287340
     ttctagactt cacccctccc ccatccccct ccacatattc tccaggtgaa cagtccctgt    287400
     gcgtctgatg ggaagaggct agaggaccac gcagagatat accccgtcag ctggctattt    287460
     ttggtgactt cgtgtgtctt ctttatcagt cacttgttcc tagaaaccac tgtactttcc    287520
     agtttctttc taaattgtcc gaaaatccga aaatcataat aaaaagggta ctcagaaaaa    287580
     ctgccgtaga gaactgtgga gtttgcgtgc ctacgggatc tagatggcat gtgaattcgt    287640
     cgcaatacat accactacga agggttgtct gaactgccgt gtcttggatg tattacgtgc    287700
     tgctcgtatt ctgatttgca ttcatgggct catcgcaacg tgctagttgg agcgcaacaa    287760
     ggtgaggagt agaggggggg tggaatggaa tgaaggactt tggttgttgg aagtccgtca    287820
     tagtgaggca ctgtttccca acattcacat cattagttgg taatgtacaa gggcatatgg    287880
     actgcataac tcatgtacat gacactgatt gctcagaaaa tattatacta ctacaaatga    287940
     gggaatatga atgaaatagg atatgctagt ttactgcctc gtgagttgcc tgcgtaagcc    288000
     cctgactatt gttcatggag ctttccgtat ccttcgcaat attctctaag atgcgagcat    288060
     acacattttg atattgccaa actggaatgc ggttcaagtg cagaaacctg attcgtgcta    288120
     tcggagtctc gtagcacctg tctaacgtag tcgataacac cctttaatgt tagaatatgg    288180
     ctattaaagt ctgcctcgct gaaggaaagc tccatatagt cctcgtatgt atctgtctct    288240
     tgatcatgcg acacaacatt ccaactcaca attgagtttg gagacataat attgacaaaa    288300
     aacatagatg tactttctaa atcccaccct aaaacatcgc gattgaaatg tattgcgcta    288360
     gagatagata gaaagctata ttcaccattc ctttcctcca ttaacgccaa gtgcggtctg    288420
     tagaactggg atgtacctcc acagtccttt atatggactt taattacccc aatccaaata    288480
     tttcttcctg aaaattcggg tattccctgt ggtaacctta taaatgctgt tccacctctg    288540
     atgtccctcg attcaatgct ttgtgatccc tctatggcac tggcattaaa tacaaaacta    288600
     catttaccat catctaaaga gcattttaaa accgtggttg gaacaatatg ttggataata    288660
     tgtacaaatc cgcgagatcc accttttaca gaatcgccat ccataatgaa aggtgaccag    288720
     tttttctgta tcctagttat agtgaattct tcgtcaacta agggcataat agggtttatc    288780
     ttcctgtgtg gcataacaat aaacattaac ctcctatcat aattatcatc ttccagattg    288840
     tagaatacca atggctctag cgtcccatct agatttctgc gtattataac tttgggatct    288900
     tctggtccca tgaattgcaa atcccctgtt gtcttaaaag gtatatccaa gaccgttgga    288960
     taaactctaa aatatctgtt aatgagctcc tgtttttcta cttcagcaag tttttggttt    289020
     tctttgtgct gtgaagcaca tttatcgtag ttttctgaat tggcctggtc gctgtgaacc    289080
     tcagcacttt tctcaacaca tttagcaaag gcattatact tctcatcgat ggctttgagt    289140
     tggtcatcaa aatcttcagg tatgtcgata tcgacatatt ttatacgttt cccaatgagt    289200
     tcgttccaat ccttgtcaaa cgcttgtgct gctataaggg aaactgatgg atgtccacgg    289260
     gatttgcgtt cagaaataat tagcctacta tacgcgacat agcactgttc atcttctaac    289320
     cattctattg aagacccaaa catgaaccat ttatctttaa aagtggtatc tataggctgg    289380
     ccatgtgcca atttcttcat aaatccatgt aggcgagact ttcgctgata caaagaagta    289440
     ctgaatgctt tataattcgg agttatagga tgagtggctg tactgtattg cagcatggtc    289500
     tggtactcca tgtgttggca gacttttgtt ttatctgttt cttgagcaag atgttggctg    289560
     ttcaagtaat taacaaatct gaacggatta tattccatct ttctgaaacg ggttaacaaa    289620
     tgtgctgatg aagcctgatg tttccatgat ggcaaagagt gagtcaccgg ttctgggata    289680
     aaactattag aagttactgg atttctgtgt gtattggaga cagttgttag agtcagtagg    289740
     catagcacaa acaccgaaat taagaccacg attttcaatg ttacctttct tctgagcatg    289800
     tttttctcat tgaaccccaa ctggtactat taaattttgc atctgagtta tgcaagtcct    289860
     gtataagtga ataaggagga cgagttggtc tttttcggta atgcaggtga aagaaatgcg    289920
     actggtttgt tgaggttact caaactgaac ttcgtttata atctatcctc taagctcgat    289980
     ggttgattca agtggaatat ttataagtat taaattccgt ccgcaatatt cgattattac    290040
     tgttcgtcat catatgccaa tagcatgaat agcgtctcac gcaggtcgct tcgtattgca    290100
     atagacaact ttagttagga ttacgcaaat catagaacag aacagtaaat caagtgacta    290160
     tggtccagat cataatacat cattcaggtc tattttccca cagtaatcat ctagaattag    290220
     gtgggcatgg atgctgaaca agtcgttgtc cctttgagcc agtcgtcgcc aataatatta    290280
     tcccactttg taaaacaata cacagaagca aagtggtttc gcagagtaaa catacggtgt    290340
     gcgtaggaag aagaagtgaa ggattgcttt tgcgtttccg agtacgatta gtgaaaggta    290400
     ttttgaggtg aggagttcgt aaatatcgtt attccacttg gctacggtgt tatgtactac    290460
     aatgcaattc ttaattgagg tattcttggt acagcagtga agtgatgttt agcttttaat    290520
     caatggaagt gaggcacact ctttaattgc tccgttgcat tatgtttatg cagagtcacg    290580
     ctggtatgag aacttagaaa cacgaacgcg aaaatagaag ttcagtttct tattttttat    290640
     tttcctccat acttctctta attgcctatc tgctcctttc aaatcgtcat taaccttaaa    290700
     tatttgaaag cattcgccca gtcacatatt atatgaatga gtgcgagcgc ttaaggaaat    290760
     tgatgtcggt gttgctcagc tttaacaact aactgcaaag agcttttttc tacgtgcaat    290820
     ttggcattcc aattgaaaaa aactcttcta gtgaaaactc tcggcaacca aaatattgaa    290880
     cgtatgtagc tggctaattc gcctatgata cataattgtt tatcaaaaga ctgttgcgtg    290940
     tccattccaa gaacatcatc acattcagct tgaccgccta tcgtactttt caatttttta    291000
     gcaacttgtg tggagggatg ttagttataa atattacatt gaatactaaa cacaattact    291060
     aaatattcta tctatatagt tacaatgcgt gtttttaaaa ttttacaggt tttgcaacag    291120
     ggggtatcta tgaatgcatg ttgctccgat taagtataaa tattacaata ttggtttgag    291180
     aaagagcaat ttttttaaca tgttcaagga acaggatccg acgaggaagg tacgttgttg    291240
     ttgtttttca ggtatacagt ttctttggta tatcttcttt gtgtgcgtta ccgtacactg    291300
     agcaatgttg tttcagattt gagcgcacgc attttggtgg tgtaccaacc atggttgcta    291360
     aatctttgga agtccaatca agaaactttc gatccgagcc atctcttaat acctgtaata    291420
     tataatcaag aactcctctg acagtaacaa cgtaactcat atagtctgat tcgctaaaag    291480
     acaactccat ataatcttca taggtgtcat tttcatgatt gtgagaaatt atgttccagg    291540
     aaacaattga atttggagac atgatattta tatatccggc ataagtgcta ttaccatccc    291600
     aactcaatac gtcacgatca aaatgtagag cgctagagta agatagcatg ctaaatttac    291660
     catctttttc ttccataatt gccaaatgtg gtctataaaa cttgaatgaa ataccacaat    291720
     gaccctgatg gctcttgatc atggcaatcc ataagttcct tccatctaac tctggtatac    291780
     catgaggtat cttaacaaac gcagaaccac ctctcagctc tttaactccg acatctttca    291840
     ggcttggtat tttggctgca tcgaatatat atttgcattt tccattgtcc aaagaacatt    291900
     ttaggatact tgtaggtgac atatgctgga caacatgcat gaatcctctt gatccatcgg    291960
     aagtggcgtc accctcatga ataaaaggtg tccagttttt ctgtgtccca cctattttat    292020
     attctttatc caccagtgga acaattggat taatttttct atgaggcaac acgacaaaca    292080
     ttagtctttg ctcatagttg ttgtcttgca tattataaac aacaataggt tcctgttggc    292140
     catcatgatt ccttctaatt aagatcttag gatcctctgg tcccatataa tccaagttac    292200
     cagtagcctt gaagggaata tcaagtacag ttgggtatac tcgataatat ttggcaatta    292260
     gttcttcttt ttcctccttc gccattttaa atcttgcttc caattgtttc aagcagtgtt    292320
     cttgctcatc aaactgtggg tctttatttt ttggaagggt tttagcagat ttcccaggca    292380
     tgcagctttc agtcaagtta tatttcatct caatggcttt gaactgctca tcgagatttt    292440
     ctggagtttc tacatcaata tacttgatcc ttttcccata aatttccttc cagtctttgt    292500
     caaacgcttg tgcggctact aatgaaatag atgggtgttc acgattttct tccttggaga    292560
     taatgagtct gctgtataca acgtagcact gttcctcttc gagccactcg gcagaggagc    292620
     caaacatgaa ccatttctta tccaacgtat cgtcaatgga tttgtcacca gcgattcctt    292680
     tcaagaagtc atgccaccta gggtctgtct tcttgacgct ttcactcagc actttaaagt    292740
     taggtctgat gaatttggtg acgttggcat actctagttt actctcgtga gatatgtaat    292800
     tacaagcgtc tgcttccttt aaccccgcgg ggatatttct gtttccgagg taattaacaa    292860
     acttgaacgg cgtgtactcc atgtttctat agttacgcac catatgtgcc aaagtcgtct    292920
     tgtccttcca tgtggttgtg ttatgagtgc aggactcctt gcaagcgcca gagtcactca    292980
     acttgaccac ggtcatctgg tacacatctc gcagtgactc cagcgataca aaacatacca    293040
     aagtcagcac taggagcaca agaacttttg tgttcagaat gtatcgtgta ggcgtcatgt    293100
     atctattcct ctctttgttg ataggtagcc acttcatatg caagaaattc tgctagtgtt    293160
     aatggagacg cccagccgat tatttgcaag aagaggtaca agtagttatt ttattttatt    293220
     ttttttccat ttagtcattg gtttatatat ttaccagaat taatcatggt gagagagtcg    293280
     tgtgtgtttg agtttacgat aaattttgtc aataagtctg catgatagtc aaagtgtgtc    293340
     aatgatgagt acgcaagaca agaaatagtg gtggggttcg cgtattgaaa ccacgttccg    293400
     caagagtatt ttgcccttta gtcttaatgt gagtagtctc cttttcttta tcgttgtttg    293460
     ttttgaactt gtgcctgtcc aattgtacat cctagttata atatcgaagg tacaaatttt    293520
     ggcgtttttg tttttgatgt tggcactatg gctatactat gagctctatg ttatggttcc    293580
     aacgtcttac ttcgctagag gtattctaac cgtactggga ggagggtgtt cattcccact    293640
     caaacaggtc cctgtgcatt ttgcagggcc actaaggcat ttgctggcac tttgctggca    293700
     ctttgcgaca ctagagacac tagagacact agagacacta gagacataag ggccttttac    293760
     gccagcgaat tggaacagct ttgttggttg agattgcaag agaacaatgg cgggaagggc    293820
     ggaggcactc ggaatgtgtg actctggccg caccgggtcc cctgtgcaga ctcataaatg    293880
     tttaatactc ttttagaatt ccgtatctct ccgtgtggat ctgagctccc ctggtgtctg    293940
     gtgcaggtag taaattcccg tagtgcagag tttaatttgc tgtaagactt gtgaagagaa    294000
     aaaaaaaagc aaccaaataa atgaacgttt cttttttact tgatgggtgc gggtgtttct    294060
     gaaggcgact gggagagggt tcctcaactt ctctttgatt gcgattgcga gtgcgagtgc    294120
     gagtgcgagt ccttttcgct gtggataagg gtctttcctg cagggagatc actgcgcgcg    294180
     gcgtgttcta gctggacttt taagtgtttc ctctggtaag atttcttgcg gactcacttg    294240
     gtggaccccc tccgtaattc tagtggggga ggccctaaag tgcatttgct cccacctgac    294300
     tctgcgtgca gcccaccagc atattataca agtgggtggt accaagaggc agcacgcccc    294360
     tgcactcgcc ctgcacacgc cctgcacgta gcaatgccca tcctgtatgc acaccatagg    294420
     cctctctgac tggtgtcaaa aggttaaaag agaaaagggc cataagagtg ctgtgtgagc    294480
     ttaacggagt aattctcccc cacctttcac taacccactt gccagttcac taaacttgcc    294540
     agttcacata aacgttcact gagaagctct ttcttgatag cccgtacctt tcggtgcaat    294600
     aaagagctca aaggtcaact cttggtagat atccaagaaa tggctgtaaa acaaatcgcc    294660
     agaacatctg ctaagacgcg ttatcaaaac cctaatgttg cacacaaatg gcctctttgt    294720
     ccttgtgaag catttgtaga aacagttgca caaacgtact gtttggaagt taaagaaagt    294780
     tgagagtcgg attgcaaaca aacaagaaac catcattacc caaccaagtg ccgtgttgaa    294840
     aggcacacga tatatataac tgtaacataa ttctttgtaa caaagccaga cctctgcttc    294900
     caccaggacc cagcaaagca aaaaaaatgc aaaagatgtg gatgctcttg aggacaagac    294960
     attggacagc gaggttgtcc aagaaacatt actatgtact cggtgtggta gccactgtcc    295020
     tgctgctgtt gcacaccttg aaggcgtacc acggcaaggt agcgctaagg cccgtgctgt    295080
     ccagaccgca tgtagaaggc tacgaatata cattgcctgg cgcatctcag aaatcagctt    295140
     tcagattctt ggacttggca cacttggaga cgctggcagc tgaatcgagc cctgggtcag    295200
     gattgttcaa aaaggcgacg gaagcacagc gggaccttgc catgttcaaa gaatgggcct    295260
     cactctcacg catggaccag tgcagattgc tcgtcaaagg catatacgtc acagacccac    295320
     aatggtccac gaaggaattg tttggtatcg agacagtttc cgatgactca agagctgagt    295380
     tggctctggc cctcgaacgg ctgaggatat ataactattg cttcaagcac gagagctcgg    295440
     tgaccccgta tgagttgttt cattcaatga ccctcccaag agaggtaatg gcgaagatgg    295500
     acctaccgcc atatgagcgc atgaacaaga aacaactggc gctggcgctg gcagtagatt    295560
     atcagcgccg tatgttcccc ttcttgaaaa agactggcgc atcctttggt aaatacttgc    295620
     atccaaagct aatcaacttg cgcacaggta agatgtcaaa tcaaccaacg gttaagagtg    295680
     ctttgcatga atacaacagt aatttcatac agcattgggt taggcagtct tatggtaggg    295740
     gtattgtcat cccaatggat tataccgact tgaaggagtt gtaccataac ttgaaagtat    295800
     ggcagacctt gaaaaataca ttgccaatcc aattggtttt ctctaataca gtggttaccg    295860
     cagaagtaca agagatactc tttgagtacg ctcaagaaac taagcagatc tttatatcgt    295920
     tgacttggag ccaatactgg atgtgctcta tgtacatgat cagcacactc cagccacatc    295980
     aaaggtactg gcatctatgt ttaacacatt tgaagaggca ttggttatgg agccagatgt    296040
     atctttcttc ttaagcgcaa ataccgtttt tgatagcgag gattacaaga atagcggttt    296100
     caagttctgg aaaggaagga acacgcggaa ggatgcccag ttcccacatt gcaaagtatt    296160
     cactcaagca ttggaaccat cactagagga attcaatatg attcattcgg aactagtagt    296220
     tagacttgac aacccatcgc tagagtcacc taatactgaa caagaaaagg cattgagctc    296280
     ttattacaca tatggcggcc ttcactatgc cgacaatggt gtttatgtga ttaataagaa    296340
     acaagccttt gaaggactat tgggagctgc gactttgcta agtcataaaa aatacagacg    296400
     ttgttctgat ggtgaaaatg agttcatgtg gctaggtatg ttcaccgtgg gtaataattt    296460
     tgtgagcgat tcaatcgatg caggtatatt gggtgaaata aaactggaga gcgaaggccc    296520
     aagaagaggc tatgcatatg tgtgtggtac gcaagtgtcc cacagtgatg atgtgggtag    296580
     actggtatgg agtaaagatg gacttgtcac ttgtaagttt gagaacgctg ctcacgaaga    296640
     cttttcacgt gactcccaat atttcaccga taggtatttg gatgagcata acctggatga    296700
     gatatacaag agcaaattga acatcaatgg gtttattgtt ccagacacca gaaagaatcc    296760
     ttggaaacag atctcagaat gtcgtgcgac tatgtactgt gcgtatatcc cgcacctaaa    296820
     atctaacact gatgatgaag gtggtattct cgccagtttt ggtggtggtt atctaacgca    296880
     tatcaaagat gtcgtgaatg caagattaga accatctgaa agagagagaa gagaattgca    296940
     ggccaagatt gataaagaga gacaagaact ggaacagata gagcatcaac tagaagaagt    297000
     cggtcacatt gtaagataga cagcaattgt tttttctgct cctttcattg ctcgtttttc    297060
     atatttaatt cataatcgta tgttttattt cctttctttt tgatgtttta ttaaattcta    297120
     tttgtttttg actttacgtt tctccattat cacaataacc ttctattatt ccacaatttt    297180
     gtactaatac taatataata acaatagtga aagaaatgaa aaaaaagcgc ctaactgctt    297240
     agcatataac gcatatctag atgactaaat actcatgact atcttcctgc ctttccggta    297300
     acggtttact cacttgccga agccacatga ctgataaggg aaaaaagtga ctcacatgaa    297360
     atccgcctgt acgtcagcac tctcttcccc taaacaaata ccctctgcac cggttacggg    297420
     gtttgtagtt ggtgggaagt ctgtagtgtg cgttcaagtg attctgaacg gaaggagtct    297480
     tcttctattt tggccgttca cggtaacttt gtatcaggcc tggtgggcag gctgtctggg    297540
     aatcacagct gaacagggat tgcaaggcag agagtggggg aaagtgttga tgcagcaggg    297600
     aatgcctgta tcgatagccg ggaacgggaa cgggagcaaa gagcaaagag caaagagcaa    297660
     agagcaaaga gcaagatcag aattcaagaa aaaccctttc acctctagga cgtatgtgca    297720
     ctactgtctg agtctgcttg gaattccacc ttgccatttg agaagaaaag aatcagcacg    297780
     gcctgcacaa tcttgaaaaa gtagccgaca tcgctagttc ggggagagag ggaccacctc    297840
     tgtactgatg ttatgtcata ccgggttaca ccgtgtcttc ccattccact attctctcct    297900
     attgggaaat gggaatacag gccttctaca accgcacaac aacggttgac tcactagtaa    297960
     aagctataac ttcctacatg aaccaaagaa aggaacgctt gggagagtgg gaagaaaaaa    298020
     aacttcctac ctttctagta atgtctcatt cagttgtgag aattgtgagt cccacaattt    298080
     acgctccatt atctcttttt tccctctgat ctttatgact cttattgtct ttcccacatt    298140
     ttattttcac cgggatcgat tccaacttga taacttccac acacgtacac acacaatccc    298200
     tcgtagaaac tctctttcaa gatagcatca ccgctctaaa atgaattttt tttcagcaat    298260
     ttttttttca tcgatggagg agctttttgc ccaaaagaac acaattgaga agacaaaaaa    298320
     gaaaaaaaaa ttatatatat aaagggttat aaattatatc aagttataac attattcctt    298380
     ccaattactt atctcataaa ccaattcaac acaagaaact caaaagacca caaaaaagga    298440
     aaaactcttt tctcttctaa gaactttttc ttactataac attctttgat ttcaaacact    298500
     accaggacaa ctatttccat ttacaatgat cagagctcaa gcttccagat tgatctgcaa    298560
     ctctcgtgtt atcacttcca agagaacttt tgccttggct gcccgtgctg cttctatgag    298620
     accagctgct tccttgatgg ctcaaaagtc tatcaagcca attgtcgcta ctcgtggtat    298680
     caagcaaatt aacttcggtg gtaccgttga aactgtgtac gaacgtgctg actggccacg    298740
     tgagaagttg ttgaactact tcgccaacga cactttcgct ttgatcggtt acggttccca    298800
     aggttacggt caaggtttga acctaagaga caacggtcta aacgtcatca ttggtgtccg    298860
     taaggacggt gcctcttgga aggctgccat tgaagacggt tgggtcccag gtgagaactt    298920
     gttcgaagtt gaagaagccg tcaagaaggg tacttacgtc atgaacttgt tgtctgacgc    298980
     tgctcaatcc gagacctgga actctttgaa gcctctattg accaagggta agactttgta    299040
     cttctcccac ggtttctctc cagtcttcaa ggacttgacc cacgttgagc caccaaagga    299100
     catcgatgtc atcttggtcg ctccaaaggg ttccggtaga accgtcagat ctttgttcaa    299160
     ggaaggtcgt ggtatcaact cctcttacgc tgtctggaac gatgtttccg gtaaggccca    299220
     cgaaaaggct caagctttgg ctgtcgccgt cggttccggt tacgtctacc aaaccacttt    299280
     cgaaaaggaa gtcaacagtg acttgtacgg tgaaagaggt tgtctaatgg gtggtatcca    299340
     cggtatgttc ttggctcaat acgaagtcct aagagagaac ggtcactccc caagtgaagc    299400
     cttcaacgaa accgtcgaag aagctactca atccttgtac ccattgatcg gtaagtacgg    299460
     tatggactac atgtacgatg cttgttccac cactgctaga cgtggtgctt tggactggta    299520
     cccaatcttc aaggacgcct tgaagcctgt cttccaagac ctatacgaat ctaccaagaa    299580
     cggtagtgaa accaagagat ccttggaatt caactctcaa ccagactaca gagagaagct    299640
     agaatctgaa ttgcaaacca tcagagacat ggaaatatgg agagttggta aggaagtcag    299700
     aaagttgaga ccagaaaacc aataaattta acaagatgga aagatttaca aaaggatcag    299760
     atcaatgaat tttatagaga ttgtcattaa tatctcacct acccagtata gagagagaaa    299820
     gaaacacatg agaatataag tgctggaaac ttcattctta actttttttt tttcaagtat    299880
     tttttgggga tagggggttt gacgatcgtc tatctattat tttgattttc cttttctttt    299940
     tttcgttgtt aaactttatt actttcatta ttcattccca caacttccaa gttcaggaac    300000
     caagatcctg tgcgcaatac tattgtaaac tagaacttta gaaccttccc caacgcaggg    300060
     aaatatatta gaaaaactac cacatcatat agcatttcat atatataaca tatgtaaacc    300120
     catatcaata agaattgatt cattattatt agtagggcgt ggatgtctgt aagctgaact    300180
     tgctcaacaa atgatgtcag agatgccagc cattccaaca ggcttccatt attcatatcg    300240
     tgatataaca aagacctgag atgcatatgc aactcctcta actgcattac gcaaagtgca    300300
     actgtagagc atcactcgga aacacattgt actaaacgat ttagctttcc gtttgggatc    300360
     ccttttggga tcccttttgg gatacctcta ggatacttct gggatacttc tggacttaga    300420
     gatgatataa caccggcacg gtgttatatc ataaacacac agtatcacat gtgtactaag    300480
     cagtgcactg cactgcactg cacgtactac ggccttacta cggcctggta ccagagtata    300540
     accccgtgga ccgagtccaa agcaccgaca acggtgtctt tttcccacca cgtcccactg    300600
     cacggtattt gtaattctgt ttggtccccc ccacgaccgt tctgacttgc actggaagac    300660
     aggggggggg aagcctataa ggggaaggaa gtccagcctc ccaccttacg tgattcttat    300720
     cacgtactgt gttggatggg acaagttccc accccctgtc ttctaccccc ttttctaaga    300780
     cgtgctcaca gaaacagctg tagcacccac aaaaagaaaa tctcttagcg actgctgcca    300840
     ccgctgcgaa cgctgctctg ccaaagaaac agaaagggga gtccagtttc tgtctggtgt    300900
     ctggaaagcg cacctctgta gtgtgcaagg aggggcacga acagtgcaac gcgtataaac    300960
     ctttgggcct ctctcacgat gaataggggc agtagcatta cactctggca taacaatagg    301020
     gccctggcaa tagggctctg gcaatagggc tctggcaata gactgtggga gggccatact    301080
     gtgggaaggg agactctgag agactctgag agacactgag agacacggaa aaaggaggtt    301140
     tctgatctag cttaacggga cagacacact ctctctctac tactagcttt caccattggt    301200
     tctatcgcat tctatttgga cttaatgctc tgtgtgtgtg aaaatcctaa acaggggaag    301260
     caaagggcag ggggatcact tcaatacaca aaaaaaccag gaaatttttc agggtataaa    301320
     taccctacac gttataagac attgcatccc aatcgaatgt tagaaaaata ccaaaagcaa    301380
     cgtctttctt attaaacaag aaaaactaca tacaacataa tcaagcaaaa caatataaaa    301440
     aaatgtctga accagttcaa aagaagcaaa agactaactc ttctctagac caattgaagg    301500
     cctctggtac tgttgttgtt gctgacaccg gtgacttcga gtccattgct aagttccaac    301560
     ctcaggactc caccaccaac ccatctctaa tcttggccgc tgctaagcaa ccagcttacg    301620
     ccaagttgat cgacgttgct gttgagtacg gtaagaagca cggtaagacc gtcgaggaac    301680
     aaaccgaagc cgctgtcgac agactgcttg tggaattcgg taaggaaatc ttaaagatcg    301740
     ttccaggcag agtctccacc gaggttgacg cccgtctatc cttcgacaag gaggccacca    301800
     tcgccaaggc tctacaaatt atcaagctat acgaagaaca aggtatctcc aagtcccgtg    301860
     tcttgattaa gattgcctcc acctgggaag gtatccaagc cgctagagaa ctagagagca    301920
     agcacggtat ccactgtaac ttgactctgc tgttcaactt cgcccaagct gtcgcctgtg    301980
     ccgaggccaa catcaccttg atttccccat tcgtcggtag aatcatggac tactacaagg    302040
     ccaagaccgg tgaaacttac actggtgaaa ccgacccagg tgtcaagtct gtcagagcca    302100
     tctacaacta ctacaagaag tacggttaca agaccatcgt catgggtgct tctttcagaa    302160
     acatagatga aatcaaggcc ctagccggtg ttgactactt gaccatctct ccaaacttgc    302220
     tagaccaact attgaactct aacgacccag ttccaaagat cctagaccca gccaccgcca    302280
     aggacgaagc tggtgagaag gtcactttcg tcgacaacga atctgctttc agattcgctc    302340
     taaacgacga cgccatggcc accgacaagt tgtctgacgg tatcagaaag ttctctgctg    302400
     atatcatcac tttgttcgac atgattgaaa agaaggttaa ggcttaaatt aatcattaaa    302460
     gatagtatat taactgcttt attattagtt tttttcaaaa tcccacattt tttaaccatg    302520
     ctttacattg ttgttactat aacgtcattg tcttttttat tcggtttctt ttctgtgggt    302580
     ttaaatatag agtttcctcg atcataaaac aaacatcctt tttttctgtc ataatggggg    302640
     gaaaaaagtg atagatagaa tcgctggaca aggaataaac tcttttttac tcgcacatca    302700
     tcatacctaa ttcatcaatt tccttcctaa ccagataaat aggatagtgg aacggtgttt    302760
     ttacatataa atagtttata ccacatatgt aatgtaaacg tgtattacaa agaatctgta    302820
     aagaaaaatg gcaaagtttt catatcgtct tttcaatgaa tgaatatact agtacgtcac    302880
     cctactaaac ggtgccctaa aaaacttcaa cctttaaaat atacataaat ggtacaagct    302940
     actgttgaaa tgatagtcag taatgttaat atgataatga ataatgttaa aatgctaatt    303000
     aaattgttat gtatgaacga aaaagagaaa atatgttata atgcaattac ttttggtgct    303060
     cgtgaatgaa actgatttaa taaaatcaga aaaaaataaa ataaaatgat gttacctcgt    303120
     aagcccgaca ccaaatccga taccgatacc agcgaacgcg catagcatct ctatagtgcc    303180
     cagcactaaa cacaagcgtc taaaccatgt caagtctact tcccagacga agcctttcag    303240
     cagaccttgt ctgtaatctg ggttcattag catcctcatt agcttgtaat cagacaccag    303300
     ataacgctga tagttcgccc tcttatagcc tactcccatg agaaagaaaa gtggcggtga    303360
     aacaaaacac aaagtcataa cgataatgat tctttttatg ctgtacaggt cagaaaatgc    303420
     ataatcatga gagttgatac tttgcactgt acttacctca ccgtcatcgt gtctaattct    303480
     tatcatgtca ccaaacgcct ctacatccac atgatcttcc atactggaaa ttctgccgta    303540
     ggtttgttta tcatcttcct catgtggcat ggcaacagct ttattagagt atagaggttg    303600
     aacgttgccg cttattttta tattgtccct tggtgagtcc ctcgaattat agtatgcttc    303660
     ttctggttcc aacaattcca tggtaccagg ctcaaccaat tgtttgacgt gaacgctttc    303720
     attgtctcta tcgttatctt cttcgtcatg atatggcatt tcttcgggaa tatcactttg    303780
     gcggtgcggc tcaatatcgg ggagtactag cgattctgga gtttccagtc tgaatttctc    303840
     aaatctttgt ctagttggtg tgtaatcgcg caaggatgaa tttgattctg aacctgctct    303900
     ccattggcct gatccggaga cagttcgtag tactggtatt gctacgtaat ctccattcct    303960
     tctctgtctt attaacgatt gttgagagtt gttggatgtg gttctatatc tggagctgct    304020
     tccgctactt ccactgctcc cacttatatt tctgtcattg aatcggttgc tatttactgg    304080
     tgatggaact aatatcttgc ttatgaggga gggactctgt ggtattgcaa gtttattttc    304140
     tggggatgat tttcttgata gaaatgtatt aattgaagga gagccattaa atgaagaagt    304200
     cgtttgagag ttccgtctag ataaattaaa ctctagaggc acaaactcag attccgtttt    304260
     gaaatgttct aaaggtggtc tacctctttc ttcctgagca aaacgctgta gttcatcgat    304320
     tgttcctact tttggaacat tcccactagt cttgttgaca tagctgggtt tcgatacttc    304380
     ttcttccaat aattttattt ccctctcgaa atttgctgag ttttcttccc ttcttgattt    304440
     tattttttcc ataagatttg tatcgttgtt attgtccata attttatcat gactctgaga    304500
     attatgtcgt attctgcctc gtggtgatag tgtctctagt aaggcactct cccgtgggtc    304560
     gaattcacta ggatgaatac ttccagatcc gggtgtattt agaatattat cttgtgccga    304620
     gtctaataac acggacgttg atacagtaat aatactatct ctattctgtc gtacattaaa    304680
     atctcttaat gcccttccgg ggcttatgtt gattgatttg ttctcgccca ctgtgtagcc    304740
     aggaacatgg atatcgtctt catcaattga atattgactc ttggccgaaa taaaatcgtc    304800
     atctcgtcca tcttgttcat ccaggtcatc ttgtttttca gagatatttt ccttcagaat    304860
     attactcttt gatggcgggc ttggtgttga cgtgacccca tttgaactac ttgcagaatg    304920
     tttagaatca tcaacgtata ctggatacaa tctttcagat ctcccattat tttctgataa    304980
     tttctcatag gatgagattt tactagagct agtgttcgcc tcaccaaacg tcagactgct    305040
     cttattttca tctatgttct cgataaataa tgactgtcgc tgaattgctg acacatctag    305100
     ctgactctcg cgcctgtcag ctgtgagcag gacagtatct atagagccaa atgaagagcc    305160
     agaggtatca cccgcggacg accctccaga ttgtgatgac atgtcttgca attgctatat    305220
     gtcaatgcca acgctgtctt gtttccacca actttatcaa tcagctcgta tgtgtgttat    305280
     aaataatagt atctgaagtt attctcaaaa gtcacctaat atactaaccg ttgtatggtt    305340
     atatgcaaaa aaaagtattg cgtttatcaa gtagggttta tatgctcaat tggtcgcgtg    305400
     aataccccca ccaaatagca atgcaatggt aatcaataat aaataagagc tagtaataag    305460
     tgcaacgcca aaagtgaaat aaacaggaaa caaagggtat tcattacata ctcactgtaa    305520
     atcaaggcgc gtccgatcca tctcataggt aacccaacat ttgtttatca agtttttgca    305580
     agcccatcac atcacctgcg agaagagttt atttgacaag aaatttcaca atgtaaacaa    305640
     aaaccctgca tgattcaaca gaaaagcccg tacaaatgcg cttttcttct tccttgtttt    305700
     aagtttttcg agtctttttt tccactgaat gtttatttat atcttcactt gattcgcaag    305760
     tcagacggga aaaacccaaa tggagagccg gggtccttca cgtgatgatt actgataact    305820
     atggagcagt ttgtcatcct gggcaccgta ttgccttggt gctgtatctc tgggtggtcg    305880
     cttgaacgta tgcaaattta gatatatata tatattatgg tatgaatgtt ctagtttttt    305940
     cactacaatg ctggaatatg tgcaaatgtt aggaattgaa aacaattaca atgaaaatgg    306000
     aaggtaatac cagtttatgc ctttaagctg tagtatctgt acatgcctct ttctacacag    306060
     ccgaagacca cgtattcgtt aactagatgg aagtgggttc tgtaccgttc tgaagtggca    306120
     gggtcattgg ggtcgtacag gaactcttct gggtgctcgt agtagtagtt cttaggtctg    306180
     cgctgagact gtgtcaagag ggactttgat gatgaggatc gagagttgtc tgttgcacct    306240
     agaatagata agcctggcct tcttactgct ggtttgggat tgttggaggc tcttagaaat    306300
     aagctcaatt gcgaccttcg cctttgcagt tccgggttgt tcaaatactc atcgtcggtc    306360
     tcatacctgt catcctcact catgacattg tcaccagtat ttgtgttaga atacccaaat    306420
     gcttgtaaat catggattga tcggtcccaa tataatccct ctcggatatc tccaacagaa    306480
     gaagacgaag atgatcttct ctggaaataa ctttcaatgc cggcaccacc actgtcagta    306540
     gatgaggaca atggtctaaa ggactgacca ttttggttgt agtgcattgg tgtatctcta    306600
     ctttcgtctt cttcgatgat tgtatcagtg ggccccattg actcgtcatc tgcagatcca    306660
     atctgattgg catcttcgag attattgtat attcttctcc agccaccaga aggtaatctt    306720
     ggtgctgtta ttggtactgc tcgattacca aaggtgattc caccatttct ggtgaaaaat    306780
     tgtgaaatgg gtggttttaa atctcgatag catctctgtc tccttacggt actctgcgga    306840
     accaagccac atccaagcat gatcttgcat tgcgcaaatt tcaagaagtc tggttggtta    306900
     ataatcttta tgatcttgtg cccgtcggaa tcatactcgg taacattggt tagcatttcc    306960
     aggttacctc tatttaggta tggatccgtt ttgaatagcc agtatctcct tccgtatgac    307020
     gagtcaatgt aacatttcca tctaacaggc tccattcttg ccatgtccac aatactggta    307080
     gtggtatccc caacattgta agctggtttc atagcaataa tttcatgttg cctatttgat    307140
     ttttcgattt gttgccaagc gtcaaatgat acttcgagag caacaagagt aggacagctg    307200
     gtgtacaatt tatgttcatt aattgtccac ctgttgacat gggcgttgtc agatatattt    307260
     aggtatctta gtttctggta gttttcgttc atttcttcct gttggggttg cagtaatgct    307320
     aggtatgagg aattattagt tgaacttagt gatttatgca attgggttgt catttttggg    307380
     tcaggcgtta aaaaatcaac caatttagat attgggatgt cattacctct aatgcttaaa    307440
     cttttaagct tagggaaatt gagttttatg aactgtaaag tatcacgggt agttatataa    307500
     tatccattcc ttgtaaatct gatttgagct ccattaccat ccgcattaga agggttagta    307560
     gagtcaattt cctctatatg gagaggtaag ccaccgatat tgaggtattg taaagtctta    307620
     ttgtggccat acctacataa ctttttaagt aaaaacatcg tgtgtacctc ggtccaagat    307680
     gatgaatgtg taagtgcgct gacattcaac cattccaagg tcgttgtgtt attttcatct    307740
     gtaacagccg gatggtgact gaaaaactct aagactgctc ttggtgttag ttgaaggcac    307800
     atagctaacg aaaggtgagt taagttctta taatgcggta tgccatttat taaggtatcg    307860
     tcatcgattg atgtgtgcgc caaatcaagt ttctgtagtt caggtagcat ctgaagtgtg    307920
     gccttgagtg ttttacttgg gagatctgtg cagtcattta aacctaagca agttatttgg    307980
     tagttaaagt acattccacc attgggatca cttagttgca aagcttctat tgcatcaatg    308040
     aaactcttgg taaatatagg tccagaacac ccacaaaaat caataacact aaggacttta    308100
     ttattactga aaaggtactt gattatattg gcatctaagt catcctggat attctcatta    308160
     gctaaaaatt ctcttagagt ggggctagtt agttgtagga attccataat agtctcatta    308220
     gttaaatttt taatcatttt attcatttct cctgtccgtc ccaatccaat agatgtcaat    308280
     tcctggaagt ccagtacttg cactacgttc cttaaactgg cattactctt caatgatgtc    308340
     agtaatgaat gaaatctctt ggcagttgtc aagttacaat atctgtaaac aaggaccctg    308400
     cagatatggt aaaacatctt gttcacggta aggttactct ttaagaaagt tgccagattt    308460
     tcattaaatt tctctgctga tccaggctgg tcattgcgca tgaagtcatt gaactgatat    308520
     gtcaaaattt ggtaaatgat ttcaggtggg acattatccc ttgggaaagt cgtattcgta    308580
     tccattaaga tgtatggact cgcctaatgc cctgataatc aacttcttat accctactat    308640
     ctcttaattc ggtgtgatat ggagagttca atatagtcta acacactctt tgtaaacgtc    308700
     ttttctagca aaattgactc tacagtgagc agctttctca aaaatggcct tctttactca    308760
     agtcaaatta tgtacaagtt ctatttattg attgatgatt attatctttg tattatatgt    308820
     ggacctgtgt caagcaaaaa aggtccattg tttgatgttc atccatcgat aatcaatgct    308880
     aaacagaggg gtgccatagg atggcacctt tagcaagaat acaagcccta attttactgg    308940
     acctaaatta tggttatttt gtgccctaac cataaggtgt gcaaattagg gtttccagtt    309000
     atcgtataaa tggagtaggg tatgatacaa attttgcatt atattcatta ataaatataa    309060
     actttggtga atcatttgtg aatctatctg gtattcataa ctcctagtgt ttacaatttc    309120
     tatgatccgt tctatattat gctaaaataa ttcaaagaac ggcatgctaa aagatatata    309180
     acactcagat aaacgttgga attaaacaaa aaccgaagca atttgcccgt cgttattgtt    309240
     attcgtcttg atcatagtca attagcgatt cagcataatt atgccctaat aattaggaaa    309300
     gtcaagtagc aataccaaca tatcttctaa attggataaa tccacttaat tgcacgtgat    309360
     attaaaatgt aagatatggt tagcaaagtt aatccagcct tcaacaaata cgatatggtt    309420
     gtttggccga gcggtctaag gcgcctgatt caagttgaaa aatacttact gggttaacaa    309480
     actcaggagc actcaggtat cgtaagatgc aagagttcga atctcttagc aaccattatt    309540
     tttttttgat tgtatttttc taaatacatg ttttggtaac tggtaatgaa caaaaagcta    309600
     tttattttaa tctgaacacc gttatcaata tatcgatatg ataatgaact taattattct    309660
     tttcgcatta tgtgaataaa ttttttttct cttaagattc atcatgccaa cgttaaatta    309720
     tattatacaa tttatgctat tatgtggtta tatatatcgt gctgtaatct atcaacttat    309780
     ttgtatctca ctattcttca atgtaaccac tttgattagt cactgctacc agcatcgctt    309840
     tcgtcactat cactatcaac aaactcttta ctcaagtatt gcttttcgct ttttttaccc    309900
     tgtctgccag aagtaccctt atcagtgcca ttagattccg tctgcgagtt tccgaccaac    309960
     ttttgtttcg gctgtgacaa tcttaattga gatgatctaa acgatctgtt actatcatca    310020
     ttagagctgt cacttgaatc agaatcacta tctgattctt tacgtaacaa tttcactttc    310080
     ttaatcaacc ctgctttctc atacctactt gccataccgt gtttctttgc agaactcggt    310140
     tcagagatag aattgtcttg ttgttgcaat cggttagagt tatgaaccgg ttgtgaagat    310200
     gatacaacag cgctcttagt actttttgag ttctgtatgt tatgtgatga tgattggtca    310260
     ttactcacag tttcttttga actgccattt tgagaagatc gtattgtatc tctactcgta    310320
     gatagaggtt tttcattggc agatttattt ggggttgcac taattgattt agtattcgtt    310380
     ttatttgatt gtgaagatat acgtggtgac ttccttaaag cagaagtcga aggttgggct    310440
     cgattttctt ttcttggcgt agtagcaacg tgtggttgag aagaaatctt ggaaatcttc    310500
     accggtatac ctttagctat ttgttcatta tcaaccttct catttttacc agcagaaata    310560
     tttccgttag ccagtttaac tgttaggggt ttttctgcat ttgtgatggt tttcaaaacc    310620
     ttttccttga tctcggtgat cttttctgct gcagttttag attttgcgga ggtaggggat    310680
     gcaacacttt ttatttgctt taacgctgac aaagtttctc ttagattgtc cttcatggtg    310740
     tcataatcag ttttttcctt cgttgccgac ctttcaagat tatttggtgt ggactgttgt    310800
     gaaatcaagc tttttagaga tagttccata ttatttacct taagtgattt actgggtgtt    310860
     ctcacattag aacttttctt attatcagta atatttctca cttcttttgc aatggggctc    310920
     ttcctttttt ttgactcatc tggatattca tgatcgacta tcgcttgcag cttttttgat    310980
     aatgttggtg ttttctttgg tgacgaaacc tttgaagatg aagtctttac tggagaagtc    311040
     ttagagacag aagatgcttt atcagtgttt tttttaggag tcttagtgtt tatctcagtg    311100
     gcatttggag aatcattaag gtttgtattg tgtagcttaa ctgccaattc tttattctct    311160
     tttttcgaat taggaaggga cgaaggacca tttatgacac ccagagctat tttttcagtt    311220
     tcagttgtag gatccaaaga tgtacctaaa gatttagtag attcttcact tctacacata    311280
     gtctgctctt tatcactacc aattatactt ctaacactat ctttttcatc agttgtgttg    311340
     gtaccataat caacttgata ctgcctggag gctaacgatg tacttcttac cggattgtga    311400
     actatttgac cctcctcggt atctgaaaag ttatcgattc tctttaatac atcctcaatt    311460
     atgggaatat tagtggaatt taccctttta ttatgaacct ttagttcaag tgatgatgtt    311520
     cttttgtcgt tacgatttgt gggtgaatcg gagtttctag tgttgggtaa aattttacgt    311580
     tcagcaccaa ctaatttctt acctcgggca gtgttactat cattttcgag ttgcacatct    311640
     atatggttgt ttattggact gttaattctc tttttactaa aaaccaaaga ctttggttga    311700
     ctttctgata ttacacgctg cccactcaaa ttcactctat tcggcgttga aataaactcc    311760
     ataggaatat ctggcacaat caactgttgc tttgatttat cagggtcgac tacttctgac    311820
     ctagacacta catccaagtt ctgtgactct gaaaatattc tcttaccgtc accaatacca    311880
     gaactaatcc tgatggcagg cgattgtggt tgtgccggtg gtggtaaaaa tgacctgtca    311940
     gttaaagttg atctattggc agcaaatgca gtcgaaacat tacgattaat aacaacagtc    312000
     gatgaattta tctcatcatt agatatctca ttagccaatg gcgaagtaac acgcaagtta    312060
     ttactcaaag gtgccaaatt attaggctta cttctcttag gtactaaaat ctgcggttca    312120
     atcctactgc tatttccaaa tgcttttgaa cttctcctct ttcttactga gctataagca    312180
     gagattcttc cagcatcatg caaatcatta gcatttagtg taccatttgc gtcaataaat    312240
     tccagctcat tttttaaaat aactaaaact gtgttatcca ttgaaaaaac atctttcaca    312300
     agataagttg cgtctaaatc acaatggttt atatcctgta aacttaatat ctcaaaactt    312360
     tcaatattca gatttgaata tagcttggtg atcctattct caatctcatc agcaagttga    312420
     agcaaagtat tttcaggctt tgtgaaatgc aggaattttc gagtatggtc acggattatg    312480
     tgaccaccat ttctaatggt tgtgatagtc tgatcatcac tattatctcc atcaatactg    312540
     taaccgtttg ccttcaattg attttgaggt tggatcaaaa ccacctgcaa cttgtacatg    312600
     ctcgttgagg ccgcttgggt ttcacaaact gtggggaact ggcctcctga tttttgacac    312660
     aactcactga gaattcttag tcaggatgat atatggaaaa cttaaacaat aaaaacatag    312720
     ttgctgctca gtacaattgg atatatatga acatacaaac gccataatca acaatggtta    312780
     ttattcccgt tattgagtga attccagcta gctgtttccc aacgtagtaa atgatatcga    312840
     tgatttatgt ttaacctaga atctcttcat gcttgtttta gttgtgccaa aaagagttac    312900
     aactacatgt gttgattgtt attaattaaa cattatatta ttattagttt tatgcgtatt    312960
     tataacggtt tgttattcct ttcttatctt tctcatttaa tatttacatt atagcaaaat    313020
     ggaaagccat aaactggcac caaaaaaagt aaggcgttat ggataccagc ttatcaaagt    313080
     caaaaacaat taatcttatt agtagtattt tgttgtgata gaaatatttg agatttatta    313140
     taacttggca catgatttag agttttgcga atgatcaaac cgtattttga tcaacgtgaa    313200
     agtttcttgt agatcacatt cacgactaat tcggtactct atttaatttt tgacaccctg    313260
     tttgttgctt gcttccggcg cttcctttcg ggatacttcg agtatttatc cagataaaca    313320
     tcttcaaagt tttccacaat gggcttaaac aacatattga agttactcat aatttgcttt    313380
     gatgtctcgt tatcaatgtc ttcgacagca cgaggagaat gagttgctgt tgtataattt    313440
     ggagacaaag atcttacgcg aatcatctct tcatcttcac agctatcctc tgaaatactt    313500
     tccataatag aatccttgcg gctctttcta aacctatgtt tacgagacat ccgcgcatgg    313560
     aatgcgtcaa tttgattctt gattacatgt ttattttttg ataattcagc tttaattaac    313620
     gccaaaagaa caatgtgatg gaagccttca gtagaagcgg tagcatgctt ggaggcctgt    313680
     ttagcatcaa ctcgacaatg attatcgatc tctttccaga agacactagc attacaatta    313740
     ctccaatcaa catttaattt cttcaagcta ttttctagtt ctattttatt tgggtgctct    313800
     tgcatccgtt tcgttccaac aaattctctc cagtcgtctg atttagtttt tttagccgag    313860
     cgatgattac catgcagcgt atcgtaccag ccttgcacaa cagcttcgtc tgcaccccac    313920
     tgaccatcag atctccaaac agagaattct tcatccgagt cgttaaattc aacaatataa    313980
     aagggcatac cagactttat atgcgtatta cccaagaata cttcaacttt caagttgtca    314040
     gcaatggttt ctgaacattt aaacttgacc atacgagaat cctgaattcc ccagaaataa    314100
     ttaaccagtt ctttgctatc ttcacatgct aatacttggg acaatcgtac aacttctcca    314160
     ttctcaccac gtacatatac agtttcgcca ctcatattat ctttgggttt agatgattaa    314220
     tattaggaaa cctgtcaaaa gtatcagaaa aaaaaaacaa tatagaaacc taccagcttc    314280
     ttatctaggt aaacttcagg gcaattacaa atataaatta taaactttac taagttgggt    314340
     tattcaactt tctccaggaa gtttggaaga ccccttccgt tttatatagt tgtcaccgga    314400
     agttgacagg tcaacaacct taaaaagtga ctcgagaaat gatttacacg atctcctgca    314460
     ctggacacct caccctttga ggaaaacgtc cttcacgata tcggctctta taatttccag    314520
     gcaccagatc tggtactaga tctcagccat tgtttagtaa atcatacgaa catcactgga    314580
     aatatagcca cttaagttgt ttaagcagat atgacttttc attctattat tatgtactgt    314640
     atttattgtt tattattttg ttttccctca ttcatatagt ctgggaaagc tatttgttgt    314700
     ggcgacgctt ctttttattc tttcgacggg ttgtggcttt cagggtacgc tgatacttat    314760
     cgttgtaaca cagggattca tgactgctat ctttgttttc tcttatggag tgttttcgtt    314820
     tctgctttga ttgtcttcta gttgcgccat ggtctatctc accgctattc agattggaaa    314880
     cgctttttgt tttgctgaaa atactagcca tctccaatga gttcacatcg cactcttttt    314940
     caactattgc tggctttgtg tttattttaa atattctgat aaaaaattcc atggttgaat    315000
     taatttgaaa aatgaatgct ttgctaagtc tgtgcgctta attactcccg ctgtaatata    315060
     agtaacacag gacgttggga tgagcaaggt cttaattata tttttgaatg ctcatcagga    315120
     ggtacaactg cttactgaat aaatatatag ttcccaaaac ctatgaaagg atacattgtg    315180
     caatatgttt acacaggttt ttgtggtctt gtgcataagc tgcacagttt ttttttgttt    315240
     gcaccatagc aaaacaacgg atatcagcaa ttgcaaatct aacatcatat atcaaataga    315300
     gctaagttac acaatatgat gttaaaaaaa tattaaataa gggagctagt gtgatagcat    315360
     tacaattgct taaggcggga agggactgct taatgaagta ttggctggca tattattaaa    315420
     aactccagca catgatacat cataaataac gagcatattg ttcttttaac agaattgtct    315480
     aatcctttac tgactgccat tttcaataat tattttgtca ctggcttctc ctaagaacga    315540
     aggaaaaaca gaattgatgg aatcgattgt ttacgttggt gaatttcgcc tgaattgttt    315600
     gtgcaggact tgttttgcag tgttcgcaat taattttttt tgtcgttttt catttcattc    315660
     tactttcttt tttttttcct ctttccttgg tcgttgccat taaaataatt tcgataatac    315720
     taatatggtg tgagtgagta aatttagttg caacgtagcg ttcacacttc caacataata    315780
     ccctttttgc atttcaacat tgttccaaat cgatcaataa ttaacaatcg ttaggccaat    315840
     tctatttaac agcacttttt ttttgacagt tgttgatttt ataacggcaa tttcattcac    315900
     attgaagcat agaataacgg ttcctttttc ctcttattgc tttgtgttga acaactccta    315960
     gtggtaattg ctttattaag acaggaaaga actatacatc ggattcatat ttcgactttc    316020
     taacacttga taacctactg aattatcctt tttttgttaa aggtcaatcc cggtttacaa    316080
     atagttacga tcgatataaa ttgaggctac tgaattctca taaccttcaa ttgatttcct    316140
     gaaataactc ctcgcaacca agataaaaag attacacatt cccattttag aatggctatc    316200
     aaattgattg atttggcaag aactttcttg ccacttttac ctgaagtgga agttccattt    316260
     gaaaagatta cttttgatga caaggttgtt tacacaatct tctctgcatt gatataccta    316320
     tttgcccaat tccctcttgt aggtctacca aaggaaacag ctccaggcac tcaagttaat    316380
     gacccacttt acttcttgcg tggtgtcttc gcagctgaac caaaaaccct acttgagttt    316440
     ggtattttcc caaatgttgc tagtgccctc atcttacaac tactagctgg ccttaaggtt    316500
     attaaggtta acttcaagaa ccaaaaagat agagaattat ttcaaacttt gatcaagttg    316560
     tttgccttgt tccaatactt catcttggcc aacatcttca tttactctgg ctactatggt    316620
     caaaaccttt ctattgttca agttggtttg attaacttgc aactatgtgg tgctggcttg    316680
     gtcactactt tgatcagtga ggttgttgat aaaggcttcg gtttctcttc cggtatgatg    316740
     gttattaaca ccgtctctat tgccactaac ttggtatctg acactttagg aatttctcaa    316800
     atttctgttg atgaagacaa caacactgag ccacaaggtt ctttgatcaa cttgattcaa    316860
     agtttcagag ctaagcacag atctttgctt gaaggtatca tctctgcttt caacagagac    316920
     tacttgccaa accttacaac taccgttatt gttttgggta ttgctgcagt tatttgctac    316980
     ctacaaagtg ttcgtatgga actggctatc agatccacta gagctcgtgg tatgagcaac    317040
     atctacccaa tccgtctcct atatgtaggc tgtctgtctg tcctattttc ttacgtcatc    317100
     ttattctaca tccacattgg tgcatttact ttaatccaat tgattgccaa gaacaatatc    317160
     gaaaacccaa tctgcaaagt cttgggtcac tatgacatgg ttaacaactt gttggcagta    317220
     ccatccttcc ctctgtcttt gttgactcca ccaagatcat tattgagcag tatcactgag    317280
     caacctctaa ctttgattac atacacaata tttatggttg ccactggtgt ctactttgct    317340
     gataagtggc aagaaatctc tggatcttct gctcgtgatg tcgctgctga attcaaggaa    317400
     caaggtatca ctttgaatgg tcgcagagaa caaagtgtcg ctaaagaatt gaacaaggtt    317460
     attccagttg ctgccaagac tggtgctgcc attctagctg ctatcactgt ctgcggtgaa    317520
     ttactcggtt tgaagggtaa agctgctggt attgttgttg gtgttgctgg gggtttctct    317580
     ttactagaat taatcacctt ggactaccaa caaagtggtg gtcagagtgc tttgactcaa    317640
     gttctaggtg ctccaatggg tatgtaaata taaggaaaca gaacattttt ctcttatatt    317700
     cattatatgt acaatttttc tccatttttt gttcttcttt accattctac cgaaatcaac    317760
     atttatttaa aatttaatga cattaataaa ctgatggata catctttgta acagtatatc    317820
     gacaaatctc ttctagaacc tgctatattt atagtaggta ctacgagtac tactcaaatg    317880
     acaacagtta atgaaacgat gaattcacag gggtcacggt gctatgtatg gtttcctata    317940
     gctatgctta ccgatatata ttttgtacat tattaaatgg tgtttctcag tatatttaca    318000
     tgtaattgaa taatcaaaaa taatcttgtg gctcagactg tgaagaagca ctatcagagt    318060
     ttcctttaac aacgactaac ctcgctcaat gtagcaatcc acatcacttg cctcgctttg    318120
     tatcctacct tttagaacat attccttcaa cttatcagca tacagttgcg catccataat    318180
     accaccttta tatcccttaa aatggtgttt caactctggt acattatgac ttacaagagg    318240
     cttcaaatcc atattataat ccttcggcgt gacaaaagta cgaactttcc tccactcgat    318300
     cacataccca cctttcctag tatgtctacc aataccagaa gacctagtac ctttatacat    318360
     atctttatta ccttgtttgg tggtcaaagg tgtccttttg ttacctgcct tagactcacc    318420
     atagaacaat gtaccatccc gatacttcac ccaaggacga gtaagaagcg tcgtcctaga    318480
     tccctgaaac aagttaacac cagtagcttt cagcatctca cagaagtctt gttcagcgcc    318540
     tgtatacaaa agttattgtt gccctattac caagctatac cagctaaata tccaagatat    318600
     agaaagtacc cgtgatcatt acttgcagtg cgcccacagc ttgcaattaa tccacagctt    318660
     tggcatttcg attggaatct tcgctgggat cctacaatga caagttacac agtaatttga    318720
     aaaaaaaata gggcccgtac caaagaattc atagtgccaa ctagtatata ggatttaagt    318780
     aacccaatac cacataacat ctacctttgt tattcatatt accttcttga gtaccacatc    318840
     aacaacaact ccaaatttat ttggtgataa ttatatttat ttattgtgcg ctaaccgtgg    318900
     aattgctagt tctgtgtttt gtgcgaaaga ggaactttat tggaatagaa aactataggg    318960
     aactcaaaga atccaacgac agcaaccact ataagccttt ttttgataca aatgtctgcc    319020
     aactcagatt tgatacatag gtggtcccac acttattcta ttttgtcgat actgccgttt    319080
     ccgaaaaaga agctgcttat tgcgggtact caggattcga agatcctggt gtttgatcta    319140
     cctgcataca atttgattga aacaattaag ctaggtgaga taagtgagaa taatactaga    319200
     tctagtgtcc tttctttggc caaatctaaa aatgagaaat acttgttttc cgccggagct    319260
     gactcattag tgagagtgtg gcgtgtgggt tccagagaca gtcaccatgg ggtttgcttg    319320
     acggaaatgg caactatata ctctgtgact gatataggtg acatattttc tatgaaatat    319380
     ttggactcct tagatacttt ggtatttggt tgccaaaacg caagcttgct attcttagag    319440
     aatctatgtg aaagaatgtg tattgctcaa aagagctcta caagagatat gaatagatta    319500
     ccacaccgta ggtacgataa attttttgat tcacaaggac ccactggtac gggttccaag    319560
     aaaccaaatt atggtgattc tgggacagat tccggtgacg acagtgatac acaaaatgta    319620
     atattagaag taccctcaga aaacattgtg ccatacgcac ataatggttt catttattcg    319680
     atctgcaaac tggataatga gtttcattca tttttctcaa ctcagagatc tgatgacaca    319740
     aatgtggaat acataacatc agcaagcggg gatggaatta ataagatatg gaaattttct    319800
     ggcagggcca atactgttac cattactttt atggatattc aattagataa tcatgatagc    319860
     gtaatatcgc aggctgttga atttccattt ctgtattcgg gcctgactca aggtataatt    319920
     aatatatggg atttaagcac tagggaacta gtctctacaa tcaagacgaa aaatgacgat    319980
     gatatcacgt ctatttcagt ttataaggac catatttttg ctatcgacga atctgggata    320040
     aatatgatat atgaaaatca agctatacac tggaatccca atcaaggtaa aattttaagc    320100
     tctgaaatat ttgagaagag caactctaac cattctttaa ctgtatattt gttggctggt    320160
     ggaaatgacg gttctttaac cttatgggat gtttcaacac taatggaaac aggttttacc    320220
     atgagaccct ctaccttatc tgcaaactct tcgaacatat catattactc taccaaatcg    320280
     tcatcagcat ccccagtgaa caatgaagaa atgctagaaa ctttgaaaac cttaattcaa    320340
     tttcaaactg tttcacagtg caaatctaca ctacatcaga tggctttaag aaaatgtgcc    320400
     accttcttgc agcaactttt tacctctcta ggtgcaacta actgccaact tttgccatca    320460
     acgaaaggca gtagtcctat tgtaactgca aagtttattg gatctcaaac tcaggacaaa    320520
     aaaaaatgca ttctttggta tgggcattat gatgttatag atgccggtga cacacaaaat    320580
     tggcagagtg atccatttac tttaacttgt gagaatggct acatgaaagg tcgtggtgta    320640
     acagacaata agggcccatt agtcagtgcg atatatagtg taacaaattt gcacagaaga    320700
     ggagagcttt taaatgatgt tatattttta gtcgagggta gtgaagaatg tgggtcacca    320760
     ggttttgcac aggtatgcag agaatttaga gaaagattag ataccgctat agactggata    320820
     tttttgagca actctacatg ggttgacgag aataaccctt gcttgaatta cggactaaga    320880
     ggtgtgatca acgctaaact gacaatctct agtgatgccc cagacagaca ttcaggtgtt    320940
     gatggtggtg tacatagaga accaacagcc gacttgatca atgtggtatc gaagttgcag    321000
     gatactgatg ggagagtact tatacccgac ttctattcac ctgtcaaaga gattgaccaa    321060
     gaagagtatg agagatttca gaaaatcatc gaaattgctg acattaacag agacacaaca    321120
     gcggatgatc tggtcacaaa ctgggctaaa ccatcattat cattgacatc aatgaaaatc    321180
     agtggtccag gaaacgtaac ggttatacct caaacagcaa gcattggcct ctcaataagg    321240
     cttgttcctg gccagcacgt tgcaaagatc aaagaggacc tttttaagta catcagggat    321300
     tgttttgata ctctcaacac tgagaatcat ttagagatag agcttttaaa tgaagccgag    321360
     ccttggctgg gagacccaaa caatcatgcc tacagagtcc taagagacga actagcattg    321420
     gcatgggaga aagagcctct gttcgtgaga gaaggtggtt ctatcccatg cttgcgaaca    321480
     ctggaacata tcttccaagc accggcagta caaattccgt gtggtcagtc aacagataac    321540
     gcccatttga ataacgaaaa cttacgaatc aaaaactgga ccaaaatggc agaaatacta    321600
     gacaacgtaa taaacaagct gtagtcaata agatgtaaac tacaattagg ctagtaactc    321660
     tccaattgct gtacccacgc atcgtataac gtacaagcat tttgcagact aatcttacat    321720
     atagcatttt aacaatatat gaaaagaaat aaatttgcta atattacata atcaatcaga    321780
     ttgacgctaa acccaatctt tcttcggatg ctgtatgcaa tccgctatac ggccgcgcat    321840
     taaccgctat gcaacgttcg ggcgatctaa gcttttctgt aaggcccata cattcacgca    321900
     ccagctcact aggacgtttt tcagttagat gccacgcatt ttctgggcaa aataccggaa    321960
     atgcaatccc gccccgccca agagcatatc catccctgtt tccttccatt ttttctgttt    322020
     tgccggtgca gagccttctc tgaccttaat tagccatcgt agctttgtca actaacaagg    322080
     agggattata acccgttccc acggttactt cttaggcact gttagcaagt tcgccgtcaa    322140
     gtgatcggga atccttccct ccccgacaca gaaacggtcg taccccgcgg tttttttatt    322200
     atttgaaatg tatttccaac tttgcgaata tcaagagaca taagagacaa aacaagggta    322260
     gagtgcacag agactggcgt agcacagttt ctcttgattc tcatttcatc accccacaga    322320
     aactcatgca aacccctgca tttcatccct tcccattata ttcaatcttc taaaaacaaa    322380
     tacccttcca ttaatacaat atgggctacg tggttttctt tgcggacaaa tttttttaat    322440
     tgatccttgg acccttacga cataacaata ctgtagatta caccatattg ttggtaaagc    322500
     taaaggatag caagagcaat aacgagaaaa catttcatgg agaacttata tatttgacgg    322560
     gtttcagata cctatgttcg aaattctctt gtaggaggtg aaagaaagct agagaagacg    322620
     tgtctatcca agcttgcaca ttcgcttcag tgtacagtat gtctacacta tcttatgatt    322680
     cccaaatcag cgggcgggcc caaacacaac atcaggcgaa taagagcgat aaggaaggta    322740
     tacatgtgct accacctgat attgtgcagt ccactctgcc ctacctcgaa cctgaagata    322800
     tcaagaacct gtcttacacc aacaggtact accacaatct gctagactat gagagttcga    322860
     tgactctgtg gcatgacctg ttccacaagg catttgtgcc agaatacacc agtgccgaac    322920
     cctttcaagc cgagaatact gtggagttca agacttgtgc tgaggtgatc atgatgaata    322980
     aatatcccga cttggattgg catgaacggt acctgatccg tgagaacaat gcggagttat    323040
     atacctgggg ctgcctcaaa catgccagac tcgggtacac agtatcttcc aacagattcc    323100
     tggaacaaga ccatttgaat ggttcactgc gcataaagat tggtgtaaac gcacctacca    323160
     agatgccttg gttcgacaat gatggatcgg agagtttctt agcagatgat agggtggttt    323220
     ctcaacttac atgtggtggg tttgcattcc aagtactcac caagtctggg aaactcttca    323280
     atacaggatc cacgtttagt ggtggccata aaggccctag cacacctgag ggagaagctg    323340
     atgtaaaccc ttttcgagaa ttaactaggg cattagaaag atcgcatact tccaacatga    323400
     caactggagg accaactccc attaacctta caggcacctt ccccagacga gccagttatg    323460
     gtggctcaca ggccagctat gttggtgtcc ccacatcggg accccatgaa gatatttatg    323520
     ataaactcaa tagactagag aatatattta accaaggggt acctggaaat gatcatgtga    323580
     aaagattatt tacaatggac tctgttaggc ttagcgattt aatcgatagc aatggaaaca    323640
     ttattgacat cgatatatcc aacgaacaaa ttgactgcaa taaatttgtg gccatttctg    323700
     caggcagaag tcacatactt gctcttgatg ataaaaatag attatattca tgggactcac    323760
     cagagacaga tgtcggtgta agaataaatt ttgaatttct acatgacagt aacgaaagac    323820
     ctatactaaa aattgatagt ggctgggact ttaattgcgt tttcatccat tccgttggat    323880
     tggtattatg gaatagacgg gatgctcttc ggaaagggga tgcttatgcg aaagcccatt    323940
     acaaaataat tcccaataca ggaattatta acagctctaa ccgagtactt gatttttctt    324000
     gcacacaaaa taacactgtc tactatatca caagagaagg ttcttgctta tggcaatatt    324060
     cgaatggact tacagaagct atcaatctac caattgaagg aaaactttcc aaattgattg    324120
     cttgttttgc ttccttaatt gtatttgata atcgcaaaaa ctgctatagt ttaaagctta    324180
     acagtggtaa aatcgacatt acttctctga caaaattaga actggaagat cctgacgagt    324240
     attttattca attggctagt ggtgactatc acacactggg cctaactcaa aaagggaata    324300
     tttatacatg gggaattgag agtcagtcat gtggttgtct gggactaggc tcacaagata    324360
     ggagaaatac tccacataat ttcataactc ttcaaaatgt tacagttcaa aggccggcta    324420
     agattgacct tggagaaaac cgaacttgtg tagctgttgc agcaggtggc tggcagtctg    324480
     gtgcaatcat tataaataat aacgatagct cgagatcatg atattaaatt ggtttgaaat    324540
     agagaatgga ttatactagg tagtcacctg gattacatgt tgaattgaag agcaaattat    324600
     aaaatattaa gaactattag taaagaaagt gaaaacaaaa ttagcttgtc cttatttatt    324660
     taaagatttt gcttctatag gtactcttat tatagtttta tgcagaatta ccatgaataa    324720
     taaaatatat attacaatgt tgcgtaccgt ggtaaattag aaacacctaa atactaccac    324780
     ttggtgaatt ttcatctctt cctttttctc ccgcttcatt aatatctcca tcaatatctt    324840
     catctttttc tgcctcattt tgtgtttcgc cttcattagg gagttcttca gatttagttt    324900
     cctgttgctc ttctccatcc aattcttctt catcgactgc ggcaaagttg ataggatcat    324960
     acttcattct caaatgatct ctcacattag cctcctttgg agtggcgttt cttaatgtaa    325020
     cattcaattg atcaatgtta tgctctctta caattggcct tatagcatct gctacacgtc    325080
     tacgtctcaa ttcaattctg gatctcaaag gcttgtagaa agcgatacct ctctcatcgt    325140
     ttaatacaat ggctagttca ttgaaaccat cttcattatt tatagttgat ataccttctt    325200
     gagcttgttt tacatgcttc atatcaaagt cccttactct cttaaatttg taattcttgt    325260
     ctgcgatatc atctgcgttc agttggtctt ccaagtttct ttccatatca tcctttaagt    325320
     tctcagagtc tttaccatct gtggtgtaca tagatatcca ttcgtcctct tccaactcta    325380
     ctggcctgaa aatggctgtg gatagggcta acttcttctt ttcttgagca tcaaatgcgg    325440
     cactgcccac caatcttaat gtgaagtaat tttgatccat agaagcagtg tcaggcaaca    325500
     gactccaggt cttcacagcc ttcaatttct ttttgactgg atgttgtaac ttatctagat    325560
     tctttgcggt agattcgaat gtactttcaa ccttctcgac aatctgcgag gcattcaaaa    325620
     ttgcttcgtc agaatctctc ctcattctct taccaagagc attaacacca cgtttcttac    325680
     caccatcgac ttgtgttata gaagatgaaa catactctgt ccttctcaag aatgtgacct    325740
     tggacatatc agttttcgtt agtctatcta ccctcggatc acggagcagt acacgatctt    325800
     ctggatgaag tttgatgcta ccatcaagtg cgtaaagaaa cttcttatcc tgacggttaa    325860
     gaaggcccgg tatctgcatc aaatccaatg gcatacctaa atcgttgtcg attttaatca    325920
     atggggtaac attggtcttc acgtaaagag agtcaatgag ctgcggtgaa tccacattct    325980
     cctcaggacg ttcgggaaca gccaatagct taggtggcag cagtggtgct ggcaggttgt    326040
     tctgaaattt tatcttagcg acatagtctt gttttttcga catctttcct gcgttttgcc    326100
     tccagttgat aaataactcc tacctttatc ccaaatataa ccgtcgaaat gactttaagt    326160
     tggtattaat tggcaaaatt atattaaatg ttgtctacca cacccagtga ctattctact    326220
     tggtcttctc tttttgctct tcaattttga aatttcactg gaggattgaa cgcttcgagc    326280
     gattatccag cgtcgttcaa tggtacaagt atacgatagc aactgctctt tgagctacat    326340
     cagcaaggct tatgtgagca tatatgccaa tttgtgcgag tttgatgtac ttagttatat    326400
     cgctagatat ttctataata gcatggttga ttgttgaatg ccttttcacc catcatctgc    326460
     cgatgcttcg tcttcatcag aggaaacttc ggattcttca tcaagatcag caacaacgtt    326520
     cattttttct acttcttgca gctgtgtttg tacttctggg tctatctctt cttcttcatc    326580
     ttcatcttct tccttctcat caccctcatc ttcttcggtt tgtgtacttc catgaatttg    326640
     aggagctgat tctggagcat atttgaaagc tgataatatt gatttcgccg aagcggatgc    326700
     tttattaaca tcactagctt tgcttgcagc tggacgttcg gctggttcag tctcgtctac    326760
     atccatctca tcatcttctt gtaaatcttc ctcgggtata tcctcttcca ttgacgcgtc    326820
     cttttgctct gcttcttgac cttgccccac cggcttggct gataatttgt gaagaccact    326880
     ggaagtcttg ggcttctcta tatgccgtac cacatcttcc aaaaaaatat aatcgtctct    326940
     gtttctaaca cactcaacca atgcatcgtt agtcaatcgc agccctgctt tcttcttgcc    327000
     tctcctcaac tgagcaccaa atagcgcttg ctcaacaaac gactgtacaa atagctccgt    327060
     agcaaaggca gtggccacat atgccatatt agacgtgaga atgctctcag gatccacttt    327120
     acctatacgt ttcaccttgg atatcggcag tttgggcgtc cggtcgcgta tcttctgttg    327180
     caacaccatc ttctcctctt cactcattga catttctaga gttaattaaa ttccacggta    327240
     gttccaaaac actccacact tggtttcgac ctcttagaca actaaacaaa taaattactt    327300
     tctatactat aaacaaggat caattgtata tcgaagacta tttcgctgct taatcgcttc    327360
     ttttcaaaac ttagaaagcc tcatcggatt ctagaaaata agaagcaagt ccatagaact    327420
     agtcgcttgt ttggtactag ggagcaagca aacaagaata ttggcaagct agtgtgcaaa    327480
     tttcaattaa taggagcaag ctggacattg gtatcggtgt gtgtatattt taggcttgga    327540
     tagcgtttga attcttccgg tcataaaggc tctaataccc aagggaaatt caacgaagtt    327600
     atatactatt cgtggaagca acccattttg cttcaagaat aaacgggtca ttgagattta    327660
     ctgatccttt tgacagacgg gctgttagga caaatataac catagtttga gccaaactgt    327720
     catagtcatt gcgctgctcg acggactggc atcagactat tttacctctc accatgattc    327780
     ctgccgagga tgcgtacata acagtagaga agagctggaa gcagtctaca ctgcctcctt    327840
     gttccgatat gtttccgtgg gctcatgagt tttatgtgaa ttcgccgagg ccttcatatg    327900
     cggggtcggc tattatcttg agatcgaaga caacaagaga taagacgatc gataatattg    327960
     caaggttcag aggatcggta gacctggcgg acgtgtttat gtcatggcct aatgtgactg    328020
     acatgtctac aaacgatatt tctttagaag atgaaatact gtcgttaaat ataggtttca    328080
     ccaaacaaat ggtcgatctt tgtaaacatg ccggtgtaat gccctttcta aagacagatg    328140
     ttccagcata ttcccaattt catctaaagc gtatgcgaaa tagagtgatg aatagacatc    328200
     attccgcaag tctttcgagc gccagttgcc gttcttccag atcacccgag tcgaacataa    328260
     acccactaag gcggtttgat ttacaatgcg ctaaaatgat tgaaatagca cagcatattt    328320
     tagtgtattg tttacatttt gagaatggca gagaccattt gcaatgcaaa acatgccaaa    328380
     tggtgacaga tattataaag ctagctctat ttcacctgcg agctaaaatc aatatagagc    328440
     aaactgacct tggctataat cagataattg actatatagg gttttctagc tttgctgatc    328500
     ttccaacggg atttttagtg gtacccttga atcatgttag ggatgtgata atctcgcaaa    328560
     acaatgaaac gcgacagcat caattgattt cacaatatga tatattgaga tttaacaatt    328620
     gggatagtga tttgaaatat catgagaata tggagttggc tatctttacg tctgcgacca    328680
     atattgatga tacaatatgg gttggtaatc accaagacaa cgttaattat agaaaacaat    328740
     ttgcccttag ggaattgggt aaataccaaa aaccaaaaac tgtaatgaat gcaccctctg    328800
     tggatagatc aataattaat gtagatgcaa taagttatga tgattctagt ctttgcagtg    328860
     aaaagttgta ttacattcca agcatagagg tgccctggat tttgtttatt aaatgtaatg    328920
     aatcctcatc gttaccatca tctgagatat tggagaatac attaacatct atattgaatg    328980
     cacatactga tgaaggtgaa ttcaccccga ggaaaagtaa atcgcttgat tttccatcca    329040
     gtggatccat tgcgctaggt caactaaata tagcatccgt cgaagtactc cttaacactt    329100
     gctacctaat ataccaggtt tatgcatcca ctaaatttca agcattgcta tattgtagta    329160
     atggttatac agagacttct cttctattaa ttgcatattt gatatttttg tgggatatac    329220
     cgttggaaga aacgctactg agactacata aagagtatgg ccggccttat tttcttttcc    329280
     atgcggactt acaaatacta ggccaccttc aatcaatttt gcgagagttc agtcctaatc    329340
     gcaagtctaa cagtaccaaa tatttagaat cggtcaagac gtacttggtc acgcaagacc    329400
     caaaagatct gttacgctta tcgataacct ctgagatgtt tagcaatata ttcttattca    329460
     aactaccttc atcgtccaac tttacgaacc taaaagggcc actaccgtca aaaattcttg    329520
     atcatctata ccttggctct ttggaacacg ccgagaagcc agagcttctc aagaaacttg    329580
     gcatcaccca tattttatct gtcggagaga ggctttcgtg ggtatttaac catgaaagta    329640
     aaagaagcaa gtgtgaagaa tggtactcca attggaagat tatagaaaag caaggcattc    329700
     aaatttgctg gatacaaaat ctagaagata atggtgttga tcctatcata aaccaactca    329760
     cacatgcatt agagttcatc gacacctgct acaaacagaa tggtaagata ttggtacact    329820
     gcatggtcgg tgtgtcgaga tcggctactg tatgcattgc tgaatgtatg aaaagattga    329880
     aatgtgacgt aatgcgagca tacctctacg taagagtacg aagattgaac ataattatac    329940
     aacctcactt aatgttcatg tatgaactag aaaagtgggc agaagagtac accgaacaga    330000
     aaacaccaaa gacggaatgg catctgctgt gcagagaaat atccaaattg aattgcaaat    330060
     atgactagat tacatgaaac tttcctctgg tggtttgagt gatgtaggtg ggatgattct    330120
     tttccattaa taatagtcat gagacacaga aactattttt tctatatttc gatcttgata    330180
     aataaatact aataaaacgg catcgtaata acaaaccaag tacccctcca taactagcat    330240
     actacatcta atctcttagt aactacatta ataatattta tcaaaatcac gtgatataat    330300
     tgcataccgt cttcaaaaaa tggtgaagta cgccaaaacg cgaagtgaag acacgttcag    330360
     taaacgtcca gtctgtgtta atgaagcatc aatgccatca gaggcatcgc aaacattgtg    330420
     ctagaaaata ttggttgtga aaccaggaat tagctgttgt tccacgtcat ttttatccat    330480
     caacctttct tgtataaaca gtataaatta gtcaattttc tttttaaaag aattatcaat    330540
     aagctgatcc ctgaatagtg ttgcgccaaa tcaacagtat aacgtcaacg tttggaaata    330600
     cgggagtctc tgttataaca gggttatcat atttgtcata gaaaaattaa tatagtcact    330660
     gtcttgacgc tgtttcctaa ggattgcggt tagaggagag acggttgtaa cactataacg    330720
     attgaaaaaa acccttgatt ctgcgacttc tcgaaatatc ccatatcgac aacgttaata    330780
     tacaggaaac agacctgatt tgcatcccac tttcgcaaca tcagtgatat aggtaccatg    330840
     agtgatggct cagcagatag aaaaggcaaa atgcgtgccc ttgacatttt atcaaagcat    330900
     ttgcgaggga aaaacagtga caagaccact ccaacaagat atggtcataa aagtgtagaa    330960
     ctggaaagta tactacgaaa ggacaacatt gttagtagtc ctttagaatc aagggatcat    331020
     caggagtctc agagaatcaa taaccctcat tctaatacag cctcacctac tccaaagaga    331080
     agaaagctca atacccaagc gatatcaagt gacaataaga cgaaacaagt actctcaatt    331140
     ggggagttat cgcacccaga tatgcagtca actcctgcca ggagtcgcat catgaaaaag    331200
     gatattggcg accaaaatat gtcatctagt gaaatctatt caccgagcgt taacaaatca    331260
     gtcagctttc ttgatgaaag taataaaaac tccgaatcga caagttccaa ttcttctcca    331320
     aggcattcac ccacatctaa acccaaaaaa tccattctaa gaaactcatc ttcacctgag    331380
     cataacaagc agagaatgaa tgacaaatac ggaaaaccga tagcggctaa tgtacatttg    331440
     tctcgatctg aaaatcattc taaaaatcaa tactcaccag ataatttaca gttctgggga    331500
     aatggagaga tacacagcct ttcgagtaat aattccgtag cagagtttga aaagctattt    331560
     ttgggggcct tgaaaatatt aatgcaatcg aaaaatcctg aatatggagc taaaaagttt    331620
     gaagtgcatg ccactataaa taacattatg ccatcttttt ccagtacaac atctaatcaa    331680
     tttattgaaa aggctgccca tattgtgaag gacaatttga agataattgc caatataagt    331740
     atcgagcacc tacgcgatga acaaaactct cttttacaag acaaggaaaa aaagaatccc    331800
     tttagtatca gactttacat ccaaattgtg aggtttttta ctaatttatt tggctctttt    331860
     attatcaaca aatttcttat cagcagtaag gctttatgcg aaagaatgaa acaagtttat    331920
     gagctttctc ttgaagcttt gaaaaacgag aactctaata agatgatgtt gatatgccaa    331980
     atgacgtttt tgagagatga gaagctcagt tatataagtt tcactgaaga tgagggtaaa    332040
     catatgattc aaattataaa tcaaatacgg gacataccta gtaccaatgc catttgtgag    332100
     aaattgatgt taatcaagca gtttttaatt aagtttcctg gacctatgat atctacaatt    332160
     ccagaatggc ttccaacaca agttatttca aagattgtct tctctgagga tgtttactca    332220
     acaaaaaccg gatttacagc gatttcggta ctcttagaac ttcttaagag atgtattgat    332280
     cactcaatag gccatgaata tgtatttcag tgtttacaca tcgattctac agctctgtac    332340
     tttggagatt caaaagacaa aaagctacag tggtctaata atactttgga acaaacatat    332400
     gacataaatg agactcatct tgcagctatt ctaagagatc atattgacta cctagttaac    332460
     tccaagagag agtataaatt ggcaatggac atgtggttat catttatggg cctccttttc    332520
     aatagtaaag gaaggctggc atttcttgca tcaaaagagg gtgaaaagtg ggtagatatc    332580
     aatctgaact gcttatcggt gaacgatcca aagtgtagga tattatcact taaggtatgg    332640
     aggattctta tctattgtgt gacaaataat attgattttc tgggtgaaaa ggaagctaaa    332700
     aaaatttctc aagtactttt gaatcctgtt aacgttaccg ttaataaact agaggataat    332760
     agtacattta tgggagttaa atatttgctc aatgactttt tttttagtac ctgcgggata    332820
     actaacaaat gtaaaccgac tacaaatata gtactttggg ggaattttat atttccgatg    332880
     ctcgcaacgc tactcaatta ttcagcaaat gaagatgtta aatttgagtt agatacgtat    332940
     atcgggaagc ttttgactaa agctattcaa aatcagaaga atgtagataa aacaaaatct    333000
     ctacatccta taaaggtcat agcatcagag ggcgtatccg ttgatgatat atctgctctc    333060
     caattatctc agcttcccta tttgctagaa acattgggct ctgtcattct tctatatgtg    333120
     ttgaatagca aatcccaaaa tcatagtcag acaagaatgc taatattgga atacttagaa    333180
     cagataccga ataatcaaat tactctgtcc acactttgta ggtgcatctc tatgttttat    333240
     gaatactaca atagcatcga tttcatcgca aattctccac gatcccttat ctctgacatg    333300
     tcaagagtct gtattaaatt taaggacatt atttttgatg ataactataa tgtttttagg    333360
     aacttcattc tttcatttct catgctattt caagaagaag aacatcatgt agataatcta    333420
     cttcaagaac tcatacagaa tgcactgcag gcaaatatat cggagttaaa acttattgaa    333480
     ggcattttgt ctctcaagaa aacagattgt gatctgtttg ctattaattg ggttggtaaa    333540
     aagttactct caccttcagt tcaagaaggt gactttattt tatattctag aattgttgca    333600
     aaaatcagtg aaaagcaaac cattgttaac tttctcgatt tagctgataa actggggttt    333660
     gaagtaaatc ccacggaaat actaagaatt agtttttgga aaccatctgg acttgttatt    333720
     tttctcgagg aatatatcgc aaaacatcat gttgactttg ctgatattgt gagctcgatc    333780
     atagatgctg atagattaaa taatgtggaa ctttttagct acgttcttaa gcatctacca    333840
     gaaaaccaga aaagtgcgtt tattaagcag cattatacta agtgtcctct tatctggaat    333900
     caaggagtgt tgattgatga ttatgatctt attgacatta cattggactg tgaaatatgc    333960
     acatttatag cccatcattt ctcatttctg tctacttcct ccaaggcaaa attattaatc    334020
     atattcattg agaaagatat gtatgacttg ctcgttcaat tcagatacaa tttgatacag    334080
     gaatttttgc caaccctaac tatatataaa aaggatgaca ttataaccac agtacagcaa    334140
     cacttaatta attattgctt tgcaaaaaat agttttgtct tgctagattg tattgaacca    334200
     tctacattga cgtcaaggac cttagaagat gttattaagc tacttgagaa atcgtatgag    334260
     gacaacatta catttgttcc ggccaaatat attattttta ttgataacct accaatggat    334320
     actaaaatta ataccacaga aattttaaga gtgtatctgg tcaccggcga tgttacacag    334380
     tgtttgttct tcttgacatc attaattaac gataagaaaa tggttccgtt aactagatgc    334440
     cgaaatgaag ttttcgattt ctttattgcc ttggattctt caaatgacct aagcataaaa    334500
     gcaaaagcag ttaccacttt tgagagttta attaatgtta tctttttact aagaaagaag    334560
     gtggatattg gattcttatc acaatacatt gccagattac cagaaagacc atccagatat    334620
     ctagttgatt tatcagagaa attaatatta aataaatcat tcaacagaag taagttcaga    334680
     aactcttcta gcttcaatga tttacacaca cacgttagaa catggtgtaa ccagttagat    334740
     aatacgtctg gaagtcccag ggaaactaca ccaatctcag cagcccacat caatgaccat    334800
     ataaataaaa atgccttgag tcttgaaaaa gataaagata atttaacaaa caatactgaa    334860
     caacagaaaa atattccgaa ttcaaaatct caagaaatct caaaattcag tagtaacata    334920
     gcagatgcca atgatctacc ttctaacact agagaatcta actgtgatgg gtcccaaagc    334980
     actgaaccag ctggagggaa aatgataaaa atagataaag ggcaaattag cgcagatatg    335040
     aagaataaca aaatcgcgcc aaggcaaatt tcttctattg ccagtgaacc ggatacttta    335100
     gtcaactcca atattgacaa taaatctatg attgaaaagg gtaaaaatgg cgataaaaca    335160
     gttaataata atgcaactac taatgatttt gaatatcgga catctgaaga tccaattgtt    335220
     tccgttaata ttccaatttt caactctaga gtttcaggtc tcgataaatt aaataatcaa    335280
     aaaatttcag atgagtatgt tattagtagt catgacctag aacttgccag aaatggttta    335340
     caaaaccagg cacaacttca tgatatgcat gagggatata aaaagaaatc tgcaaatcta    335400
     ttgactcaac ataacatgag accaccattt gaggatgttg ctattccaac tcataaagag    335460
     ttgaagattc caatctttaa ttcattgata cttaaaagta ccaaccaaca accaatgatt    335520
     cctaactctc aaagaaaagt gcaatcagag gttgctatta gaaaaagacc actcgggaat    335580
     ccgagcacac aaggccaata cactgatata gagaatgaga gagttcgtga ctatgatgat    335640
     agtcaaagtc ttgaggattc tgctgacata cgactacatt ttcctaacaa acgtgctcgc    335700
     cgtatcgttt ccaaactcag aggatttagt gaatacgaca tgggccagtt atctgcagaa    335760
     gaaaagcgca atttgagaat tgagcttttg gatttcctta tgaaaatcga atatcatacc    335820
     ataaccgatt agccacttac tgttaagatt tgaaaccaat gatcctaact tgacttctga    335880
     ctcccttctc tcaagatttg tattgtacac gatcttgagt acgtaaatgg ataatgcttt    335940
     ctcacacttt ttagttattt aatcagttcg caagtagtag attaggtatt atatcataat    336000
     ccgtaaaaat tgtattatat atatatatga ctgtggaaaa attaaataca caaacataac    336060
     aaatgcacac ctactcccag attgagccaa tgtctaaatt agccgaatcc ataaatccat    336120
     caatggcgaa gttgtcgata ggtaagaaat cagtagatgc catatcaaca gaaaacaagt    336180
     ccgtctgatc cgcggaattt ggggttattg ttttgtcgtt ggttgatgtt gtaaaatcct    336240
     tgaatgaatt cacattcagt atagcgccat ctcttccact tggcagactg cccatagctt    336300
     cggcaaggct attggggttg atcaataggc cattgaaatt agaattttgg ataataaaat    336360
     cttcgaagtc aggtgtatct agtgatgaag ttgttgtatt tggtgttaag tgatcaccct    336420
     gctctgattc tggtgttgtt ccccatgcca tattattctt ggctgatgaa atcggtggta    336480
     aagagaattg ttcagtaggg tatgggtcat tacgagtcat ttgggtctgt tgttgtatgt    336540
     cagaattagt gcctggcaag ataggagttg cagctccaga gtgaggggca tattttcttt    336600
     ctggaatcat attttggttt gttgtcattg ccgttggatt catcataggc attggtgcag    336660
     gtgacatcga tctttgctgg tgcatatgga gaacattaac ttgattttgc tgctggtttg    336720
     caggtgataa tggtgatgga atcaaaggat ttgtaacttg atggctgtca ggacccaatt    336780
     ttcttgcatc tgattcagag ttgggagtaa ctctcatatg actgctagag taggtgatag    336840
     gttgatagga cctgattgga ggtagctgtg gtgtcattct gccattggct tgggcgtttg    336900
     gaagcaaacc ttcaacatta ctaatagatg gtaaatttgt cacacttggt ctggatggca    336960
     taaagcctaa cgcatcttga taaacagggc atttctttaa ttgatctgaa tcgcttgaca    337020
     ataatgcagg tatgttggaa attttcggat gtttccagtt ggaaagtaaa agctttccaa    337080
     caccatgctt atgtttcgat ccattctttt tactaccaaa tgatccactt ggagtggtta    337140
     gtaacgatat gaagaaaccg gtagacttca tcaccctaac agaaaagcta tatttggggg    337200
     ccagtttttc agtcaattgc ttgaataaaa ccattcttga cattaatttc tcagccaatg    337260
     agtctgaatt gtccaggtta atattttgca ttaaatcatc ttgaaattgg ttatcttggt    337320
     tcagattatt tggctcttca gtgttttcat cttctacgct actactatta caactgcttg    337380
     gtacacttgt accaaagatc gtctgtgttt ccttcagtcc gtttaatgga ccacatttca    337440
     ccctcagtat caggcatata atgaattgaa gagctcgatg tcctatatct aagctgtgga    337500
     agcacagtat cacattcata tacttaaata acggattctg gtcagaaaca ccaacaaagt    337560
     atagcataca gttcctataa ccgtcaagcg cataatctaa ggctttctga gcataattct    337620
     ttgctagtat ggtagttgtt ggatcttctg cacctaacgg ttcataatga gtaaataaaa    337680
     tgtaatttag caagtacagt agcatcctca acgtcatatg tttcgagaaa aataaagcct    337740
     tggacgtcat ctcatgtgga aggtctagtt ttttgtcaac atcttgacca attctctcgt    337800
     tctcatcgcc tactatttcc tgttctgatt ttcttgcgag taatatatcc tccatcctag    337860
     gcaaatcata tatatcatca aacttttgca gcccaattgg tacttctgat gtcgacagta    337920
     agccatggtt tataagagaa ttaatgacat cattgatacc tttctcacca tcagtcaatt    337980
     tttgaaggtt agagatcaaa gcatcaagtt caaacttccg gacattctta gcaattgata    338040
     tattgagagt atggtttaag acagcaacga tacaaagatc tagttggtaa aacagtgtat    338100
     agttttttat tataataagt tcttttatgt ccttcacgta atcaatcttg gatgcggagg    338160
     gtagtttggt atcgctgata tcattcaaat ttctgattag tcgcggtgaa ccaagtaaca    338220
     atgattgctg tacgtcaaga cttacaatat aataccaaac ctttctccat gtatgctttg    338280
     ctctctcgat tgatacatta gtatctttgg gagaaacaga tggagtttct gatccatttc    338340
     gattggaatt gctaggagga ccagatcttg tattatcagt agttaaattg gcggagacaa    338400
     cgtttagctg agggaagttg tctggatctc tatgtaaacc acagctaaat gccatcatca    338460
     tgatgctaga taacaaaatt tggtgggatt cattatcaaa gttacccgca gagttacctt    338520
     gactggaggc atttgcacag ttcattaggt agaatttgaa gaatacagca aactgaatag    338580
     ttgacatgtt gacgttcgta ttggatatac tagaaatttc atcaaacttt atcagatgtt    338640
     ttttgactaa atcaagggca aaaccatcta cctcatattt caggagctgg agttcatcct    338700
     tgagcctcag tgatgacgct aacgatcctg attcgtaatc ttcgttttta aaatcatggt    338760
     ctgtgcgtaa tttgtttaat aaaggattct caatgtcgat tttacaagag ttcatcggta    338820
     aagatagcca aactaacctc atgattatga ttaagatacc taaattagag taatctgttg    338880
     gtttgttaag tgtcattgaa gttattggtt ctaattctag atcagaacta gtgctcatta    338940
     tcgtatttga gatcagcgaa ttcaggtcaa atatctgatt tatgttattc ttaaagttca    339000
     gttcatcaag aataggtata acagggtaaa aatgtttgaa aaatttgtct atgtatagca    339060
     taattattct ttttggaggt agcaattgac aaagtttttc aatgacttct tgtttagtta    339120
     gaggtttgtc attgagtcca gctccttgca ttttttcttt ggtgtatttg gaatggttta    339180
     tagggcattt tttagtagca gcattcttat tatcagtatt ggcactcgtc aggttagagt    339240
     catttacttt atgatcaaca ggacacttat tttgtacaat atgagtatgt ggggggtgca    339300
     taggttggaa ttgacctgca ttgctattta cgccaacagg gttactcatc gctctatgat    339360
     cgattgggca cttgccaatt gagctctttg gtgtatcatt aaccataggt gttgtcttga    339420
     caaaatgatt tttctgttcg gattctgcag ctttgaattt gctgtgatca ataggacatt    339480
     ttcctccgtt cttttgtctt tttcttcgtt tgtgtccaga accattggta tagtattcta    339540
     aaagcttttc tctcatagtg aaaatatgag tccatagtaa tttcaagtat ggatcacctt    339600
     tcataatggc aagccagtga gtagctccca aatgaatagt accatttgat ttaatatgaa    339660
     gcaaatcgaa ttgtctggtt agatcgagtt cgtcataatc gtgttcttta acaggtctag    339720
     ccatgtcgtc aaccatattg gtatcatcct ctagtttgac cattggactg tttgttaatt    339780
     taataggggc atcaaccggt gaactcaatc caacaggaga gtttacaaca gaggcgccta    339840
     aagatgctgt tacagctgga ttgtgcatat acctcgctag cttttcttcc agaattttgc    339900
     acctctcttt cagattcttc agttcattat ctttggaaat ttctttctta gcatcctgtg    339960
     cccagttttg ttccatgtaa tggcaaagat gagcaacacc tgtcttagta cattggttac    340020
     aatgtggcct tgttttatca cactttacct tacgctttct acaaattgtg caacttagtg    340080
     gaattctatt ccttttcttt tttggagcag ctcctggtat tgttgtagtg gtactcattg    340140
     tcgtctttag ggtacagtga gtatagcgga atacttaaat cgaaacagct agtagagatg    340200
     taaaaaccta taattctatg cttatttcgt cctgtcttgg aaatagtctc tcttgttagt    340260
     gtaccgagga tatttatcga aagattaaag cctaagatgc ctgtatgact tgtgatagag    340320
     gtaatgttaa tgaaattcaa ttggagatat tcaactctat tcttggagct gtagtgcagt    340380
     tatttcggaa agtaaaatta aaatcaaatt aataacaaat gggaaaaaga tcaaagttat    340440
     aagaacaata aaaaaccaac ttctatgggt atgattcaac caatcatgaa agttgggcaa    340500
     aattactatt tgtaatagtt attgaaatgg aagtaaacaa ctttatgaat cagaaacaaa    340560
     aaattcaaca acttgttagc ttattatttt ctaaactcca atcgagctga aggaatatac    340620
     attaagttcc caagaagaaa aaactgttct tgcttaggat ccaaaattaa atctaaatga    340680
     aaatttttga gtttcaactt cgaatgaaat aaacttggta aggttggtgt ctaaatggga    340740
     cggaatggtt caaaagatgt gctttgcaga gcgtaaatat gggttctttt tttttctttt    340800
     atcaagatac caatgttcaa tctatttgcc cctgttatcg aggcctggca gaataaaaca    340860
     ccaaactgca gtcttattta gacaatcatt ctttcccatt gttcttttat tatgcactta    340920
     cctttatttc tttctttttt tctcattaga gattgatgcg tggaagggtc ctttctacaa    340980
     caacaaaagg gcatttcagt aacaacagta gtagaaagca aaccggaaag ctcctcgagg    341040
     aaaagaagat cctcgtgtag cagggaggat agtcacttat cctctggtaa cttcccattg    341100
     tccattttgc tatcatggga tggacactac tctggcagaa aagaaatgca gggatattgc    341160
     agcattttac gagcccgttg ggaaaatctt atccaaaata tgtactggtg agttctatct    341220
     ttgttgaaca gcacctcgtt tagaagagaa ggccttttgc aagtgaattt tattgcccac    341280
     agcaactctg ctccaattgt tcctggaatc tcctccaagt ctttcaacag gccaagtgct    341340
     aatgggcagg ttttttcatt ctgtctaaac gaaaattgcc atctcatcgc actttaaatg    341400
     tttcctctac agaaagctgc gtggcgggca ggttttttct tgtctttttc tcgaaggcag    341460
     ggcagcttac taattgaaat aatgacaata gtgactttta gctggataga tcaaagtgtt    341520
     caggcattat tagtgatacg ctatgcgctg gttttacttt cttaagagca gcaaacactt    341580
     cgcaaaatat cttctattga gaagcttgtc aagaggagtg agaatcttat tgtacataca    341640
     atgattgagc tttattttta aagaacgcgg ccgtggatca cggccgtaga tgctatattt    341700
     tgtgtaccta ttaacatgga atatggacaa agatagtcac tatatgtgca gcttgttgaa    341760
     gagtgaggtt agctttcttt tgtaaagtca ctaatgggct agtttcttgt agcaatctcg    341820
     tgaaaagagt attatttcat atgcggttgt ccgtacatat gctgtcgcaa tatatttgta    341880
     ccatgctgct atatattgtg tcgcagcttt gatgtaaatg ttatctttcc acatggcagc    341940
     ggcggtttct aaatcttctt gtagcacgag actggaacaa tatgaagtca gtatcaggaa    342000
     tcctctggct ggtcccaatg gattacgcaa ggactcatcc aaatatcttg ttaaatcgtt    342060
     ggtcttcagt agtaatatca caatacgtgg aatgtgtgct aggattttca tcagttgttt    342120
     caatagttta ttctcttcgc cctgtgtgga ggtcccttca aggtcagcag gcattgatgc    342180
     cttatccagc atccgcttcc tcatgatttc tatttcgtcg ttaccacgta cgctgtcgat    342240
     atcataattc agtgcgctct ccacggatct accagtgata gccgccgcaa agagaggaaa    342300
     ttcatcatca gtaatgcccg ctaactcata gctccatttc ctcatttcat tttgatcatg    342360
     gcgaagaaga ctcagccaaa actttgcata atttcttctt gttttcaaat caggatatct    342420
     gtacagacca tgatcataca gaacaatttc atagttatga tagccattct cttttgttgg    342480
     tttacaagtt cttattgaca gatttcccat atgtggatca cagtgtattc cagcgtcttt    342540
     tgtgaatatc atactgttaa atatgtgagc caacgattct gatacctcat tacgcttgat    342600
     attatgatct tccagatagg ttgggtcatc aagtctagca ccaccaatgt attccattat    342660
     cagaactcta tccttgtgta gcaatacttt tggtaccctg acacttgtgg ctcttttcag    342720
     tttcttgttt ttattaaaaa acttggctgt taattcagca ttttgagctt ctttattgaa    342780
     atttatctca tcgtagatgg aactatggag ttcatccgcc aaccatacca acgaatattg    342840
     agggaaaact ttatctaagg ttgcaaaaac aaacttggtc atcataacat cgacggacac    342900
     aaattcttgc aactgtgggt gttgaaactt tactgctact acctccttgg ttccttgttt    342960
     gagcttagcc ctatgaactt gagccaagga agccacacca aggggttcat catcaatcca    343020
     ttcaaaataa gtagtaagat cttcaccagg aatttctttg gcaaacatac ggtctatgtc    343080
     gtctagagat gactccgggc aatgatcctg caaaggcacc atagtttgag tccactctag    343140
     gggtaaaata tatgacatcg ccccaatatg ctgtcccaat tttataaaga caccaccatt    343200
     cttctctaac gctttcaacg tgatattagc agctttcaaa tggcattgac gtaaattctc    343260
     atccttttgg tcttcatcat caatggtatc atttaatgat aataccttct tgtattgaat    343320
     aacacatcga gaaagtgcga tagtaactac accgatacgt ttgaagctga tatatccatg    343380
     ccttacagtg ttgtgaaaat tctcatttgt ctcatacaga atacaactgg taccaacact    343440
     taaccctagt acttgtaccc atctcttgtt ataaaacctt gatttggcta ctccgactat    343500
     cggggttttg ggcctcgtta gattcctgat taatgttggc aaactcatcg caaataccag    343560
     tgactaacta ttaaagtgtg tttattatgg tatttaactc agcagtccat acatatattg    343620
     tagttcatgt tgttcaaatt ctcaatcacg caggtaacgg ttgagatatg tcaaattcca    343680
     ttgctccaac tccctccgcg ttttccgtgt tcgccaagct gctggatata atcaaatagt    343740
     gatcaattaa agtaattcaa tataataatt ccaagttgac attacgtgta tttcgtagtc    343800
     ctgtgagcac taattactag tttactagcc gaatagtgcc aagttttctt gtatttagta    343860
     aaaagaatgt gaagtttagt ctataaattt atataaataa ccaattcgag tgcatgctta    343920
     ctcgagaagc taatctactt tcttaatgaa taaatatttg gttcctgtga attaaaaagg    343980
     tggacaatta tgtctattgt acagttggtg ggtattgtac cgttagcttg tgaccaccaa    344040
     cggggatctg agagttggtg tagcttaaga aagtgttcca aaatatggcc acgacattgg    344100
     ctgccagcaa cctatgttga agtggtacaa gagagaagtt taccatctgg aacagcggcc    344160
     acacgcacca attggttttc aaagtgtccc accattgtag ttttattttc tcccttgcgg    344220
     caccgagacc gtggccctcc aataaggaca tgcaaccaaa atagaatggt agcccaagtg    344280
     gtgcgaatcc aagttgatct acacagaccc taagaaccat atttgaccag tgcttggcag    344340
     gtttattact aaacttcacc ttggtcaaga agcggtacca cctgtctcca ataaaagaaa    344400
     atatcatcga cccatataca acagccctaa cggtccttgg tatatcgtac tttcctcgct    344460
     tgacatcgtt ggtttgggca cttggtggaa gtgtgtctgg tccactggga aatagtaact    344520
     gagcagaaac atcaccaatc ccaaataatg cacctgtcat gatggaattg gtcagcttag    344580
     ggcgtacttt taactgatgt tcatacaatt gaaacagcct gatcattgcg ttctgcagat    344640
     gttattaact aataatttaa actgtatctt tatgtcaacc ttttgctttg tataatgaat    344700
     gttctttgat tatttaaaat ggtaatctaa ggatgatctt agtgctatat ttgagacaga    344760
     tgtcactatt gggtattcac tgcattgtaa attaatttat atagttacag ggaatatgct    344820
     agtggtaata acgttggtca gtaatatatt attgtaaact taaattaatg aatttttcaa    344880
     agaatcgtat gttatcccct aacaaatgac aaaaatttaa agtgccactg ctggaatcat    344940
     atagaaataa tcgaaacgtc attgtatccc aggtaataaa ttaggttttg tgacaaattt    345000
     atatcggccg gggaatacaa agtggcatgt agtaaatatg ttatattagt gttatatgca    345060
     actctagaga gcagcgatgg ctgcaagtta taaagaaacg actgccttgc agcctgtaat    345120
     ttttaatgga tactgcttct tttttttgaa atgtgatcta tactttatta acaatagtac    345180
     aacaaatgaa acaatataga tacctaagat atgataaaat aatataaaat gtataataac    345240
     tgatatatct cacggagaaa taaattaaga aaagaaagaa ataatattaa acatcattaa    345300
     ccgaaaaagc taggaaaaag aaaaataagt gaatattttt gggatattct caaatttaat    345360
     attttttaaa ataaaaaaga ttaaaagatg agattcactt agaaatcttc gtcatcggaa    345420
     gaaacgtaag catcacccaa ttccttcttc ttcttcattc tctccttctt cttctttctc    345480
     aattcagcag aagacaactt cttcttcttc ttaccaccgg caatcttgtt acccatagca    345540
     tcgaacttgt cttcttcgtc ttccttcttc tcgattcttg gaccagcacc ttgaccgctg    345600
     acccagttgt gaccggatgg agtcatctta ccgtccttga cggcccagac ttcttcagtc    345660
     aagttcttgg tgaattcagc agagtgagta atgataataa caccaccttc gaaagccttc    345720
     aaagccttgg acaaagcacc tagggagtct ctgtccaaat agttagtagg ttcatccaag    345780
     acgatcaagt gaggtctttg ccaagaacaa gcagccaaga ccaacttaac cttttgacca    345840
     ccagacaaac ctctgattct ggagtgggag accaattcag cgtctagacc caacatagca    345900
     cagtgctctt caatttcctt tctggtcaaa ggacggaatt gaccggaggc caaagcttcc    345960
     ttcatatcaa cttcagcaac catcttggag tgggattcga ccaattcacc tcttggaatc    346020
     caagcgttgt caacagacat cattgggacc catctttcag acttcatacc gatgttttca    346080
     cccaacaaga aagaacattc gtactcgtag gtgttcttga actttcttct agcgtggata    346140
     ccagcaattc ttcttggggt accttcgatc ttgaagatct tgttcatagc ttcagcatcg    346200
     ttttcgttga tttgtctgtt agctctgtcc atggtttctc tatcttcacc agtttggaat    346260
     ctccattgga tatattcaga tggagtcttg tccaagtggg attcgatgtg agcgaaagcg    346320
     tgttgcttaa tgtaagcgat acgacagttc tcgtgagtgt agacttcacc ggaggttggt    346380
     agcaattcac cggtcaagac gttaatcaag gtagacttac cagcaccgtt tggaccaatg    346440
     acagcaattc ttgaagacaa agaacattgg aaggagatgt cagagatttg tggcttggaa    346500
     gtacctgggt attggaaggt catgttggag accttgacaa tagccttttg cttggtctta    346560
     acaccttcta ggtaacctgg ttctgggaac ttgaactcca agtcggaggc acctagttcg    346620
     tagtaagatt gagcagttgg gcacttcttg acgaattcag acaagttacc cttgtacttt    346680
     ctcaacttca aaccttcgta gtggataatg tattgacaga cattgtccaa gaaaccggag    346740
     tcgtgggaga caatgacgga ggtgatacca caggtgttta ggtagttgac caaccaagcg    346800
     acgttgacgg tatccaaatg gttagttggt tcatccaaca ataggatatc agcgttcttc    346860
     aagacagctc tggctagagc caacttcatc ttccaaccac cggacaagga ggagattggc    346920
     atgttgatca tttcttcagt gaaaccgaat tcaaccaact tagcggtgat agcttccttg    346980
     gtaccgactt cagaggagac gacgaagtcc aagacagaag tgtcagcgtg ggtaccgtca    347040
     atgtcgtgtt cgacgtagac agtcatacat tcttctgggg ttgggaaacc gtcgacttga    347100
     ccgttagcga tggctctcat caaagtagac ttaccagcac cgtttggacc acatagaccg    347160
     tatcttctac ctctctttag tctcaattgg gtcttgttca acaagatctt agcaccgtaa    347220
     gccaaggaga actcacagtt acataggtct tcaccttcgt cttcttcgtc gtcgaagttt    347280
     ggaccaactg ggatgttgtc gacggctctc tttctgaatt catccaagac gtccttggcg    347340
     tttctttcat gcatgaagat ggtcatgtat ggagtgatgt gagtgaacca agcttgttgg    347400
     tcaatgactc tttcgtcgat caagtcaccg gccatagcgg cgatgtattc aacgacaatc    347460
     ttgaatcttg gagcgacgtt ttcgcccttc aacaattcgt tgatgacacc tagagtggtt    347520
     tcgatgtcac cggcgtggga gatttctggc aagacatcgt cctcggtaac gttaccgact    347580
     cttctcaagg tctttagacc tctcaaagta acttcacgag cttctgggtc ggcaatggtg    347640
     gcgtagttgt tcttcaaacc tggcaatagc ttgtccaaga aaggagcaac gacttgtggg    347700
     tcttcgacca acttacacat gttgtcgata atgacggcag ccttacgctt gatagaggtt    347760
     tctctttcag ctagacctct ggacaacaat gggaccatga tggacaaagt agctggggtg    347820
     acttcagcga cgaaagtggt ggcacctagc aagtggacgg tttctgggac ttgctttgga    347880
     tcagcgatac aggagatcaa ttgagggatg aaacgctcga tatccttgtt gtcgacggtc    347940
     tcggtggcct tggtcatggt ggcggtagca gcctccttga cttccttctt ggtgtcccac    348000
     atggtttcag acaagactgg gatcaattca ggcattctta gggcgacttg ttccttagcg    348060
     gcatcaacaa gagcggagat ggcggccaag acggagacct tttcttgcca cttgttggtg    348120
     gtttccaagg acttggtcaa gtgaggcaag taagccttga tggcgactgg gttgatggcc    348180
     ttggagatgg cgaccaaagt cttggaagca acagcttgga catccttgtc cttgtcaccg    348240
     gccttggcgc agatttctgg gaccaaagtg atgacgaatg gctcgacgga tggagacaag    348300
     ttagcttcgt tagcgatgtg ggcaacggct tccaagaagt tagcggaagt cttcttgtcc    348360
     ttgacagcct tagccaactc ctcaaagaac ttttctggga tatcatgttc gatgatgtta    348420
     ccgttcaaga aagaagcaac ctcttgggca gcttcgacac ggttgtcagc agtagccaca    348480
     gaaaggttct tgaaaagctc ttctagaact ttaagagatt ggtcagagtc agtcatttgt    348540
     cagatgtctc tcttttcagt tgttgtgctc aggagagaag atgaaaagta aattaatata    348600
     cgaaagagaa aacatctgaa agcaagaaac ataatatata tatatgaaag aaaaaaaatt    348660
     tttttcactc aaaatacatt ataggccatc gcaagaaaat ttttgaaaaa aaaaaagcaa    348720
     aaaaaaaagc aaaaaaaaat ttttcagttt gttaggaagt attgtgaact tgttatggat    348780
     tagaatattg tttagcttgt tattgttatt gtagttctag ttctagttgt agttgaaatt    348840
     gaaatttgaa aaaaaaaatt ttcttttaac atagaaaatc gtccttatag caatagaatt    348900
     tcagaaaaag tatagtgaaa aagtggccct cttcgcctgg cagctctttg gtagcctctt    348960
     acgcccggta accttccacg tagcagtaga gtggaaattc aagtgcgggt atttctgtga    349020
     ggcatcttag aaaacaaaca gccaagtcgc agtagaagag aaaaaaagaa agaacacttc    349080
     acagttatgg aattgtagag agcaagagcg cacaggctca acaccaatac cacggtttgt    349140
     tggcctgtgc gagatttgct aaatcgctac atcctctgca cggacagagt ggaatgccgc    349200
     acagagtaga gagcagagag tacagagaga gacaagatga aaataaaaaa gaaagaaaat    349260
     aaatagagac gcaaatattt cccctttttg cctcggagag gaacaccgtg ggactaccgt    349320
     agacccccaa gcaatcgcgt gtggcctgaa aagaggaaga gaggcgacgg aaaaagcaag    349380
     aaaaacagaa ctgctctgtg cgttgtcttc tggggtaaca cagtgctgcc agacaggctc    349440
     ttgaaattga aaaaagcaaa gaactacgtt ggatgttaca cggtgtcaaa acgtgggtgg    349500
     tacgtctatg tggaccttta attatatata gcaacttcag aatacatacg agtgtaaaga    349560
     atgttatata agtacatcat tagcaataaa acaaaagata aaagataaaa agggaaagaa    349620
     tttttgatct gtataattta tgtgattact tgctctaatg gggacttgtg gtcgtcctta    349680
     cgtctcttta ttatagtgga tgagtttagt ttcagctgga acatttgctc gtccagaccg    349740
     tcgactatct cgttggaggg ctcgtctagg tcggactcgt tcagtacgct taggttgtgt    349800
     ttccttggtc ccggggaaaa cctcttgtcc tcttcttctc tttgtacagc attacttatg    349860
     tcaaaggcat ctctcattgc tacagctgca ggcgagtata gcaacgaggg gtccctctca    349920
     aagacgttct tccgcctctt gcgcttcatt atacgtctct gctgtgcctc ttcctcttct    349980
     agcttcttct tgcgcttggc gaacgtgtcg aacgtgttca gccatgggtc cgccaggaac    350040
     tcgtctatgg tgtaccgctt gcgagggtcc acctctagca gcttcttcac acagtgcttg    350100
     gcaccagggc ttatctcatc ccaccagggc tccaaaaatg tatactcacc acgacttatc    350160
     ttctcggtta gaacgtctat cttctcgtcg tagaaaggtg ggaacccaca cagcatggta    350220
     tatagcacac aacctatccc ccacatgtca acttgcatgg agtatttctc gtccttgaca    350280
     acttctggtg cagtgtaccc tatggtacca catggcgtct tagtgttctt ttggaatatc    350340
     tgcttggaca acccgaaatc cgcgagcttc actataccga taccaccacc gccgatagtt    350400
     ggaatgaaga caccttcatc ggccttggtg gctgggtcgt cgctctttct gaaagtgcgc    350460
     ttcttggaag gaatatattc gatgctcttg aacaataagt tctcgggttt aatatcacgg    350520
     tgcactatac ccaatgagtg catatggcgt accgctaatg caacttgttt tataacatgg    350580
     cgagaaagat cctcgctcag gtaggtcagt ctgacaatct cattaaatat ctcaccacca    350640
     tcaagcagct cctggattag atagtaataa tgcttggtct cttggaaatc tataaagccg    350700
     acaatgtacg gacaccctgc tgcaacagct ttgtgtatcc tgacttcttt cattacttgt    350760
     tcacgggatg acatcctgtt cgtattattc tgcttatctc tacctgccct cttgtcctta    350820
     gcctgctgtt ccttattaga aacatccaga tcatgtttgc tgataacttt aacagcaact    350880
     tgcttgtagt tacgtgccaa gtaggcgcta tcgctgttct tgtcggggat accacagaac    350940
     actttagaga aagcaccctc acctatcttc tctatcaact tgtaaccctt cagttcgacc    351000
     tgctcagcaa acctcagcgg cgtgtttgta aactgctctt cgatctcctc agagtcctcc    351060
     tcttcgtagt cctcttcgac atcgtactcc ccatcgaagg acagctgcga accttgatcc    351120
     aaagagccgt tgtcaaaaga gtgcgactca gcggtatact cgctagtacc ttcgacctgc    351180
     tcctccttca cattatctag atggcccata tcaacaggga taggggtatc agcaacagca    351240
     gtcaactctt tagctagcga cccaataaga tcatgtgaat taaccgtcgg atcccacttg    351300
     gtaggctccg ctggcgctac catagtactg tcacctgctc cgatcattgt atccttcttg    351360
     ctcttactat tatcaacacc tgactccaaa tcagtaactt tcttcttgaa taaagcctta    351420
     aatttctgca ttattatctg gaacaaaaaa acagaaacta atgaagtctt agttattaat    351480
     aaacccgcaa aacaaaggtt taatttataa gtttttttaa ttgtagttca ataaaaaaat    351540
     aagcccttat ccaaatttct agtttaatta ttattcctaa tattatttga tcttagctta    351600
     gattgccttt ccgtcgcaag attttttaga gccttatcct ctcttctaca gagtctatct    351660
     aatctattta cccccaatcc caaattttcg atttcctcga taataagaga tcaagtaact    351720
     tgggaacaag ccctgcaatg ttgtcactca caatcaacat ccgtcatccc atcatccaca    351780
     acatctcact tgttcacata aatttttcac tgctggaaac agtctttccc aaagaaaaaa    351840
     attgagtatc agagattggt tctggtccta catcctcctc ccccataaca agcatatgga    351900
     ttccctcagg atcacaaaga tacccgtaca acaatcgata atccacatcc acatccacat    351960
     ctacatccac atccacatat aacacccgga tgatgaatga cgtattaacc tacaaagcaa    352020
     cgctccgtca ctcccacatt taatcggaca gcccaaaaaa tggcctcccc cagtctatca    352080
     catcagttat gttcttttta agcttagaaa gtactacact tcaatttaaa gattgaggaa    352140
     agtccagaat gcccaggtaa tgcaacagat tactttccct aaagtggatc cgttccactt    352200
     cttgagctat taaccttttg cactaccaca caagctctcg tcatagacac tgcatggtga    352260
     catttcttat ttctggtggg tgacaccttc actcttgcaa ccctgatcat cttgtccatt    352320
     cccatcggag gagagaaaaa ttttttcttt tgcgtcaagc tacagtcaaa cctatttaat    352380
     tagcacatct tagaaatatt aatctattac ttttcccccc ttgcatagag gaagtacatt    352440
     caaaatataa accttttctt atgtttagag tggctctatt accgggcttg ataccaattg    352500
     cttttgcaac cggtagcggt gccccccttc taatatactg tcatcctaac attgaactct    352560
     attttactta aatagacctt ttaattaaaa aagaaaacag attaacctgc accggtttga    352620
     gttggcttgc atatttgcct ctaatgcttg ccgatataga agtgtgtcaa catttattac    352680
     atagcttgcc agtagattct tacatgactg atttattatt aaataaaaat gcaaagaaaa    352740
     atgccagcac aataatacat ttgtgcatta cacatcccaa tgtcgcacag catagtacca    352800
     tcttatgaga actaaatgat gagaaaagtt attatatccg atttcgacga gactattacg    352860
     aggaaggaca ccatcactgt gctgggcaag ataccatacc acattaaacc cggcctgaca    352920
     cctagttggg atcacttcag cagtaattac tacgattgct ggaagaaata ccacagcaag    352980
     aatcaggatt tgaggcggct ccctttgttg agctcacacg tcagggatca aggcatccac    353040
     ggaggaaact acagcagctt gttcaaggat gagatagagt accagcgtaa caaccgggtc    353100
     atagaactct cgagcacagt cgaaatggct aaacagaaga tcttcagcgg ggtcacacac    353160
     cagcatgtgc atgactacgt gggtaccaag ttgaagaagg acgaatgtgt cctgcgtgaa    353220
     ggtgtattgg attgcataga taatgcagtc caggacccac gagatttcta catactgtcc    353280
     gtaaattggt caccagaatt catagacgca tgcatcggta caggtaagat cccaaaggag    353340
     aacatcatat gcaatagact gctctctgat gaagatgcca cttatactgg tgagtttgag    353400
     aacgaggtgc tctgtggttc agacaagatc gtaaagcttc aagaaataat taacaagagg    353460
     gccggtgagc aagaccatct gagtctatgg tacattggtg acagtgaaac cgacatatta    353520
     gcaatcttac accatagtat caacggaata ttacttgtag acccagaaga gaatgcatcg    353580
     aagtttaaaa agcttgccga ggatgtattg ggagttgaca agcaacttct agactctttt    353640
     acaaccgaca gctcgttact gtttattaaa tgcttgaata aggatcacaa taattctctg    353700
     tatctggcaa aatcttggaa aggtgtacaa caaatactga accaaaatta gcgaccagtg    353760
     tggtttttct ttttctaata tttgctgatc tccctctcaa caactctttt taacgtcaaa    353820
     ttatttagtt tccttttaga gtttattcag atattcacat gccattaagt aacggtttcc    353880
     caccaagtat gaacacctcc ctagcactac tacaaaacat ataatcttat taatgttgtt    353940
     ttattactat cagataatgt tacgagaagt tttgtctttg taatatttca gactactcaa    354000
     ataggaatta gcagcaatat taactaaact gttaacctga acaccgtagt cggtaaataa    354060
     tgtattcagc tattgcataa tatctcttat tttaactatt ctatgctgtt acaactgtag    354120
     ttacccggaa tatgaaactt ttcacaggtc aaagtctgta cagcagagtg gaaaaaatga    354180
     aaatagtggg aattgaattg ggagagctca tcgcgtaata gatgtgagga actgcaggtt    354240
     gaataatagt tactattttt tgagttgggg ggataatagt actgttaaaa ttgttgaatt    354300
     tgtctttgaa acaagtggag ctcagcaact cagatataag aatttttcag tgattctcca    354360
     ggtaatggct aaagttaata gagatcactt ctataagctg gcgtcggatc ttccggagga    354420
     gcggttacaa gccgcagtgg gtgttattaa ggatctaagt gctcttgaag ttccacagga    354480
     aattgaggaa tggaattata ccatcaatag attggttaaa ggtcttgggt ctagcagaaa    354540
     cagtgctaga ctagggtttt ctatgtgtct tagcgaagca ctaaatctag cgttgtcgtt    354600
     aggtgacaaa gctccagaag gcttgaatag cattgaaaac tatctaaaaa tcctaaatga    354660
     aacgctaggt gccgatttcg atgaaggtaa gaaaagaaaa ggcaaagatg agagaggtat    354720
     cctctttgga aagttatttg gtttgcaagc acttctaaac gaaccactgt tttcaaatgt    354780
     atttgtgacc aaggatggga tctctaactt tgttcctgta tttgttcaag aaatgattaa    354840
     tttaagtaag tgcaagaatt ggatcagaga accagctctg ttcagtttgt atcaaacttt    354900
     ggaaaagcta atttctaaag ttagtaagtc ggatatcact aatttaattt ctcaactaga    354960
     tgaaaacaat ttgacaatga caaatgaagg attagctatt tatctgctac tggtcgatga    355020
     atcaaataaa atttctcgcg ctgagatcgc tgaaataaaa ctgcagaatc aaggctggaa    355080
     atctaatgac ccattggcaa agggtaactt gccatcacta actaaggtat tgttagataa    355140
     tgatggtgtg gcctttgcag aagataatga gcaaagaaaa caaaagggtg gtgcaaactg    355200
     gaaccctaga ctacattttg tttgggagaa acttctttca actattatta atggtagtca    355260
     ctcattaaat gtagaagaca aacatgttag caaaaagaga aaaaagaaca ataccatagc    355320
     atccatcaaa tttcatgaat tctggcaaat ggttgttgat gagacttact ttaatgacaa    355380
     ggcatcgagt gagcgaaaat accttggctt cttgatattt caaagggcat tcccgatgct    355440
     aaagtcgtat gaagacgttg tggactcttt gggccaaaat ttcataaggt ccttaatcaa    355500
     tcagtgcagt gagaaaaaaa ggcatttgaa caaaattgct ttacaaactg ttgaaattat    355560
     agttgaaagt tgtgaaaatg ataccaccaa gattttacca gtatttgaaa cacttgcttt    355620
     tggaaaaagt ggatcaataa cttttgacag actatcaaag accaaacttc tgagcagatt    355680
     actaggtata aaatcagtaa gatatgaagt cctgtctaag ctatttgaca ttttaagccg    355740
     tcagctatca atcaaatcag aagagaaatc atttagtcaa tttattttag acagcatgtt    355800
     gcatttagtt cgtaatcaaa aggctgaggt tgattcctta ctgctcaccg aaaaggtact    355860
     accacaaatt gttaagcttg cattctttac tggtgataac gaaactctac aagaaatgtc    355920
     taaggaaaga ttgttctcta tactttctga gctaaactct ttgcatttat cggaaagtca    355980
     agaaattcca cagtatgtgg ttatcaagct agttcaacag catattgagg gaggtgaaaa    356040
     gatgacctct gaactagacg atgaattgag agagactgaa tcttctgctt tgagaattct    356100
     tgccgaaata gcaaaagcta cagacaagcc ctatttgagg gggttgggtt ctttgtttgc    356160
     aacttgttta ttacagcttt acacaggtga tagtgaatca gttggtactt tacaagaact    356220
     taaggatata tatgaaaaac taatctcaga tgatgaaagg ccactttctt caataactga    356280
     aattctactt tcgttgctag ctcagaaaaa agcattgctg aagaaggcaa gtattgctgt    356340
     ttgggagcaa gttgtgcctt atgtctctca agatgaacta aatcttctgt tggacatttt    356400
     gttggcaaga gaaaacaagc aaggatttgc tcagttattc gaaggtatag atgagtatga    356460
     ggaagatgaa gatgacgaac agcttgaaga tgaggaacaa atcaaagagg taaccgatga    356520
     ttctagctct aactcggagt ctgatagtga ggaagatgaa gataactcag actctcatga    356580
     agatactagt agtgatagcg tcgaggatca taatgatgca gttaataaca ttgataagga    356640
     aacaaccagt gcattggcta aagctctgga tttacctgct gatattatta atgctaatgg    356700
     agaagtcgat attgaaaagc tggagatgca atcagatgac gatgaagatg atgaagatga    356760
     tgagtccatg gatgacgaac aaatgatgga ccttgatgac caattatctg aaatatttaa    356820
     acgtagaaaa gaagccttat cgaacatacc aactggtaat aagagaaaaa atgaagtaaa    356880
     ggaatccaga gaaagtgtta ttgcgtttaa gcatagaata gtagacttgc ttttagtata    356940
     catcaagcat gttgagaaaa tgatccaaag ggaggatgtc gatgaaaact ctaaggcaga    357000
     caaattgaac tgcttattaa catttgctat acctatgatc aaatgtatca agcaaacact    357060
     ggataaatcc ttagcagaaa agttagctaa gctattgaag acgagattgt ttaagattag    357120
     agttacagga atcaagctgg atacagctga tgtagttgaa gattttcaaa gaattcacca    357180
     agactttttg tttgccaagc ctggtcaatt tcctatactt tattacagtg tctgttctag    357240
     tacatcactt tattttagta agatactagt ggataatgca gattatcaac aaggtgttta    357300
     tgaaactttg gttgatacgt attcaaccac aataaaagag tggctgaaag atacaaagtt    357360
     ccctcattcc atattccttg atttcgttaa ttggttagca tcgaaaaaac aagggcctaa    357420
     aactaactag cattttttgt aaataatatg gctctattga ataattatta atatgagtaa    357480
     tatttttaat caaatgctta tataaaaata tgtacattaa tgtctcagtc aagaatgctc    357540
     aaatctacct ctggttcgcc accaatacgt ggaatgttgc ttgaacattt ccatatctgt    357600
     acgatattgt cctcttcagc gctcgctacg agccaattaa tgtttggatt cacggctata    357660
     tcatttatgg aagttttatg tcctgcatgt atcatcaata cttctggagg gccatcttct    357720
     atttcgtctt gagtttgttc ggcacctatt tcttgtaaat cccatactat agttcttcta    357780
     tcagagccag atgagtaaag aattccatca ttgtttggat cgaactcaat ggcggtaact    357840
     gcatcttcgt ggccggtcat agcataaaga ggattagata catctcttat gtcatataga    357900
     tatactaggt tatcagttcc tgctgctgca aataagtttg atgaaaaggg actaaaagcc    357960
     aaggtattgt atggtttctt tgtatttatg ttgtgtatta tctgggagga tctcttgtcg    358020
     aaaagtttca tggtcgaatc ttcggaaaca gagccaaaaa tatgtgcctc agaactatgc    358080
     cacttaacgt cattaataat gtcggtatgc gcatcttcaa aggtgatggt aggttttata    358140
     ttcttttcaa agttactaat gtcccataaa gcgatattgc tgtcatcaga gccactcaag    358200
     agtgaatact tctcgttcgc attgaaggct agaccataac cattctcagt atggtactcc    358260
     aaagttgaga gtaaagcttc cacaccgttt tttgatctat catatataaa aatctttccc    358320
     tcaccattaa tagtagcaat tatgttatca tcttgaggca tatagcgtgc tctcgtaatt    358380
     tcgccatcat gcgggaactt cttaacaatc ttcacattgg aaagaaccat gtcctcatcc    358440
     tcttcatcaa tttctctgtc ctttttggag ttttctgtaa cttccactgg tagatcaaca    358500
     gccccaatct tcaggtaatt ttgctcttct ccagatgtat gtgttccgag aatcaattgt    358560
     tgtcttgttc gagcagcaac caggttcttc tgtggtaacc actccaccgt taaagtaggc    358620
     catgttaatc tagtttcgct tacaaaatca tacagcattg gtacgttact cttccatagc    358680
     tcatactctt catcaacggt cattggctca ttgctttgtt gctctgcagc agcggcaacc    358740
     tcggccatct tctgcaacgc tgagggatcc aattgtacac tcataatttg ttggtgaatt    358800
     gactatatgt ggtgtagctt tactgtttat aaagccagtt ccggaccaaa tatctcattt    358860
     gtaactgtca ttagaggcat tgcatctttg attttatttt atcattattt agttgtttcg    358920
     cgtgatgagg aaacgcgact ctggttatgg atcgtggctg ttaataagtt aaatagcata    358980
     taataaagcg tatatatctc agatcagcta agtacaacta ctctttgaca gtctctataa    359040
     gggcatctgt cacttctgta gaaagctttt ctgtggcctc cacggtctga gcttctgcgt    359100
     agactctaac agcatcttcg gtaccactag ctctgatgaa cgatctacca cagggagcat    359160
     ctgcgactag catgtcgatc ttgtcctgta gcccagctgg tgacaccaat cttctctctt    359220
     gatcagttgt gatgaagatg gatctgtctg gtacaaccac tttggtcaac ttgtttggca    359280
     gatcagtata ttcgtggtcc caagtagctg gagaccagcc caggatgcct agcacggtga    359340
     tgatggccag catgtcgctg atagcgtctc cgatagtttg gttgatcaat ctggacagca    359400
     gtctcaatgt cagggtgctc ttgtcgtgtg cgttcttggc gagacggtcc tcgatcactt    359460
     cgtagaagtg ttgggagaat ataactgtgc cgtgaccgtt ggcctcgaaa tacacaccga    359520
     tgtcatagtt ggtgacagct tcgtggtgta agtgtttaac accggttttt gcgatagaga    359580
     cggggacctg cagcttcttg gttacgtatg tggtggagga gccgttagcg taggctgttt    359640
     gcacaacgcc cagtttcagc tcctcggcca ggccagcctc tttcagcaat gcgttgatga    359700
     agtaggccag cagcgtggat atcttgtcac cgtcgagcaa atggaaagtg agggagtcgt    359760
     cgacgtagta gaacaccact ctgtcggcgt caccgtcgaa ggagcagtac aggttgcgcg    359820
     ggtcggcgtt gataccctca ggcagtctct ggttggtctt gacgaagtca gcgccgcatc    359880
     cgctgttcag catcgaaggg ttgagccagc tgttgttggt gatgtcaatc tggtgcagcc    359940
     ttatcttctg caagtgtggc aagtctgtct gcgagtaaga gagcatcttc aggaactgcg    360000
     gtccacctat accgttggcc gtgtcgatga cgagtttgtc gaaggacttg aagccctcga    360060
     ttccgtacag ctcgaacagc tggttccagg cgtctaggaa gtagcggtag tagtagtcct    360120
     cgaagtgtgc cgggttcgcg gtgaggaagt gcagctgcgg cgtggtcagc aggccatggt    360180
     tggtgatccg cgcatctggg gacaccgcct tgataccgtc gagcaagttt gccagcagtc    360240
     tcggggagga ctcacgggag tcgtggccga ccactatctg tggtgcgtgg ccaggggaga    360300
     tgttcagctc ctgcatgatc gcgttcaaag tggactcgaa ggtgtggtag tcggcgacgc    360360
     tgttcgcgag cctggtggcc agcggttccc agtcctgcaa gagcatggac ccgtcggact    360420
     ccacgatctt gacaccgtta tccctaggcg ggttgtggga agcagtgatc atgacaccca    360480
     ccggcgcgca ctggcaagag atggacctca gggcagcgat gacacccgtt gtgaacatca    360540
     cggagtccag gatgcgagcg tcagctctga aaccagcggt accataggtg tagtgctggt    360600
     ctctggtgat acagttcttg ttgtacagtt gcaaggacat tatcggggtt ggtgagggga    360660
     ggcagttgtg tcgtcccttt agctgttttc aacacttata aattcaaaag tacaaagttt    360720
     tttcttaaat tttaagaaac ccaaaacatc ccagaggaca agactacata gggatggcac    360780
     cacctacacc tgtgatagac ggtatacctg cggaggccag ccgcgactgt cctttgaagt    360840
     cgctgacaca gtaccactgt gctccgaata cgcaaggcca gggagtgcac aaggacatgt    360900
     tcgtgtgcat ccccttcaca agactcttca aacagtgcgc agacagagcc atcgaagtga    360960
     ccacagagca caccaatata tagcactacc aataacagta tacaagtcta tgtaagtatg    361020
     atgtatagta taatgcaata tgtcagtgca cttcatacac tatgtgtggc tgcacctcta    361080
     ttttgggcgt cttttgagag aaactgcgca gggagggtac ctcgtaaact gtgacttctt    361140
     atctctttga agggggggct ggtaggatgg gggggtggca gtataaatag gcgccatctc    361200
     tgctgggggg aggatcttgt tctaacctgt ctctttgatg gaagggaggg gtacagcgct    361260
     tagttgagaa attaagccgt atatatttta aaaaagagta agaaaagcat gaagattgac    361320
     aaggttgtgg ccgctggtgt agtggctgcg gttgttactg cgggtgttat ccctgaggcg    361380
     cgcaggaact gccacggtaa gaaggagatg agtgtggtgg acaagccacc acacccaccc    361440
     caccatccgc acaagcctca cccaccacac aagcctcatg agccacaccc acctcacaag    361500
     cataaccaca agaagcacca ggagaagaaa gacggtgtgt ttgtcggaga agggttgcca    361560
     cccgtagcac catggtgcct cacaagtata ttgttgtgtt gaagaaaggc gtctctccgg    361620
     aggcggttgc tacattcctg aacgatgtgt ctgccgcgca cgctgctgcc atcagggact    361680
     tgcctaagga gcatgacttc ttcaacttcg ttaacgccga gggtctgcca aggggcggta    361740
     tcaaggacct gttcaacatc aacgacttgt tccaaggtct gatcggctac ttccctgagc    361800
     cagtggtgaa gttgctggag aagagcgata tcgtggagtt tgttgagaga gactccgtgg    361860
     tgcacgcctc caacttcgac acccagaaca acgccccttg gggtctggca cgtatctccc    361920
     acagagatcg cttgaacttg ggtaacttta acaagtacct gtacgacaac gccggcggtg    361980
     aaggtgttac cgcgtacgtc atcgataccg gtatcaacgt caagcacgtc gagttcgatg    362040
     gaagagcaca atggggtaag accatcccgc taaacgacct agacatcgat ggtaatggtc    362100
     acggtaccca ctgtgctggt accatcgctt ccaaacacta cggtatcgcc aagaaggcca    362160
     acgtcgttgc cgtgaaggta ttgaaatcag atggctccgg taccatgtcc gatgtcatca    362220
     agggtgtgga gtacgctgct caagcccact tgaaagaatc taagaacaac aagaagttca    362280
     agggttctac tgctaacatg tctctaggtg gtggtaagtc cccagctctg gacatggccg    362340
     ttaatgccgc agtctctgct ggtatccact ttgctgtcgc tgccggtaac gaaaaccagg    362400
     atgcttgtaa cacatctcca gcttccgctg aaaaggcaat cactgtcggt gcttcgacat    362460
     tgagcgatga cagagcttac ttctccaact ggggtaaatg tgtcgacatc ttcgctccag    362520
     gtttgaacat cttgtctact tacatcggtg ataccaacag agaaactgct tctttgtctg    362580
     gtacttccat ggcatctcca catgttgctg gtttgctaac ttacttcctg tctttgcaac    362640
     ctgattccga ctcagaattc tacgacgcct caaagcacgg agttacccca gcacaactta    362700
     agaagaagtt gatcgcctac agtacaaaga atgttttgac agacttgcca gacccagatt    362760
     caccaaacct attgatctac aacggtgcag gcggtgatct aggtgttttt tggaacagca    362820
     catctgctga cgaacagtct gctgaacatc cagagcagag aattgctgca gaactagggc    362880
     tggattccct agccaagatg gtcggtgacc gtcatgctgc tacagactct ctattcggac    362940
     aagtcagaaa cctcttggac aagatgaaca tcatctaagt cgagatcaat atcctcatgc    363000
     ctttctcatt tgttaactct tctcgtgaaa gggtctttcc ccattggtga tatttttttt    363060
     tattttactt ttttacttct actctttttg ttctgttcta ttattttgtt taccgattcc    363120
     caatttgtaa tccagggcta gctcataccc ctcatcattc tttgttattt tgcactccta    363180
     cactcttctt gaattgatta cttccggtat gaacaactgt gttgtcgcgg atgtcgagtc    363240
     gcttcaagaa gccactggga gctgaatctc tccctctcta agagccacac agcatgcata    363300
     gatgaaaaga taaagggctt ctttgtgaca gccactctac ggatattttt atataattag    363360
     agaaaatcaa aataaatata cttttttagt tatacgaatc tataaaaaaa aatggttata    363420
     aaactcaatc gactgcctcg gtgactatgt attatactca aagctcatcg ctgcccatct    363480
     ggagcttttg tagtttaagc tgtcgttttc agtgatatct ttgtttttgt agctctggag    363540
     atcccaaatc attaagtgaa aaaaaatgta aacaaagcgg taaaaagagt ttcgagatca    363600
     aaacacaaat agtggatctg tggcgcaaat ttaggcagat caatcgtgta tctattgtat    363660
     cggcgttggc agtgttgcat tatattagta tctaggacgg agagctgctt ttttgcgaga    363720
     ttttgctccc atttttggta atattttgaa tttggagacg ggtgacacga aaaagttttt    363780
     gatttgatag agaagacccc aggtatttag gagatattta taagctgctg gactgaaaag    363840
     aaattgagac gctctatctt ggcaaacata caataatatc cagtactgcg gacacaatgg    363900
     tggtaaccac tgaagccgta acgtcccgga gtgagcgcga tgcggagcca gtacaggagc    363960
     ccttggtaga gaaattggcc actgaggagc ttaatatact tgtggctgtc agatgtagag    364020
     gcagaaatga gcgtgagatt aaggcaaaga gctcggtggt cgttgacgtg ccggacaatg    364080
     gagtaactaa tgaagtttcg ataaatacta ccgatgatgt tggaattgca gcaaagatga    364140
     actctaagac ctatacagtg gataaagtat ttggtcccag cgcctctcag aaattggtat    364200
     atgaagagat tgcagaaccg ttatttcagg actttattaa gggttataac tgtactatac    364260
     tggtttatgg tatgacatca acaggtaaaa catacacaat gactggtgat gaaaaattac    364320
     ataacggaga gctaggtgat gcagcaggta taatacccag ggtattgttt gaactttttg    364380
     acacactgga agctaataag gatgattacc tagttaaatg ctcttttgtg gaattatata    364440
     acgaggaact gaaagactta ttagactcca cgaatactgc cacgaattct gataataaaa    364500
     aacttaggat atttgattct aacgtgaacg gtacttcagc aagtggttca agtagccgat    364560
     cgagctcgag aaataactcc ccaagatcag ctcctgataa ttccagagcg cagatgctgc    364620
     gaaggaaact gggtcgccac aacactaccg gaaatagcaa aatatccaat aataaccata    364680
     ataagttcag taggttcaag caaacctctc aagagtccac tagagctcat gcttcaaaca    364740
     atcatcaaaa cgttcatatt cctaataata attccaataa tactaatcaa cagcagtcac    364800
     ccattgatca gtccgctagt atctacattc agaatctaga agaatttcat atcacttctg    364860
     ctatggaagg tctacaatta cttcaaaagg gtttaaagca aaggcaagta gcttccacta    364920
     aaatgaacga cttctcgagt cgatcacatt ctatttttac cattacactt tataaagaac    364980
     agaatgggga actatttagg gtatccaaga tgaatttagt tgatctggct ggttcagaga    365040
     atataagtag gtctggtgca atgaatcaaa gagccaaaga ggcgggctcg ataaaccaga    365100
     gtttactaac attaggaaga gtgataaatt cactggcgga taaaagtgag catattccat    365160
     ttagagagtc taagctgaca agactgctgc aggactccct gggagggaat accaaaacag    365220
     cattaattgc cactatatct cctgcaaaaa tgacatctga agagacttgt agtacattag    365280
     agtatgcatc gaaggccaaa aatatcaaaa ataaacccca actgggtgca ttcataatga    365340
     aagacatcct ggtacgatcc atcacttctg agttggcaaa gatcaagtca gatttgttat    365400
     ccactaaatc caaagaaggt gtatacatga gtcacgagca ttataaggat ctgcactacg    365460
     atattgagtg ttataaaacc gaacttgaag agagtaaaag agcaattgag tcgctaactg    365520
     cacaaaacgc gatgttacaa caagagaggc tatccttgaa ggatgataat gcctgttata    365580
     aagctaatat tgcaagttta aaggataatg tggtgacatt gcaatctagt ttgaaagagc    365640
     agatcacaaa ggagacgaat attagaagtt tgttgaagga tgttcaaggt gctaacgaag    365700
     aaatgaagaa aacgatacat ttatttgaat ttaagcaaca ggaactacag caaagtatct    365760
     ctacctttat cagcgatgaa atttccaata ttcgagacac tctgaagaag catatcgaat    365820
     acctgcagaa taacggtgac ttgaaggata cagaaatcag cggtaatcta atgcggctcg    365880
     agaaagaagt tgtcaaagtt atcaaagctg ctgaggaaga agctagtaag tcatacgggg    365940
     aatgcgtcaa gatgatgctg aaagaaacgc cgagactgtt tgagagtgtg tcagggcggc    366000
     tggacaatat cagtaagcta gctgaggaga accactctaa gattgcagag acgttatcag    366060
     atgtaagtga agagtacaac aacttgaagc aatacttgac taacaacttc ttcaagaaca    366120
     atcatgaaga gctgctgtcg caccatgttc aaaacacgta tgcgcaacta gaagagaact    366180
     cggcacaact gatgcagaac ttcacgatga tgctggacaa gcacattcaa gagaacaaga    366240
     ggcatatgtt ggagaatata ctgggggtca ctgacgaggt tattaataat gaattacaaa    366300
     tgtttgggga gcaacgggcc aaatgggaga aatcctcagc acttatcaat caatgtgatt    366360
     ctgttaacca cagcttccac caggcgttgg gctctaacct tgtagagatc agggacgtgg    366420
     tgtccagttc ccgtgacaat attggcgcaa ctatatcttc tatccagtcg cggaccagga    366480
     acaggcaatc catcgaggag atgatccaag gcaatgacgt aatcagacag caaataacca    366540
     ggatcaagca gaaaaacaag tcgttgtctt tattcaagga gcactctaca gagacagcta    366600
     ctacatcaat aggcagcgta aacaaagtag aaggcaactt gaaagtgata atggacaaag    366660
     tgctgaatga cccgcagttg tcccggggca aggctgaagt tcccgacgaa gagctgcata    366720
     ggcttgagaa gataccactg gggatcacca acaaggagaa tgttgttgat cttcagcaca    366780
     ggtaccccgc cttacaggag aaaaggaaac cggaggatga agtgttgctt caagccaagt    366840
     tgcagagacg aaaccccgat taatcgtgta tctgccctgc aatgaaatag gggcattggg    366900
     gcatacgtgc ccatgtaggg tgatatttaa acaaaaagtt gtaatagtat tttagaatca    366960
     gcagtttttt ttttatatat ataagagaaa ataggcatat tctttccatt cgtccattgt    367020
     cccagaggtt tagcaactcc gagtttgttt gttttttgat gggttcttgt atccagtcag    367080
     aaatggacat tgtggcattc gtaagtggga tggcatcatt cggtatccca gccttgactc    367140
     gtttgtcttc ttttagcaag acttgtcatg acctttttcc accaaaaaat tcccggtgaa    367200
     tttttccagg cccaggtccc gtagaaaccg tcgtgggggg ctctaaataa agcttaataa    367260
     aaagtgagga caatgagtgt tcttgggatg ggctgggaat gacatgactg ggacagcggt    367320
     agcgctggtg ggggggcttt ttgttgatta tcgagtgtga caccgagtga tcacaggttc    367380
     aagaaggtca tgaacattgg aaattacctc aaatatttca cttgtgaaag cactgtattt    367440
     tttttttgat agatttattg tttctggaat gttaccaggc cagagaacct atataagcag    367500
     taataccagc tcttgttcat tcttgatttt tggcacacaa gtacaactac aactacaact    367560
     acaactacaa ctacaaatac aaatacagca agtaaaaaaa caagatatag caaatgccca    367620
     atttatcaca tcaatgggag agcgtctcgc tcaaggaagc ctatgcccgc aacctgccag    367680
     cgcaggccga gcgactcaag cggttcaaga gcgagtttgg cagcacggtg atcggcgagg    367740
     tgaccgtcga gcaggcgctt ggcggtatgc gcggtgtcac gggccttgtg tgggagggct    367800
     ccgtgctgga ccctgaagaa ggcatcaagt ttagaggcct cactatcgac gaggtacgtg    367860
     tgtcgctggg agtggcaggt gagcgggagc cgcagcccga ggcgctgttc tggctgttgc    367920
     tcacgggcca gatccccaac gaggaccagg tggcgcagct gtcgcgcgag ctggcagcgc    367980
     gcggggagct accggggcat gtggagacgc tgctggacac tcttccacgt gacctgcacc    368040
     ctatggcgca gctgagtata gcggttactg ccctggaagg ggagtcgcac tttgcgcggg    368100
     cgtacctggc tggtgttccg cgcggggagc tgtgggagca cacctacgag gacgcgctga    368160
     accttattgc gaagctgcct gcgatcgctg ggcgcatcta ccacaatgtg tttggcggtg    368220
     cgcaaggcgc ccaagggcaa ggcacgcaag gtgcgttcgt gctggacccg caggcggact    368280
     acagtgagaa cctgtgccgg gcgctcgggg tgcagcccga cggggagacg gaggacttcc    368340
     acaacctgat gaggctgtac ctgaccatcc acgcggacca cgagggcggc aacgtcagcg    368400
     cacatacgac gcacctggtg ggcagcgcgc tgtcgtcgcc ttacctgagc ttcgccgccg    368460
     gcctggacgg gcttgcgggt cccctgcacg gccgcgcgaa ccaggaagtg ctggagtggc    368520
     tgctggtgtt gaagggcgag ctggtgcgcg agggcaagac cgtgacggac cgcgaggcca    368580
     tccgccagta cctgtggaga acactaaact ccgggaaggt agtccctggg tacggccacg    368640
     ctgtgctcag gaagacggac cccaggttcc tggcacagcg cgagttcggg cgcacgcggt    368700
     tcccggggga cgagctgtac cagctggtct cgacggtcta cgaggtggcc ccgcaggtgc    368760
     tcaaggagca cggcaagacg cgcaacccat accctaacgt agacgcgcac tccggggtcc    368820
     tgctcacgca ctacggacta gaccagccca gcttctacac agtgttgttc ggcatctcgc    368880
     ggtgcttcgg ggtcatggca cagctcatca ccgaccgcgc gctgggtgcg cccatcgaga    368940
     ggcccaagtc cctgtccacc gacaggtaca tcgagctggc cacccgccac cacaacaagc    369000
     tgtgaagaag gaaagcgcac ttatcgcata tatatagagc attgacctaa atacatatac    369060
     gtacacaata acctatcatg ttatcttacc gtaatgatta ccaaatagcg aactcgcgag    369120
     aaacgcaaaa tgctaaaagc aaaatgctaa aagcaaaatg cggaaagcgg aaagcagaag    369180
     aaaaaagcaa cacatcccgc cgcacgtaaa ccccccccta ttgtgcccag agcagggaaa    369240
     aaaaaggggg taagagagag agagacaaac cgcgcgtgcc gggattaatg cccaaaacgg    369300
     gaagtcgaaa tctatcaaaa aagagaacaa caaaacactc agaagagaca ccataagaaa    369360
     cacgcgcaca agacacagaa cgccaatccc ttcctttaac gggggggcac ccccactgcc    369420
     tcgtctgtgt acggatgtag gaggaggggt gataccaccc cttagtcagt ggacgtgtgc    369480
     agtgaggaaa ccagctttct cgtaataatt acacgagcgc acagacgagc gtgcagtaag    369540
     aggggaggga cagcaaagac agcagagaga cagcaaagag acgaaggaga cggccaaagc    369600
     gatactgtgg gacgcctcga ggtggactag actggtggga ccggtgggta gagagggacg    369660
     agtagagagg gacggggggg agggatctac taccccttct ttatccttcc aattggaaga    369720
     aaaataaaaa agccatgggt ggtgggaata tatatagact ggtggaagaa aagctggcaa    369780
     aaaagaagca taccccccca attggaactt acttttttgt tggactaaga ggtaacaact    369840
     cacatacact taaacaacaa aaaactaaca taacacaaga tgaaggttgc tattatcact    369900
     tactccactt atggtcacat cgacaacttg gctagagctg tcaagaaggg tgttgagtcc    369960
     gccggcggtc aggcagacct gtacagagtc gaggagactt tgtccaagga gatcctagca    370020
     cagatgaacg cccctgaaaa ggcttccgat atcccagtag caactgagaa catcctcact    370080
     gaatacgacg ctttcttgtt cggtgttcca accaggttcg gtactttgcc agcccaatgg    370140
     tcctccttct gggacaagac cggtggtctg tgggcccaag gtgctttgaa cggtaaggtc    370200
     ggtggtttct tcgtctccac ctccagttac ggtggtggtc aagaagccac tgtcaagcac    370260
     tgtttgtcct acttggctca ccacggtatc atctacgtgc cattgggtta caagaacgcc    370320
     ttcgccgagt tggccaacat cgaagaagtc cacggtggct ccccatgggg tgccggtacc    370380
     ttggctggcg ctgacggttc cagaaccgcc tctgaattgg aattgagaat cgcccaaatc    370440
     caaggtaaga ccttctacga aaccgctatc aagttcgctc caacctcgtc tgccatgatg    370500
     gacgacaaga tgatgaagga cgataagatg atgaaggatg acaagatgat gaaggacgac    370560
     aagatgaagt ccggtaagaa ggccgccatg aaggacgaca agatgatgaa ggacgacaag    370620
     atgaaggatg acaagatgaa ggacgacaag atgaaggaga aggacagcaa gttctcttgt    370680
     tgtactgtta tgtaagatta atccattgat atttcccccc taagcctttc taatcatggc    370740
     atttttcctc atacttacac ctgaataaat cccatcacca tcacacacac aacccccacc    370800
     accattcaaa aattaaaaag aatactacca attttttttt tacaatcaat atgtttcctc    370860
     agaaagatat gagaagtttg aaggattatt agatagaatc gggaactaat ttactaaggg    370920
     gaagagattt tctttaattt ttttttattt tattttactt ttgttctttt atcttttctt    370980
     cttaagcttc tctgtctatt tttgaagttt gttttatctt ttatgttaat atcctagaca    371040
     tctaacccta atacaataaa aaatctttta ctaaaaaaat aagaaacaaa ttcctgtatt    371100
     tcttatacta attactcaca cactgctatt ttttttttta actaagataa attattggcc    371160
     tttagttttt tgctggactc ttcgaagcga taagaagtgc tttttaatat tttcttgctg    371220
     taataaagat caaggataaa catagcctac atataaaccc tattatatta attaataaca    371280
     tctctatatt atacgtgtct tagctagtgt tccacaacac ccaaagtttt tacttttttt    371340
     ttgcagagct catcgctttt cgcatttacg cgttgattaa tatacaaaaa taaatagcac    371400
     tacagttcac tcagtactgc aaaagcacaa tacaaaagat ctcgccaaca cgcactgaca    371460
     atggactcac tgctggagaa gtttaacagc aagcgcacaa gcacgcacga aaagcccctc    371520
     caaagagccc gcatcaatga ggacttcgag caagacaacg ccttcgcgct ggacttcgac    371580
     aagagggatt actccccgca gtaccacttc ctgtaccagt acagactgac cgtgctcaag    371640
     aaccgcatca gggagcagtg ctataagaaa tgggacgccg ggttccaatt gaacggtaaa    371700
     gaggtcgtcg agaagaaaaa tgtcctcgat atacagggca aagagccctg ctggtgcatt    371760
     ggtaccatat acagagagat gaagtataag cccaacgtcc tggaagaggt catgaacgac    371820
     acttacggca cagtcgacat aaaccctgag agttacacag accccgacgg aacagacgag    371880
     ataatgttgg aagacgaaag tggtagactg atcctagtag gcgatatgat tgcagagaca    371940
     ccgttcatta ccggcactgt gataggtgtt ctgggtatgg aagctgatgc gggtactttc    372000
     caggtgcttg acctatgtta cccgaaagcc cttccacagg agcctatgcc agccgctacg    372060
     tcgaagggta aaattgccct tgtctccggt ataaacatct ccacaacagc acaagaacgt    372120
     gtgataaagc tgcaactgtt gcaagagtac ctgatgggta ggctaggtaa cgaagaagct    372180
     gtcgctcaga ttggtaggtt attgatctgc ggtgattcca tagattttaa ccccagctcc    372240
     gaagaccctg gggcgttagt gaacaaacta gatgaattcg gcaagttttt ggggaacact    372300
     ttacaatcta tatcaattga cattatgcct ggtgccaacg accccagcga taggacactt    372360
     ccgcaacaac cattgcataa agcattattc cgtgaaaatc tgggccagta ttttgataaa    372420
     gtgaatgcta acttgttgaa tctggtgacg aatccgtatg tgtttagtat taatggcctg    372480
     gagttactca ccactgcggg acagaacatc acagatattt gcaagtacgt catacctgca    372540
     aagtcggaca cggagtccac tacaaacgtc tctacagatg acacggatgc caagtgtgcc    372600
     aagaccacag agcatatatt agacttgatg gagtgtacgt tgaaatggca gaacattgca    372660
     cccacagctc cagacacctt gtggtgttat ccttacaaag acagagatcc atttattctg    372720
     aataaatggc ctcacgtgta catagtcggc aatcagccat actttggtac caggaaagtg    372780
     agcttggacg gtgtcgaagt agttatgata tcagtgccta cattcagcga aacaggtcag    372840
     atagtgctct tggatctcga agacttgagc acggaagtag taacgatagg tagtatttag    372900
     agtgtattta gttttttaaa tttaaataaa tcacctacca gaccagaaaa ttgaaagcaa    372960
     aaaaaaaaga gaatcgaaac tagacacttg tattcgaaac aacatcagtt cagatattgt    373020
     cgctaacagt gtctttattt attatatgta cagtagtagc tacaattata atagtcattg    373080
     ttgtggcagt atagtgcaca tccatgccta aaacattaaa ttcgtgaagg agtcataccc    373140
     aaaagaggca atacactgaa gttacccgga gagattagta ctacaaaaaa aaaagaaaat    373200
     aaaaaaatat aaatgaaacg gacaggaatt gaacctgcaa cccttcgatt gcaatcatga    373260
     attccgagga aaatcccaga gtttaactgg agtcgaaagc tctaccattg agccaccgct    373320
     tcatctattt ctgtggaaac taaaactcaa acatgacact actatctctc tgccctaaat    373380
     acaaattcca aaaaaaagaa agaaagaaaa agtaatccgc aaaatttcaa aatctcgcat    373440
     tgctacggta tcctctgagg attatgataa gagaattagc cttcgagtgg gataaaaaga    373500
     aagaaatgaa agcgtgtcct aagaaagtac tgtacaagta cacttgtaca atgctgcgtg    373560
     gaatttttca gctaattgat cgacctcgag cactgggcct atgacacaca ataatactag    373620
     aatatgcact aaacactaga caatagacat agggaactgg gaactgtgaa ctggacactg    373680
     gacactggac actggacaat agataatatg tgtgtattgt ctattgccaa tgacccatta    373740
     ctatctcttc tccggatttt ctgtttcttt ttcctctcga gaaggagtta aacgttgaca    373800
     aaaaatttag tgtgagcatc ctaggaacaa aacgatttga tcacatcgac ttggatactg    373860
     attaatatat atatataaag agtatttgag aatacttccg aagaaagctg cagaacaaca    373920
     acaacttcag acacctacaa aggaactaat tctcgatgcc taaaaatccg ctgaaaaagc    373980
     agtattggac tgaagttatc gatggcttcc acagtcccga cagaacagac agtgccaatg    374040
     acagaagctc aagcccagac aactttgagt tgagttctgt caactcacca gtacgagtga    374100
     acgtcagctc tagtggtaat gatgatatac tgaaaggaga tacaaaggag taccctcgtg    374160
     atgtcaaagc gacacctgaa gctgcatcat atgtcgagga tattaacaac actaacttga    374220
     acaaagacct gagtgtgcgt cacttgctga cacttgctgt tggtggtgcc attggtacag    374280
     gtttgttcgt caactccggt gcttctctta caactggtgg gcctgcatct ctagtcatcg    374340
     gctgggtcat tgtttctact tgtctgttta cagttatcaa ctctttgggt gaactggcgg    374400
     ctgcattccc agttgttggt ggtttcaacg tctacatcac cagattcata gaaccatcgt    374460
     tcgcatttgc catcaatcta aactacttgg cccaatggtt agtgttactg cctctagaac    374520
     tggtggctgc atccattact attagatatt ggaatgacaa gatcaactct gacgcctggg    374580
     ttgccatctt ctacactgct atcgcccttg caaacatgct tgacgtgaaa tcctttggtg    374640
     agaccgaatt cattctatcc atggtcaaga tcctagctat catcggtttt ggtatcctgg    374700
     gtatcgtatt gacctgtggt ggtggtccac acggtggata cattggtggt aagtactggc    374760
     ataaccctgg tgcctttgtt ggccacagcg ctggctctca gtttaagggt ctatgttccg    374820
     tcttcgttac cgctgcattc tcatattccg gtattgaaat gacagccgtc tctgctgctg    374880
     aaagtagaaa ccctaaggag actatcccaa aggccgctaa gaggactttc tggttgatca    374940
     cagtatccta tgttggtatt ttgactctaa ttggctgttt ggtcccatac aacgatccaa    375000
     gactgctaaa cggtagcagt tccgtcgatg ccgccgcttc accattagtc atcgcaattg    375060
     agaacggtgg tatcaagggt cttccttctt tgatgaatgc cattatcttg atcgccatcg    375120
     tcagtgtcgc caatagtgct gtctacgctt gttctcgttg tatggtttcc atggctcaca    375180
     ttggcaactt accaaaattc ttgagtaaag ttgacaagcg tggtagacca ttgaacgcta    375240
     ttctattgac cttgtttttc ggtctactgt ccttcattgc tgcgagtgac aagcaagaag    375300
     aagtattcac ttggttgagt gctctatccg gtttgtctac tattttctgc tggatggcca    375360
     tcaacttgtc gctaattaga ttcagggatg ccatgaaggc tcaaggtaga tctctagacg    375420
     agatgccatt cctttcacaa tcaggtactt ggggtgcatg gtatggtgtc atcgtgctat    375480
     tcttggttct agtagcatcg ttttggacct cgctattccc agtgggttcc tccaccgcaa    375540
     gtgcaaaatc atttttcgaa ggctatctat ctctacctat cctaattgcg tgctacgtag    375600
     gacacaagct atggaagaga gactggagat tactagtgcc actaatggaa atggacttag    375660
     attccggtag aagagtgcta gacgcagaga ccagagagga agagttgcgt gtagagagag    375720
     aatacttggc caatgcctct ttctttaccc gtttcttgca catctggtgt taaaaagaag    375780
     agctctgttt tgtttctttt caatattcac tcaacttact acatccccct gatccatgaa    375840
     catactaatt tatcatatac ataagtacag catttacact atataacttt tgtgcaataa    375900
     caattcccaa aagaactgct caatcctaca ccagtattat cgttgaaacc caatggcact    375960
     cctaacgaca tagtggaccg cagaaaaatt tttcaaaatt ttttcttcaa aaatttgttc    376020
     aaactagaag ctgattgtta gaggaattcc gcagttagag tgcaaattct attcacggat    376080
     gggcaataac caacttcatt gaagttttgc aattataaca cttcccaata ccggtaaaag    376140
     tagttaagtt ggcgtttatt cttcttgtac tatctttttt ttaagttggt ctttgttttt    376200
     acctccctca gcgcatcaag aaaagataca ggacgataat agccttgaga ggatagcaat    376260
     tagaaatgtc tattaaccac tgcagattct atgagaacaa gtacccagat gttgacgatg    376320
     ttgtcatggt caatgtccag caaattgctg agatgggtgc ttatgtgaag ctattggagt    376380
     acgataacat tgaaggtatg attctactga gtgagttgtc tcgtagacgt attagatcca    376440
     tccagaagtt gatccgtgtt ggtaagaacg atgttgctgt ggtgttacgt gttgacaagg    376500
     agaaaggtta catcgatcta tcaaagcgtc gtgtgtcttc cgaggatatc atcaagtgtg    376560
     aagagaaata ccaaaagtcc aagactgtgc actctatctt gagatactgt gccgaaaagt    376620
     ttcaaatccc attggaagat ctgtataaga ctatcgcatg gccattgagt cgaaagtttg    376680
     gccacgctta cgaagcattt aaactatcta tcattgacga aaccgtatgg gaaggtatcg    376740
     agccaccatc tcaggatatc ttgaatgagt tgaagaccta catttccaag agattgactc    376800
     cacaagccgt caaaatcaga gctgatgtcg aagtctcctg tttcagttac gaaggtatcg    376860
     atgccatcaa ggaagctcta aaatccgcag aagatatgtc tacagaacag atgcaaatca    376920
     aggttaaact ggttgctgca ccactttacg ttctaaccac tcaagctcta gacaagcaga    376980
     ttggtatcga ccttctaggt aaagccatcg acaaaatcaa cgaagttatt agcaaatacg    377040
     gtggtgtttg taacatcacc atgccaccaa aggctgtcac cgctactgaa gacgctgaat    377100
     tgcaagctct tctagaaagt aaagaacaag acaacagatc cgactctgaa gatgaggata    377160
     actctgatta cgagtaagaa aagaacttac ccataaacaa cgaattagca cttaatttta    377220
     ttgcacattg aagtatattt ttttttgttc gcataataag gatgatgaag aggtaagaat    377280
     cttcagatat aaaaaaagac ttctaagagg ttcataatga ggacatatcc tgtctgggtt    377340
     ttgttcatga tagaaagaaa gagttgccat atctctactc gaatcctata aaaatgactc    377400
     cattcgtatt atttctcatt atctgttata ttagcactca aacggtttcc ttaaacctcc    377460
     gatcttcatc tttctcacag gaacacacat ttagtatata acgtatccta tgtatattta    377520
     aaacccaata ctacttattc aaaatagcac tctaggctct aggttatcaa gatatagtga    377580
     agctaccaaa gtgaacaagt ccttttaagg agtaacagaa atatgccaaa taacaatatt    377640
     gttccaacgt aatctatgaa gctcaccaat cgatagataa agaatggctg ttaatcattg    377700
     ctttttcttt tcgaggaaac gggtgcccta aggtgagaga ttagtcagat atcaataagt    377760
     agagggacgg agaattcaag agacgctagc aagtggttca caaggtcatt tgtgttgagc    377820
     catgcttatg agttgccatt tctaattgtc tccgttctat ttagctgaaa attctttgtt    377880
     tcttaatacc tatccttgcc catacatctg tacgctctcc cttatttttc tatggttctg    377940
     tacttctgga acaaacgatg agggattctt agaaatccct cttctggatt gacaagtgag    378000
     gctattaaca acattgactc ctcatccaga tggtggcatt gaagtataaa aagggactcg    378060
     ataatgtggt tgtgagattg aagctatggt aaatcgagaa gtatctccaa tacctacttt    378120
     cattcaaaga taaagtacta ctgtgaacta atatagtaat ggtaagtatc cgcagcgcta    378180
     cacatgcggg gacgtggtac tccgcacatg ccaaggacct ctctcagcag ttgctacagt    378240
     atctggagag cagctccaga gagtgtgtct ccaaggcgag gataattatc tcaccccatg    378300
     caggttacag gtattgtggt ccgacaatgg ctcatgcgta tgcgtcactg gacttgaaga    378360
     agaagcccaa gcgtatattc atcctagggc cttcgcatca tgtgtatttc aagaacgaag    378420
     tgctagtcag ccatttccag gaggttgaga caccactggg caatttaaat gtagacactg    378480
     aagtatgcga gacgctggtc ggtggatcag gcgatggccg caagttattc cgttacatgg    378540
     ataaagacac cgatgaggac gagcattccc tggagatgca gttccctatg ctggcacagg    378600
     cgctgctctg gcgccagatc cctctgagcg aggtcaaggt cgttccttta atggtgtcgc    378660
     acaactcagt aaatgtagat accagtgtag gcagtacgtt ggccaagtac atgaaagacg    378720
     aggagaatct gttcattata agcagtgatt tctgccattg gggccgccgg ttctcctaca    378780
     ctgggtacgt aggctctaca gaagagctag agaatgtgat agctgaggag acagaggtag    378840
     agatgctgac cacccggagc aagctgtcac accaccaggt accaatttgg aagtcgatag    378900
     agatcatgga caagtatgcc atgcatgtgc tatctcggaa tgcgaaatcg ccagagaatc    378960
     tgtacagcga gtggaagcag tacctggaga tatctgggaa cactatatgc ggagagaaac    379020
     cgatatctgt gatagcatgt gcgttggcga gtgttgggta caaggacttt gagtggccag    379080
     cgtattctca aagctccaac gtcaactcta taaacgagag cagtgtcagc tacgccgcag    379140
     gttacgggtg tttgtaatat atagcagaat ataataaaga aaagccagat aatatattaa    379200
     cgagtatagt tggggggggg ataccagtta caattagtat tacaatggtt taccaagtac    379260
     aaattatgta atatggttat aatcggctta tatgtatgat ggaggtaggg aactgcagtt    379320
     tattgttctg ttaagctccc agtaatgcaa gacggctaag tcatatgact gccactttgt    379380
     cgatcctgaa gaaaatgaca gtagaaagtg atataataca cgtgatatgc gtaggatggg    379440
     acccaaagat agccacatca catgatcttt aaaacccccg tcaaaaagga ataaatcgaa    379500
     ggaaaaaaaa tgccacgtga ctttgatggt caaaatcagg ttatactcct atacggtccc    379560
     ccacacaaaa cctttaccac acaccgcacg ggctggactt atcctattag aaagcggtgc    379620
     agccagggcc aagaaaacgc gaacgacgca gaaaaaacgt caagcaaaaa aactgtggtg    379680
     ttatttaagg catacaattt cctgcctccc tttaatgctc cgggggatct agcaaatggg    379740
     aaaatatcac atgactttgg ctagaagggg gggtgggaaa acagagattt tagtcacatt    379800
     gtttgatttc acgtactaca cgatacacta cactacacaa tacactccag tgcaatacac    379860
     tccagtgcaa tacactgcaa tacactacag actgtatggt tccctccccg ttctcttcag    379920
     gccctggata tgctagcgaa ggatcccaag cccatcgagg aaatcattca agggcatctg    379980
     caggtctcaa atacactaag tccaaacaca aacagcactg agctaatcca agacaccaat    380040
     tgcatgcctt ctcaattata tcagtttatt acacagctta taactgtgca tcttgccatt    380100
     cttttcgaga tagccatttg attaacatgc ttagctcgtt ctcaagccac agtaaaatgg    380160
     attgcctttt gagtttccat cgttgtataa ataggcactc attcctatag ccttgctctt    380220
     tggtcttgtc tctgtaatag taatagctgt aagtcaggat ataacactcc agaaaagaaa    380280
     cacctaacaa atgcctgctc ctcacggtgg tgtactacaa gatctagttg ctagagatgc    380340
     ttctaagaga gactcgctct tgagcgagtc tcaacaattg agtcaatgga ctctgaccgc    380400
     cagacagata tgtgatatcg agttgatcct gaacggtggg ttctccccgc tgactggttt    380460
     cttggcccaa gaggattaca acggtgtggt ccacaactct aggctgagcg atggtactct    380520
     atggaccatg ccaatcacac tggatgtgcc agagcaattc gccaactctg ttaagcccaa    380580
     ccagagaatt gccttgctgc aagacggcac cataccagtt gctatcttga ctgtgaagga    380640
     catctacaag cccgacaaga gcgtagaagc tgagaaagtg ttcagaggtg acccagaaca    380700
     ccccgccatc aactacttgt tcaacactgc tggtgactac tacatcggtg gtgccttgga    380760
     cgccatccag ctgccacagc attacgacta ccctggccta cgtaagaccc ctgctcaatt    380820
     gagactggag ttccagtcta gacaatggga ccgtgtcgtt gccttccaga ccaggaaccc    380880
     aatgcacaga gcacacagag agttgaccgt gcgtgccgct agagaaacaa acgccaaagt    380940
     gctgatccac cccgtggtcg gcttgaccaa gccaggtgac atcgaccacc acactagagt    381000
     ccgtgtatac caggagatca tcaagagata tccaaatggt atcgccttct tgtccctgtt    381060
     gccattggcc atgagaatgg gtggtgacag agaagctgtg tggcacgcaa tcatcagaaa    381120
     gaactacggt gcttctcact tcattgtggg cagagatcac gctggcccag gtagcaactc    381180
     caagggtgtg gacttctacg gcccatacga cgcccaggag ttggtcgagt cctacaagaa    381240
     cgagctggat atcgacgttg tgccattcag aatggtcact tacttgccag acgaggacag    381300
     atacgcccca attgacgaga tcgacacttc aaagaccaga actctgaaca tctccggtac    381360
     tgaactgaga aaacgtttaa gagacggtgg tgaaatccct gagtggttct cataccctga    381420
     agtggtcaag atcctaaggg aatcgaaccc accaagacca aaacaaggtt ttgctctggt    381480
     cttcaacgat gacatcaagg tggaccgtga tcaattgagc atcgctctgt tgtccacatt    381540
     cttacagttc ggtggtggaa gacattacaa gatctacgac cacaacgata aacctgaatt    381600
     tttggagttg atctccgatt tcgttcaagc cggcagtggt ttgatcattc catccacttg    381660
     gtccgcaagc aacaaggtta actccgccaa cgtctacacc attggccacg ccaaagacgc    381720
     tgacatcaaa cttgcatcca cggaagagac cattttccat atagtccaga aagttgtgct    381780
     attcttggag gacaaccatt tcatccaatt ctaatctaaa aagaagaaga caatagacac    381840
     tgtaatccgt aaaaagttcc ctttataaga acaaatatgt atttatgcta gcatatattt    381900
     gatattatta atctaatgat aaatttgcct ttcctttaat aagccataaa atgaaatttt    381960
     tattactgta tttgttggtc gataccacca atttcatgcc tgtttggaac tctgcgattt    382020
     gttccttgta ttaacgaccg tgtgaatttc ttcccacata aacaaacaaa acgagaaatc    382080
     tatcatttag agtatgaata gttacatcaa tcatttcttg atctccatga ccttaggctg    382140
     tacccatttc aattggtttt tcttgtaaca ggagtacggt ggcagagtta ctataagtgt    382200
     tacaacaaaa aaccctccaa aacacacgag caagttctgc aaagattggg taacaaaacc    382260
     aattccaaaa gatgtaactg caccaatacc aaggataaca taagccagct tctctatcct    382320
     ctcttgagcc ttgaagtcta ctggaagaac cagatgcttc ctcacttcat tcaaaatctc    382380
     attaacacca tccatgattt aagtactaac ccactctgta ttgacaactt ttaaattaga    382440
     taacaccaaa actacaccac ccgtaacttc tccagttggt cagttatatg cttctcttca    382500
     gagaatttct tcagctcggc caacgtcaag ggcatcggtg agcacagatc agactcggtc    382560
     acgtgcagat cggttttgga gtcgagtatg aacttcttca gcatattatc tatccagttc    382620
     aggtatgtgt gcatcgactc tgtgtcttcg aagttactat cagagacaga tttatctact    382680
     gtgacaaaga gatccttcag tttccgagac tgcatcactg cgtcgaaaca tgcggctttg    382740
     taatcttcca gaacttttcg ccatgatggc aacaactcat tcttgataca atgtaacagt    382800
     gtcttggttt taatagcgtc aagggcttcc tgttctgggt cctgatcgcg atcattgacg    382860
     atagacatct tctcccagta atttactata ttcctgtgtc ccagatatgc gttgttcatg    382920
     tagtttctta tcattcgctg ctcatgtggg tactttgcat agcaacaatg cattatgaaa    382980
     taccacagat aataagctgc cttcttgtac agaggagaga caactctctt tagcacagcc    383040
     tcggggatcg cagggtcggg gtctataaga gccttacgta tagtgacaca ctcatcggga    383100
     ctgagcacaa atacccccgc aattgcagtc ctgtagaata cgcatagctg tgccatctca    383160
     tcatccagct cttgttccat ccgaaagata tcacttgaca gctcccggat gaaagacact    383220
     gtgtcaaaca tgaactctaa cattacatcc aacaactccc gcttgtcgcc atcacgaact    383280
     ctctccacgg actgcagaag gtccgaacgc aattccttcc cacagacagc ctccatctta    383340
     gcagccttat caccaatgta ctagtttacc acagtttagc ctggatatcc caatactctt    383400
     cataactaat aggtctgcca ttcatagctc atcgctttgt attttctgca aagctggaaa    383460
     agtgaaaaaa aatggctccg agagggatcg tgcagaggac aaccgatgac taactttcac    383520
     agcgataaca tctcctatga atataaaaag cattgaaact ctacatgatt caatgtagta    383580
     gtccccagca gaccaacagc aatggtttct gaagagacgt attcccgggt gatgggcttt    383640
     gtagccggga tgttctccgg tgttgctaag aacacggtgg gacatccttt cgatacagtg    383700
     aaagtgcgtc tgcagacgtc gcaagtcggc agtggtgctg gtatacagtt caaaggtcca    383760
     ctggattgcg tctacaagac attgaagaac caaggtatac gtgggctgta tttggggttc    383820
     accccaccgc tcttcggttg gatcatgatg gatagtgcgt tactgggatc gttacacaat    383880
     tacagaatgc tgctacacaa atatgtatac ccggagcacg ataagcttcc tctctctggg    383940
     tgtataatca gtggtgtgat ggctggttgg acagttagtt ttatcgctgc acccgtagag    384000
     ctcgccaagg ctaaattgca ggtgcaatat gatgcaaaga caaccaagta cacgggtccc    384060
     atcgatgtgg tacagaaggt gttcaagcaa ggtatggcta caaacgggat acttggcggt    384120
     gtgagaagct tgtacaaggg tttgatcagc acattgatct tcaggtcgaa ctttgtgttc    384180
     tggtgggggt cctatgaact aataacacag tggttccaaa agaatactaa tcttagtgcg    384240
     ccggctatta acttctgggc tggtggttta agtgcttcgt ttgggttttg gaccagtgca    384300
     tacccaagtg atgtggtaaa acaagtcgtg ctatgtaatg acaagtatga cggaagcttt    384360
     aaatcatgga gaaccgcagt tagcgatata tacagacaaa gaggtatcca cggtttcttc    384420
     aagggtttcc taccaagttt cctgagatcg ttcccagcaa atgctgccgc gctggctgca    384480
     ttcgaatttg tgctaagaac tagtggtgcc aaaccatcgt agtcatcgat atttccgccg    384540
     gaattcatca aatcttgcat gcaattatag ataacatacg ctactatttc caacccagta    384600
     ttatcaggaa cggctaactc ttatattctg aaccctcttt aataatttta tagatgacta    384660
     ccattacgta ttcactttaa tagtcaactt caatgattat tcattctatg tccatgttta    384720
     gcccttgctc ttgcgctttc ttcagttcct tttccatgtc agtcttgaca tcagcccctg    384780
     aaccttgtga ttcagtattg tgaccactga cttgccatgg ttttaacctt ggtgcgctac    384840
     tctgttgatc aattggctct tctagcacta catccgggac gtcttcaacg cctgggactt    384900
     ccttgttgtg aaggatatga tctatgactt cctcgtaact caacggctgt gacatcctag    384960
     actaccaatg ttcctcaaat ccactgacca tctcatggca agactttggc cacccccagc    385020
     cccaacactc tggatcaggc actttatata cttcggagaa acgtcatcga cgattgtgaa    385080
     acaagcattt aagaacaagc agtgtgatgg acttcgagtt tatcgagtag ctattagatt    385140
     cttaacactg acaatcataa ctacaaagct gcccattgca atagaatatc aatgtttaag    385200
     ctggggacaa ttggattgct cagcttggct gtgctgctga gaattgcatt ctttctgttt    385260
     ggtgtctacc aagatgagca tttcactgtt aagtacaccg acatcgatta ccaagtcttt    385320
     aacgatgctg cttggtttgt tgcacaccgc aagtctcctt ataacagaga cacatatcgc    385380
     tatacaccct tgttgagctg gctgctattg cctaaccata tgatcccatg gttccatttc    385440
     ggtaaattaa tatttgtgct atgcgatttg gctaccggcg tattgatatt acagatgcta    385500
     aagaagttaa agagtaagta cagatatggc actgatagga tgactattat ggctgccatc    385560
     tggctcttga atcccatggt catcactatt agcacaagag gtaatgcaga gagtgtacta    385620
     tgtttcctaa tattgtcttt cctatactgc ttcctttgtg aacaatattt gctaggtggt    385680
     ctactgtttg gtctgtcgat tcactttaag atttacccaa ttatttacgc gcttccaatt    385740
     gcgatctacg ttgctgccgc gcattacaat aagactcaaa gcgtctttaa atcgagtttc    385800
     aagttattcc ttgtcggttt ctcgactttg atagtactaa ttttgctaac tgtgttcatg    385860
     tatatgctat atggtgacaa gttcattgat caaacttacc tatatcacat ctatagaacc    385920
     gatcacaggc acaatttctc cgtttggaac atgctactgt acttcaactc tgcgctacca    385980
     aagacctctg agttgtccaa gtttgtattt ttgcctcaaa tgatcattgt attggctata    386040
     tccctaacac agctacgtag gcctagctcg ttcccgctcc tatgcaatgt gctcttcctg    386100
     gagacctttg catttgtcac gttcaacaaa gtctgcactt ctcaatactt catttggtac    386160
     ctgattttcc taccatttgt cctatataac acaagaatct ccatgagaag aggcatagta    386220
     atgctggttg tctgggtagc cacccaggct ctgtggttgc gccagggcta tttacttgag    386280
     ttcgaaggcc agaatgtgtt ctacccaggt ctattctgcg caagtgtggg cttttttgtt    386340
     agcaacgcat ggatcctggg ccagttcatc gaggacacaa ttatccagaa cgactacgtt    386400
     tacaggatag aaccctctga gtccaggagc aaggacagcg ctgttatcga taagccagca    386460
     atagcaaaga cagaaaaggc cgagtaaaca ccttccgaaa cagtattaga tagattaaga    386520
     aaccactttt aaaaaataag aaaacaataa tatagaacat aaaagagata taaaccacca    386580
     tgacaggaca tagcaactac aaacctatga ggatcctcat ataaaaacta ctgcacgtga    386640
     tcccaacaaa tgggctttag ccatgcgtct tatggccatc gtaaggccga ctcgacttca    386700
     caagctgggt gtgaaaaaaa gtgaaaaatt ctgaaaaatc gctgcaaaat tatatgaaga    386760
     tgggcataat tatagccaat attgggacag cttttaagtt ttatataggt tggcttgtac    386820
     tttaaatttg ttgaagaaaa attatagttt gactgcaaga agaagagatt gagaatgcta    386880
     aaagaagttg tttactgtgg tgtatgcacc tatcctatag attactgtga gttttcaggt    386940
     aaattgaaaa gatgtaaggt gtggttgaag gagaaccacg ccgatctata cgataagctt    387000
     tattcagagg atgatgcagc agcagcatct ctgagtgcca aacttgcgga atctagtatt    387060
     ggtgaagcta gagaagagaa gctagagaag gatcttcaaa aactacagac caagcaagag    387120
     aacaaagaac aaagagagct agcaaagaag ctttcatcta aagttatcgt caagagagaa    387180
     gcaagaacga aaagaaagta cattgttgcc atctctggtt tggaagtctt tgaaattgat    387240
     atgaaaaaat tggcaaagac ttttgcctca aaatttgcaa ctggttgctc ggtatctaag    387300
     aatgctgaaa agaaggaaga agtagtggtt caaggtgacg ttcttgatga agtcgttgct    387360
     tacattcata gtcttttgga agaaaagggt atgaaggatg ttaaagtaga gactatcgac    387420
     actaagaaga agaaaaaacc tgaagccact cctgcagcca aataatccac acaatgttac    387480
     gtaaattatg cattattaat tattttcaaa accgcatagc ttttcatttt attttgccat    387540
     agtatatttt atttagattt tatgttgtaa ccgtatgtat tattaagaaa gctgcaatga    387600
     taaatagaat agaaaaagta aaatattctt attcgtatac aaagaaacaa caataggagt    387660
     taactagaga agtctttaca gactctgtat gcaattaaat tattagatat tattaaagga    387720
     tcccaacaaa caaacaaaca taaagatggg aaaaaattat tggcaacatg tttagtatgg    387780
     ggtattatgg gtgaccagtg ccaaactaca gataatggtt gtaagtgttt aaaataaaat    387840
     gtaaacagtt tactgcagta ttaactgtca tgttcatgat gcttactgga ggcatgtctt    387900
     tgcctatgct cataacgacg tctttcctgc tccctttcct cttgaatctt tctcttaagt    387960
     tcctttctct cttctctctt cttaacgacc ttagaaataa acttgttaac gaacgggttg    388020
     atcgcagtat tgacagccac ccaagcggct aaaataccat aatttctact catttgatgc    388080
     cttgaaatat ctaaaaatat aactctgtaa atttgaacac cattgtgaat tggcatcgca    388140
     taaccaaatc tataaaagcg gctgataagc accaatgggt acagcgatgg tgcaatgttc    388200
     aaaatagtcc aaataatcat ccaatatgac atatactgcg ggcagaatgt taaaatgata    388260
     gacaaaatat tctcattagc cataccgaca gccgtcatga caagccaaga ggtcatccag    388320
     taaataacga aaccggcctt accaaaacca ggtgtaaagt caatttggaa aatagcagaa    388380
     acggtacatg tgaacagaga taggaagaaa aacatactcc atgaaattag aatacgataa    388440
     aagaacaaag atctaggctt tagatacttt gccatttcct tattaactgg accaaagata    388500
     gaaatagaaa aaaccgaaaa catgatgtta tagttcagac ccatacttag tggacccagc    388560
     aaaacacgat cggtgaatgg acgtaaatca taagagttag tagcaaaatt tcctagacca    388620
     tacaagttgg cagtgttaac agtttcattg aaatctgggg atgtaatgtt cttaatgaat    388680
     tcaggaacat aaatcttcaa atattgtgat cggaacaccg actcaaattt tgccaaaata    388740
     ggatatatag aagacttcaa atttgttgga tctctaccac tctcgtatat cgattggaag    388800
     taatttgtag aattgaaaac tggtgcacct tcttctgtca cggacttgta aaatgcttct    388860
     gttgcgcctt cacgaacatt caccgccaac caaaactttt catcaaatat caattctgca    388920
     accttctcat caatttcctg ggcgttagtc acattgtata tcaccttgaa ttctgtacta    388980
     ttcatgatcc gccagttacc cggtatcgag tttataatgt tggttacgtt acgggtaaga    389040
     gcgggtatga cagtcccgtc gggggcagta tatggctcat cttgaatcac agctatcgag    389100
     tgaaccctat ataggtttcc actataattg taaatagcac cccaatataa tgataatgca    389160
     cctataacaa agatagctag caagatatgt gtagagatga atttggccaa aattcttctc    389220
     ctatgatcct tcattctctt ggagaacaaa gaggttttct ttttccattg cgatgcggta    389280
     gaagagacac gggagattac atccccttcg tcatctgcca tcacagcagg aacaccgtca    389340
     tcatcgtcat cactatctga actggaatcg ccatcatcgc tgtcgctatc actgtcacta    389400
     tcatcactga gagatgtacg tgtgcttttg cgcctcttag gcttagcctg accgggagat    389460
     ggcgacttat aggagatgtc atcactgcta tacatttgtt ttggagactt cgatttatgc    389520
     ctgccaccgg caccactctt ggctgtgtcc gacttgggct ccacactata tgaagagtca    389580
     ctgctagagg tgaaagacat gttctctagg tctttcctcc tcatgcgcct ctccttttct    389640
     tccttcttgt tagcggcctt caaaccacct tcaatggtct cagccaaagc atcggcagga    389700
     tccttccaac acttgctgtt gaacttcctg tacttcttct ccagcttctt ctcaaacatc    389760
     gtcgacactg cgcccttaga acctatgctt atactattat tttaaagata actgtcaagt    389820
     tatatactac tcatcaaact tttgaagttt ttcagtttgt tatttgttgt tgtggtggga    389880
     tcatttgtcc tacatgcaat tttttttgtc cgttacgcag taagactaca gtgtttctgc    389940
     ctcattaatt taattagaag ggcccttcta gtcttattcg tcttccaacg acgcctcctc    390000
     cccccacttg cactgactat tctgagtgtg atttaatctg tatgctgtct attcaccgaa    390060
     cctgactttt tcattggcta ttgtccttgc cattgcctgc atcacggacc tgtctgagtg    390120
     atttcctctt cttctatgtc ctttgtttac tctttgtatt cccattgccc ggaaaaactg    390180
     tttctacggc aattgtattg aatgagcaaa ggtggggtag tacaagtgaa gtactgattt    390240
     tcacttttta cctctcgtgt gacaatcgtc acacaagtct tatttttccg tttttccgaa    390300
     ttttccttaa ttttctcaca cagtctcttc taagtgcaga aagtggtttt tggtgcgggg    390360
     tgcggatgat tgtctgggtg atatttcctg atgtgtgttt ttttcttctt gatttccatt    390420
     ttgtactgtg tgttcttact ggaaggaccg ttgtcgtacc tcttcaggtg gagtatccct    390480
     tttgtctaca ttctactgta tatggaaaat atgtcccaat ttgaatctcg aggacaaatg    390540
     tataggctca tggcgagcat ctcaatatat ttgattagat aaaatacgaa tgcaataata    390600
     taaaaaggta tgaggtgtga tatgcttttg gcgaggcagc tagaaaaaca tcaaggaatt    390660
     ctttataaag aatatgcaaa catgtataag gtggtggaat tagccggact tctccatggc    390720
     agctttacgt gctctcttat gcagtgtctt cagcacgaac ttactcacga agggcatcga    390780
     tatagtgttg aggcccaccc aggcacacag gataccgtag tttctgccta gctggtgttt    390840
     cgatatgtca aagaagatga ctctgttgat gccgacaata cagtgcagtg gcattgcata    390900
     accgtatctg taaaagacat ttgcgtaacc aatggcaaag aacgctggtg ccaggttcag    390960
     tatgacaaaa cttaaaatcc agaacccaat gtatgatgga ctaatcagga tgattaacat    391020
     gatgacattc tcattcagac caccaacggc caacatatac aggtaagtac tcatccagta    391080
     cacaacaaac cctgcccgtc caaaagcttt tgtgaagtca acttggtaca tggctgaaac    391140
     agtacaccag aagattgaca caaaaaacaa aacagaccat aacacaatca gacggtagat    391200
     ccatagattt gagaacttaa tcatcctcga catctcacca tgcagaggac cgaacaccaa    391260
     gaactggaaa acagtcaaca gcaaacaata aacagcacca atctgtgtag acaacaaggt    391320
     aactctatca gtcactggcc tatagtcgtt gtagttaaac ttcatcctac ctgcagcagc    391380
     aacccgagca ggattaaaat tatctccatt ggttatattc cctaacagtt ggggcaagta    391440
     ctgataagta taaactttct ggaagacacc ctcaatacct tggaaaactg gcagcaatac    391500
     tgaaggaagg tttgtgatat cacgtccgga ttcgtagact acttcgaaaa gtgatgtaga    391560
     attgaactgc acatcagaat ctgcacttat tagtgatcta acgagagtgt cagtgacatt    391620
     accctgaaca ttcaatgcca accaaaattc ttctttataa accaaatcta tgactttctg    391680
     attcattgct tcaatacctt caacattata tttaatctgg aaagaggttg cgttgtatat    391740
     ctcccaagat agaggcactt cggcaatgat atcataaagt gggctagaga ccgaaggaaa    391800
     ttgtacagtg tcattaaaac ggtacacctg atcttcctgt atcactgcta gcaccttagc    391860
     acgcctaaca tagtgaggtg tcctataaag aacaccccac atcagcacta agatagtgaa    391920
     acagaaacac atcagcagga atacagcaag gagccatcta taagcaaccc tcttacgttg    391980
     atccttgaag ttgggtgaaa agaatctagt cttggtcttg gttaaagtgt tagttggttc    392040
     tgggttattg ttctgtgtag gtttaccctt ttcatcccct tcaggacctg gagcatatgc    392100
     ctgagggtct ttcgcctcct ctgaataatc ttcattgctc gttctgatac tttcttcatc    392160
     ctctagcggt attgaaggag caccaccata atgctcatca ttaagttctt ctctatcagc    392220
     gtagttcaac tcaggaagag caccatcata tataccgtca ttcaacgtag aatgaacctg    392280
     tgaaagacca gcccgaacac tccccctcct atcccggtta gcgttagaca tggccagtgg    392340
     taagctatat tactcaattt ctgtttaata caagcaagct tgtttatcaa cactatttct    392400
     ttgtttatct aacaatcctt taacaaaatg aggactaata taatagaaca ataaatagaa    392460
     actcacctaa tgaattatag tgaagttaga atacatcaaa tgtatatata taatatgtat    392520
     acatatgatt taatagaaaa tttttcaatt tctattttat tgctatagag aatatgataa    392580
     gcaatggggt ctaagaatgc aagcccctcc tcttgcataa cattaaccaa actataaaca    392640
     acagatgctg cagggaagac tcaacaatga gcacagaaat aagaaaaacg aatcccaatc    392700
     ttactcaaaa tggcataaac tcaagagtac ggatccataa taacgatata atccattaca    392760
     atttctacat catcttctaa aggacttttg ttttagtgat aatattgttt atttttatca    392820
     agcaacacag ctaactaaaa gaagagttaa atgttgctct gagagatgag ttcgcttttc    392880
     ttctgagaaa tcttctccat ttcagcaaat tggtacactg atgtaaatca tcccataaat    392940
     gaataataga ccttattctt ttccagcata agtaggcagg ttgctctgat ccatgaagca    393000
     tattggagca catggattga caatttaaaa aaaacaaact gtggaacaat tataaaaaat    393060
     gttatgataa ataatatcca ttcctatgga ctgtttaact ctatttgatt aaaagtagat    393120
     aaaataaaat ttgaccacta tctcagaaca tttagcaatg agaaaatgag tcaacatgta    393180
     agagaaaaat tgctctgttt ataactctga tgtgatgaag taaaaaaaaa tattatgtgt    393240
     gatttccgtt cacactataa ataaataatc gaagtaaatg actctgaata aaacataaga    393300
     aaaaaaataa atccgccttt cataataaat ataggagatt tgaacaatct tagaattaaa    393360
     tcacgggaaa acctgtttcc gactgcagaa tgtatctatt tttttgagga ttgtcagtcc    393420
     aattgaaact taagcgtctg taacacaacc ttgggaggca ttagagacta acttagcata    393480
     tttggataga gtacccctgt tgtaacgtgg ggctggaggt ttccattcgg ccttacgttg    393540
     agacatctca gattcagaga ttaggaggtc aatcttgttg ttgtctgcat caatcacaat    393600
     ttcatcacca tctctgacca aaccaattgg accaccttcg gcagcttctg gaacaatgtg    393660
     accaatcaag aaaccatgag aaccaccaga gaatctacca tcagttagca aggcaacatc    393720
     tttacctaga ccataaccca ttagtgcact agatggcttc aacatttctg gcatacctgg    393780
     accacccttt ggaccttcat atctgataat aacaactgtc ttttcacctt tcttgatttc    393840
     accattctcc aatgcagaga tgaaagcgtc ttcttcttcg aaaacacgag ccttaccttt    393900
     gaagtaagta ccttccttac cagtaatctt accaacagaa ccacctggag caagagaacc    393960
     gtatagaatt tgtagatggc cacttggctt aattgggttt gacaatggtc taataatgtc    394020
     ttgagtttca cttagaccct tggctttctt ggcacgctca gccaaagttt caccagtaac    394080
     agttaaggcg tcaccgtata agaaaccgtt gtcatacaag aacttgatga cactttgagt    394140
     accaccgacc ttaatcaaat cggccatgac atacttacca gatggcttga agtcacctag    394200
     caatggtgtc ttgtcactga tcctttggaa atcatctggg gtgatcttga caccagcaga    394260
     gtgtgcaata gctaccaagt gaagaactgc gttagtggaa ccaccagtag caatgacgta    394320
     agtgatagcg ttttcaaagg attccttggt gaagatttga cgtggggtaa taccaagttc    394380
     catagtgttc ttgatagcag caccaatgtt gtcacattca gcaatctttt cagcagaaac    394440
     agctgggaaa gcagaagagt ttggcatagt gatacctaaa acttcggcag cagaggccat    394500
     ggtgttggcg gtgtacatac caccacaaga gccaggacct ggacaagagt gttgtacaac    394560
     atcacttctc tcttcttcat tgaattgctt cgagatgtat tgaccgtagg attggaaagc    394620
     agagacaaca tcaatgttct ctggaatgtt cttggagcca caagttgggt gacctggcat    394680
     aatggtacca ccataaacca taatagatgg tctgttgtgt ctacccatag ccatcataac    394740
     accaggcata ttcttgtcac aggatggaat agcaatattg gcatcgtagt gttgtgccat    394800
     catgatagtc tcgaaagagt ctgcgataat ttctctactt tgtaaagaat atctcatacc    394860
     tttagtaccc atcgagatac cgtcagagac accaattgtg ttaaattgca tacctttcat    394920
     accggctttc tcgatggatt gggaacatct gtggttcaaa tccaatagat gcatgttaca    394980
     tgggttacca gaccaccaac aagaaccaac accaacttgc gctttgctga aatcatcctt    395040
     gttgaaacca gtggcataca acatagcctg agaggcacct tggtccttag gctcagtgat    395100
     gatatatgag tatttattca gtttctttgc aacatttctt gtgctggaga acttcctagc    395160
     aaaagttagt ctggaggaca tgatcttaat gcgtttgggc tcctttaaac tcaataatct    395220
     acagaataaa aagtatcaaa aaggaaagtt taagagtaat cagcttctta tatagcaatc    395280
     aagatcaagc tgctgcaatt tttcacattt gtcagactct tctgctgagt cacacagctt    395340
     ttttttcacc aatttttttt caaaaaactt agtggacaat gccggttcag ggccttcttg    395400
     aatcaatctc atcgctggga gacaatgtcc ctcttgcagc tacacggctg gtattttcct    395460
     gtcagttaga cggtctcaga cagtgtatgt atatttttat gaaatgctat taatggtatt    395520
     tatcttgcgt tactaatttt ctatacaata aaaaaagtgc aatgtatgat gtgtgtctgt    395580
     acatggtttt cgcctgactc ttgaaaagga aatctaagaa acttactggc aatggttgat    395640
     tgtacaaccg agtttgcatg caagctctaa tagctagtat gccttacgtt aacacatgca    395700
     ttgagatttt atattgctag ggatacaaca aaaaaaaaaa aatagagaga gaacggaata    395760
     aatgattaga cgtttaaaaa taagagcaat tgtaaacttg ctatcaatta gtctcttaag    395820
     ttcaatggct gtcttcttca tccgcttctt cttcatcatc ttcatcattt atatcttctg    395880
     attcagcgtc ctcctccgat tcttgtttgg ttaccttagc acctgtgtat ttgctagcga    395940
     actcggttgc tggggatggt tctctgatca atagcatctt ctttctcttt ggctcaggca    396000
     aatcatcact ctgctcttct tcatctgagg ttgccgaaag ggatcccaat gcaatacttc    396060
     ttggaatgtg cttgtctccc agcagctttg agtatagctt ccttcccaac gtctttctca    396120
     ataggatctc cctgacttcg aaatacagat ctcttgacgc attattcaag ttaccttggt    396180
     tcttcttgaa gtacgatcta aaatcactga tgtgtttctt aaactccagc tcatttttct    396240
     tcaaccatga cacgttcagt tcctgtcttg tagcaccacg agcaaaattt ctcatcaagt    396300
     acttgtcata gtctctaata atcttggtaa taatatcact tgtagatata ccgtctgtac    396360
     gctgggtagt taaaaactta ccaagctctt tgattggttt atagatatcg tcactatcgc    396420
     tactaacata tggaatgtca tcgtgagcta catagtcgat cttatgttcg gcaaggaact    396480
     ctggtgttac acaccatggt gcatttggaa caacttcgtc cacccattta caatgcatta    396540
     gtgtctcaca acgttgcttg tcagttagga cagtaagacc cttcaatttg tgagtaacct    396600
     catcacttgg aataccacac accaattcaa cattagggaa cgccttctta cattgttcca    396660
     actgtttcat gtgtcccaaa tggaacagat caaagatacc atccgcatat atacgaatag    396720
     gtctatcctt aggaggtatg ttaagcctaa aacctttagg tctgtatttt cttagctctt    396780
     caggaagctc agcatccagc aatgcctcct ttttctcgaa ctcctgttgt tctttactaa    396840
     ttggacgatg acgcttagca gaaggagtag ctatttccct gttctccttc ccaggggtct    396900
     cttcatgatc agcactgtca gtagtactat cctcatcgtc ctctctctta cgcttagctt    396960
     tgaacaattt tgtaaaggaa gagtttgaga gccttttctt caaagatgta gttctagata    397020
     gtttggccat tgtattttta aaagctgatc tactctataa tcctagtatt tccttactat    397080
     taacgcacaa ctaccaatca atttaaattt tttggccagt gcctcttttt aaagttatta    397140
     tgttcgctct acaggtctga tcctaactct gatctaagtt taaggataag gttttctcta    397200
     tattggcttc cggttcaaca agggaaactg tgaggtccaa tcacacaatc aaatatatct    397260
     ttatgcagca cacaattgct tctttcgagt tatatttact tctctctgct cgatcgttaa    397320
     gcccacaaat tggcagcttc accgaattta gttgacaatg acaataatag ctacgagact    397380
     gggatgaatt atatagtttc ttctacataa gagcattgct tttgacaatc ttagataaca    397440
     ccacactaca cattaagtgc aattaataca atacttcttt ttgctccagt ttgcatcgaa    397500
     ttttgagcta tttgacacaa aatatttgta aaaatacaac aaagaggtat cagagcatgg    397560
     ttcctgccaa atgggaattt cagtattgct taaccaacac gcttgataag atggacacca    397620
     ctgtcactct ccacaatatc acttacttcg tcaatcttta gtgcaaaagc ggccttctca    397680
     aagctaggct gcatttcacc cctgccgaag taacccagat caccaccacg cttgaaagat    397740
     gaacaatctg atctctcctt ggcaattgcc tcaaaactgt gtttcttctt ctgttcttga    397800
     tcttcctcta acctggcttg gatctctttc aactccttta tagcttcctc tttggtaatc    397860
     gttatctttt cttggcggtg cgatgctggt ctcctcgaat ccttgtgctt gatcaagata    397920
     tgcagacaac gtacacgcaa tgggtgatcc ttcagatagc ttataaattg ctcatgatca    397980
     gtgccctcgg gctcttccca ctgtgacttc ttagtttcgg gatcgaagaa gtactcacgt    398040
     ttcttagact tactgtatct aacagtccat ggagctggta gcccagtact aacctcttgt    398100
     gtttcagaca tctatgattg ctgtagattg cttcctaagt gtcctgatat acaattgctg    398160
     accttatggc ttcctttatc agcctctact atatggctct gtctctctta aactgctaga    398220
     aattgggaat tttgttcgtc ttagagactc cgaaaacaca taatggagaa cctttgaatg    398280
     atctctgtca tagttggagc tatgatgtga accagtttgg cgtcttgaat attattttat    398340
     aagtataaaa gtacatagag actatcttag agtatcctgc aaaagtagcg agccatcaag    398400
     tttataactt ggccctcaaa attggctctg aatcatagac tacaaaacct tcttgcgata    398460
     cactggctac tatttcccct gtggtgtcat aatagtcacc ttggacaagg tgcttgtcga    398520
     aatttgacct tgggttagtt atctctgtgt ataaccactc gtttacgctt ggcaattggt    398580
     ggaagtggat tacatggtcc aatgagacac taaatttgtg acaatatagt ggaagtttat    398640
     ggaagtaagg aatggtgaga aggatatagg agtctgacag gtaggcaaat gcaacatagt    398700
     tgtaacgtgg atcgtttgct ggtgtaacct tatctggtat ctttccatgg ccatggaaat    398760
     ggtgcttcga agcatgctga ctttgagcat cgccgtcatc ttgtgagagc actgggtgac    398820
     ggatcttaac cacgtagtct agatggtctg tgaccttggt agagtggaag aaatcttttg    398880
     ggaacttgta ttccatagga ccctcgtcga aggactcaat gtatttgttt aaaatgctca    398940
     cattattgaa cttctcaggt gcgatatttt gaaacttcac aagattaccc acaacttcgt    399000
     ccttgaacaa cttaccagcg tcaacaaggt cctcaatctc tggcttgttg ctctctttca    399060
     aacgcttaag gtggtgtagc gaatcatgct cttgtgactt cttgaccgaa aacaggatca    399120
     tactagcaaa cacgagcttt tcatgctgat atgctctcac ttgtttatga atgaagttct    399180
     taccgtttct gagatctttc acttcatatg taatcatcga cctcggatct ccaccattga    399240
     tgaaatagca atgcagcgag gtgggatgga aattcacagg cactgtgtgc aaggacgcaa    399300
     gcaaagactg cgccactaac gtaccaccaa atgtaccacg ggcgccaact ggcgcactgg    399360
     gcaagtatct agtaacaaac ctcgtcgacg tcacaggcac cagttctagg atcttctcca    399420
     gactatactt cgcaaacgac atctcttgta attctcttta tcttgctggt atgatcacgt    399480
     tagtcttttg ctctcgcctc acactcaaca acacttcctg gcactttata tagtttatcc    399540
     tcgaggtcca gacggagcca tcgcaattcc cgaaccaccg caaagtaaac tccacacact    399600
     tttgagtcgc agggggactc tcttttgact aaacctccaa cccttcgagg tgagatgaca    399660
     tcgaaggatc gggtttaatc actactgcat atttctcagt tctctcgtta gattattgca    399720
     ttcccctcac gcactactcc gcatatccct tataccagcc ggctattaac ctcgttatga    399780
     ccacctataa ctcgatttgc tagctacagt tcagcgtatt atcctatcat cctgggaata    399840
     ccaattgtgt taggtttagc tcagggatag tgcgagcccg ccacacagta ttcaacatat    399900
     cgagttgcct ccttagctta gtggtagagc gttgcacttg taatgcaaag gtcgctagtt    399960
     caattctggc aggtggcaat ttctctcaac tttttttttc ttagaaattt actgcaaaaa    400020
     tgcgtgttgt acgccacttt cactcaactc gttcagaact gttaatgata atagccactg    400080
     tggctggtcg tgctgcagct gttcattgcc aactatcata aactagctag tatattagac    400140
     gccttgtctc gctgtaagtg tattatacgg tgacaagaca gtatagctag tgtgctgggt    400200
     ctacattatc tttttttgga aggagacgcc cccacccaga ctttagcaag aagtagttgt    400260
     aagtgctaca gcgaatggaa tatatgcatc acagaggcag aggggacttg gagtattgat    400320
     aaaggtacag atgtctgata gagttgacag gaataagaag atatttgatc ttcgaaggag    400380
     aaatttttcg aggaatatgg ttatgaagct cgggtttttg ggatacctga taattatatt    400440
     taagtacttg aaatatggta caaacgtgtt aagcttactg tttaggtgtg tggtacaagc    400500
     gttgctcata tcgccattcc cagataaatc gtattcgcaa tggctgttgg ccagaaatgg    400560
     cctgccgact tcactacaag ggtccatccc aggaggattt accacagctg gtgctagtgg    400620
     cagtaacaat agcgatagta cacagacaga cactggcgat ttcgctctag aggtgctgaa    400680
     acgcaaaata cgggctatcc tgttcaattg cgtgcttact ataaatattc tgtatgtcgt    400740
     atttgccata ttattcccaa ccgacttcta cataccacag gatggcatct atattgacaa    400800
     acagaacggc catcagaata tgccatcacc tttcaagtat gggaaataca tgctagaagg    400860
     tgagaggaaa ggtggaataa cttttcaagc aatcggtgaa acactgccgt gttctaactt    400920
     atctggaaat ttgggtgtta tcttgtgcga agcccttatc cttattgcac aattgttgct    400980
     cttttgtgta acttgcataa attttgcaga actaggctat gctgatgatg acgaaaacga    401040
     tgaatatttt ataaataatg atggttacga tggaaatgtt ctcctcacta caataaactt    401100
     gcatgagggt atcgatgtta tgcttaatga aaaactccct attaccgaaa cacaaactgt    401160
     ataaataaca taaaacagaa taaactagac cttgaaaagc taagaagcca tcttatggcc    401220
     ttataaggag atagctatat aatacattca tccattctta agtttgtaca tacacccccc    401280
     attatttact atggcttcat attttaatga ttttaaaatc taatatacat taataagaca    401340
     gtttagtctt attgacatgc taataatcag tatagaaact ctgctataaa ttattttttt    401400
     tctttatctc taaccaagcc tcttcttatc ttcaatcttg gttctagtca tattccggaa    401460
     attatccatt gggctgaggt atatacctcg aagattggaa gtgccaattt acttattggg    401520
     taatttgaca tttcttcaaa tactcggcct tcttcttcag gatatcaatg gacttcagca    401580
     ctatatcttc tggttgcatg gcacctgtgc tctcaacgtt aaagacaaaa tggtctctga    401640
     ctctacctag ttttacttta ccttcaaatt cttcatgtct tagcacttct ctggaaactg    401700
     tatcctttct tgggtccagc acgtatgctt caccattctc gttgatgcca atcacacctt    401760
     tagggaaaca ggcttggaat ctcttggcgg aatcgccagt aatgggctct agaatttcga    401820
     tgtgaggtag caatctataa gaagcagtgg caactgggga gaatttggcg tggtccttac    401880
     cttcacccag tatacaatgt gtgctcaaac tgatttcttg accaggtctt agtttagcca    401940
     ataagatatc tgggtcacat gggaccactg gacaatcggc gaaggtttcc acttggctac    402000
     tgtgaggctc aaatttcaag tcacgggcgt agacatgcgc attgttgtac aggatcgttg    402060
     gatcagtgca gtcctttggt gcatctgggt ttctggtaca cttgacattc aaggtcataa    402120
     caatggtgtt cttgtcatgg aattctaagt tgtctgggtc agaagtgtcc aatctctcca    402180
     gcttctctgg gtccaccttc aatggcacaa gaccaattct gtgagccaac acttcatcct    402240
     gtatcacaga ggtgttgttc tgaatgtaaa cgtactctgg ggccacagct ggaacctcag    402300
     caatcataat acgacggaac gcattggcca aagacgtgtc aataccaatc atatcgaagt    402360
     tcaactccct ctcttcatgg ctagagacct ggatatcaaa cgtctctcta aacctctcca    402420
     catcccaagc attggcacct tgagaagagt acccagggaa atcggtagac gcagtgttcg    402480
     tcacacggtt atactcaata ccaactatat tagacatcgc agaaatatcc tcgctattcg    402540
     ttctggagct atttcaccaa caaaaacagc aataccaggc ctttaaaacc actattttag    402600
     agatgagctc atcgcaaatt ttttttttca accaattttt tttcactttt ttcacttctg    402660
     aaccgtcata gaaaacggac tggatcaaca tttcctataa ataaagcttt taagaacaac    402720
     agaatcaaca ataccaacaa ctctagcggt ttgtagggcc tggaaggaca gtttactagg    402780
     cagcggaaga ggtaaagatg tttagacgcg agaaggagga cggtgtggag gatatcacgg    402840
     gtaatatcag ccaattgggg ctgaacggga cgttgtcgcc ggctactggc aatactccgt    402900
     tcaagaagta cgcgccatcg acccctacgc agtacaagga gaaccggagt ggtgcctcac    402960
     cttacagcac ttcgccgact aagagtatat tcaagaaaga gaagccccgt gagcggatca    403020
     taaattcacc aaagaagttg ccacgtgatt tccataggaa agctacttcc aacaagacgc    403080
     agaggctagt tagtgtgtgc cagatgtact ttctagacta ctactgtgac atgtttgact    403140
     atgttatcag cagaagacag agaacgaagc aaatgatatc gaatattcag gagtacaagc    403200
     aaaaccatac gatacctgac gagcaattga atgaggaatg gaataactat ttgcaaaagg    403260
     agcatgaagt gttgcggaag aggaggttaa agcccaagaa caaagatttt gagatgataa    403320
     cacaagtcgg acaaggtggc tatggtcagg tttacctggc taggaaaagg gacacgaagg    403380
     aagtttgtgc tttgaagata ttaaataaaa aactactggt gaaactgaat gagactaacc    403440
     acatcttgac cgagagggat atattgacta caacaaggtc agagtggttg gtgaaactac    403500
     tttacgcttt ccaggatcca gagagtttat acctggcgat ggagtttgtg cctggtggtg    403560
     atttcagaac gttgttgatc aacacaagaa cattacgtag tccacatgcc agattttaca    403620
     taagtgaaat gttttgtgct gtgaatgcac ttcatgagtt aggttataca catagagatt    403680
     tgaagccaga gaatttttta atcgacgcag aaggtcacat aaaactaacc gattttggtc    403740
     ttgctgcagg tacagtctcc aatgaaagaa ttgaaagtat gaagataagg ttagaagagg    403800
     ttaagaatct tgaatttccg gcattcactg aaaagtcgat tgaagatcga agaaaaattt    403860
     accaaaattt gaggcaaaat gatataaact atgccaactc catggtaggg tctcctgatt    403920
     atatggctct ggaagtattg gaaggcaaaa agtatgacta tacggtcgat tactggtccc    403980
     taggctgtat gctatttgaa gcattaatag gttacacgcc attcagtgga tcttctacca    404040
     atgagacata tgaaaattta agacattgga agcgtactct tagaagacca ttcttaaatg    404100
     atggtagatc agctatatca gatcgtgcgt gggaactgat aaccagactg attgctgatc    404160
     caatcaacag gctaagatcc tttgaacatg tcaaaagaat gaattatttc catgagataa    404220
     attttgatac tttaagacaa ttgtcaccac ctttcacccc acaattggat aacgaaactg    404280
     atgcaggcta ctttgatgac ttcacaaatg aagctgacat ggctaaatat gccgatgtct    404340
     ttaagagaca ggataaacta gctgccatgg tcgatgattc tgaggtggat tcaaaattga    404400
     ttggcttcac tttcaggcat aagaatggga acactggatc tagtggggtt ctatacaaag    404460
     ggcatgaaaa cgcaaatcca ttttcaacgt tttattgaag taactaattg ccaacatagt    404520
     tatcaatgaa aattatctca atataaattt atttttgggt tattaatatc ttaatatctt    404580
     gcatttctat caaaagtgaa attaaacatt taaacaatac tatataaaca tcgattaata    404640
     ggttgggctt tacagaatat ttattaaaat atgtgatgct tgattaatac gtttgtttag    404700
     tcaagacatc cctcagaatt cttcttcctc atcttccatg tctagctttc ttttaccagc    404760
     atttctagtc atagcagcaa tctcactaac agctgcctgt tttctaacct ttttagtcat    404820
     tctctccagc tcttcttcag cattagccgc ttcttgttcg gctggttgca tcactagtct    404880
     acgacccaat aaatggacac cttgcagttg atccatggca ttttccgctt cctttggtaa    404940
     aacaaactcc acaaacgcaa aacctcttgc cgacttgtcg aacttctttg gaactctaac    405000
     agactttagt tgaccaaatg aattaaacag ttcaaagaca tcctttctag ttgcctcaaa    405060
     tggcaagttc tttacaataa tcttaccatt ctttgctttc tttttctctt gcgaccctgc    405120
     attaccttgt ctatgagata attttaattg aattttgtga ccatcaataa ctgtgccatc    405180
     catagcagag atcacagctg tagcttgttc cttggttcta aattcaacaa acccaaaacc    405240
     cattgacaaa accttgttct tctgtttagg atctggtttt gtcttaacct gagcaacaac    405300
     aaaaccgctg aagaccttga agcgatcagt aagctgttga gaagtagttt taaagttcaa    405360
     attcttgata aatatagaaa ctgtagggcc atcaacaacc tgttcatctt catcttcctt    405420
     atcttcggtc tttttggagg ataccgactc taacaaatca gcagatgatg gaccggcctc    405480
     ctttgcactt ttttcttcgt catgttccat tgcatcctcg ttggaagctg ccttagtaaa    405540
     gcagtcctta ggaccttttt ctaaatatat tactgtacct ttaaaccttt tgaaagcaag    405600
     tttcgaaaat gcagagcgac cagaggctat atctctaaac tgaacgatgg caatagtccc    405660
     agctggtggc attagcaatc tttctagttt accaaaggga acaaataatt ctcccagttc    405720
     ttctctagtg gtaccgaacg ggaaattctt gaccagaata acacgatcat cacgttgaga    405780
     aggtgatttc agatttgaaa acttagttag atcaacacct tttgtttcaa agtatttcct    405840
     aacatcacca ataacatggg cttcagctaa agcttgtttt acagcagaat ttgagttttc    405900
     tgggtcaatc aagtcagctt tttgaacacc aagcttagct gcaacactac ctaatactgc    405960
     atcttggttc atatacaagg agttccatga aaatgtggct ttggaagcag ctgccttttt    406020
     tttcagttca cgttgcttct tcaaaggcat gtttttcaga tcgaactcat caagacgatg    406080
     atctttcatc tcgtctgcgg ctaatatatg tagaagtcta ccttggaaaa tttgtttatc    406140
     caactcgata taagcttgga cagcttcttc aggctttgca aataaaacat acgcaaaccc    406200
     ctttgaatta ccagttctag tatctactgc tacatgcact tctttgagct caccatatgg    406260
     actaaacaat tttttgaagt cgtcttctgt agaagagtat agaatgttac gcaggaaaag    406320
     acggcctgtt ttctggattt tggcgatagc ctgttcttca tctggaattt cttcttgaag    406380
     ttcctctgct ggtgtggctt gagagttttc ttcagattct ttatcttgaa catttgttgc    406440
     aaactcttct cctacctttt caccattttc tcttatacgc actctgcgct gttttatcca    406500
     atccatatct gatatttctt catttttggc aagaccatca tcctcctttg gttcagcaga    406560
     ggattcttca ttttgcactg gtaattcaga taaactaatc attttctctt cttcgttact    406620
     ctcgtctgaa ccggccttag agtcagcgtt gttaaaactc atatattcat catcgctgtc    406680
     attctcatct cccttcttca tagataatgc atgcttcagt agtggattaa cgttagaaga    406740
     ttcttcatca tccagttctt gttcttcagc cagaccactt tctggttcag ctgtctctgt    406800
     aatcttatcc caggagctag tttgtgcact tggcttcatg gtttctatga attctttcag    406860
     ttgcttatcc ttttcgatct ctgcatcaat atttatcttg ctctttgtgt cctgcacctt    406920
     tagtttcttg ttcttttctt caagaagctt ctcttctttc tcccgcagcc tcttcaaggc    406980
     ttctctcttc ttctccttca ttgacttcgg aacccttgga tcagcaaaac tcttggccat    407040
     atcaacctca atcttcgaag tgtagataaa agaaccgtca aagtagttca ccgcatcaag    407100
     ggcatcttgc tcattcttgt aaccaataaa cgcaaatctt ctactcttac cttccctgtt    407160
     cttcaaaata cgtaaatcag tgatcagacc atcgacatta ctcgtcgcat gcgtggtaat    407220
     caacctctta ttgaaatgtt tctgtagctc tggctcagtc agatatatag gcagaccttt    407280
     cacaataact ctggacatcc tgcgatattt cgatactttt actccgctgg atcaagaaca    407340
     ataaaataac aatttttata ctgattgcaa caaattctta tcgtgtcctt caacaaaaaa    407400
     gaatactcaa agcagaatat accttgcgat gagcttgaaa tcacttatat tcccatacaa    407460
     aaagctgttt taactggttt tttttccact atggaagccg atgggcatcg caactttttt    407520
     ttttttttca gaaattttct gaaaattttc catctgcacc aattgggata catagatgtt    407580
     acccggagtc tagcttgggg gaaaagaatt tcaagatttc tatccttttg ggggttaccc    407640
     ggactagtga ccatattgtc tctctctgtc tctgtgtgaa tgtgagtgtg agtgtgacac    407700
     tagatcgtgt ttgacgtcat acttaacctc tagtttcttt gtcaagtttt gtggctaggg    407760
     ttgtttctgt gtgttcagat ggcgagtgtt cttcttcaca actttcggct acagaacaat    407820
     ggcaagtaaa cactatctga gcttagtggg ggggttgaat gagaactatt agtgagaaca    407880
     gaagcagagc agaattaaaa tagcgcaact tccttcaata gctggagcac ctacgaggag    407940
     agggatagtg ggatgcacgt actgttcctt tgtagtgctg tacctctagt ccaagtgtgt    408000
     atttgattgc tgcaattttt tgctcttgat gctgaatgtt tggtggaggt ttctcccact    408060
     cccactccca ctgtatcaag tgcactatgg gcgtgggttt cttgtctatg ggaagtagag    408120
     aaaaaaaaac ttggtgttgc atctcctact attccgttct cgagagtacg tcctgcttca    408180
     atgggcacag aaaatgacgt atagttacgg actatgtgta agtgatgggg ggtggaacaa    408240
     atgacaaaaa aacaatccac caattaggaa ataccaggaa ccgaaatgat gcttccacat    408300
     ataaaaacaa tccagtatag agttgtgagg tgtagggtag cgcgttaata cgtttggaga    408360
     atttgtaatt cttataaatt gtgataaatt gcagaagttg aatgactttt ttttttaaaa    408420
     cggaaagtgg ggagctatag cttttagttt agttgtttac gtcataattc actccagaat    408480
     agcctcaaag tctaccacgt attttcgctt tgttcgcagt attagcattg accaaaagta    408540
     cttgcataac aatatataag cccgaaggta aaacgtcatt gttgaaaccc attgttgcgg    408600
     acttataaag ctttttgttt gattcaccga agatacaatt cagtttggtg acagttctta    408660
     agccattctt tcatcaaaaa aaaagaagct agactaataa tggacttaaa ggatttctta    408720
     gttggttatt tggacattcc aagtccgaca atttttgatg cgaaggtcat cccatttttg    408780
     agggattata atatcgttaa gtctgaagcg attctatcaa atttacattc cataatctat    408840
     gtggcattgg gctaccagat gtggtttttg gctacacggt ggctgttgtt tcctccttta    408900
     accaagtgga gactcagcca ctcaaaggtt ccaaacgatg agaagaaagc caagaaattg    408960
     aacatcgagg ctgccattca ttttgtttca tttttacaga ctttggtagt ggtgtatcta    409020
     tcattgatat tcttgtgtga cggagacaag acctcaaatt acgacacggt caacgccagg    409080
     atattcggac gttcgaggga caccgagatc atcactgtgt atgccatcgg ctatttcgtg    409140
     tgggatgttt acatttcggt gttgcactcg actttacctt ttgtgctcca tggtataatc    409200
     tccactgtgg tgtttaccat aggcttgaag ccttatatcc aatactacgc gcctgtgttc    409260
     ctcatgttcg agttatccaa cccatttttg aacctgagat ggttcgggct gaaatacctg    409320
     ccaacggaaa accgtgtgtg ttcaattgcc ctcctgataa acaacttgct gttgctgatc    409380
     ttcttcttca gtgccagaat cgcctggggc tggtaccaga ttggcaagct gacctgggac    409440
     ttctacacag tgcacacgga tccaagattc ctgtggctgg actcgagtat cattgtcggt    409500
     ggtaatctcg tgctcgatgt cctcaatgcg atctggttcg gaacaatgct atccgtggca    409560
     ttcaatgtta taacaaagag aaagaaggat tgaatgtacc ccgcacattt gtactattta    409620
     tcttgtttta aatcctcacc atgtgattat aggtggcatg agggagcaaa aaaaagaggg    409680
     gtattcattt gcctattgtc ttgtttaaaa aaaaacaatc gaggcataaa ctttaagaca    409740
     ggacatttcg aatctcgagc agtgccaaat agaataaagt atagtttatt gtgtgtatta    409800
     tgttcaattt ttttgtttat cttttaattt taatctacaa cttgtgtcac caacaaaaag    409860
     aacattatga tagactaggg tcaggcattt tgtccttgaa cagttgcaaa tgatagatct    409920
     tttgtcccag caagtcccag caagtcccag cttcgtaagg tgaaaagaca actttattaa    409980
     aaaaaatgac ttgaatggct tacacgctgg gcaaatgtta ataaacccga gaactaggga    410040
     ttatcgggtc caactgtgct attcccgcat cctcgatgcc caaactatat gtgccagcgt    410100
     aagaaatgag cgtaacagtg caaaaaaaaa ggtgtcaaaa gggcagcaaa aacattttag    410160
     acggaacgcc tctctctctg caaggaattt accgtaactt gggtaagagg tatttcaatc    410220
     aatctctcag aaaggggtgc atacccttac aatgcacggc tgtacccctc gctattcccg    410280
     agaggaaaaa taaaacaatc tggggtaggc gtagagagta gcgtacggag gcgaagaaag    410340
     atgtaagaat gtaattcaca gtgcaagatt gcgggggggg ggatggccac aagagctgaa    410400
     aaaagggtcg attatgtcag ggctggagac agagaaacgg cagtgcagaa aagtgtatat    410460
     tatttaatga gacaccgtaa atcattattt tcatttatag cctattatat tttcatggaa    410520
     gaaaaaagaa aacaagattt ggaccctatc tccccttttc ttctaacaaa acgatgtacg    410580
     gggagaggat aacgtacacg ttcctgtcca atccttctcc aactttgtgt gcagttatct    410640
     gagtgatcca tggtttcccg acatttcgga tggacactta ttaacttgtg ctacgctggt    410700
     ttgctgtcag atatcgtgct tcctcagatc gcaatcaaaa aaatggaaga ggaaagtgca    410760
     acgattagga ctgcaactaa ggaaccagcg tacaacaggc ttgaaattac ttaaaagaga    410820
     tcggctctct atagcaggac tatacccgat ccacgctcca ttctaaggta ccattcccct    410880
     tccccaatat cagcgagact agcagagatc tattccccca tagtagagga cgctacttcc    410940
     agtctgtgct ccctttccac agaaagagag agagagatac acacacaaga taacagggat    411000
     taacacagcg ggaatacgac agggcaccca gagaacaagc gcaccgaaca ccttatccca    411060
     ataaaggcga ttacaacgat aaaataataa aaaaaaaatt aaaaaaaatc tggggtaaac    411120
     aattcttcta cacagggggc accgtagtgc cccggggagt attgccatta taacaccgaa    411180
     tgctaggtga caggaaaaaa gcgcacaaat cccagcctcc ccttatcagt tatcaggacc    411240
     tatatacaca cacacacaca cacaatgaga gaaggacagg gcgaaccaat tgggagggca    411300
     tccccaggaa tatgagcaat aaacgcgcac agccgtgttt gtgaaatagg gctaacccag    411360
     aaataagcgc aggagatcaa acaaaagagc gtagggatta attacgacat tacttcatca    411420
     gtctaactga gacggcggtc gcgcaagatc cagcgatagg tgttgtagtg gaaatctcgc    411480
     caaaaattga aaaaattggg ggcgaggggg gataaaggtt tgcccttcta gaagctctca    411540
     aatctggctg tattaattga taaaaataat tatctcaacc cccgcccccg cactcttgga    411600
     ttgtttgaag ttgaattgga atttgaactt gaacttgaag cgtagaagtt agagagtgcg    411660
     ataaatgagt acagtcaaat tgcgaatgtg ccaccaaaaa gacttacgga acgggatttc    411720
     ttgtaaaact ttacatccct atcgttgcgt tgtttaacct tggtttatag tgttattccc    411780
     gactattcga gttgcgagga agaggacaaa ttacctggag aggacaaagc aagtccatga    411840
     ctgaaaaata actaaaataa taataaaata aaatgtctac cgagatgtgg tactgaatac    411900
     tcttggataa tacgtatatt ctcctttttc tgcttaaacg catagtatta acccctcatt    411960
     aaaaagactc tttctaatat gccttaggag ccacatacgt aacttttgtc tttatgacgc    412020
     tcgctgaata tcgccgagcc tcgagcaaac tgcgctgtct gcaaagaagt gtaaatttaa    412080
     aaacaaaatc ataagattcc ccacaatatt tttttttgta taaataagga acgaattgat    412140
     aattgaaaat catttctctc tctctttaat cattattctt tatcctctta taataataat    412200
     aaaaccaaaa cagttcatat tcaaatacta tgactgaaac acaaactgaa tattttaaca    412260
     caaggcaagt cagtcttgct gacgacttgc taaagcacac gacatcaata ggatcaaaat    412320
     tgactaaagt ggtcagtccc accacgaagg ttaaagagga ctctttgaag ccaatgaaga    412380
     caatttcaaa cactatctca aagaccacat cagctaccac tgctaacgac tcaagctttg    412440
     atggattcaa cccaaagtac ttgaactcgg aaagtgtata cagagcccaa tcaaactcgc    412500
     agagcggacc agtggtgtca cgcacagagg ttaactctcc ttactactta ccagtcccag    412560
     tgccagaagc tgtcactgac tctgctaatc ccgtgagcag cagtgcaaag gagcaatact    412620
     taaatggtta ccaccactcc cagtacgtta aggaataccc aactgtgctg ctggcagaca    412680
     ggttcaaaaa atggaacaaa attttgaagt acctcatttc ttaccttcgc gaagccgctt    412740
     acgtcgaaga gcatatcgcc agattacatg taaagctaaa gaagaaggtg actttcccat    412800
     tcttgacaga tttggacgat cacaaccagc ttgtggaccc atatcagaaa aacttgccaa    412860
     caaagagaac acaaccaatt actccagctg aaaagaaaag attggaagct gaggcagcac    412920
     tagccgctgc caccaccaca gaagaaacaa cagaagaatt ggactttgat acagagctag    412980
     aagacgaagt acctgtttct tctgacaatg atactatggc accatcaggc tttttgaagt    413040
     tcggttcagg ctcaatacag gatattcaag ttttattgaa gaagtatcat ggttctattg    413100
     caggacaaca attgaaagtc tccagagaaa taatggaaaa cgtcattcca aaactagaag    413160
     gtctggtaaa agagttaaac aataagataa gggaaatcaa gagtttggac ggtgatttca    413220
     gaactaattt gattggtcaa atgaaccaaa cctctagatt aattcaaaag tataactcgg    413280
     ttgtaaagaa gctagccaat gaaaagtctg atgctactac cactattcaa ccaaagtgtg    413340
     acccatactt ggtaaaaatt caattggaaa cacaattgaa gaaacagtta gccgaagaaa    413400
     aatatctaat ggaagcattc gttaacttgc agagctccgg tcttgacctg gaaagaattg    413460
     tctacacaaa aattcaaagt gcacttgaaa actataccgc tttgattgat tctgaagcac    413520
     gtttgatttt aaagaaccta tgccaagaat tacaacaggg tatgctatcc aagccagcta    413580
     attatgaatg ggatcaattc attactcatc ataccaactg tatgttgaat tggacctcca    413640
     cccaaccaaa gccggttcca agagaactat ctgacattgt ataccagaac atgaaggcac    413700
     ctcagtctaa gtgcatcagg aagggttaca tgtactatgg ttcaggcaaa gatgttaaga    413760
     agtatagcaa aggctacttc attttaactt cccattatct gcatgaattc aaagatagcg    413820
     atttctctaa ggagatgaaa ggttcaactg atgccagtaa caacttctgt cacatggcta    413880
     ttagtttggt caacttgatt cctgaaaaga gtttctcatt gagcgatatt gatatcgaag    413940
     agatcacaga caccgaaatg gtattcactg ctagatcatt gaagagcacc aaacctagaa    414000
     gcagtccttc tccagcccca attccagctc ctgaacacaa gtctagatcg ccatcgatta    414060
     ccgcagctgt tccaaagttc ctaagaggtg gcccaagtag atccactaag accagatcaa    414120
     atagcggtgc taacagacaa accttatttg ctgaaccatc tctaagcgag ccattacgtg    414180
     aaattggtga aagaacaaca tggcacttaa gactttcctt gggtgattat gatgaagaat    414240
     acaagaagca atttaagaag tggagctctg atttcaaggc ccttgctgac ttcaaccatt    414300
     catatcacag aaattcgttc ataaatgagc gtgcagaaag tgcaacaaga agagcaagta    414360
     aaactgctgg gccaggcgag ttcaataagc aaaacagtga ctcttctcgt ggatcatctg    414420
     atagcaccat tgtgcaagat agtggacgct cagactctaa gattggtaat attgttggtc    414480
     tagatgagga cggaaacttg attgcttcgg atggtagaaa gtactctgtc agtccacaat    414540
     tgcaaagaca gggatcatct ggattaactt ccccatccag ccaaccaggc agtccgttgg    414600
     gtgatggatc gaccactcag tatagagacc gtgttctttc tttaccaacc aataaaagac    414660
     aagatagtac taccattgag ggcgtaatgg ctgattcaaa gaaatcccct aatacctcat    414720
     ctagaggtag tgtctcttat gtgactagca gcaaagtcac tcgtacttct agtttaccag    414780
     ttaatgacaa ggacgctgct agccctgcag atgtcccaag aagttcgcaa atgagagacc    414840
     aactaaagtc gactattgat accatagatg aatcaaatca agagaattca gcatcatcga    414900
     ccatgaagct atcaaagtcg atgtactcat aaatggcatt aacgcatgaa ctataagtat    414960
     cttgtctaaa agtacatgtt tggcgttacc aaacattgat tgatatatgg gatgagacac    415020
     atgcatctca tttccacatt tgttattaaa tattccataa cgttttcttt tcagttttat    415080
     tcatattcaa acctacgcat ccttacatgc attttaaata ttcttacttt tttaccttgt    415140
     ttacagattt tatatttata aaatgaaata tcctttgata tactctgtga ctgaatgtct    415200
     aaaatggtac tgagatgaat actttacatg ctatctgatc gatcttctca gttcaaggcc    415260
     cccctctatc tcatcgcctt ttgaaacttt cttgcctgaa aatagatgga cctgattcaa    415320
     ttcgcgatga catagaaata gatgagccta ggaatttgat cacagtgacg aatatacgtt    415380
     atagtatgtc gcagcttact tctattttgt ttacgtatag tatttgctta cttacaagta    415440
     gttgtataca tctttacagt ctttagagta ttcaagactc agtttattac aattttgtaa    415500
     aattttggtc ttttgtttgt ataagttatt atatatattt aaaactccgt tataaaaaaa    415560
     tagttgaata acagactact tgtcgccaaa cagcaaacat tccgagggtt acttatttag    415620
     atgcattgta tcactatatg ccgtacaatg ctcccaaaac taaatccatt tgccaagtga    415680
     caatttaatg gaatcaatcc aaatttgtgt ccaaataatg tatgccttgc atccaaagac    415740
     cagcagtgct gcagtacagg aatatgctcc aattgcagta caaaacacaa caaaagcagc    415800
     agttctcccc aaaagtaaag ccattgtttt gatgtatgca tcttgccaca aatgttctgt    415860
     ttccatttct tcacgccttt gtttctcaca ctcgggacac agttcataac ccaactgatt    415920
     gacaaccaga gcttgctctg tactatcatt gttattaatg gttggtaaga tacctagcag    415980
     tgactcaaaa ttgtttgtct caaaaatggc aataatcttg atggctgtaa gcaaggtgac    416040
     tttagattcc tcaatgattt gtattagctc agtaagcatc aagttagggt cttcgttccc    416100
     cttttgggtc atgtagctca agaaactgga cctgaatagc aaatgtctca ggtaaaatat    416160
     tgtgttggcc ctgacagtgc ttgcataaag ctttttcctc atccaagatg cattgtccaa    416220
     cttctcagtc aaattttggg ctcctttaat aaagtcctcc aaagagtctc ttattttcca    416280
     gatatctgag tcattgtagt cttcgagttc tggtagtagc aatactaaat tgacttcatg    416340
     catattactg atactgttga ccaagtattg caagtagttt ggttgaacag tttcaatggg    416400
     caagtcactc ctaa