(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_5

ID   CAGLA1_5; SV 1; linear; genomic DNA; GRV; FUN; 651701 BP.
XX
AC   CR380950_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 21)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome D, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380950.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..651701
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome D"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        complement(17042..17914)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194323"
FT                   /locus_tag="CAGL0D00154g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58331.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541897"
FT                   /db_xref="HOGENOM:HBG705794"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR012269"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniParc:UPI00003B60B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWH4"
FT                   /transl_table=1
FT                   /translation="METEHQADKNAELGYDSGSTVAPPNKYSTLRSRFNLGPDTMRNHV
FT                   IAFFGELVGTFMFLWCAYVIANIANHDVLLDVYPDGSHPGQLIMIALGFGFSVMFSIWC
FT                   FAGVSGGALNPAVSLSLALSRTITPMRCIVMWVAQMLGGMAAGGAASGMTPGPVLYANT
FT                   LGNGCSRTRGLFLEMFGTTILCLTVLMTAVEKGESNFMCALPIGISLFIGHLALTGYTG
FT                   TGVNPARSFGAALAARSFPVYHWIYWIGPLLGAILAWFVWQVLQWLDYSSYVTREKEAA
FT                   AKTKVMVEP"
FT   CDS_pept        23693..25075
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000243799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043217"
FT                   /locus_tag="CAGL0D00176g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /function="oxidoreductase activity, acting on the CH-NH2
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58332.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016639"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG518222"
FT                   /db_xref="HOGENOM:HBG590661"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B60B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWH3"
FT                   /transl_table=1
FT                   /translation="MSSQVNEPEFQQAYHEVVSSLKDSSLFEKHPKYAKVLPVVSVPER
FT                   IIQFRVTWENDNHEQEVATGYRVQFNSAKGPYKGGLRFHPSVNLSILKFLGFEQIFKNA
FT                   LTGLDMGGAKGGLCVDLKGRSDNEIRRICYAFMRELHRHIGADTDVPAGDIGVGGREIG
FT                   YLFGAYRHYTNSWEGVLTGKGLNWGGSLIRPEATGYGLVYYTQSMIDYATKGKESFSGK
FT                   RVAISGSGNVAQFAALKVIELGGIVVSLSDSKGCIISETGITTEQIASIAEAKIKFKSL
FT                   EQIVGEYSAFAENKVEYVAGARPWTLVGKVDIALPCATQNEVSGDEAKALVAAGVKFVA
FT                   EGSNMGCTPEAIDVFESSRATASAPGEAVWYAMGKNSNLGGVLTSGLEMAQNSQRMSWT
FT                   SEEVDQELKKGMVNCFNDCIEAAEKYSNESNKNALPSLVKGGNIASFIKVADAMFDQGD
FT                   VF"
FT   CDS_pept        27559..28710
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194324"
FT                   /locus_tag="CAGL0D00198g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58333.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B60B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWH2"
FT                   /transl_table=1
FT                   /translation="MRSLAYFKTGDIHFTDKIDTPKINNDHELMIDVAWCGICGTDLHE
FT                   FLEGPIFMPKDGDTHYLSGLDLPLPMGHEMSGIVKEVGKGVTRFKPGDRVVIEATTSCG
FT                   DTHRWPKSKVAKGELCPACEMGLPNCCTHGSFQGLGSVGGGFAEQVVVGEKHVVKIPDK
FT                   LPLDVAALVEPLSVAWHAARLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEP
FT                   AKLRRELAEKLNVVVFNPTHTRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA
FT                   ACIQGHIVNVAIWGPKPVAFHPMDMTYGEKKLTGTMGYVTRDFEEVVDAIDKGYISIEE
FT                   CKLLITGRVKLEDGMEKGFHELIEHKETNVKILLTPNNHGELQ"
FT   CDS_pept        29345..29914
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499724"
FT                   /locus_tag="CAGL0D00220g"
FT                   /product="Similar to uniprot|P39715 Saccharomyces
FT                   cerevisiae YAL059w SIM1"
FT                   /protein_id="CAG58334.1"
FT                   /db_xref="HOGENOM:HBG124461"
FT                   /db_xref="HOGENOM:HBG397015"
FT                   /db_xref="UniParc:UPI00003B60B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWH1"
FT                   /transl_table=1
FT                   /translation="MAKKISKNSRAARQYDLTDLAPKELQNLPRAENTDLTNIMIRTAA
FT                   KNESLLEAKIRKKKDSKNKVSKKDFEKKIAKSVKIMEKERLERALNITNRLDGKIAKSI
FT                   SRAKYVQSSRKAGWDSINASIKKELLVQALEAEEEEKKNEEAEKEGDIEVDEMYDSAKI
FT                   ETTTEVKPQSVEPQNLFALLPLDTDE"
FT   CDS_pept        30268..31416
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432277"
FT                   /locus_tag="CAGL0D00242g"
FT                   /product="Similar to uniprot|P27825 Saccharomyces
FT                   cerevisiae YAL058w CNE1"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG58335.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG124463"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00003B60B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWH0"
FT                   /transl_table=1
FT                   /translation="MKSIGLLGLFFTAAHVHGRHLPINSTNISGFWEDFETYKTNEDLK
FT                   EVWHSSEAVDEHGRKLFPASWKLFHNPDYVESNRKGLLVKSPGKYAMIGRNIEKPVNLS
FT                   DSELLVIQYEVKSTKDPHCEGAFIKLFHNMYLESLTNYDRKAGVKYDLLFGPDFCLPDT
FT                   NMVRFEWRNRKDKEEKKLIFSPKSKLNDGQHKNHLYTMILDLGNKILEIRIDGKVVLAT
FT                   SLNDSQHFKDTKYMSTTDTHEDSSEFNFSIDGLTFDIWGTLSGIVFKNVYIGNSIEEAE
FT                   IIGNNTYLPNALKENDLILKKLKVKNDGKVPNAKSPYDDNIYSQNLFDILFDKLVGLLE
FT                   GLSIKHMITVLLVLIPYMLYYLARNHEMKKRIRTEDIVEINK"
FT   CDS_pept        complement(31657..32868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043218"
FT                   /locus_tag="CAGL0D00264g"
FT                   /product="Similar to uniprot|P36047 Saccharomyces
FT                   cerevisiae YKL193c SDS22"
FT                   /protein_id="CAG58336.1"
FT                   /db_xref="HOGENOM:HBG124465"
FT                   /db_xref="UniParc:UPI00003B60B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG9"
FT                   /transl_table=1
FT                   /translation="MHIAPDRALTPLNLNGGFQIPYSSHSFKDDDIDDNSNGSKSSDKF
FT                   KYATQLDNSLDLSRDELVFKERNVSGRVNLTDTQGKPYSFLCNTDASISQIPFKPKTKI
FT                   IRELNVQGKGLLHLNLNNYRDLETLNCSYNCIADLEFLNDGYHLTQINMSHNQVRSLTT
FT                   LENTPLRHLDLSYNLIEGCIDFRELMHGSRDKLGWASLEYLCLTGNKIKELKNIHLLTN
FT                   LRVLLVDNNNLEKVDNLHLLRYLETVSLMKNFNLPHLELKCLPLMQLKELHIDACKCLR
FT                   EWKICPPHIEVFEICNGAICDIPKWEYFPPNLKILKISNISGLRELPSNLYQIIPTVQR
FT                   LDLTDNDLHDLKNILRAIPTTQLKYINLCRNPVTKQLSRRTAQNYEHVFRIACQIIENV
FT                   HLVD"
FT   CDS_pept        37583..39784
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347586"
FT                   /locus_tag="CAGL0D00286g"
FT                   /product="Similar to DEHA0D08195g Debaryomyces hansenii and
FT                   CA4636|IPF1520 Candida albicans"
FT                   /protein_id="CAG58337.1"
FT                   /db_xref="HOGENOM:HBG124265"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI00003B60B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG8"
FT                   /transl_table=1
FT                   /translation="MSRKNSNISGLSSESSSDQLYADAKTESLPMEDFESSQFDDIESG
FT                   LIDGKDDANSKRNKTHIKTSLNDIIQQVRQRSRLLANRTGLTSTKNIIIRLLVVNVVLF
FT                   LIFIHFSSFRSHHLKNEANIGNGGIEEQGNEESIAGLDISIGHGLENSVSVKGRIKDYN
FT                   RNLNKILQGVPQVNDKSEMSQYDTSKFIKMQRFDLMATANGFPNNTFLPFELTSYQSNM
FT                   YNLTGSESNKCDAISWKSRIHYSQERLPIEEDLVAARIKFVKEDKHLGKIVEELHNASK
FT                   KETIEESVKKQWLRFGSSAQWLEDHQCYLVFSRIIVTEGGFKGAGKMSLVSAQAFDKDW
FT                   NEIKGKRIPFIDTEIPDDLEQQLIAIDKKYDLFKNCDEEDKTTYQYQVCVQSKQYMKEK
FT                   AEEEKDELLGNYYRVYPTILKIPFAMEKKWFYKGPEDPKLILRTNKDGIQEPIVVYNIY
FT                   DPTHQERMMQVVLPHRKISPVIPLIEQDAIVVGRQKNWTPFIKDEDAGGQISRGSLHMF
FT                   SRAAPLQIVKCSLDTGYCKFVFDAAEYSKKDFEPNEIRGGTPLIKLPPVVPQLKGRNLW
FT                   FGLMKGHIKECGISDRLYRPSLAILEEENGKYFFNLITDTLHFNTEVLGWSEKNFKADG
FT                   YNVLSPNSVISWDVLSQNPETKSYDDYMQISVSQSDKGSYVIKMKGVLDFILQSYTKEG
FT                   LNNNMDWESSGLEDRIELGGVCFRKHLRNYCEEYSKSHS"
FT   tRNA            40063..40146
FT                   /gene_name="tRNA Leu (TAA)"
FT   CDS_pept        41436..42704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043219"
FT                   /locus_tag="CAGL0D00330g"
FT                   /product="Similar to uniprot|P32464 Saccharomyces
FT                   cerevisiae YKL189w HYM1"
FT                   /function="binding"
FT                   /protein_id="CAG58338.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG017984"
FT                   /db_xref="HOGENOM:HBG331109"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B60B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG7"
FT                   /transl_table=1
FT                   /translation="MFKKYKNQDLDVSFWWKKNPKTPSDYVKLINEQLNKIEPTPLPNG
FT                   TNITSSSSDNKRKAQEEVAKYLVGMKHYILGDVDPKPTSEAIDEFYSAMLSSDIFHNLL
FT                   VHIADLDFESRKEVLLILSICLNYSKDNKFVTVDYLVSQSKTLSLMLRTMGLTLQRRDT
FT                   YDIFIIVGNMIIECIKYEQLCHIFLTDTQLWSLFEFAGIANFEISTQSMQILNSVLTTH
FT                   PKLVAREFFSQEKNINLFIRHINKLMAHGSYVTKRQSSKLLASLIIIRAHNVLMMTYIN
FT                   APENLKLIMTLLTDKSRNLQLEAFNIFKVMVANPKKSKLVFDILVKNRDKLLAYLELFG
FT                   KEVQDSTFLDEKEFIMREIESLPRIKPNTNEHNINMSNSPPKGLLHSDQKKTASSQQFN
FT                   ENHNELSGNNSSGNVTKSLASIG"
FT   CDS_pept        complement(42946..45531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432278"
FT                   /locus_tag="CAGL0D00352g"
FT                   /product="Similar to uniprot|P34230 Saccharomyces
FT                   cerevisiae YKL188c PXA2 ABC transporter "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58339.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniParc:UPI00003B60BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG6"
FT                   /transl_table=1
FT                   /translation="MTLLTAYKNHRVNILRTSYILLLFVSLYGSGSSSGSTKQKKTSSN
FT                   RDRSETLSEKSTLSRLSEKLRDRKDSISSPDELASDVSSDEQSDSKSDEIVLKTRGTRS
FT                   LSLRRSSNVQENTNVVEQTSPVEKSTDVNLKRTDFLMKLLLGDKKVMILFMTQAFLLVL
FT                   RTFLSLHVATLDGRLVSSLVKAQYGKFLKILLGQWMVLGIPASFINSLINYVTKLCSVS
FT                   INRLVTNHLMGKYLSNHRTFYAVAAADSASEVQDNLTKDISKFSNNTSVLLNQLLKPML
FT                   DLILCSFKLLMSGSGVMGEGTLVLGLIVYISNSMLKLIQPNFTKITMMRSSLESWFRSL
FT                   HSSVHRNNEEIALLRGQSRELTSLDFSFYRLAFFMGREIKARAFYDLASTFVIKYTWGA
FT                   AGLALCSIPIFFKGKVQNGDQPDATDATADFITNRRLLLTASSSVGRFVELKKNIQELR
FT                   GTSLRLNYLNDLLDKYAVGNIDKKDEDVLDLVEYNENLIKFEHVPLITPANQVLVPELN
FT                   FELKHGDHLLIIGPNGCGKSSLFRLLGGLWPIRQIETGVQTKLTVPPRKIGQDCAIFYL
FT                   PQKPYMGNGSTFREQIIYPDTIEDFEERFNGDYNMGDEKLISVLELLDLTDLITENLSL
FT                   VLAGKGTKKSDNLDEENLTEIRAAFDLKRNWSEELSIGVQQRLAMARMYYHKPKFAVLD
FT                   ECTSAVSPEMEQKMYENAQNLGISVISVCHRTTLWHFHNYLLKFDGKGSYQFGEFDATT
FT                   RLETEKRLNELNSLLDQQVPLWEKRLRDLLDAKKSNVIRKSETDLQTLQKMANATTDSD
FT                   IPELTRADTEKFTSKSATRKINHNGRLPLLSSKGSESSKLLKKKQKKKT"
FT   CDS_pept        45775..46086
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194325"
FT                   /locus_tag="CAGL0D00374g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58340.1"
FT                   /db_xref="HOGENOM:HBG124401"
FT                   /db_xref="UniParc:UPI00003B60BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG5"
FT                   /transl_table=1
FT                   /translation="MRKDSITRDVVVGKTFILNLKSGPKLIQAPTHTKHQRCPKHSPYS
FT                   PFSKDDMVESRGKCNRMYRVSHHSRATQKELYSDENEKLDVILTQGRTVSLNRRKNIP"
FT   CDS_pept        complement(46316..46558)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194326"
FT                   /locus_tag="CAGL0D00396g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58341.1"
FT                   /db_xref="HOGENOM:HBG124402"
FT                   /db_xref="UniParc:UPI00003B60BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG4"
FT                   /transl_table=1
FT                   /translation="MNTAPYATVSTKTQSRFTHKIQYPRIAPKPYRENNWPDLALGRIF
FT                   YVEAILKNVFTRPHCSFLKPIATRYIERPRDYGAL"
FT   CDS_pept        complement(47786..50011)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194327"
FT                   /locus_tag="CAGL0D00418g"
FT                   /product="Similar to uniprot|P34231 Saccharomyces
FT                   cerevisiae YKL187c"
FT                   /protein_id="CAG58342.1"
FT                   /db_xref="HOGENOM:HBG124407"
FT                   /db_xref="HOGENOM:HBG202582"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI00003B60BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG3"
FT                   /transl_table=1
FT                   /translation="MVNLAVHRSAHRAAKKYTHPDTYPNAKQLKRSTEVLLFSVCILFL
FT                   FTTFITFIVATAGSTANYSPIHNIYIGDADIKHINVTKVLPQIAPILTVLGTALSAPNS
FT                   SLSEVFNSLKAIADTPALTPLLNLLKNAKNTSDSVVALTELAPLAISSDSSSSTKELIA
FT                   ISGLLSFSNNTNQTLESLGNLVMPTLAQLKSGQPSDNSTSIVLSILQGSDNKVASVDSL
FT                   ITLNNMTLAEKTKLLPVFQLFGYTTNINNTVDALGDLMNANVPTQLGVTLLTTIQSSLN
FT                   GEADQDLSPLFDRIGGSVPEDNKQSVEAVEALLNDSSNKNGTINNLLSLLRQNVTTSPS
FT                   AKAAFQAMSTLLDHSNNQTMVLQSLPILAAVRNTTLAQAQLEGLQGMLQVSTNPVQTLG
FT                   IIAALQAGMADPNTNTDAVPALFNLLSASDNPANSFTSLVALTSWATSNPDTFRPIVSI
FT                   LEDANSVEPVTQEQLKAMTPALLDFLHVPVDFRLSIFTLCHVNGQGEITDCNSPHAVQN
FT                   LDFRSIIYDALLDSDFQPYLKALNISKYDLYLEGKLLHRQHEYVPAVKAVLAMNILTII
FT                   TSFFGIIGFILLIAPKYNRKLGLWIYTVVLTLSTALFSCLGAGIIAIMISIIKSGTSHD
FT                   KFNVVFSTGGAYSGCVWAGFAVAFFACLIVLYCAFYARVGKPRGQPFGDEKGYDNDMSS
FT                   MSNSSENNNYESEKVVQTVDVADVDEDDSSSPEQVNKQQPKDTDIIV"
FT   CDS_pept        complement(52244..52798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500008"
FT                   /locus_tag="CAGL0D00440g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58343.1"
FT                   /db_xref="HOGENOM:HBG059076"
FT                   /db_xref="HOGENOM:HBG398436"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="UniParc:UPI00003B60BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG2"
FT                   /transl_table=1
FT                   /translation="MNSNSNNNSQYHLIDIFVKKVLAHLDEQDPNKLMNFLQLFQSSKN
FT                   MPPSPTVSKVVYNSMPFADPSIFLTMWSQQVVQTQHIISALDFHVIPTGASNTIICNVN
FT                   CKVRFDESGRDKMGQDSVIPMGPSGAKRMNNNRPLWGSYFGVSLQLCLDDRIFRNDING
FT                   VITSLNYKIVYKPEDSLIKIN"
FT   CDS_pept        55305..57443
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433285"
FT                   /locus_tag="CAGL0D00462g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG58344.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124416"
FT                   /db_xref="HOGENOM:HBG202400"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00003B60BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG1"
FT                   /transl_table=1
FT                   /translation="MSLPLNELPVPILGKTSFSSANRSSYISSAGSERHAALMENSEAL
FT                   RSPSHSSNQGFRLQSNAHTSPISKNYSYFSSPIPSTSRLSLNVGKTGLANITATDLPRE
FT                   SISYQARSSSFGPQIEFPYRKSNTAPASPHHFSTSNYVSIITPSTSPAGLENRMVGSTA
FT                   QFSHLPSLRAASIPNISCSPTFQETTNSLSDHYSGNSTTHISSVKSGTILPSLRHLQLL
FT                   PDRSLQEHSKLYPDTAKINGAWRQNVISWCKEKSYEDYVKVQEEVAKVRTQFPISQLRS
FT                   HPESTKNPNMPKIPSLLNAKDQFESLSNSPWSYEAPVTPPMSPSVSKRRQNSNTSSSKL
FT                   QSVTYNLTPKTPGDDLKDFTPIISERLVQTVKMKQMETYYQSSPGRHKKTNSFKALQIK
FT                   KLLDNRDVLSINSKSGFKVSKPGRPMSSVIVSGISTQIASKLESISSNSSSSSASSSPK
FT                   SSKRSLSRSPTRFTTFVQPSTPREYNQKQKINSSRSRSRSPIRPSTPTQQTPIYKNTFQ
FT                   NSDNSNYNVNSASVFSTPALKYGQSSTESPNSATFNSIGAHTTSISVTTSPKHYYSSKK
FT                   ISGGSNSPKRRKSNPTFTSVTSTPTASHGAKSKSGSNSPKNGAYHLRKCVSCNSSDSPC
FT                   WRPSWSGKKTEQLCNSCGLRYKKTRTRCLNDGCRKIPTKGELNIMKSQGLEKEYNTQLQ
FT                   REVEGYKCLFCNHITETR"
FT   CDS_pept        59152..60543
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000274133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433286"
FT                   /locus_tag="CAGL0D00484g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="catalytic activity"
FT                   /biological_process="polyamine biosynthetic process "
FT                   /protein_id="CAG58345.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006596"
FT                   /db_xref="HOGENOM:HBG152288"
FT                   /db_xref="HOGENOM:HBG672375"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="UniParc:UPI00003B60C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWG0"
FT                   /transl_table=1
FT                   /translation="MASQPEIAKNLFASTTTLVDYPAKEEKKSHEDNVDTYLEQLFYKL
FT                   KNDPEISKLPHNEAHLEIYNALKKRVDDINNETCEPGEENSFFVCDLGEIERLYANWWK
FT                   ELPRVQPFYAVKCNPDLKIIRKLADLGANFDCASKLEIDKVLSMDVNPERIIYANPCKA
FT                   ASFIRYAATNKVMKSTFDNVEELHKIKKFHPESQLFLRIATDDSTAQCRLSTKYGCEME
FT                   RVDSLLECIKTLGLNLVGVSFHVGSGASDFSSLYKAVRDARIVFDKAVNDYGLPELKTL
FT                   DVGGGFQLESFKESSAVLRLALDEYFPESSKVDIIAEPGRYLVASAFTLSANVIAKRKL
FT                   NEAESMIYVNDGVYGNMNCILFDHQEPTPRTLWHDNNYHYDDFDSTSPNPITTCPYKVS
FT                   MWGPTCDGLDCITKEYYMKHDLVVGDWLYFPRLGAYTSSAATPFNGFDQTADIIYINSE
FT                   NHDNI"
FT   CDS_pept        61050..62033
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433287"
FT                   /locus_tag="CAGL0D00506g"
FT                   /product="Similar to uniprot|P34234 Saccharomyces
FT                   cerevisiae YKL183w"
FT                   /protein_id="CAG58346.1"
FT                   /db_xref="HOGENOM:HBG124421"
FT                   /db_xref="UniParc:UPI00003B60C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF9"
FT                   /transl_table=1
FT                   /translation="MSESKLVFFKPTLEHVIPWKRYQLEQPKVLVNNELYDDKEGKLIL
FT                   YGGGREFLLRDIDRGEEVEVEVYILEGRLMLWIKHPDINKGVEIPNSSIIYHGSRINYE
FT                   GRDGHRLELVVSVCRDKIIDELFGSDKSRDTDIYGGTVLNGGNELNAGHEGSSRGVSEE
FT                   LPMYTLSSVELVLRPKYSSFDRYYSEEIEQLFTFDNFGLNRGDDLIENCHNQLALSIEH
FT                   SAQEEEVLSSDNAGMNEQPGEPTSMSTLLNSMNSTNGMYPTNIAQSDQRFENSNSDTPV
FT                   IGNTGNCDDLDDMNFGMEIGDASSFAIEQNQLNPASAILGRRSRDS"
FT   CDS_pept        64404..70649
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194593"
FT                   /locus_tag="CAGL0D00528g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="fatty acid synthase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /protein_id="CAG58347.1"
FT                   /db_xref="GO:0004312"
FT                   /db_xref="GO:0005835"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053545"
FT                   /db_xref="HOGENOM:HBG736477"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016452"
FT                   /db_xref="UniParc:UPI00003B60C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF8"
FT                   /transl_table=1
FT                   /translation="MDTRPFTISYGSIEHTLVIPISQFFLVSQLNDQFLKLELPNHQQP
FT                   SEDFQSDEEPTSPVELLGKFIGYVTSLIDTAGSDESQQKKITSILELTFKDFESSYLNG
FT                   NDIHTLAAKLLQDNDIALEEQVEAVENNTNNKQEVFPTTLPKVKELVKNYLNAKVLLHK
FT                   LGVITVQNSQNKINSALFGSDITKIYAIFGGQGNTDDYFEELRDLYQTYSYLIEDILDF
FT                   VSKTLNNLLKNSSQDMEKIFTQGLDVKHWLKYPNATPENDYLLSIPISCPLIGVIQLTH
FT                   YALTARLLNVTPGELRSKIQGATGHSQGLVAAVSIAEADSWDAFFKSFEKAITLLFFIG
FT                   VHCYLAYPKTSLPPSILQDSLENGEGVPSPMLTISNLTKEQVQEYVDKTNSHLPAEKHI
FT                   VISLVNGARNLVVSGPPQSLYGLNLTLRKAKEPSGLDQSRIPYSERKLRFSNRFLPVAS
FT                   PFHSHLLEPANEAIIDNLKAFNVEFSAKDLKIPVYDTFDGSDLRDNSGSIVQRITDCII
FT                   RLPVNWETSTKFEATHILDFGPGGTSGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGF
FT                   KQEIFEVASNSVKQNPNWLKEFCPKLVKTKAGKVYVDTKFSKMIGRPPLLIPGMTPTTV
FT                   SPDFVAATINAGYTIELAGGGYFSPGHMTQAIDEVVSQIKKGYSLGINLIYVNPRMLQW
FT                   GIPLIKELRERGYPIQSLTIGAGVPSLEVATEYIETLGLTHLGLKPGSIDAISQCINIA
FT                   KAHPNFPIVLQWTGGRGGGHHSFEDFHQPMLQMYSKLRRCKNIILIAGSGFGAAEDTYP
FT                   YLTGEWSAKMNYPPMPFDGLLFGSRVMVAKEAKTSLAAKKLIVDCVGVPDNQWEQTYKK
FT                   PTGGIITVRSEMGEPIHKIATRGVLFWKEMDDTIFTLPKNKLQAALDAKRDYIIEKLNS
FT                   VSQKPWFATVNGEARDLTSMTYEEVAKRLVELMYIRKTNSWIDITLRNFTGDFLRRVEE
FT                   RFTTQKTSSVIQSYAILEKPDEAIKLVFDAYPCAKDQYLNAQDVDYFLALCQNPMQKPV
FT                   PFVPVLDQRFEFFFKKDSLWQSEHLEAVVDEDVQRTCILHGPVSAQYTTKVDEPIQDIL
FT                   DGIHNGHIDMLLKDYYGGDSSKIPVVEYFGGEDPVEINNTEIVKDEDTLVLDASTIKDE
FT                   AYWFKLLSGSKRNWRHAFFSTDRLVQGSSYTENPARKVFKPSKHMFVEITNANNEEKCV
FT                   ITLKEMVQGELKKTAVLKLIQKDLIEMDMIENRTMDGKPVVLPLLYKYNIEDGFAPISE
FT                   VMEDRNQRIKEMYWKLWIGEPFNLKFDPRKEIKGSDFKITKQDIQEFTHAIGNNCEDFV
FT                   PRSGRDLLAPMDFAIVVGWRAIIKAIFPETVDGDLLKLVHLSNGYQMLPGAKPLKEGDI
FT                   ISTSASIKSVVNQPTGKIVEVVGTLSRDSKPIMEVTSSFFYRGKYSDFENTFQKTVEPI
FT                   YEMNIKSAKDIAVLRSKEWFQLDDEDIDLLNKVLSFETETEVTFKDATIFSSVKCSGPI
FT                   FMELPTKEKIEIGIVNYEAGESYGNPVIDFLKRNAATLEQKVNLENPIPIAVLDSYTPS
FT                   TNEPYARVSGDLNPIHVSRHFAAYADLPGTITHGMYSSAAVRGLIENWAADSVSSRVRG
FT                   FNCQFTSMVLPNTPLKTSIQHVGMINGRKLFKFETKNENDTVVLVGEAEVEQPVSAFVF
FT                   TGQGSQEQGMGMDLYEKSAVAKEVWDRADKHFKETYGFSILNIVKNNPNEFTVHFGGEK
FT                   GRKIRENYSNMIFETIVDGELKAEKIFKEIDETTTSYTFKSPTGLLSATQFTQPALTLM
FT                   EKAAFEDLKAKGVIPVEAAFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVP
FT                   RDSAGRSNYGMIAVNPGRVSPTFTQDALQFVVEKVGSRTEWLLEIVNYNVENQQYVAAG
FT                   DLRALDTLTNVLNFIKIQKIDIAKLQDEMSLEKVEEHLFEIVDEISKKSTAKPQPIELE
FT                   RGFACIPLRGISVPFHSSYLRNGVKPFKNFLNKNIMKDNVKVDRLIGKYIPNLTAKPFQ
FT                   ITKEYFEDVYKLTGSDRIKEILDNWEKYEA"
FT   CDS_pept        71400..72689
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433288"
FT                   /locus_tag="CAGL0D00550g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAG58348.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="HOGENOM:HBG247648"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI00003B60C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF7"
FT                   /transl_table=1
FT                   /translation="MRKCKVFVGNSHPELGNLVCQRLGIEPAPCTLKKFANGETSVQIG
FT                   VSVRDEDVYVIQSGSPNINDHIMELLILVSACRGGSAKKITAVIPQFPYSKQCKMKKHR
FT                   GAITARMLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLANWIRENVENYE
FT                   EAVVVSKNPGGTKRVTALADVLKINFAMIHTDRRRAKDLYSQHRDMKQLRQRKQSLLRK
FT                   NKPIIRQGDDPDEEENIILTNGIQTARIRNGHVIGDDEEDFIPESADEVAMESDAEDAS
FT                   VTDTYGLGGTYDAVDSEDEEEVSEAVKEKLITLVGNVNNRSAIILDDMIDRPGSLISAA
FT                   EHLVKNCGAKKVYVVATHGLFTGNCLEELEESEVIDKIVVTNTYPISNDRIEKSEKLVV
FT                   IDVSAIFAECIRRDHYGESISVLFDSLSTL"
FT   CDS_pept        complement(72970..76083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194594"
FT                   /locus_tag="CAGL0D00572g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58349.1"
FT                   /db_xref="HOGENOM:HBG059071"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI00003B60C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF6"
FT                   /transl_table=1
FT                   /translation="MLTAELIYTHQSSDIADYLPIYESQKLLVVKKNGDVEVFSRSADT
FT                   IKLYQTYPGLLKAKDNTGSCKELIYAHAIGTIFVRSDKSLQLLNSSNLHEYDKISERRG
FT                   ISRCWIVDDRTKSLDTNESELSKSDSTILVYTTHTPRVLRLFEWRKRSFQNVYEVPLNL
FT                   DKTEIICDVSTIKDDLVVTTNKATYLWNYKTAKPVMNKITKMVKKRTPDNIITALTELE
FT                   RQSLHFDDASDYSIDMQSSIFSGTSVSEKKSRSNIWSKFKGIQRANLQNDYLDKVLYSA
FT                   GKSGGITIMDMKNHSIVQLKTSESNEPFLLINKTSENFRWHNGVRDVHYLSSIDSLIQI
FT                   YDTYLLITDCEYGVPFLQIDVQEGIKDFKQINGQFLLIHTRNDCFKSFKLKLRDLEDDS
FT                   NSDEMSLTTSVKDHSSFEKLWKEVLIYTKLVESTSLPQFCNNNDEDEQTRLLVSRLRDV
FT                   TVLFNLQLLDKFFSIFNRINNNNNLTYMDPHLPEIIISEIFGSLSNFWAPPQLVISRSL
FT                   PKSIAKLVGALTGEYHDFSTLSKGDDTGIQYELIAPNLISYLIDVRRYIRRLVSQPNEL
FT                   LQYTSFTQTLLVDINFFLIDDHEDTSAKSLLSLIDTVLFKVYLNYKPALLAPFLRIPND
FT                   CNYEIVVNDLKIAGLTQELVDFYFQRGKHEFALNLITELIDDSTKSDGYQAKEQAITVL
FT                   VIQYLQKLSNDDLEVVFSYTDWLLRKFPKSKVQIITPIFMTETMNSRSYEYQRVYNFIK
FT                   RSDSTLSLQYLEYIIGVYDARQEFIEVELISRYVENLSNQDAKSKLASLIKLIKDDYPA
FT                   KCLETLQERLPGLPQSDKKFVMFLQTFFLFHLNRHVDSLNILFDQLHDLQKTISYCNSV
FT                   YEVNDQIGSECFLTLFEKILQSGDYSEMHLQSFLEDNFLKMDPLQLLQKIPTSIPLSKL
FT                   TFLLSQIMKMSTFHVEDSFIEKDLVKTNIIKTTSILNEEKSKYTTVSEAMLCSLCKRKL
FT                   VNNSNEKLTWYKDREHDKLMHLSCRRIFLEKQRTDKTKNAMKTLADLT"
FT   CDS_pept        complement(76764..77780)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500009"
FT                   /locus_tag="CAGL0D00594g"
FT                   /product="Similar to uniprot|Q07458 Saccharomyces
FT                   cerevisiae YDL076c"
FT                   /protein_id="CAG58350.1"
FT                   /db_xref="HOGENOM:HBG059069"
FT                   /db_xref="HOGENOM:HBG203086"
FT                   /db_xref="InterPro:IPR013951"
FT                   /db_xref="UniParc:UPI00003B60C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF5"
FT                   /transl_table=1
FT                   /translation="MTDDAYRATQSQIYSLQETLLDSNKSAKADVKDKDKDKDKDKDKD
FT                   KEKKKEKKVKSSKKRKTDEDRPSKRHSKKVEEVLQVVSNTVIPTEAPRYLGTLQYNYAK
FT                   EGVLNAVNVVDRKDRTTVPFPYDLERRVLPVPFLPEFPEESANSIITISIKYEDLMKSF
FT                   NDSGECPRTFNNEIWGCDVYTDDTDPILALRHCGFTCLDPPPLTPTHFKGKASHKPSTP
FT                   APLRRTPVNQTNKDNVVGEIPKDEHGLKPFDLDVDILLLPRLQQYFSVKRYGITSRHWG
FT                   KLTTPLKVDAYTVHLRMSMHVSLEENIYPIETMAHDGLSYGIHKIVIKPRTANAVEW"
FT   CDS_pept        join(78622..78678,79473..79757)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194595"
FT                   /gene_name="RPL31"
FT                   /locus_tag="CAGL0D00616g"
FT                   /product="60S ribosomal protein L31 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58351.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG269646"
FT                   /db_xref="HOGENOM:HBG505448"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="UniParc:UPI00003B60C6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWF4"
FT                   /transl_table=1
FT                   /translation="MAGLKDVVTREYTINMHKRLHGVSFKKRAPKAVKEIKKFAKLHMG
FT                   TEDVRLAPELNQEIWKRGVKGVAFRLRLRISRKRNEEENAKNPLFSYVEPVFVASAKGL
FT                   QTTVVEEDA"
FT   ncRNA           complement(80087..80292)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR63"
FT                   /db_xref="Rfam:RF01259"
FT   CDS_pept        complement(80947..83028)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000095255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194596"
FT                   /gene_name="BRE1"
FT                   /locus_tag="CAGL0D00638g"
FT                   /product="E3 ubiquitin-protein ligase BRE1 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58352.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG059068"
FT                   /db_xref="HOGENOM:HBG203087"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013956"
FT                   /db_xref="UniParc:UPI00003B60C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWF3"
FT                   /transl_table=1
FT                   /translation="MSSEEPPIKKQKLELSDPDEPLTQHDVISFQKEALFRCLNSKRVE
FT                   LEALTKQYSTVHDKWEQNVHTLATLMSVLSTAASHLRGLCNEESEKTLCDEMINAGESV
FT                   DKERTDEFLNLLRKYTNSNGSSDSKIDSLGLELQRANKTKSELRLQNKKLTDEIDSLKA
FT                   YYHGLVRSYDREDSMTVKRVFNKQKTDDNTDNISNTEQRPTSVSPVLTNGATHVKNEVK
FT                   TEQEALNNHTDSSQSSGITEEEKKKLFLQYENKITDLESHNSSLNRIIEELENYKQLNE
FT                   KELAQTRLEISNLLSEKHSNEEEREDLLHQIEKLKASNTDLTLTNESFLSKFQELAKEK
FT                   DTFQEKISSDFEKTLESLKAQNLALEKDLVRVRTTRDELISKVAILEAETSKSVLISDL
FT                   KQALDILRDQWEKIEFRNNQSPSSDALLKEIQDLESAFKELSSLTHKKYSEYLNHESVI
FT                   SKLTIEKTKADQKYFASMRSKDSILVENKNLSKSLNKANELILQLKDTDKLYKQKIESL
FT                   HKQLALSQNNEKRLVDSNKAANLKVMNLNSEIQKQKKLLDFTSSQKNELINELTEANGM
FT                   LKSKELEIEFKENELQTALKKNEKLEEFLSKENYNMNKPSSLATTNLDEDSMAEELENF
FT                   RTLVYCSLCSKNWKNMAIRTCGHVFCEDCCKERLAARMRKCPTCNKPFSSNDLLMVHL"
FT   CDS_pept        85554..88889
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500010"
FT                   /locus_tag="CAGL0D00660g"
FT                   /product="Similar to uniprot|Q07454 Saccharomyces
FT                   cerevisiae YDL073w"
FT                   /protein_id="CAG58353.1"
FT                   /db_xref="HOGENOM:HBG124443"
FT                   /db_xref="InterPro:IPR013887"
FT                   /db_xref="UniParc:UPI00003B60C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF2"
FT                   /transl_table=1
FT                   /translation="MTVKDEEEDTRSFNVFYEQEMMEQEEDEKHLFRDLNAFIGMISAE
FT                   EVEVERTHSRKNSSSSITDLKRKRSLSLKDLRKKVEPNAFQFLKRKNSSLSSLLRLHLL
FT                   NYLRSVQTMQHKHNFPLVKEIKKREILLQWWITLLNFLSSKLKFDFLLKTEWPEEVPDT
FT                   ELISIVLEAISRIITLLIVLPNHNKVDHEVYAQHLNLTIKFVSDILIVNSRIQKKYTAR
FT                   HSSSASSFASSNIEAETTFSSTAGSVKTQSNGNICENAAVLQNSVLSMIDNYNSFLTTF
FT                   IGKVNAYAFVYLPDECHFEYLILSTWYPRLRAIRRQNSLFPWKETRYQVSRSPMDSNTK
FT                   KYFSCRKNNEHQKICASYMKNKSIFLTFYWHYWYIVLRYSENISTNCFTKGNTHQLPGA
FT                   ELLLNFIVEISFKVDLRIFDKFVGGSPMRTSRKGKGNSTSSGLYGDDIDGAAIALAPSS
FT                   KRYLRNETVNDFIFTNFGTIKLWETIRSVAGCMKSSKNVESMLGLHDLAILKQVRKIPS
FT                   HDYTTANLVYNKIFQFIIFQFNSLPSIKFIHWEIWIQGLMKMLENLNTNSQTVALISFF
FT                   NMWPYLNVAKKQAIIEQIVLSEKYWTLMLEESQSTIIRILFIKFVVFRAIPSMDMDQRN
FT                   LLALRLHQIELQMNNLFGTLKKEGYTTDIPYSDPFAFALNNRFVIVNSRCYEEDYLTFE
FT                   FHQRPRKPKLIAVLNNDIYPMEKFPNIGSVSNVRPTYVLKKGRYPYDVFDELLEVVAKN
FT                   KSSKKWGIRNDIDDGLEDLMLENFDEFVTKCNANDQESSVVKALTNKVNMWFSGMSVNE
FT                   PIAESSKVDTKDIRPSTAPTKTSEIESQNIDQTSTRSSVKSSGGWSFGFSSRKNSSSSI
FT                   RKFSDTALNSKAVNLLKIGSTKQGNSHSAKNNKVFESLYGHLLLKQKVIFAPEFTFSQD
FT                   VLSNPSVVGIIKAIQLHPEKSLNDKLDIVNRKWGSISMKNVPSNAIQVEEIDKNDINVL
FT                   EIPLTSSSNSMLSEGQELDQSSSDTFGKDVKLPKLDYEKLELGTNIPDEDVLQGVTQES
FT                   NLEKDGLPSIMRMRQQTAFENLIKIIRIFNATKDEFLDYRDDHEKILIEFELYRNGYQS
FT                   LLAI"
FT   CDS_pept        complement(89194..90825)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433289"
FT                   /locus_tag="CAGL0D00682g"
FT                   /product="Similar to uniprot|P32432 Saccharomyces
FT                   cerevisiae YLR403w SFP1 zinc finger protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58354.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059064"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B60C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF1"
FT                   /transl_table=1
FT                   /translation="MDTMVADYMEDSNRITIDDHKYYPRIRRDSIAHLQGVGGVSWGSL
FT                   SIGSWLRDEVMLHTAFNKPSQGSRRESINLMHPISMSSGRRSSVLHPHHMKAGSPPVSY
FT                   NAILPNLEEQYCKDYSCCGISLPGLHDLLKHYEDAHIEPSHSTHKHKHGTLAPVNGTVG
FT                   SQLATSSTNNDLNTPQHMNIIRQQLNHDNLHEHQVYTDRQMRSNSNAALGQQYMGHVPH
FT                   STVSESPSPTSSQLTSTQTTPLVGKNTALSAVHTTPSFGQSGHRMRNNGNLIDSVPTND
FT                   VFMNIMNQNNDSKTVPPDFQNHTISFSNYNINFSENIAKPSNIMPKPLDNSQMNDPLEN
FT                   NTRPDILNTSQTKSGISQVFAASHAAPDQLSRSNTDENGNLNDGRNVNTSKETQTVPIG
FT                   MKNNSSGQPSATKKFQSAPKINANIKTDHPGIKNAGLLTSQSIDPARRVFYENDENKPF
FT                   KCPVLGCGKTYKNQNGLKYHRLHGHQNQTLIENPDGTYSVVDPESNEIYLENLQDIKDK
FT                   PYRCDTCGKRYKNLNGLKYHRGHSTH"
FT   CDS_pept        complement(92050..92625)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043503"
FT                   /locus_tag="CAGL0D00704g"
FT                   /product="Similar to uniprot|Q07451 Saccharomyces
FT                   cerevisiae YDL072c"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58355.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG489199"
FT                   /db_xref="HOGENOM:HBG717354"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI00003B60CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWF0"
FT                   /transl_table=1
FT                   /translation="MSLYYALVFGILVLEIAVFSVLSLPLPTRIRRPMMLVLLKPFRAP
FT                   TVQVGIKCILGFILILFIDCITKVYNINRELNAGSKGQSNTAGATGGTVFAQDRIEVVS
FT                   RKFLAQRNMYLTGITLFLTFVVVRTYALVSELFQLKDNYRAAEGEDTKGMTPEEAEKRR
FT                   KELLEEIDRKEKEINRLTEKATLLQKEM"
FT   CDS_pept        complement(93272..93895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433290"
FT                   /locus_tag="CAGL0D00726g"
FT                   /product="Similar to KLLA0B03212g Kluyveromyces lactis "
FT                   /protein_id="CAG58356.1"
FT                   /db_xref="HOGENOM:HBG124452"
FT                   /db_xref="UniParc:UPI00003B60CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE9"
FT                   /transl_table=1
FT                   /translation="MIQGSIKNKLTHVKSLGTVPIKHTIPSRHDSRNKEIVGRVVKQLE
FT                   FDKYNVQYSRESLKRCLYPSKDILVPIDADRKVEVRNKVLIGQGRHLLNLQWNIAMLRL
FT                   FKRTPDNLNGFDFNYSEKSSILAELRQRDITRLYVQYLRDHDLKGIARIEIPADRVSSR
FT                   LQKRQDLQAFLGIMGYISLLNSEPTLINFINRSIIIKIINPLIS"
FT   CDS_pept        complement(94612..94794)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043504"
FT                   /gene_name="COX9"
FT                   /locus_tag="CAGL0D00748g"
FT                   /product="Cytochrome c oxidase subunit 7A "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial respiratory chain "
FT                   /protein_id="CAG58357.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005746"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="HOGENOM:HBG053624"
FT                   /db_xref="HOGENOM:HBG736151"
FT                   /db_xref="InterPro:IPR014368"
FT                   /db_xref="UniParc:UPI00003B60CC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWE8"
FT                   /transl_table=1
FT                   /translation="MSALAPITGTLKKRIITDIVIGFSLGGVMASYWWWGFHKNVIDRR
FT                   EAFYADLAEKKKAEN"
FT   pro_peptide     complement(94615..94623)
FT                   /gene_name="COX9"
FT                   /locus_tag="CAGL0D00748g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWE8 "
FT   mat_peptide     complement(94624..94791)
FT                   /gene_name="COX9"
FT                   /locus_tag="CAGL0D00748g"
FT                   /product="Cytochrome c oxidase subunit 7A "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWE8 "
FT   CDS_pept        95715..96986
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043505"
FT                   /locus_tag="CAGL0D00770g"
FT                   /product="Isocitrate dehydrogenase "
FT                   /EC_number="1.1.1.42"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="isocitrate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG58358.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006102"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG020077"
FT                   /db_xref="HOGENOM:HBG596047"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI00003B60CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE7"
FT                   /transl_table=1
FT                   /translation="MLGRRCFASSAKLAKIKVKTPVVELDGDEMTRIIWDKIKKQLILP
FT                   FLDVDLKYYDLSIQSRDKTKDQITHDSAEAIKKYGVGVKCATITPDEARVKEFNLTKMW
FT                   KSPNGTIRNILGGTVFREPIVIPRVPRLVPGWEKPIIIGRHAHGDQYKATDAVIPGQGK
FT                   LELVYKPNGDASKAEVMEVYDYKGPGVALAMYNTDESIRGFAHSSFKLALQKKLNLFLS
FT                   TKNTILKKYDGRFKDIFQEVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGFIMAL
FT                   KNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTN
FT                   SIASIFAWTRGLAKRGELDGTPDVVRFANILESATLNTVQQDGIMTKDLALACGKTDRA
FT                   SYVTTTEFLDAVEKRLQTEIKSID"
FT   CDS_pept        complement(97236..98213)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500011"
FT                   /locus_tag="CAGL0D00792g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAG58359.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="HOGENOM:HBG203092"
FT                   /db_xref="HOGENOM:HBG389562"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="UniParc:UPI00003B60CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE6"
FT                   /transl_table=1
FT                   /translation="MTEDFDYDDLDDLLDEDPSKLEDVQAETTQSRGTTEADGLKKPAD
FT                   PVMDKDDPAVKEMIEDLQQEFQNLMKQNGDGANVNIEDKEAAENFKKLLDILEEVGQVP
FT                   KETTTQQLESLNTQTTSKGEKAGKGGFKDVISSTLDRLKENANKVDTQLEEEKKQSING
FT                   SGNPDEVLSKLLNDLVSDSGDVPADGEMDNAILGILNKMSSKEVLYQPMKDMQIEFSKW
FT                   LEDNKDHPSHKDNMDTYKRQFELVNKLIVIYEKPDYDNDKDRDEVTELLDQLEQLGDSP
FT                   VSKNFNGGNPANDFDEMSKMLNIDANDPKLADLDKDLADTCKQQ"
FT   CDS_pept        98589..99062
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433291"
FT                   /locus_tag="CAGL0D00814g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG58360.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B60CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE5"
FT                   /transl_table=1
FT                   /translation="MSSLCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGI
FT                   PGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWR
FT                   PAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKVLIQAKQYTK"
FT   CDS_pept        complement(99696..101555)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194597"
FT                   /locus_tag="CAGL0D00836g"
FT                   /product="Similar to uniprot|Q07395 Saccharomyces
FT                   cerevisiae YDL063c"
FT                   /function="binding"
FT                   /protein_id="CAG58361.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059058"
FT                   /db_xref="HOGENOM:HBG203093"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B60D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE4"
FT                   /transl_table=1
FT                   /translation="MGRSKKRSRTSASRLNPLANPNNGGISKKDANLIERKLQPLIKNL
FT                   NSVVPNERSMALSSATVLCEDAHMRKLLLKEKLIPTVTTKLLSDENTEIVVEAYGLLRN
FT                   LCLEEGYDVAVHLWRSDIWTSILSGFEKLSDSLRALAAQDASEDTKKTTPQSKESRRLL
FT                   FDFAENLLSLVIALCNGADSILEEVLTTQKLAELFTVLVNLLEYGIEKLPISVFNTILD
FT                   LIYDFSSESFEFIETVSSDPTLSEFVKVLPTLKKEDHKSFNELTYVLIQGIYLQFLDMD
FT                   MTYEQANEIIHTTCNAINGIDLVELEKNLSSITQDEDIANTVDSEVAAKIKEYTKKRAL
FT                   AHMQLQSIEITIDLITAIIEIIAAKFEQEHKRKLPESLSETLVSFVPLVFNKLASSFPA
FT                   RVLIGWNNLLWLYMSIDVNFYELPNNQHTLLWNFIKKEEGSDSKDISLKVSLMSVVWAM
FT                   LKAATLQSEPLAVINQLGLNNSMAFVETIINEYKTCNEIELQQKCIGVLSSLALVQNQV
FT                   EINRFIGHFFMEILTSKESDPLLLVEVTNFIFEIYSDSAYDYDTEVFVKDSFLQTLKEK
FT                   VVPNLKERFKFVDRNKSPELKERATETFNILGSFINYKESEAH"
FT   CDS_pept        complement(102048..102218)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433292"
FT                   /gene_name="RPS29"
FT                   /locus_tag="CAGL0D00858g"
FT                   /product="40S ribosomal protein S29 "
FT                   /function="metal ion binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58362.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG312140"
FT                   /db_xref="HOGENOM:HBG589144"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI00003B60D1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWE3"
FT                   /transl_table=1
FT                   /translation="MAHENVWFSHPRRFGKGSRQCRVCSSHTGLIRKYDLNICRQCFRE
FT                   RASDIGFNKYR"
FT   CDS_pept        103843..106263
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043506"
FT                   /locus_tag="CAGL0D00880g"
FT                   /product="Similar to uniprot|Q07381 Saccharomyces
FT                   cerevisiae YDL060w"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58363.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG270821"
FT                   /db_xref="HOGENOM:HBG330634"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI00003B60D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE2"
FT                   /transl_table=1
FT                   /translation="MAGHSHRSSVKNGHKAFKSRHSSKNALKRANKGKVERESIGTGRP
FT                   IKNASKLQRRNKAKQLRAQKILDTLQIRKLFEGSNGAEKIITVIPLTEDVDAHDIITKI
FT                   LSSADLDEQTLSQFVPQGMPNSAFVKDIHIKKFKSNLKFIVPDMSNFLNILDASKVADF
FT                   TIFGLSGTSEVDSEFGEQVIRALELQGIASYIGVVSNLSQVHPKEKFQLDVKQSLESYF
FT                   KHFFPNEDKIYNLEKPSDSLIALRTLCQKFPRGVTWRDNRGYMVANNIDFIDSETQPDV
FT                   GDLVISGTVRGCGFNSDRLIHIPGLGDFQVNKIERIAASTRKTKKDADELDEISSLLEN
FT                   SFAATSEQDTLDEYAPVDMEFEDMSDEDEFEYSNLKAARYDDHGFLPGREQQSKKYKIP
FT                   KGTSEYQAKWYLEDVVEVDDDEELEPDHEETAMDDMDMDEAVDEYAHEGFNDEMEDDFT
FT                   DAKTTTEDLFVELSPEEEERQLREYRALEKEDREFPDEIELEPTQSAIEALKYYRGLKN
FT                   LYNCVWDVEERDPRTPQEWNRLLRIGNYKNTKNRLQKEAVKTAQVVAGDRIKLHINFPK
FT                   NLLSKVNDPSIISFPVYGLLRHEHKNAMVNFSIQRWEEYEDPVPSKETLLVQYGARRYA
FT                   IQPLFSGDANSSNNVHKYDRFLHPETASVATCIAPVDFTQSPAIFFKPSSTDRKGIELV
FT                   GQGTFMNADHTRVLAKRAILTGHPFRFHKKVVTVRYMFFRPEDVEWFKSIPLFTKTGRS
FT                   GFIKESLGTHGYFKATFDGKLSAQDVVAMSLYKRMWPRPSIPWNGESIEEIQD"
FT   CDS_pept        complement(106570..107208)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433293"
FT                   /gene_name="RAD59"
FT                   /locus_tag="CAGL0D00902g"
FT                   /product="DNA repair protein RAD59 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58364.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG059055"
FT                   /db_xref="HOGENOM:HBG203094"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="InterPro:IPR016810"
FT                   /db_xref="UniParc:UPI00003B60D3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWE1"
FT                   /transl_table=1
FT                   /translation="MDGKVTYEGAVYSSGPGVEVGDIVFVEDWDGRPASEWSVQRIGVL
FT                   QSKIERYTYQIYHSNRYGKHNLSKLIPRHVLVGFANEVFGFDGWKTDIEFVETKDGFPG
FT                   STSSISIADKISADSGGGTGALADRYTVIAEASVKVTLKDGTNTRMTGFSRATTPSKIE
FT                   SFNKAKKEAVNDALKKALLSFEKIILEHELKTKNDFYVDGLYGSKAQKI"
FT   CDS_pept        108341..114283
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433294"
FT                   /locus_tag="CAGL0D00924g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle fusion with Golgi apparatus "
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="CAG58365.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0048280"
FT                   /db_xref="HOGENOM:HBG059054"
FT                   /db_xref="HOGENOM:HBG203095"
FT                   /db_xref="InterPro:IPR006953"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B60D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWE0"
FT                   /transl_table=1
FT                   /translation="MDIIQGLIQPPKVQSADETIPTLCDRVENSTLLSDRRSAVLALKS
FT                   FSRQYRETVIASGLKPLLNTMSRDNIDDDLVKAVLETLLILFIRGDGDDDLTRNWISLH
FT                   SRARNGKYPSPLVMKQEEEQVDQFSLWIADALTQSEDLLKLIIELLESENFHIKLYTIQ
FT                   LLEAVLVARPSRARNAMINSPTCISTLVALLDDIHEPIRDESILLLMAVVNDSPHIQKL
FT                   VAFENIFERLFNIIQEEGGLRGSLVVNDCLSLINNILKYNISNQTLFLETGNLPKLALL
FT                   LNEPISEKEEFFWNDQRINNVKTVLDIVSLTVEAGTTVVKQHQAALLDSHILLVVLRIA
FT                   FFHTIPKKVRATALMVAADMIKDNEYAQTEFGNIDVPYFDPSLASDTQFDNSHLVPVVE
FT                   LLINWALYANSIHTFDTRVAASNLLKAYLSNNLGLQKQFLERQISAFKEIEKGSKVDGL
FT                   KANLLEAILIYDADLKLNPYKLYFSTDILMYLFEHDNEGNAELRELLRSIKLGTAIEDE
FT                   EPLTSIQTITEIVITFLSCEDKRVPIFYLSFLAYWLFADFSAVNDFLSAKENIHSLLDF
FT                   SHQIEDEDVTVKCLITILLGIAFEFSSKSSPIPRLEYFDIVSNSIGRDNYTSRVKQFKE
FT                   KSLFSKSQIEIDMFNPPLDDTGLPKIYFNEYFTILFKENFYRILRCFYHDPTDEPIAIV
FT                   SFEAFEEVQNQCTSLKSHLSELEIQSSEKRSQLEKQIKSLTSNFEASEQLKKELEDKLS
FT                   TISEKQQTLESEYEEKKKELAEITANNTSLEQLNTQKEKLTEELKKQLADTKEKLTQME
FT                   KQVKELSEHKEKNEQGINKMNRDLFSLQREKQKLEEDNKQSKKDLEKTKNDFTKQETKL
FT                   KDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQAKYKSHDTFVAKLTEK
FT                   LKALATSFKELQAERDTIKSELEKITQERDTNIAAITSEKKSLEELYKNMESEKDGLLK
FT                   KITELETGIESDNKKFEDEKSALESETKRLTLEIAEFKSNAEKLDTERERLQTLTESYK
FT                   EKLNEANSSIDEKNKDLNNIQQQIEGSQSEISTLKAEITQLKTSLNEEKSTRKALEKLK
FT                   EENETYIQSAQDELLQLQKEVDLLKSENKDALDNNSSLKQKYDELVKELELKNLESKQL
FT                   SDNSLNLNSKIEQLEGDIKSKYNTIKELEEKLSTSLQEREENIANIADIELKLNSKEEQ
FT                   YTEQTNKLEELRISFEKKQSECKELESKLKSSNDDLQEKNRLTKELQKNLDSLMKDKEK
FT                   TEGSLQSLLEDKKQEEKKYKEEIDQLGKENEDITKQNKELNLRLEDYSAKIDAKDEELK
FT                   LANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENSLKSELEKTALEMNELRSDNDNII
FT                   KLKNELQRTNDKLIEENKRTEEKLRSEVAKLKDELKTKSDTFEKERKLMNEDSSTIIKE
FT                   YSEKISSLEEKVETIKSEYDKEINILEDKKEVLESELSDKKQEIIDYNQKIKEQETKAT
FT                   EKEKEIQVAKNALKNAEKKKKDIENDLRTTIATVEKENTTLKRENQLKSESIDKHQNNI
FT                   HLLQEELSKQKELADKKHDEIRKLEKENSKMIDRIDKLEKQKADTNEKIANIEKENSSL
FT                   ISERKTLVEKVENFQDEITNLKSSLEKNDSLSSSHDELKDKFNELETELKRNLTELNKL
FT                   ESENKQLSDKVIEHEEKVSMVEKELSTAQKTLKEREDVINKLKDSNNELNKTIDKHGAT
FT                   EKHYEESITKKDSDIAQLKKKIKDIEDKLSNILEEKAKAAMLMTQLEKDKTDLKNSESE
FT                   LKQELEHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEISIS
FT                   EMDAIKKQVELLTKENVDLKSKSNKADNSAKLKSELDELKKENEKLQLKVNDRSELDDL
FT                   MLLVTELDEKNSKYREKLSELGVELSSDEEDDDDDDDDDDDDDDDEH"
FT   CDS_pept        complement(114552..115802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433295"
FT                   /locus_tag="CAGL0D00946g"
FT                   /product="Similar to uniprot|Q6B265 Saccharomyces
FT                   cerevisiae YLR380w CSR1"
FT                   /protein_id="CAG58366.1"
FT                   /db_xref="HOGENOM:HBG324518"
FT                   /db_xref="HOGENOM:HBG540797"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI00003B60D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWD9"
FT                   /transl_table=1
FT                   /translation="MTEDNYAFRVKTLNEEQLQFLKIVWLHLLKFWGIKVDERPLLNDS
FT                   GCSGRKRATSLAAHELKTNRPRSRSTIFKIHSSVEENEGEGISDFELHEALKNSNPDDT
FT                   REEFWNMIRADFPDSLLLRFIRARKWDLNKSMTMISNTLDWRVNDSKVDKIIYEGERAA
FT                   YDGTMPGFYKNLELQKAVICGKDKEGRPIVCVRPKLHHSKDQSLEEMQRYSLLIIEQAR
FT                   LFLKDPVDTATVIFDLSGFSMSNMDYAPVQFLISCFEAHYPECLGKLYIHKAPWIFSPI
FT                   WKIIRKWLDPVVASKIVFTKSSNDLKEFIACDQLPEYLEGSNPINLDTYQEIAADHDNQ
FT                   MEDVDTKNRLLSERELIIKQFVDTTIKWIESSNATESQNLLYSRIALGRQLTANYCELD
FT                   PYIRSRSRYDIDGSLVV"
FT   CDS_pept        117147..118073
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433296"
FT                   /locus_tag="CAGL0D00990g"
FT                   /product="Similar to uniprot|Q07379 Saccharomyces
FT                   cerevisiae YDL057w"
FT                   /protein_id="CAG58368.1"
FT                   /db_xref="HOGENOM:HBG124454"
FT                   /db_xref="HOGENOM:HBG203096"
FT                   /db_xref="UniParc:UPI00003B60D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWD7"
FT                   /transl_table=1
FT                   /translation="MIEVIDFEPDHIECQEHERFIYLYDSTYHHSRGIACIVASPKRHR
FT                   AKNKLIVLVHGSLSHKNAIYQPLLAHCLAELGYHSLRLDFRGLGDSEDVRDPKLGRTIE
FT                   EDIHDIKTVYKATQEAQICANLFETESITFHAIVGHSRGVLAMFDFALSIAPSIIPILV
FT                   NCSGRFDGQGLLKRCSENNPNWIEKGGFYATTLRQGKLQKIWIPKEESFSVIRTNTLNY
FT                   RNLSHDTTVISIYGTNDEVVPPMEASLDYSSVFKDHHQLIYIDGAGHNFYGKLGEQNTR
FT                   GLPLRRGMINYNHELVEYLQDIFTKSV"
FT   CDS_pept        118878..121286
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433297"
FT                   /locus_tag="CAGL0D01012g"
FT                   /product="Similar to uniprot|P39678 Saccharomyces
FT                   cerevisiae YDL056w MBP1 transcription factor "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG58369.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG175896"
FT                   /db_xref="HOGENOM:HBG203097"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B60D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWD6"
FT                   /transl_table=1
FT                   /translation="MSNQIYSAKYSGVDVYEFIHPTGSIMKRKNDGWVNATHILKAANF
FT                   AKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIAINLAEKFDVYQDLKPLFDFSE
FT                   ENGDAAPPPAPKHHHASKASSAKAKKAGRSVSSPAMNDSKTRASTRKANTPSSNDITSD
FT                   SGAVVNPVVTRRRGRPPNSTLTNKRKLGTGLQRSQSEMAFLKPEIPNDLNSNDIANIQQ
FT                   VNSGDLLRNEKIQKNIQLKEIDLDDGLSSDVEVQETDTFQPNHQSSLLGAEGHELRNND
FT                   SPLSPSSSSSLPTSPANLNDSNPFDQRLGGGGTSPIISLIPRYSVQSRPQVTDINEKVN
FT                   DYLTKLVDYFISNEMKSNKTVPQELLHPPTQSAPFIDAPIDPELHTAFHWACSMGNLPI
FT                   VEALYETGTNIRAANANGQTPLMRSAMFHNSYTRRSFPRIFELLSETVFDIDSMGQTVL
FT                   HHIVKRKSSTPSAIYYVNVLLSKIKDISPKYRIELLLNTKDANGDTALHIAARNNDREF
FT                   FDILIKNGSLSTISNNDGQTPTEIMNQHYQDLHLQAQTNIAGSNTSAYTDSFSSFGGKV
FT                   KGSKLHSISELDDDKNTQNPENTVTNIVSNLHFSSNAAINLVKNIPAFTDSMKHLAEKF
FT                   DGSYKNHEESCRSTEKMLGSIKRTVHSTDNRIREILETDADADISSAILAQEKDITELK
FT                   IEAENHLRKLKNQFEYLQKQRLLKLTEYHNGEHNDTDNTLDNKIEICKQISVLQIERKR
FT                   KISELISHYEDSRKIHKYRRMISEGTEMKTEEVDGCLDIILQTLINNSS"
FT   CDS_pept        complement(121908..122993)
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000283479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433298"
FT                   /gene_name="MPG1"
FT                   /gene_synonym="VIG9"
FT                   /locus_tag="CAGL0D01034g"
FT                   /product="Mannose-1-phosphate guanyltransferase 1 "
FT                   /EC_number="2.7.7.13"
FT                   /function="GTP binding"
FT                   /function="mannose-1-phosphate guanylyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58370.1"
FT                   /db_xref="EMBL:BAA77382.1"
FT                   /db_xref="GO:0004475"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG495575"
FT                   /db_xref="HOGENOM:HBG688195"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI00003B60D9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y725"
FT                   /transl_table=1
FT                   /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAG
FT                   VTDIVLAVNYRPEVMVETLQKYEKEYGVSITFSVETEPLGTAGPLKLAEKVLKKDNSPF
FT                   FVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEK
FT                   PKEFVGNRINAGLYILNPEVIDLIEMKPTSIETETFPILVEQKSLYSFDLEGFWMDVGQ
FT                   PKDFLSGTVLYLNSVSKKNPEKLTKGDNIVGNVMVDPSAKIAASAKVGPDVVIGPNVTI
FT                   GEGVRITRSVVLSDSSIQDHSLVKSTIVGWKSTVGKWCRLEGVTVLGDDVVVKDEVYVN
FT                   GGKVLPHKSISANVPSEAIIM"
FT   CDS_pept        complement(123851..125320)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246467" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347852"
FT                   /gene_name="MCH1"
FT                   /locus_tag="CAGL0D01056g"
FT                   /product="Probable transporter MCH1 "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG58371.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059647"
FT                   /db_xref="HOGENOM:HBG396884"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B60DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWD4"
FT                   /transl_table=1
FT                   /translation="MALSSIEHYLSYHLRVLLPQVLSSKSSHNIAYIFALFAAITSGFV
FT                   SLISLYAQPWQEHLSYSSWQINMIVTVINMGMYLTPPILGIIADIHGPITLSLSSVLGF
FT                   IPSYAYLAYTFHRDHSFTNESDGSFTPTLVCFFIIGVATSGLYFSALITCAKLFPGTKL
FT                   LSISIPTTCYGLSSLIGSQFLRVKYFHPVDYPYLDLGRVFKAFAWIYTVIGVMIWIATS
FT                   KVAQIQHEADIMEEQDRMAEPSDNDVENHYDDNEQSRLLHATHAQQMTLMKVFRDPVLY
FT                   IFGATIFCALGPLEMFIANMGSLTNVLAGGHEPAMSSALLSIYALTSTLTRLGTGLTVD
FT                   YFNKRQLSVKWILLLFLVVGLVTQGKIYMLSMSSLDHSHMVTINRKLFYIGIMQGIAYG
FT                   GLFTIYPTITLMVWGEKMFGTAYGTLMIAPALGSALSCLIYADVYDSECANSTTRSCIA
FT                   PVYETTALEFCAAILLTVVVTVLWRKRRTHI"
FT   CDS_pept        complement(125834..128554)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433299"
FT                   /gene_name="SEC242"
FT                   /locus_tag="CAGL0D01078g"
FT                   /product="Protein transport protein SEC24-2 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG58372.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG353109"
FT                   /db_xref="HOGENOM:HBG746961"
FT                   /db_xref="HSSP:1PD1"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI00003B60DB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWD3"
FT                   /transl_table=1
FT                   /translation="MSHHKKRVYPQAQFQYGAGVPPAGIPVSDASIIPPQVQSPQVGAT
FT                   DNMIPPYNQTPTMNQMEQAPQAQMFTPAQQQLNQQINSVTTNMGAMNIGTPMMEQMPQQ
FT                   MTPQPQMYGQSQGLMGHSNKPMNQLYPVDLLTELPPPIHDLMLPPPPLMVSPDKMLVPS
FT                   ETANASSDYLRCTLNAMPKNGSLLKKSKLPLALVIRPYQHLHDEVNPPPLNEDGLVVRC
FT                   RRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPMQLDQSFEGAPANRYERNEIKHSVMEY
FT                   LAPKEYTVRQPPPSTYIFVLDVSQNAVKNGLLATTARSILDTLEFLPNHDNRTRVSILA
FT                   VDNSLHYFSIPLDEESDQIRMMDISDIDEPFLPKPHSMIVPLNECRNNLEKLLTQLPEI
FT                   FQFNIMSKFALGPALKAAQNMISNLGGKIVVVSATLPNIGIGKLQRRNESGVANTPKES
FT                   TQLLSCQDAFYKNFTITCSKSQVSVDLFLASEDYMDVASLSNLGRFTGGQTHFYPGFTA
FT                   ANIADVTKFTKEFSKFLSMDLSTETVMRARGSTGIRMSAFYGHFFNRSSDLCAFSTMPR
FT                   DQSYVFEMSIDENIGTEYCYVQIAVLLSLNTSQRRIRIITVAIPTTESLSEVYASADQL
FT                   AIADFFTKKAVEKAMNSSLQDARDLLNKSLQDILATYKKEIVVSNTAGGAPLRFCANLR
FT                   MLPLLVHALSKHTAFRAGIVPSDHRAAALNNLESMPLKYLVKSAYARVYSLHDMVDEAG
FT                   YPDENGEIVLPEPINASASLFERYGLYLIDNSSELFLWVGGDAVPELVNDVFGLQDIFQ
FT                   IPNGKHELAIVEGSEFNERVRNIIQKVREHDDVITYQTLYIVRGPSVSEPVGHAAGREL
FT                   QPLRMWATSNLVEDKVLGTESYREFLQTLKNKLNK"
FT   CDS_pept        complement(129293..131713)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433300"
FT                   /locus_tag="CAGL0D01100g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="CAG58373.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="HOGENOM:HBG058567"
FT                   /db_xref="HOGENOM:HBG395770"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI00003B60DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWD2"
FT                   /transl_table=1
FT                   /translation="MEKMESLSPTNSGSGAGISPGSSREGSQGALSNVVKKSSHSNSAI
FT                   SFQRKVEVFGSDCDEEEDRMIPDTEDEAIASPRKNYLKSKYVGIGQDDDDDEEDEDDEE
FT                   SRDQLGAHILSSLPSFKRRPLSDTPVASMWNSPSGSAEATPSSSRESSTLSLVQLNQAL
FT                   QNSKINANLNKTVPSEGFTMGPTDIISPKSPSPNEASPGLVKSPSQFYHPKRRPTTIDV
FT                   PGLTKSKTSPDGLISKEDPGSKLVIVMVGLPATGKSFITNKLSRYLNYSMYYCQVFNVG
FT                   NTRRKYAKQMGLSEQDSSFFDPTNTEYTALRDKWALDTLEELMDYLLDGPGSVGIFDAT
FT                   NTSKARRKQVLERIRNRSPHLKVLFLESICTNKAVVESNIRLKLFGPDYKGKDPKKSLL
FT                   DFKERLSNYIKAYEPIEDEEDIQYIKMIDVGKKVIANKIQGFLASQTVYYLLNFNLKER
FT                   QIWITRNGESEDNVLGKLGGDSHITSRGDKYAKALSRFIDEQRAQFLVNEIEKNKAGQE
FT                   QLKKLESGNIHDVDLDKDKLPSVADLNQPDQLYNEFFVWTSMLKRSIETAKYFNEDEYP
FT                   IKQMRMLDEISAGDYEGMTFPEIQAKFPSEFAERQRDKLRYRYPGIGGESYLDVINRLR
FT                   PVITEVERIQDNVLIITHRVVARALLGYFMNLSVDIISNLDVPLHCVYCLETKPYGITW
FT                   SLWEYDEDKDTFFKVPEYNLNTKRVKEAGLVNNERRYSVIPTAPPSKNKSPSNTNENKS
FT                   TKQGTAKVSSLGNNGATLLPPKLTRLEGGGTSVSIGQRRQVSNSKGSALLQKE"
FT   CDS_pept        131947..133464
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433301"
FT                   /gene_name="ALG11"
FT                   /locus_tag="CAGL0D01122g"
FT                   /product="Alpha-1,2-mannosyltransferase ALG11 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58374.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG058569"
FT                   /db_xref="HOGENOM:HBG525304"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI00003B60DD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWD1"
FT                   /transl_table=1
FT                   /translation="MSTMLWVVVAAVLLFVLPVVRVPMLDLTRRNIIRWQRGGIQKYTT
FT                   RYYGFFHPYCNAGGGGEKVLWKAVQETLLYDPNCSIVIYTGDVDSSPKEIIANVIKRFD
FT                   YEMDFNRVQFVFLKYRKWVDGSTWKHLTLVGQAMGSMLLTIEALLRFVPDIWLDTMGYP
FT                   FGYPVVRWLAGLPVMTYTHYPVISSDMIHKIEIENQKQPSKKGTLKLIYWKLFMKWYQY
FT                   VGKFVDVAITNSTWTGNHIRSIWKRVKIKVMYPPCSTEKLVKNSSPTAYETRQNQAVLI
FT                   AQFRPEKRHKLVIQAYSDFISRTASKDHFKLVLIGSTRSEEDRAYVETLKSWAFDTLKI
FT                   PKESLTFKTDCSYDDIKKFLAESTFGINAMWNEHFGIAVVEYAAAGLISLVHASAGPLL
FT                   DIIVPWDSAKKQQLPYSDSTKDTRTGLFFKDKSDPDYKPTDAQFNNYGSLADIFEEANS
FT                   LSIAERKQISERAKECASNKFSDNTFNHAWDHALDELEHKTSRLGSN"
FT   CDS_pept        133799..134281
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433302"
FT                   /locus_tag="CAGL0D01144g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58375.1"
FT                   /db_xref="HOGENOM:HBG058633"
FT                   /db_xref="HOGENOM:HBG396367"
FT                   /db_xref="UniParc:UPI00003B60DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWD0"
FT                   /transl_table=1
FT                   /translation="MSTPPAVREAAKQVVKCLERFPADRFKHLTSFKDIQISRFNRIAG
FT                   VSLKGEDAANEKKPSLSEVKDMISRTSGPLGLQKDFLKKLQGALQQDMVSEEGLTKQKR
FT                   SLEVLMSDKYKNYYEVGDKLYKPNGNPEYYQRLMDELTGKKKENLFTGLRTVFFGK"
FT   CDS_pept        complement(134536..135441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433303"
FT                   /locus_tag="CAGL0D01166g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58376.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058640"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B60DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC9"
FT                   /transl_table=1
FT                   /translation="MKQENIKTLYLQNLPRRPVNKESFIRNLLKCINRNNIYVLNPSKP
FT                   IPASIDFNEYNELKESQDKNLYLDESLGLISISLSRSLRLRNQGFLTFESHELAQSFMD
FT                   RYQNNKLKVSGRIINISFAKKESFLGLYLDNERVLQKALRTKYRKEDLENNQHKLETLK
FT                   LRRKQRRLRSKLRSKGVDDEQIKAAVTGLTQKVTATINEKKPVPLALKQETRPPKQDNE
FT                   KLVEPNSILLLTDLPSGCTSDQIKVNIPTKELKEIRLVSVRNVAFVEYEDIEAATVALK
FT                   EMVPKLTKLGNNIKVTYAKK"
FT   CDS_pept        complement(136033..137409)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433304"
FT                   /locus_tag="CAGL0D01188g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58377.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI00003B60E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI3"
FT                   /transl_table=1
FT                   /translation="MGKDKQHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   AAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMIT
FT                   GTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDES
FT                   RFAEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNASWYKGWEKETKAGVVK
FT                   GKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPA
FT                   GVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKAAASFNA
FT                   TVIVLNHPGQISAGYSPVLDCHTAHIACKFEELLEKNDRRSGKKLEDSPKFLKSGDAAL
FT                   VKFVPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVDKTDKAGKVTKAAQKAAKK
FT                   "
FT   CDS_pept        137954..138646
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433305"
FT                   /locus_tag="CAGL0D01210g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="racemase and epimerase activity, acting on amino
FT                   acids and derivatives"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG58378.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016855"
FT                   /db_xref="HOGENOM:HBG255754"
FT                   /db_xref="HOGENOM:HBG617053"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniParc:UPI00003B60E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC7"
FT                   /transl_table=1
FT                   /translation="MKVGIIGGIGPEATTHYYISIIKQFQDAVGSDKVLPEMVVESINM
FT                   YHMFEMLEQRQYDDVAEYLAHAACNLQKAGADFGVMCGNTPHIVFEKIQGKTDLPLLSM
FT                   VQCSLDVASAMGLKRLALLGTKFTMQNDFFKRPFEMAGISIYTPSPVEQETIHQKIVGE
FT                   LENGIVTPDTKSTLLTIINGMIKEHGLDGVILGCTELPLILNQRDFSIEVLDIAKEHIN
FT                   AIVKKLSC"
FT   CDS_pept        complement(138971..139960)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433306"
FT                   /locus_tag="CAGL0D01232g"
FT                   /product="Similar to uniprot|Q06815 Saccharomyces
FT                   cerevisiae YPR079w"
FT                   /function="transporter activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58379.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124455"
FT                   /db_xref="HOGENOM:HBG203975"
FT                   /db_xref="InterPro:IPR000479"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniParc:UPI00003B60E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC6"
FT                   /transl_table=1
FT                   /translation="MLLSCLLLLLSCLPIKAAKAEDNEKPFCAVMNPLTGTYIDLSQLS
FT                   TSPNEEFQMTQRRNNKKTKSNKTRWLVKDWEGKTNFTLSVCSSPVVSKEEKDQLSNTTG
FT                   AFYVVNDTEHGYTMKYVSIGDFSSEPRLTGIYDTRVLTLKYENGSMCPNGKDRKATLLN
FT                   FICDKTVSSKAQISYVGNLHECSYFFEIRSVYACPTSNKTNEVNVYGIFISIIVIFFMV
FT                   EYACRKWLFKDGSVKSVRLHDNYSSSTTSFARDDMRWEMNRHNRSLWKTIPMKVFGGTF
FT                   RFVGSVVGGLLTKNNSRAQYSAVSTNQQSPFYRDMEEQNDILDSLDTN"
FT   CDS_pept        140355..141038
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433307"
FT                   /locus_tag="CAGL0D01254g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58380.1"
FT                   /db_xref="HOGENOM:HBG124456"
FT                   /db_xref="UniParc:UPI00003B60E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC5"
FT                   /transl_table=1
FT                   /translation="MHQDSSTEERMFQFDEEMGDGLDAQLDLLFQQTARVEKIIEFNER
FT                   DLAQQELDCTIPALDTKVKWYRKYVRIMLDKWLLIKVRCYSQGQKQEQKQKQEQEQEQE
FT                   QEQGQHKSTQCTVTKTLSSLVLDVQGPMSNRHEFEAGSYSYEHAHPSSTDADAESIVTD
FT                   ESELQHTRATTSNYRALGQCQGQSQGQSQGPPNILHDRDKEAPRGRTRHRSRYTPVRHA
FT                   SCGNR"
FT   CDS_pept        142000..142191
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17610969"
FT                   /gene_name="MT-I"
FT                   /locus_tag="CAGL0D01265g"
FT                   /product="Metallothionein-1"
FT                   /function="metal ion binding"
FT                   /protein_id="CAR58010.1"
FT                   /db_xref="EMBL:AAA35272.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="UniParc:UPI00001688A7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15113"
FT                   /transl_table=1
FT                   /translation="MANDCKCPNGCSCPNCANGGCQCGDKCECKKQSCHGCGEQCKCGS
FT                   HGSSCHGSCGCGDKCECK"
FT   CDS_pept        142618..143949
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433308"
FT                   /locus_tag="CAGL0D01276g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58381.1"
FT                   /db_xref="HOGENOM:HBG124457"
FT                   /db_xref="InterPro:IPR018571"
FT                   /db_xref="UniParc:UPI00003B60E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC4"
FT                   /transl_table=1
FT                   /translation="MSSVSQSVSIPQPSQTYSRGADGCVVCPTSVACPTCAEDENCVLT
FT                   ALTCDTCPYTYCAKKSSLAIGSLSGVDANGNALNATNSSGSSTNSHKGRVNIPGIVSGS
FT                   VVGFLVLVLVLVIVYFWKRRKRFAREGKLRAYKLSRGRRGPNRVGGKNSGDGEDGEDGA
FT                   GGDGIKWDSDIENELDDDDLDLDIDDDDDDEDDDDDEDDEDDIDDGAGPRHLYAAQPHM
FT                   RQRLKDIVEEGDDMNVSGPVGLDALRNGQTVEQFRLRPMRPLKAASDAQSIYSNNTVHT
FT                   KASSNVLPIAYIPGVTINQMQPHVKPGYRPHSRAVRGRLNHDDVRSHITLGSSILGSED
FT                   NFDLEFDHSVTPVPVKPEMEKAEKPATNLTTAIRAKPRLITIDGKDPQDASEGMPEETQ
FT                   DVQVPEQHDDVHSSGSSTESFTIDLDISLPEDESPFGDQHQIVN"
FT   CDS_pept        145031..147070
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433309"
FT                   /locus_tag="CAGL0D01298g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="transketolase activity"
FT                   /protein_id="CAG58382.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="HOGENOM:HBG001305"
FT                   /db_xref="HOGENOM:HBG565885"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI00003B60E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC3"
FT                   /transl_table=1
FT                   /translation="MSFGEIDKLAVSTIRLLSVDQVSKANSGHPGAPLGMAPAAHVVWS
FT                   QMRTNPKNPDWIARDRFVLSNGHACALLYSMLHLTGFDFSIDDLKNFRQLNSRCPGHPE
FT                   FELPGVEVTTGPLGQGISNAVGMAIAQANFAATYNKPDFTLSDSYVYTFLGDGCLQEGV
FT                   SSEACSLAGHLKLGNIIAIYDDNKITIDGNTTVSFDEDVCKRYEAYGWEVLHVENGNED
FT                   LNAIAQAVNKAKQSKDKPTLIKMTTTIGYGSLNAGSHSVHGSPLKEDDLKQLRKKFGFD
FT                   PEKSFVVPQEVYDYYQAKIATPGAKANQEWDAKFAKYQQKYPEQGKELARRLAGELPAG
FT                   WCSKLPTYTPADSAVATRKLSEIVFQSIYDELPEMIGGSADLTPSNLTRWKEAVDFQPP
FT                   SSGLGDYSGRYIRYGIREHGMAAIMNGISAFGANYKAYGGTFLNFVSYAAGAVRLSALS
FT                   GHPVIYVATHDSIGVGEDGPTHQPIETLAHFRALPNLHVWRPADGNETSAAYKVALESK
FT                   HTPSVIALSRQNLPQLEGSSVEKALKGGYVLKEANNADITLVSTGSEVYLTVDAVKVLA
FT                   AKGITARVVSLPDFLAFDQQPEDYKLSVLPDGAPVMSVEVLSTKSWGKYAHESFGIDRF
FT                   GASGKAPEVYDYFGFTPEGIAERAEKVVKFYHGQKLSSPLKKAL"
FT   CDS_pept        148620..149102
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000273094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433310"
FT                   /locus_tag="CAGL0D01320g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAG58383.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG300882"
FT                   /db_xref="HOGENOM:HBG730979"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI00003B60E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC2"
FT                   /transl_table=1
FT                   /translation="MTTDKKLSVAFVCLGNICRSPMAEAVFKHTVKENNLESRFEKIDS
FT                   FGTAGYHVGESPDSRSSSTCRSHGVPVNHRAQQIRAHHFNEFDYIICMDESNYKSLERI
FT                   KPKGSRAQIFLFGNWNTDSKFKKIVDDPYYGGKEGFEYNFQQVTYFSNEFLKQELV"
FT   CDS_pept        complement(149562..151208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347853"
FT                   /locus_tag="CAGL0D01342g"
FT                   /product="Similar to uniprot|Q12514 Saccharomyces
FT                   cerevisiae YPR072w NOT5"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58384.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG181557"
FT                   /db_xref="HOGENOM:HBG395803"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI00003B60E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC1"
FT                   /transl_table=1
FT                   /translation="MSQRKLQQEIDKLLKKVKEGLEEFDSIYEKFQGTESSNISYREKL
FT                   EGDLKREIKKLQKQRDQVKTWLSKEDVKDKDTVLMETRKLIENDMEKFKQIEKLMKTKQ
FT                   FSKEALTNPDIIKDPRELRKRDESLFIHECIDELTKQLESLEAQEDNEHQIERHEFHIA
FT                   NLENILKLLQNNELDPDKLNEFHDDIKYYVENNDDPDFIEYETIYEDIGCELNKAAIAA
FT                   QQEESIKSTPKKSPTKKSSKISGSAAKRSPTPLAGTANANKNESSDKTKTIDTQETKAD
FT                   KSKPEEIIKSEDKPTKQAEDEQSNNEGDDNEDEDDDKEDDYVEPVDRTAEINEILQQDI
FT                   QLNSTAMNNPLFKDEIQYWLESKRNLLQPIEDMTPAMIQQLESSLLNCPDSLDADSPSL
FT                   YRKPLSQHHPTSIFFPNEPIRFVYPFYEQTQPNHQNGSEGRNNKHEDIYSRTSLAKIFN
FT                   MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKEIEKLPPGMTKSEE
FT                   ESWRYFDFKKSWLSRRCGSDFVYNEADFEKL"
FT   CDS_pept        152033..155479
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433311"
FT                   /locus_tag="CAGL0D01364g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG58385.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051979"
FT                   /db_xref="HOGENOM:HBG204163"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B60E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWC0"
FT                   /transl_table=1
FT                   /translation="MATTPSAVAAAAAAATTGNASANATTTTTTTANATNEQQLDPLTQ
FT                   STAETWLSIASLAETLGDADRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQKAAEL
FT                   YECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYD
FT                   RYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILAQPPTP
FT                   LQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKVFQQLGCLYGMNNVQFYDPQ
FT                   KALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV
FT                   LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDPE
FT                   NIHIRKRLETLTAQLENPQEAAALQQQQQQQQLSTPSNGNVILSNNSQQQEFNQGSVQM
FT                   MINNNANASPPVMLQPTLQVTDQVNPLNVRPAYPADQQPQQPQQLYSGAPLQQPPQTQQ
FT                   PPHTETQPLQQPVAPPSLPPTQIPNTLPQQPLPSQQQANLLPKANPMDISNANNQIPPR
FT                   NPDIPSAEQAEPAYTAGAHQQSVGAAQPEAPESVGAAPKPDILNQPEAPKTEDNQLPQA
FT                   NIPEIKPMEVQNPTTQETETHQLPRIQPNAAPQTLPENGSINALVNAAVSSAPAPTNKN
FT                   EREPDANEVEPAQKRQKLDDSPEAPQATESAPESVPESAPESAPESNIEPTNQEKEDLA
FT                   KETTPTENTESAKSVKQEQQTQQEVSEPPVENGQEETTTSLPVPATEETNHNNETVGTA
FT                   EDLKDEAMHDATQDGEKHQAVEESVTTDLPSTEQEKHLDEPAQKSEVEENTRAETAGYE
FT                   EPSDLPDAQKSSETTGTTETAEAEHTEVTNVPSEVETSETAKPAETTADQLTGEINQEK
FT                   QIEQPSEASESVPEEKTEVEQPKPAEEDSKGNDTPQEEVSISNTETTMADESSTQPVKD
FT                   STETNQNDPADNMTEESHGQDSTIDEADKGSIEENKDTPNEDFQKLQEGTSTDEKINND
FT                   EEMKEENDEPKITTTNENTEQNDSVNGEVQTNGTTEVEEAADETVIKPTAEALEKLEEE
FT                   AKLREEEEKERLNNENNEDNKTEVTKDAVVREVEEDENYDD"
FT   CDS_pept        complement(155762..157459)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433312"
FT                   /gene_name="MED1"
FT                   /locus_tag="CAGL0D01386g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 1"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58386.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG058774"
FT                   /db_xref="HOGENOM:HBG203970"
FT                   /db_xref="InterPro:IPR019680"
FT                   /db_xref="UniParc:UPI00003B60E9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWB9"
FT                   /transl_table=1
FT                   /translation="MADQYVEVLGDLIGLLKDYKPGTITIENITKLCQSMGLESFIDEL
FT                   DNDISRLSTASKIIVIDIDYNKTQSTVQDVKLVLASNFDNFDYSNEQLEEAGDKQSNIL
FT                   LNSLTNYDSLKQFHHNLEFLYLLDTYSSVESDNQISSGNNLGSGNGTNGSSLTNKTDKK
FT                   SVSSGNGLDSKLNEGKLNLFKYFRELKKYINTFFKESCDNRFKVVANVDNRFGLYIYET
FT                   HGYSMRSRPLAKVYFERAKVPQQRFYEYIYSSETGSWINENSENYSVGVNLILEVNFDD
FT                   TDEDVFWFPKEFVPTDLFIDEKDQLTSRKVSDVLCHAFYELGSSKKQTIELMNDFTTDL
FT                   IQIRRFNINNDNLDLIADILNWTIWYRTVLRPIYLKLVSSISDDDDQHIRADIANTKDE
FT                   FTVENTNPEIMKGPTNKNASFMQRNSMSLQRRRRSSNKAKRPSMSEAVVFKDEGLQQFS
FT                   LHEIMADTTTEPDQKPDNLNISNNSESFIGQQELMEGSNIINDDKMDIDEEAINDDDSD
FT                   SQSGEEGNIPVLLVNEDHVSFKGLGSCSFYDDKDKWAKFVEDLFNVFS"
FT   CDS_pept        157783..158664
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000256147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433313"
FT                   /locus_tag="CAGL0D01408g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="CAG58387.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG011091"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI00003B60EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB8"
FT                   /transl_table=1
FT                   /translation="MSEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDV
FT                   LIFKSTNYGNVLVLDNVIQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLRE
FT                   VVKHECVEEAWLCDIDEAVIRLSKEYLPDMAGVYSHPKVKTHIGDGFQFLRDYQNTFDV
FT                   IITDSSDPEGPAETLFQQSYFELLRSALTDKGVITTQAESMWLHLPIIKDLKKACSQVF
FT                   PVAEYAYTTIPTYPSGTIGFMVCSKDASANVKKPLREMTEEQEKKLLRYYNKRIHESSF
FT                   VLPTWVAKELEL"
FT   CDS_pept        158990..160327
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347854"
FT                   /locus_tag="CAGL0D01430g"
FT                   /product="Similar to uniprot|Q12214 Saccharomyces
FT                   cerevisiae YPR068c HOS1"
FT                   /protein_id="CAG58388.1"
FT                   /db_xref="HOGENOM:HBG058786"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI00003B60EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB7"
FT                   /transl_table=1
FT                   /translation="MVQLVISASQFQSQVVDLLPCNKRQKSQLIYSMLESYGLLECFDH
FT                   IIDVPSCQRKDLEKFHSKDYLNVILDEQLNWNPQIDGNEDQLMELRKAWNDITTSNEAS
FT                   KPDFKTYSELLHYYRDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCP
FT                   IFPYLPLYCYVSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALL
FT                   IMTLRRGGVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETGFFPCSGSLEDNSS
FT                   GKSIVNIPLLHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSI
FT                   KGLTSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLTWSICHQYASEYSTPIDDLIQ
FT                   DHCYSDLYSPEQFKFWYYDQETSGGSLKNYNTTAYIEDLIKNIPLT"
FT   CDS_pept        160810..161253
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347855"
FT                   /locus_tag="CAGL0D01452g"
FT                   /product="Similar to uniprot|P06787 Saccharomyces
FT                   cerevisiae YBR109c CMD1"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG58389.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B60EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB6"
FT                   /transl_table=1
FT                   /translation="MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPS
FT                   EAEVTDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAA
FT                   ELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIQQFAALLSK"
FT   CDS_pept        complement(161495..163480)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433314"
FT                   /gene_name="AIM3-1"
FT                   /locus_tag="CAGL0D01474g"
FT                   /product="Altered inheritance of mitochondria protein 3-1 "
FT                   /cellular_component="membrane raft"
FT                   /protein_id="CAG58390.1"
FT                   /db_xref="GO:0045121"
FT                   /db_xref="HOGENOM:HBG124458"
FT                   /db_xref="UniParc:UPI00003B60ED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWB5"
FT                   /transl_table=1
FT                   /translation="MDSLKSGLATAGKFTYKGTKTVAKAGYNTSKKHMHKKDKDTHHTD
FT                   HHEEDEYSEDYHTPRSVNTLRDPSSFPPPPTRSGQAGHVAGNTAGSIAGNYSGYSQPTA
FT                   AANNTISYNAQAQNTPYSSPAQQQPVSPQPPVQNSQYNPTQNYAIQQPQQPAGTNANYS
FT                   YGNQQHPAGQAPIVNSITPNHQYNANNTFQSNLPNQQLNVAAPTQSTNNNFNQMAANNT
FT                   YTNSAQVAYNSQQQQLQQNSQQNTYSNAPYQVQAQAAYNPLPQQQQQQQQQPEYNTQLQ
FT                   QNQQLHNQQAYGQQQQIYSNNTQPQYVSQTQQTSYTQNAPPQQTRSPEQPVYGQGITPP
FT                   VQANAYRPMPSIPPDVNQTAITSTNSANEALQNRIPMNNVDLSSLPPPPTHRDRGRASV
FT                   ENETIDENMQTNNSTIDSSSVASADINNNSIRNIPAPAVGPPGAATRAVPPPPPRRTTS
FT                   QSMSTNSVVETSPGINSIEQINNYYDGTYAGHSANERPPITNTLKRGTPPLPRRSTSTK
FT                   MNTQPNPQTPISPSRDTNMDLQRRSTVSSIQSSNRPMPDPPIRKDNIQENNIESKQVNQ
FT                   EVNSQMSVSNIGIGDITSELQHIKLKSVGNSYEREIHGEAATEVVHNKPLKKKPPTVPK
FT                   KKDSLKGKAPPPVPKKKPTLTSFVHS"
FT   CDS_pept        complement(163802..164482)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194598"
FT                   /locus_tag="CAGL0D01496g"
FT                   /product="Similar to uniprot|Q12425 Saccharomyces
FT                   cerevisiae YPR067w ISA2"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAG58391.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG058825"
FT                   /db_xref="HOGENOM:HBG730174"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="UniParc:UPI00003B60EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB4"
FT                   /transl_table=1
FT                   /translation="MRDSVTLDKTAVKMIGIRSVTVSRISVRGYARVVSMPKVIPMAKA
FT                   MAKPMAKPMMNTMQNTRWYGIKVEASEGEVPLVEPYKVLNKQEDKGLKIAERAAKRLNE
FT                   IYKESQEVLRVLVESGGCHGFQYNMKLVPESTLSLEETGNSESKTQEEVVDEFAEGADS
FT                   SSKDVIYIVSEEGGKVAIDETSLGILNNTTLNYTTELIGSTFKITDGNLKSSCGCGSSF
FT                   DIEK"
FT   CDS_pept        complement(164750..165643)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433315"
FT                   /locus_tag="CAGL0D01518g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAG58392.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG028577"
FT                   /db_xref="HOGENOM:HBG521753"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI00003B60EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB3"
FT                   /transl_table=1
FT                   /translation="MAMKVLVLGAGGLGCELLKNLARYDYVSEIHVVDLDTIELSNLNR
FT                   QFLFREQDIGKYKAEVAAHAIGKRVTDKVIVPHVTDLTTLDATFYSQFQFVISGLDAIA
FT                   PRRYVNQVLVDITRASAFEICIPFIDGGVEGLKGHIKTIIPGINACWECSIDTLPHESA
FT                   MNNPMCTVANNPRSLEHIVEYVVLISNPDADLDDLAVCTQLLDQCRQRASQYGIDCSEL
FT                   TLSKMAGIAKRVIPTVSTTNSIVAAMCCEQLNCIYRDLWDPESSPNFTTINGAEGMYIF
FT                   SFQYQRNPECTVCSML"
FT   CDS_pept        166233..166616
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194599"
FT                   /locus_tag="CAGL0D01540g"
FT                   /product="Similar to uniprot|Q12160 Saccharomyces
FT                   cerevisiae YPR063c"
FT                   /protein_id="CAG58393.1"
FT                   /db_xref="HOGENOM:HBG124459"
FT                   /db_xref="HOGENOM:HBG398565"
FT                   /db_xref="UniParc:UPI00003B60F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB2"
FT                   /transl_table=1
FT                   /translation="MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIF
FT                   LKNKFIAWFSLIQSVHSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMN
FT                   LVFPTPDAPPPSSEKKILDEEKK"
FT   CDS_pept        complement(166898..167365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433316"
FT                   /gene_name="FCY1"
FT                   /locus_tag="CAGL0D01562g"
FT                   /product="Cytosine deaminase"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58394.1"
FT                   /db_xref="EMBL:ABG43005.1"
FT                   /db_xref="EMBL:ABG43007.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG220403"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00003B60F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB1"
FT                   /transl_table=1
FT                   /translation="MSNAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGR
FT                   GHNMRFQKGSPTLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCV
FT                   IGESDNFKSPGEEYLKSRGVEVVQMNDEPCKAIMKKFIDTRPQDWFEDIGE"
FT   CDS_pept        167879..168781
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500012"
FT                   /locus_tag="CAGL0D01584g"
FT                   /product="Similar to uniprot|Q12350 Saccharomyces
FT                   cerevisiae YPR061c"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG58395.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG124460"
FT                   /db_xref="HOGENOM:HBG203968"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B60F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWB0"
FT                   /transl_table=1
FT                   /translation="MLVKGSTKFLMAHRHDSMLLNKIRCYATTDDNNLVSAGKGSQVLH
FT                   DSLWPDKHNPTPYEIFGFGVGTHVDLKKLKMEYHKYVKMYHPDLSSHIQIRKSSLVKSH
FT                   HAMEIANTAQYLTQAEKIQRFKLVTQAYEILKDPRKKNLYDCTRSGWDMAGSAGPTGAQ
FT                   SAYYASSAAYNNFSDQSYAYWNAGNWEDVHNYQNNSGQKLDPWTLLMWFGGLLLCLEGS
FT                   SLLARIEDTLTDKSITEDNIEVELGQCYINYGLDTDKWSRLRRFLWFRTFNMYRSKVDL
FT                   DREAEKNEDLIKTLQEKVK"
FT   CDS_pept        complement(169066..169983)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194600"
FT                   /locus_tag="CAGL0D01606g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58396.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B60F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA9"
FT                   /transl_table=1
FT                   /translation="MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQP
FT                   FDTTKVRLQTSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMK
FT                   RFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGP
FT                   IDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCL
FT                   YGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGP
FT                   TMLRAAPANGGTFATFELAMRLLG"
FT   CDS_pept        complement(170546..171628)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347856"
FT                   /locus_tag="CAGL0D01628g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58397.1"
FT                   /db_xref="HOGENOM:HBG058872"
FT                   /db_xref="UniParc:UPI00003B60F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA8"
FT                   /transl_table=1
FT                   /translation="MAGRNRNSKDQNKEALSSAIDPVFGQAKAFNINDPEVNPLVKSYL
FT                   SEVRNEALHTNAISHQIGQVSKNTFDANIYDDEDDSTSIPSDTKVKSDQITEYLYSIEN
FT                   WYKWFENISDIIWHGCYVFEGYDDESISHLTQLLRFYLQKKIDENRASSFDRHLVNIFR
FT                   DQLKCSDPDPVNGTLEIDEDWAENLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWA
FT                   KYVTSNQPTHTAFINMIDSSNLWTLVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILL
FT                   HIPTRLTAEQMSNIRSLAKQAREILNRRVNSNIFGTTNIVIPDELHEHNCPPCPPNLDI
FT                   ASLILAVVTRKYGQHDILEF"
FT   CDS_pept        complement(172035..173042)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175900" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194601"
FT                   /gene_name="TFB4"
FT                   /locus_tag="CAGL0D01650g"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   4"
FT                   /function="general RNA polymerase II transcription factor
FT                   activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="core TFIIH complex"
FT                   /protein_id="CAG58398.1"
FT                   /db_xref="GO:0000439"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016251"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG382873"
FT                   /db_xref="HOGENOM:HBG737144"
FT                   /db_xref="InterPro:IPR004600"
FT                   /db_xref="UniParc:UPI00003B60F5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FWA7"
FT                   /transl_table=1
FT                   /translation="MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSG
FT                   EKQSVTTVLKSLIVFLNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDL
FT                   SIISSHMYRRFRNVDETLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKE
FT                   FESISLRSRLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQ
FT                   QTTDATNGVYIHLESTNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVA
FT                   IGYICSVCLCVLSIIPPGNKCPACDSQFDERVIAKLKKKPVVPKSTLKKVKKKV"
FT   CDS_pept        complement(173338..176382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043507"
FT                   /locus_tag="CAGL0D01672g"
FT                   /product="Similar to uniprot|P32855 Saccharomyces
FT                   cerevisiae YPR055w SEC8 transport protein "
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAG58399.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058909"
FT                   /db_xref="HOGENOM:HBG203966"
FT                   /db_xref="InterPro:IPR007191"
FT                   /db_xref="UniParc:UPI00003B60F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA6"
FT                   /transl_table=1
FT                   /translation="MSHLAVNQGRGRRRALSVNSYSEDQQHAMENALDNLRDDLSLVKS
FT                   QWNRVLTEDSNPLELALAFLDDTSVGLGHRYIEFNQLKEQIGSHLQEVVNQHSQAFNSN
FT                   VASYTQAVNAITKSQQKILELKDSVREANHKFVLDKSDLEDLNNQSLKYNQVIEDLNSI
FT                   EKLIQYPDIIEEHIRGKNYRDARILLEKGFLLAGSQTLKDVSAIKPLVQQLELQEHVLF
FT                   NTIIEEIHNILYSKNDDSFVTNEIGRMVGTAQTNFSTLENYVYNVVNIDIKEQSRIIND
FT                   KFSIFMKDIEDSKSYSKKVMVRSKQTVFDKLFIYLSLLKDMKKLSPALNIIYDRTKEEF
FT                   HNIVLKSTEKVRLKHPSLLKMSQGFEKELNFGLSIKDILSLIMRECFWEIFIKFLVATQ
FT                   GHRVVAESVNSLRSPTSKSTIYPLDKVWRKVIDEIEFLLTRYLRNDQLLNSNKLLKTKR
FT                   SRASSIANNRIEHFSLEDNIEGEASAKKHAAELKTLLKDIFPGFTVSSNMELGSIYIQD
FT                   ESFERDDSLIPGSIFNIKVLLEPYLVYVSACENILPEQIKTNTISPLKFFKDYMENQFF
FT                   PNIEVTFNSLFENHVENNNPYALEINDENKTIFKAAVDFQNLLARIMLLMNTTNTFRKN
FT                   VSTSILEVIIRLQAYYEDLFNTIVNSHNDISNNILITWLNDEKLSHLESKIYNGDESVI
FT                   TQETNELFRYVPNFCVKSRGLTTYDSLSPTSFDNIIYFLSTIMWILDWLPTMKKRVEEE
FT                   NNVETKSEIDILRKQWSFFETTDSDVKQIKTLKFSLDKESEEKFDQTINAFMQLKTKLV
FT                   SLLRFDMRSLCISNIGELFQNTTMWNPEDSSNEIDQSIASLISRLRLSENKLKQQLSDV
FT                   ELKIIFIGVDKLCNIAFIKGSQTIKVLNSNGVKKLSRNIQMLQHTFRNFSPDPSNIDMS
FT                   EPLLFYSLCDADESTLFEELNKGSLANLPVELHKTILKLQFSEELYRQQMRSARMSTST
FT                   HSKPTNKRYLDAMEKLNNLGVSTAA"
FT   CDS_pept        complement(176981..178279)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433317"
FT                   /locus_tag="CAGL0D01694g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58400.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B60F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA5"
FT                   /transl_table=1
FT                   /translation="MGLSKILGSNDNIVNKNGSSNTGGSKKSSFFSLNSKRNTDAAGIV
FT                   PDFTSIKAPRTIYKNANFSISGKYEIIQVLGKGSYGVVCSAKHKLDNEDQEQFTVAIKK
FT                   ITNIFYRKILLKRAIREIKFMNYFKGHKHIVNLIDIEIVQDKPYDGLYCYQELIDYDLA
FT                   RVIHSSVQLSEFHIQHFIYQILCGVKYIHSADVIHRDLKPGNILCTVNGCLKICDFGLA
FT                   RGVAKQFVNKNSKPNEITNYVATRWYRAPELILSNNEYTKSVDMWSVGCILAEFYGRRP
FT                   IFMGKDSIHQVYEIKKILGTPSRSLLVKYGTLKAWNLFGHNSNHNLDNLKSGMPWSTVY
FT                   PMASATALDLIDKLLQWEPESRLNVLQSLEHQFVQSVRKPNDEPICSKGPFNFSYEYNL
FT                   NSMDDLRQCLNEEVAQFYIERQLGEEYSKYIEE"
FT   CDS_pept        179249..180025
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043508"
FT                   /locus_tag="CAGL0D01716g"
FT                   /product="Similar to uniprot|P15873 Saccharomyces
FT                   cerevisiae YBR088c POL30"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="CAG58401.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG049725"
FT                   /db_xref="HOGENOM:HBG749295"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI00003B60F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA4"
FT                   /transl_table=1
FT                   /translation="MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRV
FT                   LLVSLEIGIEAFQEYRCDHPVTLGIDLTSLSKILRCGNNSDTLTLIADDTPDSVLLLFE
FT                   DTKRERIAEYSLKLMDIDADFLKIEELQYDTTLMMPSYEFSKVVRDLSQLSDSLNIMVT
FT                   KETIKFVADGDIGSGSVILKPFVDMEKPEDSVKLEMEQPVDLTFGSKYLLDIVKGSALS
FT                   EKIGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE"
FT   CDS_pept        complement(180212..181279)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433318"
FT                   /locus_tag="CAGL0D01738g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58402.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG330815"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR019483"
FT                   /db_xref="UniParc:UPI00003B60F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA3"
FT                   /transl_table=1
FT                   /translation="MSLWVDKHRPKTLKTLSYNDDLTRFLSSLAMNPRDLPHLLIYGPN
FT                   GSGKKTRCMALLESIFGSQVYRLKIDVRRFVTPSNRKLELNVVSSPYHLEITPSDMGNN
FT                   DRVVIQELLKEVAQMEQVDFQDGSSGIANRFKCVIINEANSLTRDAQAALRRTMEKYSK
FT                   NIRLIMLCDSMSSIISPIRSRCLMIRSPAPQMKDITKTLKDVASEENVNIVDQVILDKV
FT                   ANESNGNMRLALLMLESMSLSNEMQLKENTPVIKPDWMVVILKLANKIKKERSVSSLVE
FT                   CRAVLYDLLAHCIPAKVILQELAFALISDKTTPDSSRVEIIDHASVFDERLCLGNKAIF
FT                   HLEGFIAKVMCTLDK"
FT   CDS_pept        181792..182544
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500013"
FT                   /locus_tag="CAGL0D01760g"
FT                   /product="Similar to uniprot|P53093 Saccharomyces
FT                   cerevisiae YGL198w"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58403.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059420"
FT                   /db_xref="HOGENOM:HBG204454"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniParc:UPI00003B60FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA2"
FT                   /transl_table=1
FT                   /translation="MATDDQFIEPDFIEPDVPVRDGSNGNSSAAGSRGIAGLSGNMETS
FT                   SGDWNRGTLDESVLATFKRDIYDINSKLKQVVYPHLPSHRYMATTSGDQDSAQGANEDI
FT                   FNSSDFWAPLTFIILYSVCVSHAKGLFSSVFVSCWFVLVVMALHLKLTKPYQNATLLSY
FT                   VSLSGYCMFPLVICGLLVQIVIPAVSHTLGTSPWKVRVSTLLRLTVFGFCFIWSFTCSA
FT                   IVTRSKGFVQLYPLALCLFGLAWLSMIL"
FT   CDS_pept        183156..188054
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433319"
FT                   /locus_tag="CAGL0D01782g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58404.1"
FT                   /db_xref="HOGENOM:HBG124462"
FT                   /db_xref="HOGENOM:HBG204455"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI00003B60FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA1"
FT                   /transl_table=1
FT                   /translation="MSLLQPFTCTCYPLRLPAAQAGSGDEYVRRKQSLDCRTGAAVTLT
FT                   RSNIFVHGGLTIPLNLEKVTCAEIQNQVVLYFAKEKDCSAGFKDLKQWLSPEIFFLDLI
FT                   SRTWNRVDTTVESETMLGAGAGAGAGTATGTGMETDPAREAADVDVFANEQSLSSSVTL
FT                   SVIEQESFRERLFHSMCYVDGNIFVFGGLVMSPQNGYEFTASNELWRLDLRTKQWSLVS
FT                   RNPLIQRRFNHSMHVKNEHSDTRDTKIVIVGGLNNLDEPVHKVDIYNLTRGYWQSVPDS
FT                   EFPIELETNIEGKPVDLATDSCFSILVENNEAKIPALAFYKPLSCRDHSVITSRSKKAK
FT                   QVSGRSSVDTEMAVCDSDTGTKEQDEQDPNSQSPIVALPIVSGSKGIRMASHPLQPNDL
FT                   LEAPLNLLNPTGDYFGYNIVIGGFCPTLLPSDFHCYIYDIPSGKWTRIGITCPDCEINT
FT                   HRFWKLFVWDSHHQALVLGTKNDDGYLPSVQKFDHLLSFGLPIINIFNKGIHSVPSNKD
FT                   AVMSVPDSKFGSSGVSDLESDLNRMSFASSQTSQFESYIRYIAPPYEMTSIRSVFPAYA
FT                   MVLGKDALEIYGKPLSDFELVSSEGEAIGVPLYLLRKRWGRYFDLLLSQGYSKACTEYE
FT                   ASGNLSTLIKLTPFSSRTGSRDIHSSRLSSSSSLDNYFVKGIGAQHHHYSVSGPAGRKP
FT                   PGSENIVDRTSRSSVDGHLMGSSPNPMSESVYLTHIDDVDDDDDDCVGPTSQAKNTNKM
FT                   KSVSRTITSSTTSSTGGMVFRVPFQEKKPSSSVQDIAPDSQFFQTGSSSRRSSLLSSQT
FT                   MGIQRSPKIEGKRRASHPIISSIMDKGQPVSTRSVGSTRSSLSYVSSSSERQSKSHLPG
FT                   SRNSSVTGSPILGVLNVPLPPPCQTPTEPVPPPPVTKYPNITSKPRTNSMSEVFNTIKG
FT                   SPLSSRRSSYSRKTSTSEVNSAIDRQLMEDRFKEADMAFAKQTPTKPVAGSKMPENIRS
FT                   STRNSVNNDWSRHSFASVSDSSESATVNGNIEMEPMLIPRTLYLPWSTATVHAFAEFFY
FT                   TGQVNGKWMLSPVVLDLLVISKLYELPLLFNLISEVLYSIVGKKEEGMYITCKSLIDSF
FT                   SRKVSTYFGNDKEKEVAYLESCEAYKILKKIKLCLERIDNGFFDLDLMRRHSMSRSSYN
FT                   SSNGSTVEKKNSLDLSPRGSSNLPTMMGNGPRDSHVSIESLNYPMHMNIPSSRRSTGTF
FT                   AHRTTKKSSLSKEIDPSFFNDTSSTLSLHDTAIVKDFNEKIAKADTITEKDYSSTSSSS
FT                   SCDLDDESDQEKLRHLSETDFATILDTRDSKSHQLNTKEDINNFDFSLGLLSSFNDEKN
FT                   KLRKVDVDEPIDPLAKISHNLDSPNRLYSKYSQGFGKMPKSGSQASNMGLLTLENLASP
FT                   NALPPDDAVIKAIHQTTVLANEVRLMIRCGDCLQISKDLRRCKKIMNSELTKLEKTHNV
FT                   SESRTSISASSSQTRLSDYQSSTNSGKITPTAGGSVTTMDPLVKSKLKQNLTGQELHPG
FT                   IHFVETLHSPKSVADFESKETSSQPGVLNGLHTGLHSGFHAGLHTSPHAGLHSKPQHSH
FT                   SATKIPKVSHKLGKATTSTSLKSESKSPSSTNLGKKEHNSSLGPLSFFGIRNK"
FT   CDS_pept        188295..189578
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043509"
FT                   /locus_tag="CAGL0D01804g"
FT                   /product="Similar to uniprot|P53095 Saccharomyces
FT                   cerevisiae YGL196w"
FT                   /protein_id="CAG58405.1"
FT                   /db_xref="HOGENOM:HBG165424"
FT                   /db_xref="HOGENOM:HBG324429"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniParc:UPI00003B60FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FWA0"
FT                   /transl_table=1
FT                   /translation="MKEYPEEYLGQHISTLPTPCMVIDEKKFNSNCENMLKHVGELGSL
FT                   TEHPILFRAHVKTHKTTEGTLRQLGFEGTSAPFRSKAILVSTIKEAEGLLEYQDSINGV
FT                   FVDDIAFSLPACVPEVLERLSSISTRVSNLRVFVDNIDHLENLKQFGRPKSGKKWSIFL
FT                   KIDMGTSRAGLEVRSEEFKELVEKLCDESVKEVTQIFGLYAHAGHSYSSHDINEANGYL
FT                   IDEITAVNEAAKLVGSVTEIEPRLLTLSVGATPTANSLSTKENKKLIDIIRNDLVAPLE
FT                   IHCGNYPCYDLQQYSTKCIKLNKISAFVLASIVSKYEKRNEALINAGVLALARENSSIP
FT                   GMGLCINTDKYLHAPRDFEVSSFVNRVSQEHGILQPYNRDKCEDWKLGEKLLVIPQHAC
FT                   ITMAQFPYYFVFNDSGKVIDVWKPHQKW"
FT   CDS_pept        189933..197933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433320"
FT                   /locus_tag="CAGL0D01826g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG58406.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG052842"
FT                   /db_xref="HOGENOM:HBG324045"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022716"
FT                   /db_xref="UniParc:UPI00003B60FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW99"
FT                   /transl_table=1
FT                   /translation="MSNPRSWEVLEPELGKLCYDSKISNRIPILTELKEIVKTNNLSRE
FT                   QLLNLASVLLNTYTIYKDHESKKAVCDIYDEMITIDGSFIAIFLDHIVETLGDKIGTKA
FT                   LSDYLNLLDNINHFLQVILVDSNLTSQYLPKVLQCHTITTASIETSLDISEKSMELVSE
FT                   KQNQHRRRMRKTIIQNSTKYLNKGLKNTENIQDVLETIRHQLLEEYVKLKLPVAGILVF
FT                   SAALTKAALQLHVQTPIVLEFLRTTYSKDFVVFFGKEVLLGKTPPSSLCVATSIDTISQ
FT                   ELFTEDMIKNDIIPVLEKSNLRSPESSFQYARALFGSINAKTINMAELYASTKLMSQAF
FT                   SSFKSSREGTKTAAISFTVSVLRSLCVETTEESALLKIVENIFTNLKTNMNADYKAIVS
FT                   TLLQAIPTFHENVSLDIAEKLSPLLVKESNEQALVNLLNPFYQHYFATGTSIDKFNTTI
FT                   ISGLQEKKAPLKRCWFSSLFMNIDTVTESIAKTIGKLCTTYIKENLVHAQRTEHSVAFS
FT                   ILSGFVFFSENVYAEIEHDIIDIQKDAMLGEAFLRVCTSIELDAVTRQRSVTLLEKAVS
FT                   LQGETISENVINSIANLMKQDSFELDEKCSIVYFIPIFNALVTSNEDKTTQGNILRFLL
FT                   VISQYDKFRIKNGWAGLALKCGIDPSQIIAENTSTIINTIISESSKPELLNTIYGSCVI
FT                   KAASYIAFINPVAVAGPIAKLFSEDLSVADLDKLTEEDVSIWKGNEGEMVINVLEKRND
FT                   RKLADKNSKDYETLKWEESIRKEQAKKANLKLSKEDQMLVKEQLEKESKIRTHVNGIYL
FT                   RLYRSLSLIKQLSKEAKLVDNGILVWYPTAVNSLMSLIRTENSYNLLESLLVESFLSLS
FT                   ENTAEKLEHYRLFCGLAILRVYKAKFIPSNYLEENLEELLSRVLFRLKIVTSNTELDSI
FT                   TLTYLLPLITYVLEEGKKAALKNADKPVNRTEFVEEDSEEENLLLAMDIISAQAPLFEN
FT                   SSIPRASILQVLLSLLSLPSKAKIAKDCLNTLSQSISVHPTENDLKIIISSLLSGHSFV
FT                   RTTILEVLDNEYELQEFMKFSPEIFMCRFDSDDNNRELANFIWEFNKFEIVPELLDGLL
FT                   SLFYQQDSGLRLFLARGFAYATYNVKGEEYLEQSLKMLMNFYNEKAQPLTAILDEFGLV
FT                   VVPASQRKDLWEERSTAAIALKELSPGLPSDGDTVVSVIEFLIAGPLGDREPIVRQEMK
FT                   EAGIEIINQHGAQKSSQLVPLFESSLETIKDVNTKENVIILYGTLAQHLDKSDKRIGSI
FT                   IDQLLQTLDTPSLDVQQAVSSCIAALVFQFKENCGSYITQLLAKLLDSTIAKPVRKGAA
FT                   WGIAGIVKGYGISALSEFDIIRSLMEASEDKKDAIKRESVAYAFEYLSQSLGKLFEPYV
FT                   IEVLPNILKNLGDSVPEVRDATAAATKSIMANTTGYGVKKMIPVTVANLDEIAWRTKRG
FT                   SVQLLGNMAYLDPTQLSNSLSTIVPQIVGVLNDSHKEVRKAADESLKRFGEVIRNPEIQ
FT                   RLVPILLKAIGDPTKYTEEALDALIQTQFVHYIDGPSLALIIHIIHRGMHDRSANTKRK
FT                   ACKIVGNMAILVETKDLIPYLQQLIDEVEIAMVDPVPNTRATAARALGALVERLGEDQF
FT                   PDLIPRLLDTLNDETKSGDRLGSAQALAEVISGLGLSKLDELLPTVLAGATNYRSFVRE
FT                   GFMPLLLFLPICFGAQFAPYINQIIQPILAGLADIDENIRDTSLKAGKLIVKNYATKAI
FT                   DLLLPELERGVFDENERIRLSSVQLSGELLFQVTGISSRNEFSEEGEIGSEFSGKMVDV
FT                   LGQERRDRVLSSLFVCRNDTSGIVRASTVDIWKALVPNTPRTVKEILPVLTDMIVTNLA
FT                   SSSNTLRNIAAQTLGDVVRRVGGNAMAQLLEALEVTLEKTSNPDSREGVCIALNELVMS
FT                   ASMDTLTQYQDTVANILRRTLIDSNESVRQAAALSFDSYQEAVGKVAVDEVIPYLLNAL
FT                   KSNENSEYALLGLQDIMATKSDVIFPILMPTLLASPIDSFRASALGSLAEVAGPALYKR
FT                   LSVIINSLVDTLISDDIDDTTKEGVKQALDRVFLSVKDDEGLHPLLQQILALVKNDDMK
FT                   KRIVTLQCLPNFFEQTSLDLDVYVPDFVSNSIMSLDDENAVFVKATFEALSALVKKQPK
FT                   DMLEKLVQPAKQALQRTGKQGEDLSAFALPRGPNCVLPIFLHGLMYGSAEEREVSALAI
FT                   ADVVSKTPADNLKPFVSAITGPLIRVVGERFKSDVKAAILLALNILFKKIPQFLRPFIP
FT                   QLQRTFVKSLSDPTNETLRLRAAKAIGTLIEFQPRVDPLVIELVTSAKQTEEEGVKTAM
FT                   LNALLEVVGKAGSKLNEASKKNIVKLVEEEMLSSNDKLAVAYAKLIGSLSEILSEDEAK
FT                   NILQEKVLDADMEGSAGKFAVLILNSFLKDAPSHIFSSGEIHKFVKFITDAMTSTNVHF
FT                   VENATLAAGKLLLLHNETKSPYTNMKNDVTFIVPEEDIKSLVEELAKSALVPSSNTTDQ
FT                   RRLSLVVLRTIARLKNEETVKPYLDVLAPAVFSCVRDVVIPIKLAAEKAFLALFGLIEE
FT                   EDMATFNNWFESVSSNGATIDNIVGTTIQLRSIGDYTKRVAKRLAAVERERTAAGGDDE
FT                   MMFSDRYEDEREIWAVGGVELPTDI"
FT   tRNA            join(complement(198647..198685),complement(198566..198610))
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        199161..200417
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433321"
FT                   /locus_tag="CAGL0D01892g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG58407.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B60FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW98"
FT                   /transl_table=1
FT                   /translation="MSATIFNNIEELPADALFGIKQRYNQDTRATRVDLGIGAYRDDQG
FT                   KPWVLPSVRMAERAIQEDPSYNHEYLGINGLPSLSSAAANVIFGEDSPALKEGRTISVQ
FT                   SLSGTGALHIAAKFISKFAADKKIYLSQPTWANHNAIFKAQGLETASYPYWKSSTKSLD
FT                   LEGFISAIESAPKGSIFLLHACAHNPTGLDPSEKQWPVILDALVKGDHLALFDSAYQGF
FT                   ASGDLDKDAFAVRLGVEKLASTSPIFVCQSFAKNVGMYGERVGCFHLILPKQNANLAPI
FT                   KSAITSQISSIIRSEVSNSPAYGAKIVSKILNTPELTKQWHEDMVTMSSRIKEMRIALR
FT                   DHLVKLGTPGTWDHIVEQCGMFSFTGLTPEMVKRLEVQHAVYLVSSGRASIAGLNSGNV
FT                   EYTAKAIDEVVRHYSTSKL"
FT   CDS_pept        201005..202012
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433322"
FT                   /locus_tag="CAGL0D01914g"
FT                   /product="Similar to uniprot|Q01590 Saccharomyces
FT                   cerevisiae YLR026c SED5"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58408.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG025919"
FT                   /db_xref="HOGENOM:HBG628558"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR021538"
FT                   /db_xref="UniParc:UPI00003B60FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW97"
FT                   /transl_table=1
FT                   /translation="MNIKNRTFEFQQSVATYKKRVKKNDATSNGKPQAGVSEFQKKASA
FT                   IAREISSSAQLLSKLALLAKRKPMLNDNPVEIAELSFLIKRKIYAIEQSLIDLSKLQKV
FT                   QRNGGNSSAGSTTDVTTQHSKNVVNLLNTKMRNISGGFKDVLEERQRMEMANRDRWEKI
FT                   NSTSNSTSRAMSNTQDSENKNLNDNAMVNEVATYNHSNPFMSSSLIDEESHANANKGSE
FT                   LALPQSDSQMLLMMEEGQMANNVYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEV
FT                   IQRIDANVDEVDLNITGAQRELLKYFDRVKSNRWLVAKIFFIVFVFFLVWVLVN"
FT   CDS_pept        complement(202712..203398)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043510"
FT                   /gene_name="SNF7"
FT                   /gene_synonym="VPS32"
FT                   /locus_tag="CAGL0D01936g"
FT                   /product="Vacuolar-sorting protein SNF7 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="CAG58409.1"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG371348"
FT                   /db_xref="HOGENOM:HBG618740"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI00003B6100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW96"
FT                   /transl_table=1
FT                   /translation="MWASIFGGKGNTNKELPKKAIIELREHINLLSKKQAHLQGQITAQ
FT                   ENEARKFLTRGNKTMAKNALKKKKVYEGQLVKLESQMDSLEQQLFSIESANLNLETMRA
FT                   MKQGAKAMKSIHSGLDIDRVDETMDEIREQVELGEEISDAISRPLYTGANEIDEDELDE
FT                   ELDMLAQETEPQVATKEQALPESKQALSMPNIPNTKIDESKTKIEEEEEDEDERALREL
FT                   QAEMGL"
FT   CDS_pept        204175..204720
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433323"
FT                   /locus_tag="CAGL0D01958g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="electron carrier activity"
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58410.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG362919"
FT                   /db_xref="HOGENOM:HBG734972"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR014361"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="UniParc:UPI00003B6101"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW95"
FT                   /transl_table=1
FT                   /translation="MLSLGLMNRSAGCTRRAVLLIRGAAQRRLLSSSVRRLNTMKSSMN
FT                   AEEEALLNKQRALRPISPHLTIYQPQLTWYMSSVHRISHLILGGTFYVLTILFGLGYFV
FT                   SGINTESVSQWYHKHVSPMTEQIVKAGFAFTFAFHYFSTIRHYIWDFAKELTLKGVYRT
FT                   GYSVLALTAIAGTYIWNM"
FT   CDS_pept        205102..206787
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043511"
FT                   /locus_tag="CAGL0D01980g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG58411.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG024584"
FT                   /db_xref="HOGENOM:HBG332621"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniParc:UPI00003B6102"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW94"
FT                   /transl_table=1
FT                   /translation="MIFNSFTITDYVIVLLVYLESMVAFFLKLVPQPIISLLEWFIDYS
FT                   FSEDNTSFEERLRTAVTIHDMCRLFGIEVEDHLVRTEDDYILTLHRIPPREGTANGKTV
FT                   YLHHGLLMCSDVWVCHVERHKNLPFVLHDLGFDVWMGNNRGNKYSTAHLYKQPKSKEFW
FT                   DFSIDEFAFFDIPNSIQFVLDRCKIDQLICIGFSQGSAQMFAALSISEDLNKKVSHFIA
FT                   IAPAMTPKGLHNRIVDTLAKSSPTLMYLFFGRNIILPSAVVWQKTIHPKLFNFFIDFGN
FT                   RILFNWKALNITQKQKMAAYSKLYSTTSVKSIVHWFQILRAQKFQMFEEQDDMFNSLTR
FT                   PYKIPRFPTKTNIKTPILLIYGGVDSLVDINVMRNNLPLTNVFDIKVDLHEHLDLIWGK
FT                   DTDTLVIAKVLRFIEFFSGEKLLQSTTLSLGEPERLMPVKTPISQHTSRRNSNSSVGTE
FT                   NATPSTFNVRKTTTPSNYRYEQTESPTAQYGLEKLNSLYSNVGRGLEDIDEKEAFLDYN
FT                   TGDKMDEIQKTNSINQRRLSEYLDSSTDLKQMDSNATTTVNTPN"
FT   CDS_pept        207419..209080
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194602"
FT                   /locus_tag="CAGL0D02002g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58412.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW93"
FT                   /transl_table=1
FT                   /translation="MSFAGYSGNSNSNSHFKRRNTTQTDRDGANTHNKRSRPNNYSKNA
FT                   DFAKSNDMNDRNNSKPEFTGSRYQGGKASRFPKKDYEESSNKNRNRNQNTKRFQSTKPN
FT                   RKLNVNESRFREDYNNKHGRISTRYNNFTTGNTSDIRTNGNNTPLRQDDRNTITRPSNN
FT                   ANNNQDSGRKIFELPKGPKSTISRYNTGEPYKGTKPQSIPTPTLPTTFLSRPMNDSVYE
FT                   RLLQVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPITSIREIKLLQSFNHENVS
FT                   TIKEIMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSKHIFKQILHGIEYLHDNNI
FT                   LHRDIKGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPPELLLGTTN
FT                   YGPEVDMWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWPNIFDMPWFFM
FT                   IMPQQATKYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTASEALQSEYFKEDPQP
FT                   QPLILNDAISCHEFEVKLARKQQKKKEQSKSTTSSA"
FT   CDS_pept        complement(209430..209642)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194603"
FT                   /locus_tag="CAGL0D02018g"
FT                   /product="Similar to uniprot|P69852 Saccharomyces
FT                   cerevisiae YKL138C-A HSK3"
FT                   /protein_id="CAR58011.1"
FT                   /db_xref="HOGENOM:HBG398802"
FT                   /db_xref="InterPro:IPR013183"
FT                   /db_xref="UniParc:UPI00017BD730"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMY7"
FT                   /transl_table=1
FT                   /translation="MNNTKQRQYAHLAQQLEELNQNLKETTRHLDTMSKQCNENLVGQL
FT                   GKVNSSWLIGSSRCFEDQMLGGGEK"
FT   CDS_pept        complement(209961..210353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166603" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433324"
FT                   /locus_tag="CAGL0D02024g"
FT                   /product="Similar to uniprot|P14063 Saccharomyces
FT                   cerevisiae YKL138c MRPL31"
FT                   /protein_id="CAG58413.1"
FT                   /db_xref="HOGENOM:HBG124464"
FT                   /db_xref="HOGENOM:HBG396093"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniParc:UPI00003B6104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW92"
FT                   /transl_table=1
FT                   /translation="MFGPFRGTQFLQGGLLWKVPWRMSGPQKFRQRQRLKAVDDVVKNL
FT                   TLGLHVQRCQEKGLQFEQALEERKYKPRSAIMRLLNKASFFPKEYQMSAKDKYTVFDKK
FT                   SRGYRKGIHKVPKWTKISARRNPQFF"
FT   CDS_pept        210605..210919
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433325"
FT                   /locus_tag="CAGL0D02046g"
FT                   /product="Similar to uniprot|P36064 Saccharomyces
FT                   cerevisiae YKL137w"
FT                   /protein_id="CAG58414.1"
FT                   /db_xref="HOGENOM:HBG059437"
FT                   /db_xref="HOGENOM:HBG202412"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI00003B6105"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW91"
FT                   /transl_table=1
FT                   /translation="MSEQAASESGRRVPLWVLNAREEKEARTNLKNMAYKNCDEYVKAM
FT                   ADCAKQNGLKCFPACDQQRADMRQCLLFYQTDHYLDVERDKIVQKRIARLEEMVNKQKS
FT                   "
FT   CDS_pept        complement(211249..213378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500014"
FT                   /locus_tag="CAGL0D02068g"
FT                   /product="Similar to uniprot|P36000 Saccharomyces
FT                   cerevisiae YKL135c APL2"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAG58415.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG201632"
FT                   /db_xref="HOGENOM:HBG718694"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI00003B6106"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW90"
FT                   /transl_table=1
FT                   /translation="MPPLDKRIKKFLKDSVRVAPKISSKGELAELRAGLVSPYSQTRKD
FT                   AIKKTIQQMTLGKDVSSLFPDVLKNIATNDVEQKKLVYLYVMNYAETHPELCILAVNTF
FT                   IQDAQDPNPLIRCMAIRTMSLIRVEKILEYIETPLRKTLQDDNPYVRKTAVICVAKLFQ
FT                   LNKQLCVELGVLEDLQSALDDSNPMVVANATAALVEINNMDPTAVKLPQLIQSHVSQFL
FT                   LALNECTEWARITILTALAEYSARDGVEAQDIIDRVTAHLQHVNPAVVLATIKVIIQNL
FT                   PLIIADNSSKRASIMKKLSSALVSLMSTPPEMQYVALKNIRIVLEKYPELLTKELRIFY
FT                   IKFNDPLYVKVEKIDILVRLVDPSNLKQCNLLLAELKEYAMDFEPEFVSRVILALSQLA
FT                   IKYSDLPFIQKVMDILVELLEVREKSKDDCCSAAIDLLRHTNNNAELAKQLCSVLNSWE
FT                   SPEIELTTDAAKCKYIWIMGQYPRLFSSLESKMKGFVDNFVNENTSTQMSILITTVRLH
FT                   NMLPSDLLQSVLDTSTKETKELDVRDMAMVYWRTLSLPNVDELINSLCSSQVPQINSTI
FT                   DQFSPELLEKLLRQLGNISSINFKLDSGNKRVKYVQNIVNNKQLEELQDIAKNELENKA
FT                   NDDVLLDFGDEDDDMMSTSNNNNSTPQPSALSELDDLFGFSSTNATVGSVSQKVENLNI
FT                   NEKKSTTTQDLLDLF"
FT   CDS_pept        join(214357..214893,215564..215860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043512"
FT                   /locus_tag="CAGL0D02090g"
FT                   /product="Similar to uniprot|P38011 Saccharomyces
FT                   cerevisiae YMR116c ASC1"
FT                   /protein_id="CAG58416.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B6107"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW89"
FT                   /transl_table=1
FT                   /translation="MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISW
FT                   KLTGDDQKFGVPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFV
FT                   GHKGDVMSVAIDKKASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSDDD
FT                   DKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATASGIKIFS
FT                   LDPQCLLDDLKPEFAGYTQSAEPHAVSLAWSSDGQTLFAGYTDNVIRVWQVMTSN"
FT   ncRNA           215062..215155
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="SNORD24"
FT                   /db_xref="Rfam:RF00069"
FT   CDS_pept        complement(216204..218489)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433326"
FT                   /gene_name="OCT1"
FT                   /locus_tag="CAGL0D02112g"
FT                   /product="Mitochondrial intermediate peptidase "
FT                   /EC_number="3.4.24.59"
FT                   /function="metal ion binding"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG58417.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG056557"
FT                   /db_xref="HOGENOM:HBG562792"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00003B6108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW88"
FT                   /transl_table=1
FT                   /translation="MLIQKILLNKEISRLPRILSILNYTGLRWLSGSSGRNTTELQRIF
FT                   DDSKYWQSLSENTTQYTKETGLFKNPYLTSTDGLRQFSHDSLHKAHKLAEILRNSVSKE
FT                   EKVHYIMNLDQLSDTLCRVIDLCEFLRSAHPDQSYVEAAQMCHEEMFEFMNVLNTDVVL
FT                   CNKLKEVLEDPEILKVLSEEERKVGEILLDDFEKSGIYMKAGIREQFIELSQQISVIGQ
FT                   EFINNTDYVAKEFIKVKRDEMDKSGISPLLTARLNRDLTGKYYKIPTYGQIPLQILKSC
FT                   PDEDIRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENV
FT                   KGFIKTLMNVTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKYDSD
FT                   NEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGITLQPSRTENGETWSPDVRRLDVISE
FT                   EEGLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVI
FT                   SLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCATDFVE
FT                   LPSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLD
FT                   QKLHGSFSLSDIERIDSAKIYQKLETRLQVLADDESNWCGRFGHLFGYGATYYSYLFDR
FT                   AIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGLKNPWSCIADVLEKPDLAKGGAEAMT
FT                   YIGDSEDL"
FT   mat_peptide     complement(216207..218378)
FT                   /gene_name="OCT1"
FT                   /locus_tag="CAGL0D02112g"
FT                   /product="Mitochondrial intermediate peptidase "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW88 "
FT   transit_peptide complement(218379..218489)
FT                   /gene_name="OCT1"
FT                   /locus_tag="CAGL0D02112g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW88 "
FT   CDS_pept        complement(219065..220477)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433327"
FT                   /locus_tag="CAGL0D02134g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58418.1"
FT                   /db_xref="HOGENOM:HBG059436"
FT                   /db_xref="HOGENOM:HBG397959"
FT                   /db_xref="UniParc:UPI00003B6109"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW87"
FT                   /transl_table=1
FT                   /translation="MLRRVILVSRFGVRSFGQSSRWRQISASANRAYSVENGIDEAPQS
FT                   DKSGRYSRLAMRVVGAAVIGVGLWWFYWPHHTFPSSVATILRKGLWQETEKFGKNYHRG
FT                   LQYYRDALKECDKLGVDPLSDEYTGIEIKIAEMHERLDDLENACEIYDHIMQKYLDYLL
FT                   TTSVSDLDKVGRYIKRDLSVLIKYLQHRDDKYLGKTMLLHHLRVLQNVIYTRYPEISEF
FT                   LQEQQAVLDTVVKPTSEHRPFEFIDLADGSQTAIGKKLSGEMLDDVVGLFKDELFTALD
FT                   LFTQYCLQSNDVPAALRNQLMTVQLMSLANVKKSQILFSQANLGSILYLQAEKIEGVLY
FT                   KLEKEKSSLENEVATDTSKDNEENYYLNLLHSNHDRYVKLSLQCFQGVLNSAEITDNFE
FT                   EMLDPLSMKAAALAVYGIGVWNIHEGNLKKARKLLKESAKFAKETSFDSLLKEAEKELR
FT                   KVRKMIKQEKVG"
FT   CDS_pept        221349..221579
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500015"
FT                   /locus_tag="CAGL0D02150g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAR58012.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00017BD731"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMY8"
FT                   /transl_table=1
FT                   /translation="MVSTPELKKYVDKKILLQLNGSRQVAGVLRGYDLFLNVVLDDAIE
FT                   LLKDGEKQKLGSQTVVRGSSILSLEALDTIV"
FT   CDS_pept        complement(221692..222174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500016"
FT                   /locus_tag="CAGL0D02156g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAG58419.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG341300"
FT                   /db_xref="HOGENOM:HBG736206"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B610A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW86"
FT                   /transl_table=1
FT                   /translation="MALDPRYVIRRMTSEDYEGVVGALQVLTAVGEVSKEQFDKLLQYW
FT                   DSSLLFPEDEGKKQYRMYNPTVIYDTETKSVAACGNIIIERKIIHGTGMCGHIEDIAVS
FT                   KHHQGKRLGKHLIKRLTEIGFDAGCYKVILDCDEKNVAFYEKCGYKRAGVEMQCRL"
FT   CDS_pept        222597..224330
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194604"
FT                   /locus_tag="CAGL0D02178g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /function="catalytic activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58420.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniParc:UPI00003B610B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW85"
FT                   /transl_table=1
FT                   /translation="MSTKEFKEEIHTSTSEFTKYDSQKPYYSSGESPEPVVTKRNIFQR
FT                   CVDSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIG
FT                   WTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLE
FT                   IIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFII
FT                   LCIVLICGGGPDHEFIGAKYWHDPGALAHGFPGVLSVLVVASYSLGGTEMTCLASGETD
FT                   PKELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDNSPFVIAIKLHHIKA
FT                   LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSL
FT                   FGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFV
FT                   SAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCI
FT                   HKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFW
FT                   C"
FT   CDS_pept        224941..228159
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433328"
FT                   /locus_tag="CAGL0D02200g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG58421.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058881"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI00003B610C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW84"
FT                   /transl_table=1
FT                   /translation="MEGISIETSLLDIKDGIDKIIASGEPCDVNEVIDKIDLFQQDPEV
FT                   LDRELNGLIKKLTTGFFQLESDDKKIHIASVFYTLSKVCNVKKTYIHLDANVYLLEHIE
FT                   NAVRTYDSMELSTPVSSKILKWHYLYLAFCWLCVIVKAPLKLSNDSHLLQFIDDSITKH
FT                   EKVTVLQPLFAEIKAELLVKNRILLHKFCELLHETTNDENVIDYFEMLLIYRILKAIVK
FT                   SPKQFSIYRDDVGLIELLSWICLYQSDRLLSLERGAILMTKIFPKLLPFFIYHHNIEMI
FT                   EDIISWYLNNMNSKFSEFRFAIANSYKKVVEQLTNTYEDKDILPPLILERLTDTSNILN
FT                   NSSWDTVDSDRLHTLLLISAFSIDMIYKRLPNQIEEIIVKLIPLASRFQQRSISVIRGN
FT                   QVRDAANFICWSLARCSLENKSTIENIIFFLLTRSIMDSDYLIRKSANAALQEVLGRHG
FT                   YKIFDNNTILEFIQLPSFNLEKHLFSNLESIFEITNLNYPSFLSRLLFWLVDFGILDNV
FT                   DCETTLLCIYGLSHLAYKSAEKILKDFGITTKLKQLLSIASTLSTEKQTRLINLCLHLP
FT                   SAINLIEVLPILGSISEKVLSSQHKSLSQEDIFLHLTILKFWSVAINESKPVLLTHQDI
FT                   QLFFSIVRGAQATISNFSKFQEYSNIIVSQISNLGSSIFCTDDISRLFWTEYKKFIRFD
FT                   NILACGSLPYVHGEMFINILSEVLPLLFSQAKACIIKSIDDNTQLLKPFIQTKDFMYIM
FT                   SDFLDDYTVTDQGDIGRHVRMQAVQFYMNNITMFHHIDNVILQKVETSLVRLMAEPSFS
FT                   IREMSYQLLCKIYSYNEVLESNKSYEYSILIFQKNIFKNDNIDFWKGYCLNGGAIYSTD
FT                   LQIATAIDEFIKFYTNEGIDEKIKLCNYLAKIIPAAQKILDERIKNKKKSITGGKEYDI
FT                   VKFTISATIFWRRLIESQLEVPSHFNFNGLFARVYNIHLLNINKVMKTNCIKLFPLIAI
FT                   AASRSQADNEKHLANSILKKMIILMKRLPTTNNQQPLYKKAYLEGIIQILLYYKADSQV
FT                   ELLQATGDTDYELTKLKDEDILLS"
FT   CDS_pept        complement(228285..229223)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500017"
FT                   /locus_tag="CAGL0D02222g"
FT                   /product="Similar to uniprot|P24720 Saccharomyces
FT                   cerevisiae YOR350c MNE1"
FT                   /protein_id="CAG58422.1"
FT                   /db_xref="HOGENOM:HBG124466"
FT                   /db_xref="UniParc:UPI00003B610D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW83"
FT                   /transl_table=1
FT                   /translation="MMLKRYTPGLNIRNYQLLCYTSKRYQSDNSISKLVTDVFPQPKRS
FT                   KFLKVQYDTRAWITKYIDFSKLKEKDDRKDHSALDLSMIIKKLQQLRNENRRKIYFRVL
FT                   TLLNTSNIDWIANSGKTLKGRIPKELYHECIKMLKNINNRIDDEASKVTFAKLGIGMIK
FT                   SYKRMESGDIGNFKQNERGLVFYRDCLQLISKADSKQLYNEVIKELNSEEYKLLKIWFQ
FT                   IAWYLHTKQNIELKLTIQTLVSSIGNDDVILNNAEKAIFIPILIKSLAEFITCNNPDGI
FT                   RQLAHIFTKWEDILTADDKERYKLLSNKIMV"
FT   CDS_pept        complement(229504..230967)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194605"
FT                   /locus_tag="CAGL0D02244g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58423.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058882"
FT                   /db_xref="HOGENOM:HBG396527"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020647"
FT                   /db_xref="UniParc:UPI00003B610E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW82"
FT                   /transl_table=1
FT                   /translation="MDSYLEVIGDFKPGEVLLSGQWGHRVVGHNLAGTPRPRVYIELHN
FT                   PIKIGRSPKENCMCISNPAISAIHCMVWMILFDETSIPMYYLRDCSLNGTYINGTKLLK
FT                   ENVAILNDGDLIELCENGGKFLKFSCQPSTPSLPKKITINYTENVDNWNISNIVVGNGT
FT                   FGYVLIAYMGIGAHSGKSSQKITPKCYAVKIVKMKLSKLDKEAKILMQLNHPNIIKVFK
FT                   THTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVFVYQILHALKYLHTKGIV
FT                   HRDLKLDNILLCTPEPFTKIVLADFGIARTVTTMKSRMFTVVGTPEYCAPEVGFKANRK
FT                   AYHSFFRAATLEQQGYDSKCDLWSLGVITHIMLTGISPFYGDGTEQSIVENAKAGILNF
FT                   NVSQWSTIDIMAQNFVSKLLEVNVDKRLDCEQCFNHLWISKHQKSLKEIYEKKVLLRFS
FT                   EKNQMGQPKTELETKYLIEEKINHKGIVA"
FT   CDS_pept        232229..233164
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500018"
FT                   /locus_tag="CAGL0D02266g"
FT                   /product="Similar to uniprot|Q08816 Saccharomyces
FT                   cerevisiae YOR352w"
FT                   /protein_id="CAG58424.1"
FT                   /db_xref="HOGENOM:HBG058883"
FT                   /db_xref="HOGENOM:HBG202927"
FT                   /db_xref="UniParc:UPI00003B610F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW81"
FT                   /transl_table=1
FT                   /translation="MSEPPTPVHAGPNEQLDIDDIKELSDEDIEELDLKPDMDTDSLSE
FT                   KHQGEYVQENGAVKREHSILSNEELYGEDERSDFQPRVNINSPFSSYANLRALDDRARP
FT                   KPQRRLSMSQQSKFIAYCDQKLMDIQRKFVQSRGLNTQNGYQGLEPLLQDVKCLVDFIW
FT                   YSLDGSPNTDVLLTEELQSDDSMGMKMNNNNMAKDTYFGQSSYLIKIADDLLDYIEKFD
FT                   LKFLSGEELHQTLSKLFKLLFILDRIFSKLIDGDIPGGKRLNGTESVRVNGIAERTRMK
FT                   LPVIFESQDLHGYHFEVSKVYENTLERCSR"
FT   CDS_pept        complement(233487..236093)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141967" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433329"
FT                   /locus_tag="CAGL0D02288g"
FT                   /product="Similar to uniprot|Q08817 Saccharomyces
FT                   cerevisiae YOR353c"
FT                   /protein_id="CAG58425.1"
FT                   /db_xref="HOGENOM:HBG058884"
FT                   /db_xref="HOGENOM:HBG202928"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR019487"
FT                   /db_xref="UniParc:UPI00003B6110"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW80"
FT                   /transl_table=1
FT                   /translation="MPLANEKYNDDSSKGSQAMNELSIDEMREVIDHELTQQESKNSST
FT                   VKLIGLNLKTIPPEDIKLLANAERLSLRKNNITYLPENFSELKNLRYLDLHSNGLREIP
FT                   VELLNCQKLEILDISSNKISQLPEEFPSVFSTRLKVISLKNNRLTSIWKLSPILQLNHI
FT                   KVLEIEGNPIPKEELDQVLSYVPNQQNLPKDEYWAIAIPRFLNNHPKMKVQSLESKLSR
FT                   AAKRMGFVNTIPVTDEQLNDSSISSATISEHINNVTIAKENFTDTNMNTPNVLSSNDLY
FT                   NHTKYNDYFKRLSILPEEVNQEQHKVSHTDLVVACRKLLFSFTECQQAIRKITSLCKEK
FT                   SIAVNVVSLLYSVRSHIDNLVEILEQSDNQEISNDQPLITLCMTIISIFKQIIALLQKN
FT                   FKAFFEEDDLCFIRMFFMSLVCSYTEMYNAWSFITPQETLLLHKKSASNNSNKIQPESD
FT                   GHPAIIRSKSEANSRTDHVGLSRKPTLTNVSKPDIAGVRLSNEEKTRYHDAVSDQESSV
FT                   EHNESGIPKVARSRSNTIQGRGTGSLLNVNGSKSNIITSPNGVSQLRTQGQLPTHAVAT
FT                   TNSTQEQGSSDKHKMNISNLAKTADNRGGNFKNPPDEKQINNELQNGNVSLTAPKLKQV
FT                   QQPPLTEKGGISTPTGTDVDIDQQLHETLGTVVKMVTMVYNQLTSEISKVALASSTGHQ
FT                   VLTDTLATKIKDLTDTCRQLLQLSQVLGERLRLLTGDGITAEKYSTTSEKLKTWESINA
FT                   FLKAIISILANAKTLMADLPSLNEVRPQLASLAKITKDVTVILDLSSYKAVSVAAANQE
FT                   ALQHNNNNSETKSGDSKSPVNESAISGDHSHTDIANVPLFTPQAASAYMRDPFDQQ"
FT   CDS_pept        complement(237084..239213)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043513"
FT                   /gene_name="MSC6"
FT                   /locus_tag="CAGL0D02310g"
FT                   /product="Meiotic sister-chromatid recombination protein 6,
FT                   mitochondrial"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="meiosis"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG58426.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="HOGENOM:HBG124467"
FT                   /db_xref="UniParc:UPI00003B6111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW79"
FT                   /transl_table=1
FT                   /translation="MLRINQRLLVRSLRDAQYQYLKSTALRFLSSSTQSNVETTPRRSG
FT                   RLFELNKEYTGKLAQPDGKANIESLYNEFKNDLDKISEFSNGRQGMAPKYGRSRSLSFI
FT                   NRLFQSITNAKNTSSLDPYVVLEQLSKYNLIGPAQYEMILRYYLLVKDAPKDVISLWVK
FT                   YLEQFTTSNENLMAYTTIAYLKLPDMNEPDCSMLQQILQTERFHTDIPFGRIISIVEQN
FT                   EVLKRDQELSNRFAYLLNLYATQNKTWFINQLDICYTESRLRSFYNIYSAQRDINNCDI
FT                   EIITKFMEQFNKLNANSSFPMQVFNEYKDKLSDADGFKLKLGLLDIVSKYPAPSKIQKL
FT                   QRLLAVWNSYLKPEFGKVGIDASLAYASLIKALNTSGNIEELQNIWEKEIPTEYKNNQV
FT                   VFEAFLLAIIRRTKITYSQIQNRIDATKFGKLKSVDLAEAIALKIFNENPNDSKVFDDF
FT                   YQQNSLDSFGSNTSILALKTYGDYIYKTKTDDETYVIANDVRSKVLKLKPQISTQSWKQ
FT                   EVNLILEKFIDIAPSIIPVRVLFEQRGIYQLNFTLQKKILFSEFRKPDGDVQNAEKIFE
FT                   ELMKTDNNKVSQPMRINSPQLMGTMIKGLCQVIGRTHDVSLYPELSKYLEMLPGLEVHM
FT                   SINWMEQVLRTIRMVFRSGSTKTIPKELLEFSEFIIEKLPAIDPDFNYQFRNDDIAMFK
FT                   KIGAKSFSKLKSTST"
FT   mat_peptide     complement(237087..239126)
FT                   /gene_name="MSC6"
FT                   /locus_tag="CAGL0D02310g"
FT                   /product="Meiotic sister-chromatid recombination protein 6,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW79 "
FT   transit_peptide complement(239127..239213)
FT                   /gene_name="MSC6"
FT                   /locus_tag="CAGL0D02310g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW79 "
FT   CDS_pept        239710..242241
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433330"
FT                   /locus_tag="CAGL0D02332g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58427.1"
FT                   /db_xref="HOGENOM:HBG059786"
FT                   /db_xref="HOGENOM:HBG202454"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI00003B6112"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW78"
FT                   /transl_table=1
FT                   /translation="MTYSFKCCDDGSGIASGSILRFDNVTILLDPGWSSYKVSYEDSVA
FT                   FWSNIIAEVDIILISQPTTECLGAYTFLYYNFISHFISHIQVYATLPVANLGRVSTIEF
FT                   YVTKGIIGPYQTNQLDIDDVEKAFDFIDVLKYSQLVDLRSKYDGLSLFAYNSGYAPGGA
FT                   IWCITTYSEKLIYAPRWNHTRDTILNAANLLDNTGKPLSSLMRPSAIVTNFDHFGSSQP
FT                   FRKRAKSFKDILKTKLSNNGNILIPVDIGGKFLDLFVLVHDFLYENGRNNKLANIPIVL
FT                   LSYTKARSLTYAKSMTEWFSSISAKTWENRNQKTAFDLDTPFSVVDSNELANLKGPKIC
FT                   FVSNVETLVNDALSILGSDNNTLLVLTTDNRQEVPALHTIYDYWKENNTESSIESANVL
FT                   KLNQKITINTTTFKELQNEELDAYLSKLEQRKRKQLITEITTRKGLKKGAAVALPTNLA
FT                   SDEGQKTEVDLVDDITNTEDLEKLLEEEEEDEDEDNEDNLINILEDEDRADGIEESIPV
FT                   DIIITPGVNNKHKIFPFQPLRQKKDDYGIVVKFDQFVPAEDKDDITPSKRHINGDNEED
FT                   MDDDYVIKEASNKKIKSDSVNQPTKETKFSDDINHLRNSNRPGIREFKATEVNLNMSLT
FT                   FINMESLVDRRSCGVIWPLFKSRKLILMGPSNVQDKHVTGIITSKTMEVTSLAYNQSID
FT                   FDTTIKALDITISPELDALLKWQRISNDYTLAHVTGRLVKESAHQSSAVPVTDNTTSSG
FT                   REKYVLKPLNGNVGVQTNGSLAIGDVRLIKLKQNLNATNHTAEFKGEGILVVDDKVIIR
FT                   KISDSETIIDGPPSALFYSVKKLVMDMLAKI"
FT   CDS_pept        242706..244103
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433331"
FT                   /gene_name="BBP"
FT                   /locus_tag="CAGL0D02354g"
FT                   /product="Branchpoint-bridging protein "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG58428.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG124390"
FT                   /db_xref="HOGENOM:HBG605582"
FT                   /db_xref="HSSP:1K1G"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00003B6113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW77"
FT                   /transl_table=1
FT                   /translation="MSERREEERGRTGFSMKKNHNSNFNRRNQEQIHQKLPTKISGPLT
FT                   LEQLCAYQHMFRIQEISSIIKSHSFEVPNARNRSPSPPPVYDAEGKRINTREQLYKKKL
FT                   MNERFKLVEVVSKLIPGYSAPKDYKRPTTFQEKYYIPVSQYPQINFVGLLLGPRGKTLR
FT                   KMQEDSGCKIAIRGRGSVKEGKTSSDLPPGAMDFSDPLHCLIIADNEEKIENGIKACRN
FT                   IVIKAVTSPEGQNELKRGQLRELAELNGTLREDNRPCATCGQQGHKKYECPHRETFAMK
FT                   IICRRCNQPGHTIRDCTSDSNYGKQIHSSRYNNEMPYHRTSTAVDQPSAYSRYGYTPRN
FT                   HNGSSRFNDNSKYLNNGNKRATPQPELELETSHKRQQINPTSSSQDTLSHQTNHMTMTT
FT                   IEDSGIDKLQLPAGMSNENPIPQPVNFNEIQINDVSGPNGTLEAPPGLDLGNNDSNITL
FT                   QGPPGLN"
FT   CDS_pept        complement(244241..246328)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043514"
FT                   /gene_name="CLF1"
FT                   /locus_tag="CAGL0D02376g"
FT                   /product="Pre-mRNA-splicing factor CLF1 "
FT                   /function="binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG58429.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG068482"
FT                   /db_xref="HOGENOM:HBG611628"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI00003B6114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW76"
FT                   /transl_table=1
FT                   /translation="MTEIPAKQITDNDILKDVYKSQNKQFSIDAIDILDLEELKDVQRR
FT                   KRTEFEGYLKRNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIES
FT                   ELKLGYINHARNILERAITKLPRVDKLWYKYLIVEESLAHFDIVRNLFQKWCSLEPAAH
FT                   VWDSFTDFEVRQERYEDVRNIYSKYVLIHPQFSTWRKWINFEVRYGSTKTVRSVYSLAL
FT                   DALIAYSESRNELVDDCINLIVEFSKWEALQKEYIRSKSLLEIAIQKWPKSNTLNNALL
FT                   QFEREHGTAETLENTIILNRKKHYEDILNEKVYDYDTWLLYLQLLENNYPKLVMEAFSN
FT                   VLNAAIPTSRTKDKYWKQYILIWIKYLTFLELTINDIPLCGQKFEELIHNIIPNDDFTF
FT                   SKIWILYAEFEIRQDNLEKARSILGRSLGLCPKRKTFKYYIDLETKLREFDRVRILYEN
FT                   FLKFDPLNLDTWRAYVEFEDSLGDEVRVRSVCMIPIQNNIGLFSKSFQLHLLEILIDYE
FT                   MEYQNFDNIEPLLKKQVELSNFTVEAWTDYAMKKLTVPTEEQVQNFQIMKEERLKDSSA
FT                   LDEQEIEFEFEITDNNKDNARDVFERALNYFKEIKRDEDRARILQSYVDFEGQYGDISS
FT                   RQRIEKRLPSIVNGIKDIDGLKTQNITYTFPDDENKSNIDTSNILALAHKWKESQEAKS
FT                   R"
FT   CDS_pept        complement(246787..247479)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500019"
FT                   /locus_tag="CAGL0D02398g"
FT                   /product="Acyl-protein thioesterase 1 "
FT                   /EC_number="3.1.2.-"
FT                   /function="carboxylesterase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58430.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="HOGENOM:HBG398734"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI00003B6115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW75"
FT                   /transl_table=1
FT                   /translation="MSTAVRIASTKKPAKYALIFLHGLGDTGQGWSFLAQYLQQYHPCF
FT                   ESTNFIFPNAPIKPVTANGGMPMPSWFDIKVWDWTTSNVDTVGFQQSLKEVQKYVDSSI
FT                   SDGIEPQNIIVGGFSQGAALALASAVTLNNKIGAFIGLSGFAYLRNELQETRKNLNPNT
FT                   PVFHGHGESDDVVPFPIGVQTAEFFKSAGELENYTFKSYRGLGHSADPAELNDLAEFLK
FT                   SNVYSKDA"
FT   CDS_pept        247761..248318
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347857"
FT                   /locus_tag="CAGL0D02420g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58431.1"
FT                   /db_xref="HOGENOM:HBG124391"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="InterPro:IPR017435"
FT                   /db_xref="UniParc:UPI00003B6116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW74"
FT                   /transl_table=1
FT                   /translation="MDKPPILPPREDAVALEPANDQPKLDVKLPVNINLLSYNELLELI
FT                   NQHRDKLHWFCASMDSFEPITEEVKRLKNQFKELEEKFSKLEDGKVVIQDQIAELVILE
FT                   SEYTKKYQNLQQLIRSNYSKDVAKRTMLNKIKENEQKCDELEINAKGSLDLDVFLKSYM
FT                   DFKLDYHMQKQKLNVLSAQNNF"
FT   CDS_pept        complement(248731..249984)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433332"
FT                   /locus_tag="CAGL0D02442g"
FT                   /product="Similar to uniprot|P42838 Saccharomyces
FT                   cerevisiae YNL323w LEM3"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58432.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG356600"
FT                   /db_xref="HOGENOM:HBG525157"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniParc:UPI00003B6117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW73"
FT                   /transl_table=1
FT                   /translation="MVKLDLTQVNNVFRKKEHEYQEDVPEEEDVDASEFEDDDYVPVKT
FT                   KNRRPKEDNFTQQRLASINPVFTPKSVLPIYLLVAAVFVIVGGCLLAQSSRVDEITMFY
FT                   QDCVTAAPKDNFQDMPDDHFNYIFHNHKDFNTKPQWRFVDDPSDDSNERGTCQIRFTTP
FT                   ADLKKTVYVNYVLEKFAANHRRYVLSFSEDQIRGKRPSLHDVRSNTGINCKVLGHDSEG
FT                   KLIYPCGLIANSMFNDSYPFELQNVQDSTKNYPLTNKRINWHSDKKRYKKTKYNHTEVV
FT                   PPPYWAKAFPNGYNETNMPNINEWEEFQNWMRPAAFDKQTKLIRKNTNDTLPAGEWQID
FT                   IGLHWPVTEYNGKKGVFITHGSSIGGRNPFLGEVYLIGGCICAAMAIVLALAWVMGGRK
FT                   IADPTALSWNKDDSFRLK"
FT   CDS_pept        250405..253020
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433333"
FT                   /locus_tag="CAGL0D02464g"
FT                   /product="Similar to uniprot|P42837 Saccharomyces
FT                   cerevisiae YNL325c FIG4"
FT                   /protein_id="CAG58433.1"
FT                   /db_xref="HOGENOM:HBG434519"
FT                   /db_xref="HOGENOM:HBG676929"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniParc:UPI00003B6118"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW72"
FT                   /transl_table=1
FT                   /translation="MAGGYESYSDAGENLADVREDSPMKDVDDVTVAQKPRSSKFVLSK
FT                   FTIYEAKDRMYVVGSNKRESMFRIMEIDLTVPCEELSLLEDNVFFTRNEVMDVLSRLED
FT                   ASSDGLTKILTCDALLGFIRFTSCYYLVVVTKISQVAVIGGHSIYHIDGTELIPIMSKK
FT                   TFKTPERSSPEARLMNIFKDLDLTKTFYFSFTYDITNTLQTNLLREKLKAIGRTDISIP
FT                   YDIFGYNDMFMWNNNLLEPVLSCLESVYDWFQPIIHGFIDQVNVSVLGKSVYITLIARR
FT                   SRFFAGARFLKRGVNNNGYVANEVETEQIVADMVLTAFHKSGMGYFDSNRYTSFVQHRG
FT                   SIPLFWTQEASNLTAKPPIEITVRDPFFSAAAIHFDNLFQRYGGGRIDVLNLIKTKEKV
FT                   PRETKLLKEYEECIKYLNSLIYDNNMISYTSWDMSRESKQDGQGVIEFLESYAIDTITS
FT                   TGIFHNSKDFKGTKIQQGVCRTNCIDCLDRTNAAQFVIGKRALGVQLKSLGIIDDSFLE
FT                   YDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWKSHSRDMIESIKRFYSN
FT                   SFMDAQRQDAVNLFLGNYVWKEDQPSLWEMNTDHYLHNDFGLEETKRSYTHWWNNHHVI
FT                   KLGDLIRNEVTEKNNDISRANLIANIRGYPAAFDNYWNEYYTTKVVTWLHELFAYNMNS
FT                   TRRYHQLKKYSGKDSSPFKSRKQSWINKKVKGSVIDSPIDLNSPEDRKLDVIKDEKCLR
FT                   ITSTDELLFGNYQLTSLVNKRNHIANLLHADEISLERATSTGYEDEHCCSTIEDRFEIE
FT                   RYGNNDNLYSVIDITTSIGYYKEIRVDFDYYTRLGQVDRYKELENYETYFDNHSWEPIM
FT                   "
FT   CDS_pept        253763..256399
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433334"
FT                   /locus_tag="CAGL0D02486g"
FT                   /product="Similar to uniprot|P25611 Saccharomyces
FT                   cerevisiae YCR106w"
FT                   /protein_id="CAG58434.1"
FT                   /db_xref="HOGENOM:HBG124392"
FT                   /db_xref="UniParc:UPI00003B6119"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW71"
FT                   /transl_table=1
FT                   /translation="MYDKNRHFSINSMLDHRSNHSQYLGNNIRTTDSGTSENPSTENKE
FT                   RTKELEFSSTMNTTEKNYSENIANMLTNSSAYQPINEITPESLSASGRKSLECNGETAY
FT                   DSILAENDLDDMILELFNPNNMIVVYGNMTYIDSPFALHTLAQLDAFARALCGALHGNT
FT                   MIELHSKLLLCPQANNYAEMLSQLQPPSPVAELNSELSTLPYIKQSIIKWVESSEKNQY
FT                   CAIAIGLSHKTVSLDETMSPQLYAGLQLLVYDIENKFTTVVETEYILKNFFENIYPFYP
FT                   FMELCSFKSNLNKICETSENGRYKFNIISKNNTQSDFETFCLFNVVLAISFRQLMVESD
FT                   VTFLKSKDVESVIKNLYSNSQKLLIMLDTYKNTNESSFCCELYAFLLSYLEPNAELTCL
FT                   THEKIGRLKSLNEIALTLGLHHNPSKYTRYFNELEPDPKILKFRRKLWLGLNTLKMEIL
FT                   IPNGVANRLDIDYMNAFISPERSLAKILQNDFHSIGEIDASILQRYDNKYQLQLILNEL
FT                   VISCTPVSNNVHFGEVVQNLKRAKNFLIANFSITDCEMLEDQTLLYKVDPNIEINLKST
FT                   KNVELIINYINGYTCIMCVYFVLATKFEELSRQDWRKYEKYYHKFLIEAIESNVKLDTL
FT                   VMGYLEGKYAKFIDTKHRYVLDRIVSNLVIKLWTLKSCFLTRFSYKRYVTERLERKYRA
FT                   EKMAYPEANLLPVLIRIINLLNVQMYRSVELLRSNISAEYYTRSYCSPMFQYIVNIIEK
FT                   GKLVEVVNKFWDRTFEAANVPSLLLKSVNMKWGLDMKNPQIIKYHLISPEGLQCMNKKL
FT                   LEGIENVLNVHLVDCRDCEAIWDSNEVADTASTESGNFDQFFETNFDLFLGAFNNSLGD
FT                   FPKITFD"
FT   CDS_pept        256760..257758
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433335"
FT                   /gene_name="PFA3"
FT                   /locus_tag="CAGL0D02508g"
FT                   /product="Palmitoyltransferase PFA3 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG58435.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124393"
FT                   /db_xref="HOGENOM:HBG396839"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI00003B611A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW70"
FT                   /transl_table=1
FT                   /translation="MNLVNNFSKLFPRCLTTGLYLWSLYAIVVCIHVIRARVVLPLVFT
FT                   IAMVALYTYAKLIYVGPGTTKEYSILRVYDLNAAESGFELPPEMLVKRSYTQKRNGRFR
FT                   VCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILV
FT                   LILSSMEIYTWFKGEFFEVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQTTIE
FT                   LYSLRRYNEEVAFLNEFSNEPIKGTINIFDLGKKLINWEEVMGYSLIEWALPISRRPSS
FT                   LDLEGSHSHGLFFNVNKNVSKTMNESVDLQDRLLRRLTPRSSLDVDRSNFV"
FT   CDS_pept        complement(258073..260103)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194606"
FT                   /locus_tag="CAGL0D02530g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58436.1"
FT                   /db_xref="HOGENOM:HBG124394"
FT                   /db_xref="UniParc:UPI00003B611B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW69"
FT                   /transl_table=1
FT                   /translation="MKFTTTFLLTFMSISTSIFANAQKGFLTDIQVFDTHSGSNNSTDP
FT                   SHWFLIQGQVFVPQDAKNSIPFTVPDEFDSFPSGDFPLSYNSKIIGSINKADDSNNFDI
FT                   QLVDSNILQNVSTTFNFLCKLSSKGLSEIRSPGSVSYTFTNGDNVEFVRNINYLATDPT
FT                   KINTNGGIYQTNNTAWFTLDIPISQFKRPIRIQSTPSVPNAYQFDASKTTFKVVTKLNK
FT                   FNQPLATVPLTAVHDYSTNSKIDVLFNSSFSGGEYVRITYYSSQLYSKTISNNLNISYP
FT                   ANDLSKRDVVDPSEININTNLYAAPLDNLSHINVSTPNPDVSKNSTMTPLPAYTNGTAS
FT                   NVTKSLEVIPTYSLDHSTVSAIVSEYGVWIPVSTLNGTTSSKMMIQSKIVRNDTTTSTP
FT                   TATPTSRPDEFTNSTSSSSSIMYHNSTITTISSSQTDYSSAATSSSISSSTSKFTNTTT
FT                   TQSLKQTVTKTVCPTCEKADNETQLSTIASVYQSTISEQLSEYEFLEAASTIQSTKQTS
FT                   STKASTSSKVKSTELSVSEQVYYSTKPASKSVYGDLEAVSTLSSKSSNSVAHSVEVSAS
FT                   KSLSTKSAVVTDIGVLEPVSTLKSSSSPKPTNNIVSGKVETTSTAPAIISLYTSVQAST
FT                   LSTVHPGNTTTSHVVSIYQGGSSSLTIQFSTIIIGFIALLL"
FT   CDS_pept        261991..262422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433336"
FT                   /locus_tag="CAGL0D02552g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="heat shock protein binding"
FT                   /protein_id="CAG58437.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG435009"
FT                   /db_xref="HOGENOM:HBG526913"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI00003B611C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW68"
FT                   /transl_table=1
FT                   /translation="MVLPIIIGVGVTLVAWTTQSALRAWQIYRTLTPGMIAAMNGIKLT
FT                   NFRSKYASKFHSDRLNPGLKMQLNKWEGGFYHPMSESEALMILNITQKEIMSLNAPLLK
FT                   KKHRLAMLKNHPDKGGSPYLSAKINEAKELLEKSVLTRK"
FT   CDS_pept        263063..266116
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347858"
FT                   /gene_name="PEX6"
FT                   /locus_tag="CAGL0D02574g"
FT                   /product="Peroxisomal biogenesis factor 6 "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="peroxisome organization"
FT                   /protein_id="CAG58438.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG060100"
FT                   /db_xref="HOGENOM:HBG396289"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI00003B611D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW67"
FT                   /transl_table=1
FT                   /translation="MMITADLIWDENLDNDCEVSKDIWEDDTFIDKSYLKVVLPSYDGV
FT                   DTPIVYHFKLNDDLKINSIKIPTNSIGNLGKFGRLNTCSLEAVSGEPPVLKEIIIKIDE
FT                   RLYDKLALLPKANEKKQYFQIKYNLVNKQSVIHEGNIWGHVCEVVETKPFSQGVIDFSV
FT                   TDIVLIRSKILSVENKHDRSLVNLQAFHDLSRIPLKCLHYPVERSLLLPEPPFDDDDSI
FT                   YVFFPFDLLSKLKISSGSFVRLSNSKNSVLVRAFLLQSPNHYAVDGIYTTPFVLAQFDE
FT                   LPLVEVEPVYNNELAFPTASEVVISKVGNVLHTQKRYQELILQKLRYYFLTARRILSNG
FT                   SLIPITIDSSFDEIILEDIDLDVNTIKSDDDCIVWFVVSNRKFENISNYDPKAEFFVDP
FT                   KHTKLITSAMENRSLSSNTFNSALKYYGLPGVFHYRPDIFPVVNDIKNVINTHAEANKK
FT                   VPNLPMILNLSSNVPKVGKASILRSIAIDLSYQFVDIDTLSVVFSSGSSDIATTFLGYL
FT                   KGKLENLLPFTGNTIILIKHIDHILKKVDQNQDIQQSRQVKALEGDLISFIKSYSRIYP
FT                   GVVFAFTSASIDNLPEGFRSEIKFDYVVHPPNEKQRRSIIDELLSTSDLFQKYGNRKLR
FT                   IQCSNEIEISTLSLHSAGLSPYDIQYIISLAVADSLRKCNNYLLWRQNKIKVDMISIQN
FT                   ALEKVRSDYSASIGAPSIPNVTWDDVGGLSSVKDAIMETIDLPLKHPELFGSGLKKRSG
FT                   ILFYGPPGTGKTLLAKAIATNFSLNFFSVKGPELLNMYIGESEANVRRVFQKARDAKPC
FT                   VIFFDEVDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSSDGDGVFIIGATNRPDLLDE
FT                   ALLRPGRFDKLIYLGIADTREKQANIMRALTRKFKVSSDINFDELVSDFPFSYTGADFY
FT                   ALCSDAMLKAMTRISKEIDEKVDKYNQDNGTSISIRYWFDHVCSDEDTDVIVKKEDFLN
FT                   ANKELIPSVSQQELEHYKQIRANFEDSK"
FT   CDS_pept        complement(266641..267390)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433337"
FT                   /gene_name="PSF3"
FT                   /locus_tag="CAGL0D02596g"
FT                   /product="DNA replication complex GINS protein PSF3 "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58439.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG036635"
FT                   /db_xref="HOGENOM:HBG324670"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI00003B611E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW66"
FT                   /transl_table=1
FT                   /translation="MGYYDIDDILVDSTEVPCKFNYEIPGLGYLENNPGKPIRKNTKLS
FT                   LPLWLARVLAIVGADSQEQEDMDPNAEEEDGGDAFVELLTPDMFSNKVINAIKTDPKSL
FT                   DLHAINPYFLDMALKWIALYSDKDLGEIVYELLLERAQQINNYASSVSIDTEYGNKYRS
FT                   ALLDALRLQQNSANEDRSGPLASINGTSSLTTRSANNSGIGSSVGTSQATNLAASTRFL
FT                   LKLDEFERQLYKDTHDSYRDTKKWVSK"
FT   CDS_pept        268327..269073
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043515"
FT                   /locus_tag="CAGL0D02618g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="peroxisome fission"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG58440.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0016559"
FT                   /db_xref="HOGENOM:HBG325966"
FT                   /db_xref="HOGENOM:HBG435522"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniParc:UPI00003B611F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW65"
FT                   /transl_table=1
FT                   /translation="MVCDTLVYHPTITRLIKFLDTTAGREKALRLLQYLCRFLAVQQSS
FT                   ALAKGLQVQFTMVRKILRFLKPLNHLQAASKFYDNKLNGDDILRVGNVIKNLAYAGYLT
FT                   FDQINLLRILKLVPVTQFTGKKVPKLANWFWFVGLISGLVMDVRNIHTSQTKILTIASK
FT                   ASSVSPDGSDVEKPSDAQFAEETKAAYVTACKQRYAAIRRLVWDSFDTFIVLNNLGYLS
FT                   SSEDSIGLAGVVTSLLGLEDLWKGTK"
FT   CDS_pept        274285..275979
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500020"
FT                   /locus_tag="CAGL0D02640g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58441.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B6120"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW63"
FT                   /transl_table=1
FT                   /translation="MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTADVSAM
FT                   SPEAEAPPKPISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAADGS
FT                   YYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTT
FT                   WYQYFVGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYG
FT                   TKTHTNSIQWRVPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSM
FT                   DDPIVTAEIENISAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYF
FT                   FYYGTTIFKAVGLEDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMV
FT                   IFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVK
FT                   NRAMAIAVGFNWIWGFLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLT
FT                   LEEVNEMYEEGVLPWKSAQWLPTTKRTSGYDVDAALHDDKPWYKRFA"
FT   CDS_pept        complement(278099..279793)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433338"
FT                   /locus_tag="CAGL0D02662g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58442.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B6120"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW63"
FT                   /transl_table=1
FT                   /translation="MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTADVSAM
FT                   SPEAEAPPKPISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAADGS
FT                   YYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTT
FT                   WYQYFVGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYG
FT                   TKTHTNSIQWRVPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSM
FT                   DDPIVTAEIENISAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYF
FT                   FYYGTTIFKAVGLEDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMV
FT                   IFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVK
FT                   NRAMAIAVGFNWIWGFLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLT
FT                   LEEVNEMYEEGVLPWKSAQWLPTTKRTSGYDVDAALHDDKPWYKRFA"
FT   CDS_pept        complement(282249..284369)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043516"
FT                   /gene_name="NDC80"
FT                   /locus_tag="CAGL0D02684g"
FT                   /product="Probable kinetochore protein NDC80 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58443.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059487"
FT                   /db_xref="HOGENOM:HBG203030"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="UniParc:UPI00003B6121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW62"
FT                   /transl_table=1
FT                   /translation="MPNEQSEASVLSRLNPHRFTTQIPQHPLSQNMQRRRNSVSSAASD
FT                   SINSLKQSSARAVSNSNGIQKNNKKYMRSTVAGASGILPTYNKSMSFSQNKNLDDNNMR
FT                   ASLPVLERDLNANNFKSANNNPIGFSSFSQPYSGSRDPRPLRDKNFQSAIQQEIFDYLI
FT                   QNTFEIDTNYPISLKTLKQPTQKSFVTIFKWLYLRLDPGYTFTKSIEYEVYQLLKILQY
FT                   PYLESINKSQISAVGGSGWPKFLGMLHWLVTINLRLDKCLNTLDQNLLNQQTQDLTTLS
FT                   KPVENIEDQEVRQEKYELMAERLFIDYITDSYKTFLNLKDDYSDHMNELKAGFERYLHI
FT                   IKLDVNNIQSKNENMFEKFEISRNRVEKLKVARGKSTALNGDLVKFQKYVDSMKAKSEE
FT                   WPIKLSKIEDELNEKKENIKLITEEISQIQDSLQRKGLSVEQIENKNEQKLQLEKEIDQ
FT                   IAEKADEFVSLIKSTKVDNEKVFVTFQDSIRQYNDLLLEFLTSRRKLGHDIEIEPLKIT
FT                   LPNEVVVPNSENALTMDKLFPTDHPMPEYYQNMLLSINSDIMKRIETLKTDNQELEREI
FT                   GMLTEEINSRGSTNESLELKLSDLNLNLKNVRQENRAEILAQSLEIEKLERQITEGNKN
FT                   IEQKIANAERIVTELLNEKEVLYNEHSKFKSDLNLKIQKLIKEAHSLRFAVKDSTNRLN
FT                   ELIFTESSETDD"
FT   CDS_pept        284942..287245
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500021"
FT                   /gene_name="RIX1"
FT                   /locus_tag="CAGL0D02706g"
FT                   /product="Pre-rRNA-processing protein RIX1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58444.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058123"
FT                   /db_xref="HOGENOM:HBG203822"
FT                   /db_xref="UniParc:UPI00003B6122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW61"
FT                   /transl_table=1
FT                   /translation="MNKAIPVSVLADQLAESNGFQFHNILYHLKSSDYVDEKLLKSELS
FT                   VLVVKIQKLLNSNSNYSIWKGCHAAVVICTYNPLVLMAYGGKLLDIVYQKLEIKVLQRS
FT                   TNSLDAQGKQVLNSLVNAISVLMNLMRNKTGLSREFLVPKIKAIIPTLITLSQYEPELV
FT                   LPILRSLIFKHTTTFKPFNAKFKVILTQFLTEGFDTLNEHTQKLVCDCYAYLHMVKTQT
FT                   YQQQDEHSSHHKTFQDENWMNGMNAVLAEFKPLIELCGEILDFSQDEELTKLIGKMVPL
FT                   AAESTSIFRSLTMDMNKSTTLYDIPKRIDVLSKMLMSFISVPTTYTIRIPLDKLNVTCS
FT                   ALLSITSKHIPIKRELRRDIELNATINDVFTKIQFAGIRLYSTMVSKFGNVCFSYLSDI
FT                   FYALSLFIPFKEKSLNIDFEKCFALKREFLVVFDLVSKIIANVGHQLTDIDFLLQLIEI
FT                   GLDLTEERSLIQNVFQQTNAKKEQELSKTKNKNKKDNKRGSLADLYVSGSQFTLACDLK
FT                   TFDTLNKFFISIIANQKLATAQMTKLSRYAIFTAQTYKQNLGEVPTTFVELLRTLVIQP
FT                   GNERVTILPMAVNIIKESSDDVFDILSHPRLPMSILHSIEKSTFDNGEDDEDDNPDLHA
FT                   NEKQQEYNDQPVERSEQKVVDFVLEEPVAVDVKTKETVQFKDGITTSEDQVDTKRPRDE
FT                   EFIIEKSSSAKKFRTENQPETIPIGVSDETVYQETEKVTVNVDTSSNDNEDDEDDSDFE
FT                   IPAIELSDDDDEDE"
FT   CDS_pept        complement(287379..288308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347859"
FT                   /gene_name="AIM18"
FT                   /gene_synonym="FMP22"
FT                   /locus_tag="CAGL0D02728g"
FT                   /product="Altered inheritance of mitochondria protein 18,
FT                   mitochondrial"
FT                   /function="intramolecular lyase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG58445.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016872"
FT                   /db_xref="GO:0042398"
FT                   /db_xref="HOGENOM:HBG124395"
FT                   /db_xref="HOGENOM:HBG396892"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniParc:UPI00003B6123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW60"
FT                   /transl_table=1
FT                   /translation="MLRTLVRRSLIKNTGLATRATRLSAVTKRLQSSAPKPATEKSDKK
FT                   AWWIVGLVSAAFAGGTYVCTWEREELQKERDGKSVLVDDAVTPFPVVISRPTYPLSTKY
FT                   DILGSGIRSVSVLTFKAYALGIYIARQDKPKVAQVFDSTFMSKNFIDMDENKSHAENVK
FT                   IALDDPEKSRILIDNLLDSNIRMVAKLTPIKNASAKLLKEGIIKNVQMHPDASKNKETL
FT                   AMGIKEVEEAIKIKGPVPKDDDFLMELLADGSLKFSYYNRRKDIVNELGTVHQPLVGKY
FT                   LFAQYLSGSNPVSPGTKDQCAETLASLV"
FT   mat_peptide     complement(287382..288218)
FT                   /gene_name="AIM18"
FT                   /locus_tag="CAGL0D02728g"
FT                   /product="Altered inheritance of mitochondria protein 18,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW60 "
FT   transit_peptide complement(288219..288308)
FT                   /gene_name="AIM18"
FT                   /locus_tag="CAGL0D02728g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW60 "
FT   CDS_pept        288647..289021
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433339"
FT                   /locus_tag="CAGL0D02750g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58446.1"
FT                   /db_xref="HOGENOM:HBG124396"
FT                   /db_xref="UniParc:UPI00003B6124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW59"
FT                   /transl_table=1
FT                   /translation="MGHGGLATKYLSKFTVTHSLLWKNVYKIVTWITMVLSRYSYELSD
FT                   SITDHSMIKDKNRNLMITNQFQNNYAVGTLSSFVIFDVNGFEYYVINVYRQFTIHYCRR
FT                   NNTRKLSWTLGVRYTLSLQF"
FT   CDS_pept        complement(289675..291276)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194607"
FT                   /locus_tag="CAGL0D02772g"
FT                   /product="Similar to uniprot|P32523 Saccharomyces
FT                   cerevisiae YLL036c PRP19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="CAG58447.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG124397"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="UniParc:UPI00003B6125"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW58"
FT                   /transl_table=1
FT                   /translation="MYCAISGKVPKEPVLSLESRCVYERRLVEEYVRQHGTDPVNGRPL
FT                   AVEQLVEINVDPESMTLVNAANSATLNSNYSIPSLLSTLQNEWDAVMLENFELRKAVES
FT                   LKKKLSTTLYERDAAKKVALKAISQKRKLQSEVDRLATEVTLVETTGNDDAPSKKRKMD
FT                   TEPSHAELAVPDSNFSDELLASSVAYLKETKPLLKQSNISKDSEIVFDKLDKIAINNKS
FT                   MTFTSLLAENKSKSLALIHDKSISHIKDPKNTTMIDMSEQLATGDDLELVVPTTGEDIL
FT                   VKTTNNRIMVLNTKTKQAQQIELGGSELGNLLYLYSHENVKPEYCVWADDKGNIGYVSK
FT                   DGKTDVRVRQTENSDDMHYDKVDLHKDGILIALARSSCVEILNLCQPDDPPIKFEIGSE
FT                   LPNDAKAITNVKFCPNGFYFIVELDGDVLYTFDLRKSPPTLSSNPLPINGGCWDFDITG
FT                   RFLLLNKSLDSNRIEFQFHQYDKTANSWKAVQTREVVLGDNSSFNSAKSMWLLSHEDTS
FT                   FILLYSDDNLLTFDLK"
FT   CDS_pept        292034..293425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433340"
FT                   /locus_tag="CAGL0D02794g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58448.1"
FT                   /db_xref="HOGENOM:HBG124398"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI00003B6126"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW57"
FT                   /transl_table=1
FT                   /translation="MFWHFLLLLCAVRAEQLFCSNENSASGPGTSYTWQSTGWCASHCS
FT                   GYDYAIVQGLMCWCSNSGPADSIDISSCDHYCPGYSLENCGSQQNNAYGYMYLGSQPQS
FT                   AIIPPRKSSNTAQSSTPSSTSAASTSSTSTSTSSTSTSSTSSTSSTSSTSSTSSTSTSS
FT                   TSSSSSSTSSTRSSSRTTLAPSTTSSSSRTRSSSEASDDYVLSTSMIYSVMTVTSTQTH
FT                   DSAVQSNVTSVFSSNVITTKVVTSIISTVATVATTTTSQAANTSVASTAAGMRGSSNQG
FT                   DVSEKKAKGYWQSPGKVAGTFVVVGVVILAILGLLFWYFVLRPRWEQKKFEKNYNDAVG
FT                   LAPATPPNMPRNESGHSRIFSTPIFHTHHSSSEDDSSTGSNGAGFNEEKNLDEANVKTN
FT                   KRATRHDVFADDAYSDYSNTIPVMVDQRLDPNQMMSQIEQSPSNVSLSDDVDYSRRVLR
FT                   VINEL"
FT   CDS_pept        294431..296323
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433341"
FT                   /gene_name="GRC3"
FT                   /locus_tag="CAGL0D02816g"
FT                   /product="Polynucleotide 5'-hydroxyl-kinase GRC3 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="polynucleotide 5'-hydroxyl-kinase activity "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG58449.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0051731"
FT                   /db_xref="HOGENOM:HBG059432"
FT                   /db_xref="HOGENOM:HBG202506"
FT                   /db_xref="UniParc:UPI00003B6127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW56"
FT                   /transl_table=1
FT                   /translation="MAETDLNALAYKDSDSTDTSSSSSSDEEYQAEVKVSNQNEKQVDY
FT                   DSDTDLNTDNKVSSVDAYKPCVGENLIIRDSNIIILLRAKEKLCLSGLFDLKIEKGGLL
FT                   YNDIHFNASSKTYHYWHPLSNSIPEIKSSFYAGFEDVDISAFYAAYDISPNNDYETVLK
FT                   ISNHKSKSLIDGEILMPSLKSLWITKEDFLQKNGYTNFSFDIIMPATLQEITTLNISKS
FT                   WTNCLQKLKFINQNSIHDTRIMVIGGKNSGKSTFLRSLVEKVLYSHDISDKSVSEMLYL
FT                   DLDPGQPEFSHPDCISMTRLTSNDMNFGQSFGQASPEVLKQYYIGSPSPQEYPTRYLNM
FT                   VNKLITEFEDTMFAGISCINLPGWVKGFGLNILQKVLEIYKPTDIVYLESPSTVRHFSE
FT                   LRIPKSFSSTMMTEYSPRSYRIPAEFSNAAINNSPEIKFAPSDIRTYKLLCLFHRSDTS
FT                   NVPTFDFRPLIAKSPKKISYGRAGIHTIIINIEFALVPSHELIQALEGTIVAIYHEENT
FT                   DDEHDSSSDIRVLSNDDLETAKFITLGLVHSVDEERKYFNIYVPENMVATLKNLGNRFM
FT                   IERLSTETPFCELSPPNKVLKTDQTSPFISFKTRKKYEHVWKIRKNIKRKGHHL"
FT   CDS_pept        complement(296403..298907)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433342"
FT                   /locus_tag="CAGL0D02838g"
FT                   /product="Similar to uniprot|Q07844 Saccharomyces
FT                   cerevisiae YLL034c"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG58450.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI00003B6128"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW55"
FT                   /transl_table=1
FT                   /translation="MAKAKGKKNGSLTNSLENKLTDLIYRMLEEKTLEKQRQLRSQADS
FT                   SQEDEEMDIMDATCFAKDLVPGEIFTYVLSKDLSLQRVKKVPLQKTIEKVLKAIVEDEM
FT                   EELQEMPGYVEDTPVMDEGDVLAEKNLMIAPETNDMNKSIVSQWETKSETPAADVGNGE
FT                   TDQETKTRKRSKESSQKSKRQKIKEDRSPPTSSLSALGGMDDVIAQLMELIGLPILHPE
FT                   IYLSTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGESEKKIR
FT                   ELFDEAKSLAPCLMFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELTLSNTNGKPV
FT                   IVIGATNRPDSLDAALRRAGRFDREICLNVPNEISRLHILKKMAGKLKIDGEIDFHKLA
FT                   KLTPGFVGADLKALTTAAGTCAIKRIFETYASIVPNIEAVEDMDVDKNKLDSVEGNSQK
FT                   DSDSEINLKNTANMIDPLPLSVIQRFIHNYPDPLNDDQLNQLTIKYEDFLKALPTIQPT
FT                   AKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPG
FT                   CGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELD
FT                   ALVPRRDTSMSESSSRVVNTLLTELDGLNDRHGIFVVGATNRPDMIDPAMLRPGRLDKT
FT                   LFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFSGADLAALVRESSVL
FT                   ALKRNFFKSEEIQSVGDNDLDKEFEDLSVGISSDEVIVTPADFKVALNKIKPSVSDKDR
FT                   LKYDRLNKKMGWNDEVPTPNDA"
FT   CDS_pept        299215..299850
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347860"
FT                   /gene_name="IRC19"
FT                   /gene_synonym="RRG4"
FT                   /locus_tag="CAGL0D02860g"
FT                   /product="Increased recombination centers protein 19 "
FT                   /biological_process="sporulation resulting in formation of
FT                   a cellular spore"
FT                   /protein_id="CAG58451.1"
FT                   /db_xref="GO:0030435"
FT                   /db_xref="HOGENOM:HBG124399"
FT                   /db_xref="InterPro:IPR016613"
FT                   /db_xref="UniParc:UPI00003B6129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW54"
FT                   /transl_table=1
FT                   /translation="MVRRGVGTIETVNALVNDNYALIRNVAKYMLNDKGLTNAEFLRAS
FT                   YRRFIRLRPFVSNRSMVKDTYTDYIRYKYRYEDYPKRMAMIGVQCDNQLNRSQVKNSLS
FT                   FVAKACSFIDESKGTKFEVARDNTMCRQILKNLLTIHYEKTSHTNEKRTPLRHIFQYSF
FT                   EHMKDINKSTNSQSYSKPASPKSSLILDLYGEFDRDILLLNNLLNMRL"
FT   CDS_pept        complement(300025..302028)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500022"
FT                   /locus_tag="CAGL0D02882g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG58452.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124400"
FT                   /db_xref="HOGENOM:HBG202615"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI00003B612A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW53"
FT                   /transl_table=1
FT                   /translation="MNEYPIPRPYPLAKSNTGLSLQTNWKAGSNWKLWLKLDYNSDEIN
FT                   QAISIEFDENDTIEDVKDKLFNRLNGTRWNRYNDMMSVGIGIYTNVPDLQENMTNLNTS
FT                   DKILSHSPSSLKEQILQTNNNRSPQNSPLDRQNYRTRWLANHRRSNSASPTFQSIPNNR
FT                   ITPILNSNWHSEYHNEQLSSLYSHPKYASPNPHVSRQSPRKNLKYSVEDIDDYHYKIIF
FT                   DPDEQIYQIYVSLFGAIGSQTSSSALLVFSNVDMGHAPPLPMESPAAGIFDDDHDKFAG
FT                   HIQVLSQEHSVGNMDTYDNDNSLHGFGSNNADEVNFYANGTDIDERSNSELQAVQPAML
FT                   LLPKDYRLEEQEQLYHESEHNSNEQNKGLAFISDRNSSASVPQLENDKSKQLHVDTNVL
FT                   DKQNAIDSNNYKQANSLLLSPLDVLKTTETTPIPVSKEKQQNITALDTLPFKLTTTSEK
FT                   VFPKINVLIVEDNVINQAILGSFLRKNKISYKIAKNGKEAVDKWKEGNLHLIFMDLQLP
FT                   VLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED
FT                   KREALISGCNDYLTKPVNLLWLSKKITEWGCMQALIDFDGWKKEASRMTDSVLVRSPHR
FT                   NRIPSANKSSTSISRSSSSGGKKQERAVSINN"
FT   CDS_pept        complement(302952..305615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043517"
FT                   /locus_tag="CAGL0D02904g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58453.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG192766"
FT                   /db_xref="HOGENOM:HBG397459"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B612B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW52"
FT                   /transl_table=1
FT                   /translation="MTKGKKRVSKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGC
FT                   LRNNVPCVSVDPVTGQDIPRSYVFFLEDSLSNMMSKLSECGINPMTIKSNVPCSENDTN
FT                   CNLEEYKKKFKKNGSLIPVDDMLGSYLVQKGMLMQDNSETSNGSRSDFANSPSINSPMD
FT                   QAYFRSPKPMMPQTASPMESSSVGADLEETNNHFSDIGSMKETTKNSYLGDSSGVSFAK
FT                   LVYTAANFQPDYIDSEFDEDIKLRELKYRDYALAENDPNFDPLALPPIEEAEQLINRFF
FT                   IDTNSQLPVFHREQFLKKYYEPIYGEWNNKITLVSNKTKINRNFMGPEPLRPNSPYGVQ
FT                   PWYNTWKSLEDKGVRDIELHDYYRIPYFVLNMVFTIGCATKVLASDIKQVVTFKRRATY
FT                   FKKDIFSSTDRLEALMGTLLLAIYSIMRPNVPGVWYTMGSVLRLTVDLGLHSEKINMTY
FT                   DPFTREIRRRLFWCVYSLDRQVCSYFGRPFGIPEDTITTGYPSLLPDSEITPAYGTIED
FT                   YSDVKPKSISYKKLAIAMFAIRQLQAKIVRVLYAPHAEIPRKYNDLEEWRAAVHSELNA
FT                   WYDKAVPRSQKMIDCHYNSSLFELNYHYTKSILYGLSPKCPILTELSCRLVFLSTKGTI
FT                   DVFYDLCINQKIGYTWVAVHNVFMAGMTYLYVIFYSGNNIKENRQEVEDYTGKILFILK
FT                   NLIGTCEAAKNCFQSYDVLSKVVIKLKFGEKIIEDNSSKENTFKSGGNLQIDDSKNTDL
FT                   LKRKPSISGGSLDLPLEKFFLQLDKLEENNDEEPSNTGKFRGRSMSFLNNNNNNNNNMN
FT                   NGNKDTGINLHNEQDFQNDFKLQDDLPLFDDPANEEQNMVDILFQVTSQSLWDEFFVKQ
FT                   NNEEKKEENIDPFFTL"
FT   CDS_pept        306241..307686
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066117" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500023"
FT                   /locus_tag="CAGL0D02926g"
FT                   /product="Similar to uniprot|P43132 Saccharomyces
FT                   cerevisiae YLR015w BRE2"
FT                   /protein_id="CAG58454.1"
FT                   /db_xref="HOGENOM:HBG059152"
FT                   /db_xref="HOGENOM:HBG202620"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI00003B612C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW51"
FT                   /transl_table=1
FT                   /translation="MKPEIIPYQPEVDLVLDDSVCERRPHLPVYQETHEVNGVQFWKTE
FT                   DIPLSRRNFIYRPCLPNPLFTELGYCTTEYPFDTSGVNIQDRSYGMSVLRGENSVVSVR
FT                   AKDGWRTARSDVCIKEGDVYWEVEVLNVGNGSGSGTGSGSSSNVDVDVDKGSVQQRRQF
FT                   LNSSAHVRVGISRREASLEGPVGFDSYGYGLRDFSLESIHDGQLEQVLARAPLKNGDRL
FT                   GFLVSLPSVERQVAQAREYTARRIEALASHGQELGAQEEWESHGRKRQKRAGVTNMDFQ
FT                   RALLEDIDHANVVRDHIPIRYKNQLFYEATDYVKTTKPEYYSSDKREREEYYHLEGSYV
FT                   AVFLNGEYLGKAFEEVKPFLPPFSELQYNEKFYYGYWKHGRAEGEDREEARIGGKHRKG
FT                   LILRNKYVNNSKLGYYPTISCFKGGAARLVTTRSELRHLRAATDVADQPVAVLDDLYRR
FT                   QIADEVVWDIVDEIEEEAKVKWK"
FT   CDS_pept        308191..310194
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433343"
FT                   /gene_name="KAR2"
FT                   /locus_tag="CAGL0D02948g"
FT                   /product="78 kDa glucose-regulated protein homolog "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="CAG58455.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00003B612D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW50"
FT                   /transl_table=1
FT                   /translation="MNAIKRLLPVSLFLYALFVVLLPFQARAKDDVENYGTVIGIDLGT
FT                   TYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQIAANPTNTIFDIKR
FT                   LIGLKFNDRSVQRDIKHLPFKVVDKDGKPVVQVKVKGEDRVFTPEEISGMILGKMKQIA
FT                   EDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKSDK
FT                   EHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKTFKKKHG
FT                   IDVSDNEKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDL
FT                   FKKTLKPVEKVLEDAGLEKKDIDDFVLVGGSTRIPKVQQLLESFFNGKKASKGINPDEA
FT                   VAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFS
FT                   TAVDNQPTVQIKVYEGERAMSKDNNLLGKFELTGIPPAPRGIPQIEVTFALDANGILKV
FT                   SATDKGTGKSESITITNDKGRLTQDEIDRMVEEAEKFASEDAVLRTKIEARNKLENYAH
FT                   SIKNQVEGDLAEKLEEEDKETLLDAANDTLEWLEDNFDSATTEEFEEKFEALSKTAYPI
FT                   TSKLYGGADGSAPVYDDDEDEDDDTDYFDDEL"
FT   sig_peptide     308191..308274
FT                   /gene_name="KAR2"
FT                   /locus_tag="CAGL0D02948g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW50 "
FT   mat_peptide     308275..310191
FT                   /gene_name="KAR2"
FT                   /locus_tag="CAGL0D02948g"
FT                   /product="78 kDa glucose-regulated protein homolog "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW50 "
FT   CDS_pept        complement(310516..311148)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347861"
FT                   /locus_tag="CAGL0D02970g"
FT                   /product="Similar to uniprot|Q07930 Saccharomyces
FT                   cerevisiae YLR016c"
FT                   /protein_id="CAG58456.1"
FT                   /db_xref="HOGENOM:HBG202621"
FT                   /db_xref="HOGENOM:HBG396145"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI00003B612E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW49"
FT                   /transl_table=1
FT                   /translation="MRQSRYDATGSRAGRGISKPGYRYNNRKREWKDRREVKRTKPSKG
FT                   PLLPNFESSGLLELDSNNKNGIALKYVEPKDAISPLDYFKGSTDKTKYKCLLYKESTGK
FT                   VIDEFELEAKNSYLIGRKDEEEEENNIADILIPEETCSQQHCVIQFRRTENDSIKAYII
FT                   DLESSNGTVLNGNTIPQARYIELKNGDTIQFTADSRDRKYYLVYAYT"
FT   CDS_pept        311423..312364
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433344"
FT                   /locus_tag="CAGL0D02992g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58457.1"
FT                   /db_xref="HOGENOM:HBG058389"
FT                   /db_xref="HOGENOM:HBG202223"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI00003B612F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW48"
FT                   /transl_table=1
FT                   /translation="MSSTKFDTQLYLSRPYLTRKQVQRAQQNTIGDHRAYNAKRVAIVK
FT                   FLSDICVQLRFPRRTLEAAVYFYLRYHLFNNFETEPCYIIATSCLVLSCKEVETIKKVN
FT                   DICTVSLSLRNTGKVSGEVLENFKKRVFVMELKVLESCSFDYRINDAVHVDEYIIKFGK
FT                   TLGLSYELCHIAWCIAFDVLKTELLLLVPQHVISLACIKLASGILDVPVAIEKSIQQFE
FT                   MDNPMFSEAYFELLNFYINSFDSCDLKNVYQGASLEQFMDLKRKAGQEHGLKEPLEKQI
FT                   EMDTYLTTSRTQPIRERRYVLSQSLVNNEVGK"
FT   CDS_pept        312825..314522
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17433345"
FT                   /locus_tag="CAGL0D03014g"
FT                   /product="Similar to uniprot|P47079 Saccharomyces
FT                   cerevisiae YJL008c CCT8"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58458.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI00003B6130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW47"
FT                   /transl_table=1
FT                   /translation="MSLKLPQNPNAGLFKQGYNSYSNADGQITKSIGAIREIHQMCLTS
FT                   MGPCGRNKIITNHLGKIIITNDAATMLRELDIIHPAVKVLVMATEQQKIDMGDGTNLVM
FT                   VLAGEMLNVSEKLIALGLSPIEIIQGYQLAKNFTLKELDKMVVGEITDKGSKEELIKII
FT                   KPVVSSKQYGSEDLLSELIAESISHVIPKGSNQPLFNVDSIRVVKIMGGSLINSTVIKG
FT                   MVFNREPEGHVKSLPQGDKHKVAVFTCPIDIAATESKGTVLLHNAQEMLDFSKGEEQQI
FT                   DAMMKEIADMGVKCIIAGAGVGELALHYLNRYGILVLKVPSKFELRRICRVCGATPLPR
FT                   LGAPTLEELGLVETVKTMEIGGDTVTVFKQEENESTRTATIILRGATQNNLDDIERAID
FT                   DGVAAIKGLMKPNGGKLLPGAGATEIDLVSRITKFGEKTPGLLQLAIKEYALAFEVIPR
FT                   TLAETAGLDINEVLPNLYAAHTVTNEDGEDKKHLVKGIDIDGLTSEGVKDITEDGVYDM
FT                   LETKKFAINVATEAACTVLSVDQIIMAKRAGGPQAPQGPRPGNWDQDD"
FT   CDS_pept        complement(314724..316592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348106"
FT                   /locus_tag="CAGL0D03036g"
FT                   /product="Similar to uniprot|P47082 Saccharomyces
FT                   cerevisiae YJR001w"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58459.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058384"
FT                   /db_xref="HOGENOM:HBG397737"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00003B6131"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW46"
FT                   /transl_table=1
FT                   /translation="MSTPVDEERQPLNPRGSRSQVRYISIPLARNPDLEAVDGDTSGYA
FT                   VQDSSFTNHEPQPMGRRQSILDQPIGSFRGVNSLSRFATSLRRANSFRNIEVKPEVERT
FT                   YFNDDYDELFDPSTLAPAPHGRSLSIALQSANATLQVSGKPSIPNIDAQSTHSISQQEL
FT                   EDFRSIRTTSFSMDNNGILRPTLSMNEMLTGSTPFDTNDVDSMVIKQVEGKDGTVVTLL
FT                   AGQSTAPQTIFNSINVLIGIGLLALPLGMKYAGWIPGLIMLSIFAFGTFCTAELLSRCL
FT                   DTDPTLISYADLGYAAFGSRGRAFISALFTVDLLSCGVSLVILFGDSLNALFPQYSVTF
FT                   FKIVCFFVVTPPVFIPLSILSNISLLGILSTTGTVLVIFICGLFKRDAPGSLIEPMPTH
FT                   LWPTDFKSLCLSIGLLSASWGGHAVFPNLKSDMRHPQKFKKCLKTTYQITSVTDIGTAV
FT                   IGFLMFGDLVKDEITKNVLLSDGYSNTVHVLISALMTVIPIAKTPLNARPIVSVLDIMF
FT                   GIHEAEKEYTGKKLKFAQFGQFFNRIFVNFMFVLIAIIFPQFDRIIAFMGAGLCFAICF
FT                   ILPCLFYLRICGEANIVKPWERLACKATIVVSVVLSVLGVSAAMFS"
FT   CDS_pept        complement(317022..317669)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091079" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500283"
FT                   /locus_tag="CAGL0D03058g"
FT                   /product="Similar to uniprot|P38624 Saccharomyces
FT                   cerevisiae YJL001w PRE3"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAG58460.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG314521"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI00003B6132"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW45"
FT                   /transl_table=1
FT                   /translation="MDGVQVDITALKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYI
FT                   ANRVTDKLTRVHDNIWCCRSGSAADTQAVADIVQYYLDMYEGQFGEPDTYTAANMFKTL
FT                   CYQNKDALTAGIIVAGYDEKNKGEVYSIPLGGSIHKQPYAIAGSGSTFIYGYCDKNFRE
FT                   NMSKDETIDFIKHSLSQAIKWDGSSGGVIRMVVLTKDGPERLIFYPEEYENL"
FT   CDS_pept        complement(318089..319975)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043777"
FT                   /locus_tag="CAGL0D03080g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nuclear origin of replication
FT                   recognition complex"
FT                   /protein_id="CAG58461.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005664"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG057972"
FT                   /db_xref="HOGENOM:HBG202610"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniParc:UPI00003B6133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW44"
FT                   /transl_table=1
FT                   /translation="MDVSEFADSQRTHYIARPTYNVSEFVEKSNSETEESLGTVPFVKL
FT                   LDGEETNVAVLKRWELYHLLYSNFHNQVDDIVNNIETDLKDEVMSVLLNLPNRQDNYGK
FT                   PCFNTLFLLGSDSSLAVDLPNNDPETIDVLIDLTPKESPNVRMMLRRSMFKLIQTADSI
FT                   LSGTTKIKTELEDDDDNEVPDFSVSSDKITYDLTLLENFKEVFGKNLNIVFNFKDVDSM
FT                   GAIVLDNFVELLSRALKNDHVKISLIFNINTNLSNFEKNFRQSTIRLLKRHFHKIDVSS
FT                   NKGYKYGNRIFQSFLDTVDGKLNLSDRFVEFVIEKMSNNSNHNLQLLIKILDYSLMAYF
FT                   FENPFSVFIDPVNIDYLNDEYLNRLVRCPTFMFFIEGLIKDNANTSEVLALLDNTDGNL
FT                   VNFFVEFLVRENPINGHAKYVANFLETELGIKNYNLIELYHNLLQGKLKDYLWRWKSCQ
FT                   EHIEKLDFEPVDTMFQELFTLDHNNGLLSQSLFPFYRTNVENNLLNWEQVLPIKEAPAP
FT                   ESKVLQELNRKLNPILSHLFKLYREANNQINTYDFYMVFKETMPRDIILDYVKEQAQEN
FT                   HSLETLLDKPDAFDKISLILFMQAIVDFEMIGILKPAGKGHDVMEKCIWRGL"
FT   CDS_pept        complement(320341..320697)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500284"
FT                   /gene_name="COX16"
FT                   /locus_tag="CAGL0D03102g"
FT                   /product="Cytochrome c oxidase assembly protein COX16,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58462.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057978"
FT                   /db_xref="HOGENOM:HBG398300"
FT                   /db_xref="InterPro:IPR020164"
FT                   /db_xref="UniParc:UPI00003B6134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW43"
FT                   /transl_table=1
FT                   /translation="MALGGRSFRSKKQQLAYDRSFAGRYQKLLSKNPFIFFGLPFCGMM
FT                   VLGSYWLAGISQVKFDRDDQKVQEMNEEEILKMKHGKREFDIKEEYYRLQGLAEEDWEP
FT                   KRVERFKGESDNVF"
FT   mat_peptide     complement(320344..320613)
FT                   /gene_name="COX16"
FT                   /locus_tag="CAGL0D03102g"
FT                   /product="Cytochrome c oxidase assembly protein COX16,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW43 "
FT   transit_peptide complement(320614..320697)
FT                   /gene_name="COX16"
FT                   /locus_tag="CAGL0D03102g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW43 "
FT   CDS_pept        complement(321029..323206)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265456" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348107"
FT                   /gene_name="DRS1"
FT                   /locus_tag="CAGL0D03124g"
FT                   /product="ATP-dependent RNA helicase DRS1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG58463.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW42"
FT                   /transl_table=1
FT                   /translation="MSLKMKGKKYTDLDFVPTISDSEEDVPDLDSDEEKPKPETKGKKK
FT                   NKSVDEESADMNSGFRFNTDDGEINTNFDGWEFLGDEKDEEKKDVDLDKIIRKKGGLIG
FT                   MAHVDEAEKSESEESESDDEDLAMDGFGMGAQEQPEGEEEDEDASNSEQESNDEEEDDD
FT                   EETYDVGDAGDAEEKVEEDTAEEMQAFYAPESESENAKKEVHKTFNDLALSRPVMKGLS
FT                   NLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVASTRVI
FT                   VLTPTRELAIQVADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIVIATPGRFI
FT                   DHIRNSASFNVDSVEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATMNSRIK
FT                   QLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPSLLFNLIRKLDPNGQKRIV
FT                   VFVARKDMAHKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSLQVPVLICTDLASRG
FT                   LDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFVGEASAERSIVKDAIRGVN
FT                   DSEIPGSKAVGRNVDWNQVEETNKIVENMDQTVQDILVEEKEEKEILRAEMELKKGENL
FT                   LKHKDEIQSRPKRTWFQSEKEKKNSKIMGALSKTKKEVNSKKRKRNEAMEDGHKRSYKK
FT                   TQSDRTADQERTMKKQAKANGKKKGKSKGKR"
FT   CDS_pept        323492..324064
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043778"
FT                   /locus_tag="CAGL0D03146g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58464.1"
FT                   /db_xref="HOGENOM:HBG058004"
FT                   /db_xref="HOGENOM:HBG446678"
FT                   /db_xref="InterPro:IPR019185"
FT                   /db_xref="UniParc:UPI00003B6136"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW41"
FT                   /transl_table=1
FT                   /translation="MVNFRRYLRVPRELRPSEIFKQDSMSPGKIALQIILLQVFYYTTA
FT                   CILFYGWAKVAGYKLEMVQWLFSWQAIEFTNALGLTLCLLWLTDSLICVIFLTVIVERS
FT                   KLAWDFAITIHAINLIVVSVHTGTLPSLSWFVLQVLSSLILIFLGTYTTRWRELRDTFF
FT                   EGLVDADMVSPSASSQPIEMRDLESQK"
FT   CDS_pept        complement(324192..330440)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434393"
FT                   /locus_tag="CAGL0D03168g"
FT                   /product="Similar to uniprot|P08678 Saccharomyces
FT                   cerevisiae YJL005w CYR1 adenylate cyclase "
FT                   /function="phosphorus-oxygen lyase activity"
FT                   /biological_process="cyclic nucleotide biosynthetic process"
FT                   /biological_process="signal transduction"
FT                   /protein_id="CAG58465.1"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0009190"
FT                   /db_xref="GO:0016849"
FT                   /db_xref="HOGENOM:HBG190577"
FT                   /db_xref="HOGENOM:HBG397746"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="UniParc:UPI00003B6137"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW40"
FT                   /transl_table=1
FT                   /translation="MSRRSESNRTHLEQGTYSKKVHDEQPRFKSTYDQQDFSGTSSRRN
FT                   STIQNVYSSIGGLTRTRSRDSVSSIKSNPGEFPSNKNYQHKSKKSPFSLKRTLSNLSVT
FT                   NMLQTQTPSSLQNMAFEDEIDQKIDSSNTTDVDSIGSMSDRSFTSRVASNSENDHTHHR
FT                   KHGSTSRKYSFAENLFKKLAPSNSSTKTSHKGQTTRRTAGLTHSKPTAETISELPGEHD
FT                   LTNVKFPPPLAEIGADGLRNKVKQIVRGHSTSGIAIANDGSTRSSIPLMKELEKKKLKH
FT                   KDQEKHQSESSSIHSSQGNKKLFLSTGSSASSRRGSTVNSILTNDNRSSVSNPKEPKSV
FT                   LGEPSHNNQTKDINTPNQKGFTTAQRANSISVPSKSHKFNAIDPENTIEARFNESTLDK
FT                   EKDESIKEKDNSDNKGNDENNAEDIKTENPNTGLFPLDTNLENMAEITKNVEPPSEADK
FT                   EPITRSNTFISGPKKSHSIADIPTWVSSESSLKDYTQTDRDQWVAPESWDVEMRMGGSN
FT                   ANHLENEEEPFDSILSPEEVTMATQQKQRRNKSNNKSSKSRNGSEVNGKKPLSTKSMVR
FT                   IKNSLFMSPTSNDTENSSDLSRNGGINFNSKLGSSRVRKSSSDSLASIISPTESLHSDD
FT                   DKQSTTSRSSYNSSTSNQYPDNIDDENEEYELQLNARAARKRKTISSSELFQKMNDGTD
FT                   NSDSNENISADIDDERHDNVEYELERYYKDVSDLDPKRHYAIRIFNTDDTFTTLSCTPG
FT                   TTVEEMIPALKRKFNITTQGNFQISLKVGKLSKILRPVSKPILIERKLLLLNGYRKSDP
FT                   LHIMGIEDLSFVFKFLFHPVTPSHFTPEQEQRLMRSEFVHVDLRNMDLTTPPIIFYQHT
FT                   SEIESLDVSNNANIFLPLEFIESAIKLLSLRMVNIRASRFPANITEAYKLVSLELQRNF
FT                   IRKVPSSISKLVNLTILNLQCNGLDRLPSGFSQLKNLQLLDLSSNRFAHYPEVINFCTN
FT                   LLQIDLSYNKIHHLPKSCRQLVKLAKMNLSHNKLTHVGDLSELKNLRTLNLRFNRINTI
FT                   NTNAPNLQNLFLTDNRISNFDENLPKLRALEIQENPITSISFREYPMNMTSLSLNKAKL
FT                   ASIPGEIFKKLLRLEKLELNENNLTRLPSEISLLTKLVYLSAARNKLESIPQEFSKLKS
FT                   LRSLDLHSNNIRDFFAGMEDIELTFLNISSNVFANASLDPSFFLNVSNDSKLSKSLMFF
FT                   VAADNQFDDDAWPLFNCFTNLKLLNLSYNNLQDITKMKLENLTELFLSGNKINTLPGDT
FT                   VSKWKYLKTLMLNGNQLLSLPAELSQLPQLNVFDIGSNQLKYNISNFHYDWNWRNNKEL
FT                   KYLNFSGNRRFEIRSVTNQELQTDLSDLTVLPHLKVLGLMDVTLNTTKVPDENINFRLR
FT                   TTASIINGMNYGVADTLGQRDYVSSRDVTFERFRGHDDECLICLHDSKNQNSDYGYNIS
FT                   RIVRDIYDKILIRQLEKFGDSNEDEIKKALRFSFLQLNKEINGMLNSVDNGANIDNLTS
FT                   ADLLSGACSTVIYMKGTKLYAANLGDCMAVLSKNNGDHQKITKQHVPTKREEYERIRLS
FT                   GGYVNNGKLDGVVDVSRAVGFFDLLPHIHASPDISVINVTKADEMLIIGTHKLWEYMDI
FT                   ETACDIAREHVLEPMLAAEELKDHAIAYGCSENITILCLALSKSNSQESKFTLNRSSLL
FT                   SKRSTVEDTTLRRLQPEIAPPTGNLAVVFTDIKNSTFLWELFPNAMRTAIKTHNDIMRR
FT                   LLRIYGGYEVKTEGDAFMVTFPTPISALVWCLSVQLKLLEAQWPEEITSIQDGCLVTDR
FT                   NGTKIYQGLSVRMGMHWGCPVPELDLVTQRMDYLGPVVNKAARVSSVADGGQITLSSDF
FT                   VSEFNKIMKYHDNVVKDKKPLKEVYGEEIIGEMLEREITMLESIGWSFFDYGEQKLKGL
FT                   ETKEFITIVYPKSLASRHEFITEEEQSKIINLDFLLSLRQLANKLEAILSAVGGGFLEL
FT                   DSKQREYHSVIDRSLKGVVAASMSDKELILFFDHLVTRIETIIAVLQLRIKVTKGLDIC
FT                   QHHDFCLPQKGIFEVLDDVFKLMDAAKQIQN"
FT   CDS_pept        331747..332760
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434394"
FT                   /locus_tag="CAGL0D03190g"
FT                   /product="Similar to uniprot|Q07938 Saccharomyces
FT                   cerevisiae YLR017w MEU1"
FT                   /function="transferase activity, transferring pentosyl
FT                   groups"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAG58466.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016763"
FT                   /db_xref="HOGENOM:HBG205650"
FT                   /db_xref="HOGENOM:HBG286690"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="UniParc:UPI00003B6138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW39"
FT                   /transl_table=1
FT                   /translation="MLFTRFTGRRVLKMTSDIATTFEGEIDLGIIGGTGLYNLECLKAI
FT                   AILPPMETPWGKTSSPITISKVTTTKDIEGHPSINKNFHVAFISRHGLHHEYPPTKVPF
FT                   RANMAALKHLKCKAVLSFSAVGSLQHHIRPRDFVLPQQIIDRTKGIRDSSYYNDEGLVG
FT                   HVGFGNPFSEAFAKYIYQFKDNLVNKGDHCTLHFNKDITVICMEGPQFSTRAESKMYRL
FT                   LGGDVINMSVIPEAKLARECELPYQMVCMSTDYDAWKDEEEPVTVETVIGHLTNNGMNA
FT                   NVLASCIIESMAHELPEFMVTGDGLKNSVKMSISTKPEGMSKETLNKLRYLFPDYW"
FT   CDS_pept        complement(332928..334025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434395"
FT                   /locus_tag="CAGL0D03212g"
FT                   /product="Similarities with uniprot|Q12445 Saccharomyces
FT                   cerevisiae YLR018c POM34"
FT                   /protein_id="CAG58467.1"
FT                   /db_xref="HOGENOM:HBG124403"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniParc:UPI00003B6139"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW38"
FT                   /transl_table=1
FT                   /translation="MSGINRNNLSTPSRPLSREQFFSVRERIVKDTPKLYQGRSIATDE
FT                   KKERTDERVFTPTSSINIFSHKSQEPIQQTVERQTVQSHDLGFFENPVLEKLAERSVNK
FT                   SLEVQKIINNVLLYLLWNLITKFILLYLDHTSSGQKVRKNWLQTDQILALLHMPNNKAA
FT                   ENAIDLLFSVSSFNKAFRGLVLYNVLMSIFALVGKVKISDLKLNQRQKNLLGFIGQGET
FT                   SNLRRIEPSNLMLKQNSKKTTENTKDQSVSSGINKKNTESQVSAPPYAFRSIQTPMKKK
FT                   MEEERNSNMNSVSNNVNPLVRSNIFNNNASTGNNRSVNFAELHHSDIVRRNSTITTLND
FT                   TSAGYIPSSKYTYMMDTPSPRKSFK"
FT   CDS_pept        334913..336145
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434396"
FT                   /locus_tag="CAGL0D03234g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="phosphatase activity"
FT                   /protein_id="CAG58468.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG124404"
FT                   /db_xref="HOGENOM:HBG603876"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B613A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW37"
FT                   /transl_table=1
FT                   /translation="MGFISALFCCSSNSTTDSITTKQITSQNNNRDTSNTDPEKYHQNV
FT                   KMMTYNNTTTLTPERDSSLNKHNNSSSPQIADINASKRPRTTPDISANPQNNNIPQVNV
FT                   PDDALSRSSSDSGQQRILKGSWTIGGEDEKMDDHTHLKIHGDEDMGEMSNEKTTINESN
FT                   SELDRSTQSSSEMTYQPTDNQGGIITSVYDNDVDMDRDVTPPYDEPYVDLAALQEDQYH
FT                   APGYNTLLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLPVNIDDQVHNVYVIK
FT                   RPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSIHHRLFREACYNYEGNYIK
FT                   NLSQIGRPLSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNELIDIVPLLEDLSSNSV
FT                   LDVGKVLDVTI"
FT   CDS_pept        complement(336625..338250)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348108"
FT                   /locus_tag="CAGL0D03256g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG58469.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG124405"
FT                   /db_xref="HOGENOM:HBG202623"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniParc:UPI00003B613B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW36"
FT                   /transl_table=1
FT                   /translation="MTNYLVHILHEIVSDLMIGGFMAALFILALFHNLFSSHIFGNKDP
FT                   RDVRKSSTKIYPERHKHNKSHGREKSHNRGMSTSSTTPLDIEVDEDNNIEYDNTITGSP
FT                   EPSTLNEDSYEENRQFYLNNITENPFDSISEVEDSQLVPNLEYYYSQYNIEIETFRIET
FT                   KDGYIIDLLHMKHNEPGMENIQRYPLLLLHGLLQSCGAYASTGRASLAYFFHQAGFDVW
FT                   LGNNRCGLNPDWNKNKIDKPHWFNKWDWDIKDFVKYDIRALVEQVKSRTGFSKITLIGH
FT                   SQGTTQSLLGLINGPELYDEPDKFTLIDSLDNFIALAPAIYPGPLLDEKMFVRFMAASI
FT                   DSPWVFGQKSFIPFMMRMRKLMAGTKMFSFFSYIMFNYMFDWNDKLWDKKLRDRCFLFS
FT                   PVYVSVKLMRWWLTPDRSITGFKNGAHKLFPDTKTWFPVLSDTSSSSSSLNLKNVPNHL
FT                   NAPRETANDFPHIMLFAPKQDRLVDGERLINHFINYESRDIYKIWYIDEYSHLDVLWAK
FT                   DVIERIGKPIVENMRIPSNETVHN"
FT   CDS_pept        338736..339248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434397"
FT                   /locus_tag="CAGL0D03278g"
FT                   /product="Similar to uniprot|Q07951 Saccharomyces
FT                   cerevisiae YLR021w"
FT                   /protein_id="CAG58470.1"
FT                   /db_xref="HOGENOM:HBG058044"
FT                   /db_xref="HOGENOM:HBG202624"
FT                   /db_xref="InterPro:IPR018854"
FT                   /db_xref="UniParc:UPI00003B613C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW35"
FT                   /transl_table=1
FT                   /translation="MQVRSIRRKLDAQIDAAEGEVAVKALHYSNSVVLQIRYNGEFDST
FT                   YEVNSVGLRPGSMTNGRPLALNTYASEDNSQNGGSGEIDEETEEPTDYLADYKVVVRLG
FT                   NGDDPKMNIVCSQIAELYNQMQGGDELRGVNLVISLSRKLWKGEDSHSRDFAVLVFLLQ
FT                   CIKDMYV"
FT   CDS_pept        complement(339318..340058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500285"
FT                   /locus_tag="CAGL0D03300g"
FT                   /product="Similar to uniprot|Q07953 Saccharomyces
FT                   cerevisiae YLR022c"
FT                   /protein_id="CAG58471.1"
FT                   /db_xref="HOGENOM:HBG056098"
FT                   /db_xref="HOGENOM:HBG333702"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniParc:UPI00003B613D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW34"
FT                   /transl_table=1
FT                   /translation="MGVINQPSGQIKLTNVSIVKLKRNKKRFEVACYQNKVQDYRKGVE
FT                   KELDEVLQIHQVFTNVSKGLVAPKEDLQKAFGTTDVDLVIKEVLSKGEIQLSEKERQLM
FT                   INKINNEMLTIISAKCINPQSKKRYPPTMIHKALQELKFTPVINKPAKTQALDAIRLLV
FT                   SSQIIPITRAKMKVKLTINDKSTHEDIIQKMEKLFTDSEFTQTDSAWIASGLIDPVSYR
FT                   YIVESAKDIGTVQVLDMAVIDSSK"
FT   CDS_pept        complement(340949..342586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434398"
FT                   /locus_tag="CAGL0D03322g"
FT                   /product="Similar to uniprot|Q07959 Saccharomyces
FT                   cerevisiae YLR023c"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58472.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124406"
FT                   /db_xref="HOGENOM:HBG202625"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI00003B613E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW33"
FT                   /transl_table=1
FT                   /translation="MDSISSASKHVSQYFDFEPSLHKWKQRGLDNIHRVRQTGRNVRYP
FT                   RFIHNTWNSLTSYTDELRAPDNDAKARSQGQNKVTRPARSRAPKKNRYSESTISLTSDA
FT                   NTLVNSNASTTSFSRFRAPKPATTSNSFGSVGSGGSSPNDYSSTTSLSSAATPVPEELL
FT                   EYVEKPVYTLTFKDDDVVVKEEEIIEELDIKTYINTYNYENAFEFGKVRHLHYYELPFP
FT                   WRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQFPSSE
FT                   VFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGISILI
FT                   TASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFILLA
FT                   SMGILSFLHLTFITSLSHSTWLLSPITKKSVVWYLVGVVFYGSFIPERWRTDIQYDHTI
FT                   PTSHELSTNVDIINKEKHIHFRETPTPHEMCKHHEHHHRSFKSLWWVDYVGCSHTLWHF
FT                   FVVLGVIGHYRAILDILTKKWILSGSPL"
FT   CDS_pept        complement(343595..348958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194898"
FT                   /locus_tag="CAGL0D03344g"
FT                   /product="Similar to uniprot|Q07963 Saccharomyces
FT                   cerevisiae YLR024c UBR2"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58473.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058076"
FT                   /db_xref="HOGENOM:HBG202626"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="UniParc:UPI00003B613F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW32"
FT                   /transl_table=1
FT                   /translation="MDSVSCLRTFLDRLPTLCGARHDQSVKFLLWKAIHLSAEHGSQNV
FT                   NWPELIEVFTSEEFRNCTLGNILSNETWEESFIQIQDTNTHHGVCNRICFPPETVYYCF
FT                   TCTLNPIYEICEECFDESKHVGHTYTARTVTRAEGKICHCGDPAVFKKPELAYCCKSYR
FT                   DSGYTPDLTNKDGFLLKTINILVDFLIEYSLKQPNLSLEAPENNEFTNNKNKKPLKDVH
FT                   LRDSMTDGAEIMDTSTDDMTNFELEQEPTWAITIRSDDCDLHYIDLASRVSDILNIPNE
FT                   YAIGIVDSLQDDCSIVTLVESNDLSKIKALADEFYSKNVNVRISKLESIFNQLLIEDII
FT                   CYITKRCLLDKGNIRFKHLLRLSLIDIWNSELPTKQLNKNNNLNPYSSKINLLGGFLVS
FT                   SEQNPDNPWFKKWSFPEIKDNYVQMVISNYNQRIDEANSPDTLAHFYTLYGSRMQYLLS
FT                   ESLMLFCSVTKRQLLKIVNSVFSISDNCRKFVAAQYLDIYLTLLYKTVASDTTGFRVCT
FT                   MSLISQQIFLEPTYAAMAIESGFIERTLKFAFTLMYFESDDLLPYLSIPLHSGFQLPQE
FT                   TIKSRRTIICFKDLCCVMSTNRNPLLLLQREETFNAVLKTFEAFSAILPLKRETSEHVE
FT                   FENFDFSAFYFFFSSCLIMMDGYIRNLSMVEDKNIRAKIAVRMLELVMENEFTALAKSR
FT                   SEITSRNMNVEKLPGNIKLPTYNKLPFLRERICNHVSEVVNFQVGIDTQNLFNPMAYMF
FT                   KFVLQWARCGRYEPLNYNGNTVLDLKTIFEDKQKALYISESSLATLVLIGQVRVGFWVR
FT                   NGTPMTHQIRMYTKYSMREFTYFSDFFNVQFSMAIADPNEFMVTYLYKWGLKHWSNGIP
FT                   NCDYPDMEITLSIVEEALILLIQLLTDMKSIVVISSIDSFEKTLKTEIIHAIGFQSFTY
FT                   SQIMAMIPEHITKHNAFDIALKKYTTYSPPSGLSDSGLFSLRDDLKCEIDPYYIGLPNG
FT                   KRYEIEQQLRKHISAIKDIPYELSFVPAKRVIDDIKESAFPNLFAITSKDTFGLFIKNS
FT                   LDHIKKFENEGLLHRILHLIHICVVNNVNDFAKIFWREYAIVDTEYCNDHSIGSILYSC
FT                   LFKDCFSDLHGKIKEIFSIFNSEAAHINVEEYLKEQTVNFNPKILVSSDSSSCRDEEFE
FT                   RKKKLAMIRKEKMLRKLAKQQKKFMKLNREASCEDSLPTTATNSSEDLLMCDDKMGTPE
FT                   ILEETCVFCKMYKDDDQFIYFAYLERNICDKGVCTGHQYGQEETMVTDSVVRACGHGAH
FT                   TKCLAHHMKSARLLHNQTTKNVPIAYGMGLIYCPLCAALCNCIIPHITNNNASTSNLIS
FT                   ANKTNSFSFNELFEDSISEIVIKSGFIFSDLCNEKYSKEDNLNHLFITVSRLLYNTVAN
FT                   FELRIRRNLQKGFYKKSGKKYIPNMGSLSSRLLNDMRVYMIKYMSKHDVTIKLEDSFLA
FT                   AACLVADSVTGKELGSNVPTMTISKIQMDIDAIVSHIATCEFSDESESDIDMFDISSKE
FT                   EVMAQTCGYLLGHGCEKAVQTNLERIDIWRRLRDSALVFLRRLFILSNLASEKITLANC
FT                   DQGPDHELSFYSEYFCIGLELPQLVEQAVNQWTATGKQCSEFNIVCTNTPLQLYSIPRN
FT                   LSNYEKDLRSSQHLMLGRSPTDTTDLALCLMCGEHVRTQRLVSRLGYEIGECTNHCRNE
FT                   CSMATPFGTFLLVRSNAIYIAYGNRGVFYPGPYLNEFGERDVEFKYGTPVYLNQQRYEH
FT                   FCDEILLGNMIPHVVFRLTDGNADLGGWETM"
FT   tRNA            349921..349991
FT                   /gene_name="tRNA Gly (GCC)"
FT   CDS_pept        350302..350898
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434399"
FT                   /locus_tag="CAGL0D03388g"
FT                   /product="Similar to uniprot|P47064 Saccharomyces
FT                   cerevisiae YJL024c APS3"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAG58474.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00003B6140"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW31"
FT                   /transl_table=1
FT                   /translation="MIHAVLIFNKKCQPRLIKFYTPVEISKQRILLKQVHELISQRNNE
FT                   YQSSFLVSPPAVLTNGTHTEDNSFNEDGEDIQIIYKNYATLYFTFIVDDQESELAILDL
FT                   IQTFVEALDRCFSEVNELDLIFNWQTLESVLEEIIQGGMVIETSVSKIVQSVDDLNKAC
FT                   ESTDGKVGGLLGNSSFGSAFQAFASGGFANWAGSQ"
FT   CDS_pept        complement(351075..352706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434400"
FT                   /locus_tag="CAGL0D03410g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58475.1"
FT                   /db_xref="HOGENOM:HBG058079"
FT                   /db_xref="HOGENOM:HBG202216"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="UniParc:UPI00003B6141"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW30"
FT                   /transl_table=1
FT                   /translation="MSTFIRGPVCGTDNCPSRLWRIIDGRRTCRYGHVMDGDIEFNNDE
FT                   DDVGGNAMAGVASSGVVTRRLNLTTNAVGGFQASLDPSQIGQMDKLRQQKDKKRKLSGV
FT                   EADRMFLRCIQYILRKQCRMLITKKSFPESFESTVKLIWIRLLQDIDQKNSYDLRAHAP
FT                   EDGSDSDNEPIEDQGRSKNRLHADREPRHQPLGIHMLTTISILYLASYLMGLPVYTNDF
FT                   IRWICNQDIPYFHTSRHLPHNFKSRLPGYYFMLLDGSKPPRKGAYFAQISAVAAKVRFS
FT                   TLCKDSLFLEGLLLKTTLQLTIPPIIYLKVNYLINAIDPERESFHLPESERFLKKRRQI
FT                   NTMPEYRLLAYLIITLRYELLLNSDNYSESYVRSLIEQPYPDIDPSGKTVQNQISNVSY
FT                   GRINIENITRWSKDETMDYLDFIENKLVHGNDELSQQSPFSDLTIDQKIAKRQLFKLFP
FT                   IKDSIDSKMERRKLQSFSNELQEKYLKQFSMHSVYYEQNTSEYVKLVSVLEDRLITILA
FT                   EDFAVTKRQFELCVKRIEHQIKRASI"
FT   CDS_pept        complement(353289..354491)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434401"
FT                   /locus_tag="CAGL0D03432g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /function="transition metal ion binding"
FT                   /biological_process="deoxyribonucleoside diphosphate
FT                   metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58476.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0009186"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG006380"
FT                   /db_xref="HOGENOM:HBG418082"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniParc:UPI00003B6142"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW29"
FT                   /transl_table=1
FT                   /translation="MTKETPSKVAASALSDLELKDSQSNLKKQLEVLREENREQIEALK
FT                   AKLSTAAVEHKEYLKSHKVHRHELKELEKDEPLLNDDPDRLTLFPIKYHEIWQAYKRAE
FT                   ASFWTAEEIDLSKDLHDWNNRLNENERFFISRVLAFFAASDGIVNENLVENFSTEAVIP
FT                   EAKAFYGFQIMIENIHSETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIA
FT                   NSEALFAERLVAFAAIEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFAC
FT                   LLFAHLNHKPDPEVVERIVTEAVEIEQRYFLDALPVALLGMNAQLMNQYVEFVADRLLV
FT                   AFGNKKVYNVENPFDFMENISLAGKTNFFEKRVSDYQKAGVMSKAQNTEGGGAFSLDED
FT                   F"
FT   CDS_pept        complement(355262..356368)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434402"
FT                   /locus_tag="CAGL0D03454g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58477.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG020894"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="UniParc:UPI00003B6143"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW28"
FT                   /transl_table=1
FT                   /translation="MGIIDKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLADE
FT                   SQSSGGGGSGFEVAKSGDARVVLIGYPSVGKSSLLGKITSTKSEIAHYAFTTLTSVPGV
FT                   LKYEGAEIQIVDLPGIIYGASQGKGRGRQVVATARTADLVLMVLDATKSKHQRESLEKE
FT                   LEAVGIRLNKEKPNIYFKKKETGGVKITFTSPSRTNLTEQAIKLILRDYRIHNAEVLVR
FT                   DEKCTIDDFIDVINEQHRNYIKCLYVYNKIDSVSLEEVDRLAREPNTVVMSCEMDLGIQ
FT                   DVVEEIWYQLNLSRVYTKKRGSKPSFDDPLVVRNNSTVGDLCHQIHRDFKDKFKYALVW
FT                   GSSAKHSPQKCGLTHRIDDEDVISLFTK"
FT   tRNA            356685..356758
FT                   /gene_name="tRNA Asn (GTT)"
FT   CDS_pept        complement(357058..357675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500286"
FT                   /gene_name="YKT6"
FT                   /locus_tag="CAGL0D03498g"
FT                   /product="Synaptobrevin homolog YKT6 "
FT                   /EC_number="2.3.1.-"
FT                   /function="transferase activity"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG58478.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG020879"
FT                   /db_xref="HOGENOM:HBG324813"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI00003B6144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW27"
FT                   /transl_table=1
FT                   /translation="MKIYYIGVFRSPAEQSSDEKALELTEVKDLSQFGFFERNSVGQFM
FT                   TFFAETVATRTTAGQRQSVEEGNYIGHVYARSEGICGVLITDKDYPVRPAYTLLNKVLD
FT                   EYLVAHPADQWKSITATNDSLKMAELSTYISKYQDPAQADAIMKVQQELDETKIVLHKT
FT                   IENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKTNSCCIIM"
FT   pro_peptide     complement(357061..357069)
FT                   /gene_name="YKT6"
FT                   /locus_tag="CAGL0D03498g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW27 "
FT   mat_peptide     complement(357070..357675)
FT                   /gene_name="YKT6"
FT                   /locus_tag="CAGL0D03498g"
FT                   /product="Synaptobrevin homolog YKT6 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW27 "
FT   CDS_pept        358053..359267
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043779"
FT                   /gene_name="MIA40"
FT                   /gene_synonym="TIM40"
FT                   /locus_tag="CAGL0D03520g"
FT                   /product="Mitochondrial intermembrane space import and
FT                   assembly protein 40"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58479.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124408"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="UniParc:UPI00003B6145"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW26"
FT                   /transl_table=1
FT                   /translation="MVSAVSRQLVNRQLNRVLLRNARIAPFARATRFYSSKYAQESENA
FT                   KRHKMGLLIAGVAVAGAIVFVTPPQWKKYFRAAKKVEEVAESKEDPVSEAAEEVSESVQ
FT                   ESTEEPQQSQEKETADVGNEQAQDESASSGDSEAKKAHDEFADQNEASEKESAPMGESA
FT                   DADQTAKDETVAEKTGNSKSESSESDQSEQDILSSDLEETMETVSEADKELHQISDNTV
FT                   LSSEEDKTPKAEELKSTSPSGNDEEPKKEDDSSKTIHSLNSEKDMEAVEEEVKQESAYN
FT                   PDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSEAEPKGIDCVEKFQHMQDCFRRYP
FT                   EHYAEQLADPADDENVDHEKNLSEGKDTGVDSTPPKDEAYLKTEKEKKIEENASPDEDT
FT                   ASKKD"
FT   transit_peptide 358053..358154
FT                   /gene_name="MIA40"
FT                   /locus_tag="CAGL0D03520g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW26 "
FT   mat_peptide     358155..359264
FT                   /gene_name="MIA40"
FT                   /locus_tag="CAGL0D03520g"
FT                   /product="Mitochondrial intermembrane space import and
FT                   assembly protein 40"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW26 "
FT   CDS_pept        complement(359549..360937)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434403"
FT                   /locus_tag="CAGL0D03542g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="threonine-tRNA ligase activity"
FT                   /biological_process="threonyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58480.1"
FT                   /db_xref="GO:0004829"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006435"
FT                   /db_xref="HOGENOM:HBG181500"
FT                   /db_xref="HOGENOM:HBG352811"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI00003B6146"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW25"
FT                   /transl_table=1
FT                   /translation="MLCNSVGRIPVKPVTNSVVLIRANSKLAKKDSDSRLTLLQEVSNR
FT                   QRLFITDQITPGSAFFLPNGTKIYNKLVSFMKTQQKHLFGFKEVITPLIYRKSLWEQSG
FT                   HWENYKEDMFRVEGNDLTKEEYGLKPMNCPGHCVIFNRFDHSYNDLPIRYSDFSPLHRN
FT                   EASGALSGLTRVRMFHQDDGHIFCTPDQVEVEILNCLKLVDMCYTKVFPISGEQSKSKD
FT                   SYEIHLSTRPEHYIGELESWDHAEEVLRSVLEKSSKPWKLNAGDGAFYGPKLDIMVKDH
FT                   HGKQHQVATIQLDFQLPQRFNLRYKDRDNSYKRPIMIHRAVLGSVERFMAMLVESNGGK
FT                   WPFWLNPNQAIVIPLNTNNEEQVKMAKQLHDKLRGKLEIEDNLKPVPISHVSYNADIDI
FT                   RAEPVGYRIKDAITKNYSYLIIVGDNEVKAQKFSVRTRENRTPVLMDTNEILEKFKDLE
FT                   SNYK"
FT   CDS_pept        complement(361241..362260)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434404"
FT                   /locus_tag="CAGL0D03564g"
FT                   /product="Similar to uniprot|P36047 Saccharomyces
FT                   cerevisiae YKL193c SDS22"
FT                   /protein_id="CAG58481.1"
FT                   /db_xref="HOGENOM:HBG526095"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI00003B6147"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW24"
FT                   /transl_table=1
FT                   /translation="MEVDGGKHEDKQEDKHAKIEIVDDDREVDVIKPDSELTDDLPDDT
FT                   ENIELVHLRIGSLEELNLTRFHQLKYLCVRQNFIESISEVDVLPDDTVEDLDFYDNKIK
FT                   HISKYINKFKNLKNLDLSFNKIKNIKNIDKLENLENLYFVQNKIEVIENLSTLKKLKNL
FT                   ELGGNRIHEIGEDSLKGLDKLEEIWLGKNHIPRLINLHWLKNLKILSIQSNRIKKIENL
FT                   EQLENLEELYLSHNFIEKIEGLDKNLKLTTLDITSNKITKIENVKHLTKLTDLWLSFNK
FT                   IDQSFESIGDELRDLPEFDTIYLEGNPVQLNNKTSYRRKLMLNLGPSLQKIDATYTRQ"
FT   CDS_pept        complement(362690..363040)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434405"
FT                   /locus_tag="CAGL0D03586g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="CAG58482.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG505479"
FT                   /db_xref="HOGENOM:HBG755218"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniParc:UPI00003B6148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW23"
FT                   /transl_table=1
FT                   /translation="MLRTVVNVARQRPMMMAKANMQMLRPVRFYSQGLSKDVVQKRVVD
FT                   VIKAFDKTSASANITEDTLFHKDLKLDSLDTVELLVAIEEEFDVEFPDKVADELKSVKE
FT                   TVDYILSNPDAN"
FT   CDS_pept        complement(363465..364790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500287"
FT                   /locus_tag="CAGL0D03608g"
FT                   /product="Similarity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG58483.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124409"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00003B6149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW22"
FT                   /transl_table=1
FT                   /translation="MPLPPIYTNRFGYENSNISLPSFSELTSMLNLPRYTLPKPRIQIC
FT                   SHLRPRTQATTGGIDGTANNKPISAYIFMERQPQTTPKIPIVSGSSVSPGAATPYYGAL
FT                   PYDVSRRKLSIASLDNGIRPVNSLSPTISITPVSSYGSVPPKLASVALDNPGVPEPSFA
FT                   PPSMPRINGVCSHRYKIKVTPERETSSMRARCNNSGADKLHSLSAVASALVEEECMVKT
FT                   ENSYPLSPDSINNSVLKSRNNSIDSLISGAIPKFDKEARNNCDGAAQELPAKASYIVSA
FT                   TDDVKEVPSVTLTSSATSNDVTVESQLITAERDAIILAGSQRRESQRSSGSSGSHGSAL
FT                   SQDSSEPKFNTIGSSIRRRKSKPGKVSKSGKNRNVFGYCLQCGKVDTPEWRNGPQGKAT
FT                   LCNACGLFYKKLKKYFADENMAIQFMQHRSIVDPEDRTMPKF"
FT   CDS_pept        366246..367025
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348109"
FT                   /locus_tag="CAGL0D03630g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="polynucleotide 5'-phosphatase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="CAG58484.1"
FT                   /db_xref="GO:0004651"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="HOGENOM:HBG124410"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="UniParc:UPI00003B614A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW21"
FT                   /transl_table=1
FT                   /translation="MKSLTYDEFVGFLGKWVTQEYKKIPLECYQQVEIEAKFGRINSKS
FT                   NSTEFKESKKIIVLNNDYHMIPRISKFDFDRLRNKYINTKFNKLKKSSTKNSNNLSLSD
FT                   YSVSTSLPAPLDKGRLRLNNETAKLDSLIHKEKISNILLSIPNSTYGCKISFNLEIELP
FT                   KAVYINTDLDKCYRRHKLGNRISMPRSKNTLELFKVCTENRAGKTFENYEVEIELCSKN
FT                   IATLIKQENNKDLEKEIRKFSNDFLEIKNTCKLKSKK"
FT   CDS_pept        complement(367129..369198)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141958" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348110"
FT                   /locus_tag="CAGL0D03652g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58485.1"
FT                   /db_xref="HOGENOM:HBG124411"
FT                   /db_xref="HOGENOM:HBG203469"
FT                   /db_xref="UniParc:UPI00003B614B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW20"
FT                   /transl_table=1
FT                   /translation="MSADTRMTLKILYSLDNGAAGSYLARSKTPHLVKVLNIPDPNAVP
FT                   VGRMVTEGDGMAMLRVGAVHISSVLQEIYNNSPEVLSALDSGCGQDYNLYYRDICETDE
FT                   PLVSLGLLSHIRKTVDSDRKELAGNDADEDLDEDFVVTGRVCSNLSALLRRSYSGMSKK
FT                   VSSTPQETLEVKLRFTKIYNTASLKPDNEVKVRRVTKEPSLPQPKVVETTPIVNQPKQV
FT                   INRNKGRVVTKHVQQMNAPPLGAANVNTNRRQTNPMPAPKAKRTQSLPIWNLKPGGSNN
FT                   SYLKNSIAHKIYMADRQLDNSSNTTTVSNSVAEHESKPTDDDKVSKRFDFMLSKKKGNS
FT                   GSKNVTKKSSSNSKKTTEKDNQSQNKSVKKAKAKTTEFRKPSLSINQDFNLPYPNLLGE
FT                   TTPQADLFINNKINDDINDKENIPPHSDSDNYDISSELDMIAFDNMTMKGDMNWLNTYD
FT                   AFEYQNAHLNLQNSKGFNSTPQDANTCNTVNIENDDDDEISAGTRMDDVNINSDGYRSK
FT                   SSAYAQTDIDKTSPIDNMSGSAITNLNRNSTDVDKKDKNKMVLNIEVDDDDDDDDNMNA
FT                   NTTSAAAMNSTPIEQSTIRKVSTTRRSISTIQEEDQDEADEDKRMSKKRKTIPSSPSMM
FT                   FSYHDGSPSSEITNELFTSFINNGIEGEEDNQDTPATICPSSDPAIGQKETPLV"
FT   CDS_pept        370066..373626
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434406"
FT                   /locus_tag="CAGL0D03674g"
FT                   /product="Similar to uniprot|Q08972 Saccharomyces
FT                   cerevisiae YPL226w NEW1"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58486.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG056255"
FT                   /db_xref="HOGENOM:HBG325362"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B614C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW19"
FT                   /transl_table=1
FT                   /translation="MPPKKFAKSLDDFLGEQPQDPNLVPSPFGGYFQQKQSNYQKQRTY
FT                   NKNPNVQKWNQNSNYNYNAQPYNNNQNNYNNYNNYNNYNQSQGFDANGIPINAYKYQQS
FT                   AVTPNQSNGPTPSASAVSLTSLTNKLNELDVSPISGHINKLMEAQNITECKAQVAAIAD
FT                   EFKNTSAKSIKDWKFTDVLSKLTKSKSNPLIRESTMLLITALANVFANNSPQEAYLLPF
FT                   FEFSLDMMADKETTVKRAAQHSLDALMNAFPVDALTSNVLPVILEYLASGAKWQSKLGA
FT                   LGVIDRIREDSPNDLLELTFKSTVPILTDVATDFKPELAKQGHKTLLDYVSILDNLDLA
FT                   PRYELIVNTLQDPNKVPQSVKALSSVTFVAEVTEPALALLVPILNRSLNLSSSSQEQLR
FT                   QTVIVIENLTRLVNNYIEIESYIPQLLPGVQKVVDTASLPEVRELAEKALKVLKGDDST
FT                   SSHNKDSFQGRITEEEGKQYVSDAIKKANITDETKSSFIQDEDVVEYLGKILTVDTNVN
FT                   DWKRLEELFTGVFGADNEAVVNTEIIDRMRALFHQEKVKHDEDEGIEIVNTDFSLAYGS
FT                   RMLLNKTNLRLIKGHRYGLCGRNGAGKSTLMRSIANGQLDGFPDKDTLKTCFVEHKLQG
FT                   EEGDLDLVSFIALDEQLQTTSRDDIANALASVGFDETRRAQTVGSLSGGWKMKLELARA
FT                   MLQKADILLLDEPTNHLDVANVKWLEEYLLEHTNITSLIVSHDSGFLDAVCTDIIHYEN
FT                   KKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQMRFPPPGILTGVKSNTRAVAKVTDVTF
FT                   TYPGASTPSLSHVSCALSLSSRVAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHPNLRI
FT                   GYIAQHALQHVNEHKEKTANQYLQWRYQFGDDREVLLKESRKISDEEKEMMTKEIDVDD
FT                   GRGKRAIEAIVGRQKLKKSFQYEIKWKWWKPKYNSWVPRDVLIEHGFEKLVQKFDDHEA
FT                   SREGLGYRELVPSVITKHFEDVGLDAEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLV
FT                   LDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNEFVGALCPEQWIVENGTMVQKGVKD
FT                   VDQSRFEDGGNANAVGLKPSSSVTDDDSPANIKVKQRKKRLTRNEKKAQAERRRLRYIE
FT                   WLSSPKGTPKPVDTDDEEED"
FT   CDS_pept        complement(373830..374657)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348111"
FT                   /locus_tag="CAGL0D03696g"
FT                   /product="Similar to uniprot|Q03219 Saccharomyces
FT                   cerevisiae YMR178w"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="CAG58487.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG049605"
FT                   /db_xref="HOGENOM:HBG460925"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniParc:UPI00003B614D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW18"
FT                   /transl_table=1
FT                   /translation="MGKISAACVIIGDEILNGKVIDKNSSFFAKFCYDQGIQLNSIVTI
FT                   GDDEDQIVRTIKELSKRYQFIVTTGGIGPTHDDITYESIAKCFNLQCRIDEETKKRMAM
FT                   KSNPESRLDPESLKDYYRMATLPSGPDVKKYYVADDLWVPICSINQQVYIFPGIPQLFS
FT                   RMLMEFLPTLECIYKLDDDKREYKRYFVKTKLSESELSRHLRNFQEEATVHSNEIKLGS
FT                   YPHFGMGFNTVSILGEKKDDEYLRGLKDKIIGILNGEEISEEQESKFSNGNRI"
FT   CDS_pept        complement(375335..376552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434407"
FT                   /locus_tag="CAGL0D03718g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAG58488.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG141771"
FT                   /db_xref="HOGENOM:HBG559646"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI00003B614E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW17"
FT                   /transl_table=1
FT                   /translation="MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNLSDVARA
FT                   LNRPPQYLLKYFGFELGAQTSGNVETERYLVNGVHEPAKLQDVLDGFINKFVLCGSCKN
FT                   PETEIIITKNDDLVRDCKACGKRTPMELRHKLSSFILKNPPNTLAGSKKNKKSATASAN
FT                   VRGGGVSISDIAQGKSQGGDEDGEGNAGDDDDDALAREINAAASELEQIEVKDDEWAVD
FT                   MSEEAIRARAKELQVANGAVDTELTKLEEYGEWIINEAGEDKSNLPSDVELYKKAVELD
FT                   VLSDPKIACVLAQCIFTEDIVNEISEHSAFFTKVFVNADYEKNFLGGIERFLGLEHKEL
FT                   IPTLPKILVQIYNEDVVSEEEIMRFGTKSSKKFVPKDVSKKVRRAAKPFITWLENAESD
FT                   EESDEE"
FT   CDS_pept        376920..377804
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043780"
FT                   /locus_tag="CAGL0D03740g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ribonuclease activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAG58489.1"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG135833"
FT                   /db_xref="HOGENOM:HBG396045"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI00003B614F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW16"
FT                   /transl_table=1
FT                   /translation="MLVDLNVCWPQKDFKTPISAQDEANVRATLMTLKTLGYTHVALNF
FT                   TVSQTEKFPNDARELNPMDINVRFKKLMEATGLKIYSRITLVIDDPSKGQSLAKVSQAY
FT                   DIVAALPISEKGLTLATTNLDIDLLTFEYSQRLPMMLKHKTICSCVNRGVKVEIAYGAA
FT                   LRESFVRKQFVSNARSVIRSSRGRGIIISSGAASPSECRNVLGASSIISFLGLKSDSCS
FT                   RAMGEVPSLVLLNGRLRNKSYKQTVAVGTASNGSNVVESKLEDDSRNIKIVARDISATA
FT                   EPDQGPERKKRKI"
FT   CDS_pept        380418..381356
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348112"
FT                   /locus_tag="CAGL0D03762g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58490.1"
FT                   /db_xref="HOGENOM:HBG124412"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="UniParc:UPI00003B6150"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW15"
FT                   /transl_table=1
FT                   /translation="MDNTKPATGRKSLPKMNSIWIDEDQEEKLYNIQAQVMLNDDNSND
FT                   DLQNIMFLNSKTPLLNNKKNIELPPLDENQGKTGKTPKNAKVNQKTKGNSQEARISTMK
FT                   LLKLFGSRKETKPLTISTPFDFQHISHANGFSSAAEAREVERHELKRETLQTPRASIDL
FT                   TQVALQSPVRLSTKPNYHHSSSSRSSSKFSESPSGSSGIMSNFTVDTSVDEVSVELLTT
FT                   ENKDDDSVYLNDLKNYNFPSIISQSLDNMQSNSSKENSTSKLTSEDPSPTDIAPSIGKK
FT                   QRISVDDILRFYSGNSNSRSSTQASIPIKGV"
FT   CDS_pept        complement(381868..382356)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434408"
FT                   /locus_tag="CAGL0D03784g"
FT                   /product="Similar to uniprot|P38784 Saccharomyces
FT                   cerevisiae YHR060w VMA22"
FT                   /protein_id="CAG58491.1"
FT                   /db_xref="HOGENOM:HBG124413"
FT                   /db_xref="HOGENOM:HBG203755"
FT                   /db_xref="UniParc:UPI00003B6151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW14"
FT                   /transl_table=1
FT                   /translation="MIQLLQLLADYDALLEQLSKSMHDGFNNISRANYHNKDALRGKYG
FT                   KDYWDDGYVGQVMAEVMVSGKVDIVAKPKPVNVPAEKVKDKEAEQLRNRKQTKKIADAE
FT                   ITEETNRTRDYDPILMFGGGLSTPQTLRNAQSNFKGTLPIIVKLLNCKNSINAIINEN"
FT   CDS_pept        complement(382689..383066)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434409"
FT                   /gene_name="FYV4"
FT                   /locus_tag="CAGL0D03806g"
FT                   /product="Protein FYV4, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG58492.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG057948"
FT                   /db_xref="HOGENOM:HBG203754"
FT                   /db_xref="InterPro:IPR019083"
FT                   /db_xref="UniParc:UPI00003B6152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW13"
FT                   /transl_table=1
FT                   /translation="MLSIFGCVRAVPRVVQMSARRTLKVPAPSQSIPDVEAFLKTIGRD
FT                   CSELTETFENKWENLFEWDSKTLKSKGVSVQQRRYILHQAQKFRNGEPVKEMKKGKKSF
FT                   FGGERNRKATVAKWRAEQRNK"
FT   mat_peptide     complement(382692..383036)
FT                   /gene_name="FYV4"
FT                   /locus_tag="CAGL0D03806g"
FT                   /product="Protein FYV4, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW13 "
FT   transit_peptide complement(383037..383066)
FT                   /gene_name="FYV4"
FT                   /locus_tag="CAGL0D03806g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW13 "
FT   CDS_pept        383316..384224
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194899"
FT                   /gene_name="MED6"
FT                   /locus_tag="CAGL0D03828g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 6"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58493.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG137407"
FT                   /db_xref="HOGENOM:HBG272267"
FT                   /db_xref="InterPro:IPR007018"
FT                   /db_xref="InterPro:IPR016612"
FT                   /db_xref="UniParc:UPI00003B6153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FW12"
FT                   /transl_table=1
FT                   /translation="MDTPLDELQWKSPEWIQAFGLRTDNVLDYFAESPFFDKTANNHVI
FT                   KMQRQFSQLPNNGAAAGSMNPETMRDAHSEDMGQEQEFSYVDPIRRAILEKYVVHAFLE
FT                   RELMKVRGIEYVLANVREPDFWVIKKQRRTSPTAIEPLQTYYIVGANVYQSPTVFKIVQ
FT                   SRLLACSSHLSATLAELNNLVEFKPSQGVQYKNILDMPVTTRKTGNTANVGSVPGTISA
FT                   SLNMPMVNTGRLNSAGAATIGTSGVPNSAGMTGANTMATGQTGATSRFENGSSRSSTDA
FT                   ISTDTLDKLLITSMKSTPEYI"
FT   CDS_pept        384689..387193
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434410"
FT                   /locus_tag="CAGL0D03850g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58494.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124414"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B6154"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW11"
FT                   /transl_table=1
FT                   /translation="MYQAVLTKKVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDCF
FT                   YPKVPGGASADYTSLNGQVGQLPTDFTKAKFTVDKSSKSKQSGYKNSILPGENGSHRRL
FT                   ELELSTVEKLREYQTALQLFNAHNPDSLATSSSYDNYKLGAFRSSNYLNWHEDSAEYDI
FT                   MTTTMTQEEVIDKEMEYLKDRLAELKSYALDRRLISTKDSELNSSNSKKRSFEEVTQDD
FT                   NIYDDEDGEFLLRPIFDYQLPQASDTLIVKEVFNALYSPSFLMTLDNVLLQFFGNTLGS
FT                   FNEEQMAEFKKLKVEKKAGLDVEAVSQSSLIIPSSNTLRNIGDFYFDVAIPSKYFDLLN
FT                   KNEYDTLIPSSHKSDSAISINGLSIDDIAAVGILSIIALIVFEALLSMNDLSRSQKSLF
FT                   ELLKQNYESLIANLFLVKNELNFKNHSLQSMRVLKFYIFMKFFDSISVSRSIVNANDND
FT                   EDIYLARALRINNCSNSSENEEKIHIWNILLRLYQDRKLNKGTIPIYSQDINDNSTNVT
FT                   DSLLLKNLPFYDAASSLVDYLMIRDARLSSLELAERVNNVEKTIASNKLECINTPYFLL
FT                   NDYNCWLLGKTSVLSVQYFQLLGIEAERLLSPAQHFSQMQSIIEHVKDALLHSLFYNTS
FT                   GISENFMYLTLSKALTSVESACLITFGILQRCRLQLDSFNDNEEYGEPDNQEELNETKE
FT                   LEETNNHKKEIIRRIVEKLEDVLKKVYCYLVDWATKSEGLNLKAANLAKKLRIFIKYFL
FT                   HTPKESFTPDIDWKEYLSERVGEIDIEAYRKLYYLSENLSEKLMNSVVYEGKSKQLIHE
FT                   SGKFNAPLVDESILHDFFEAFF"
FT   CDS_pept        387624..388433
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194900"
FT                   /locus_tag="CAGL0D03872g"
FT                   /product="Similarities with KLLA0C10230g Kluyveromyces
FT                   lactis"
FT                   /protein_id="CAG58495.1"
FT                   /db_xref="HOGENOM:HBG124415"
FT                   /db_xref="UniParc:UPI00003B6155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW10"
FT                   /transl_table=1
FT                   /translation="MSCVKRSFCNGLQRAVQIRRLTGLANSDLTPFLAEQKQGSGSGPF
FT                   VEIPSIEKVPRSNVLFKLPRNTNLHGELNSVAVLDIAESPDLAQGQDKAKLKVIDQNCK
FT                   SISKIFSNTNAMNLLVNTTVPTTNIRFFKIEDYKNGIQVNVKSNPSILCYTGEIRRSPV
FT                   REQGKLRLSNIVGHGLLGIRSSAGPITQIALAAGEDVTIGTNSLITLESTCQVVPETQL
FT                   EPAVTSMRNIYQSISVAIKRSYRKYSNRWTEDKITIRGPGNLLIQLK"
FT   CDS_pept        389509..390966
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194901"
FT                   /locus_tag="CAGL0D03894g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="RNA binding"
FT                   /function="glutamate 5-kinase activity"
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58496.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004349"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="HOGENOM:HBG273629"
FT                   /db_xref="HOGENOM:HBG507643"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="UniParc:UPI00003B6156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW09"
FT                   /transl_table=1
FT                   /translation="MSQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVV
FT                   IVSSGGIAVGLNAMEMDKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITR
FT                   NDILGWTQYKNAQNTILQLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADH
FT                   LFLLTDVDCLYTENPRTNPDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIA
FT                   ADLATNAGVNTIIMKSDAPSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKN
FT                   HPYGKGGVISPPKSEEDLLSLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHG
FT                   LVTKGVLIIDEDAYNTLTNESGDEEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKG
FT                   SFHELECVDIKVGKRLPNGKLDPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGY
FT                   DVSEYVAHKDNLAFPPSASSVSLQLKT"
FT   CDS_pept        complement(391089..392123)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434411"
FT                   /locus_tag="CAGL0D03916g"
FT                   /product="Similar to uniprot|P38768 Saccharomyces
FT                   cerevisiae YHR034c"
FT                   /protein_id="CAG58497.1"
FT                   /db_xref="HOGENOM:HBG057943"
FT                   /db_xref="HOGENOM:HBG398291"
FT                   /db_xref="InterPro:IPR012981"
FT                   /db_xref="UniParc:UPI00003B6157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW08"
FT                   /transl_table=1
FT                   /translation="MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLE
FT                   AGSKIFVNLCHDPQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVI
FT                   DCCVASDCVKWFVEDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLE
FT                   IFSNELDGSDIKEATQNDKGNDPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPPLFPK
FT                   ANETKGRSLIQEIDDLTLKEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLDIQIDSIT
FT                   GKSDLNIFYDPTNNDIVLRNLNTDLYDQKDFKIPLPNIFEGKDIMNSSEIFYVNKTGTL
FT                   TIFL"
FT   CDS_pept        392433..394304
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500288"
FT                   /locus_tag="CAGL0D03938g"
FT                   /product="Similar to uniprot|P38769 Saccharomyces
FT                   cerevisiae YHR035w"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAG58498.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG124417"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="UniParc:UPI00003B6158"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW07"
FT                   /transl_table=1
FT                   /translation="MQLQCAQAAVTESSHLRDIDNNENVLYSIFEPFLPEQDDNMVDGD
FT                   SSVCSVCGCHIYEKEVCHICDSVRLGDMNGYTLRTGDARVPLEGRVIVIDTICEEIEFL
FT                   ALKTKLVDFLSQIDPVPSLLISLHADGTIKIHGSEKIASIYVEHLRVKYAFKRHDKKYF
FT                   MKLIDGIEIMNSYNEHVIAHIKALRNSVYTHNRKKRAKRATGCALFLANLLCKSDKLHY
FT                   EVLSFLSGPCTLGNGKVISREVKNTIRQFTDLDQQKAKYFDDARSFYKYLAADSKSVAY
FT                   GFYINCLDQIGIYEMSPLIKQSGIIYQFDSFQDTDLHDAFDKYKFFKKSNAIYDVKINV
FT                   VTSPGIQWQKNHDVPLNWSMIFNKTSISIPIRLKIQDFTKKFYNIQATLEYTLGPNRYK
FT                   YVKNAVIHGKDNIAKNIMFHNVLLASITKEIAWETLNEKYYSSQTCTKYREVILKRIAP
FT                   RFKHNMDVLHYIYNLLRSNLLTTRNMSPDERVIAAHEIAYSTMEKIVLMIKPKILLARE
FT                   ADIEPQEVEITAELYADRHSMLGVDAGNLFLLRKSDDIDNNELRETIERWFRKRDTYSV
FT                   TIIPLIEVVPGSGQDRFFKYKLIPMVSQQASAVHSEDTSFEEFVRQL"
FT   CDS_pept        394925..396421
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348113"
FT                   /locus_tag="CAGL0D03960g"
FT                   /product="Similar to uniprot|P38770 Saccharomyces
FT                   cerevisiae YHR036w"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58499.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG124418"
FT                   /db_xref="HOGENOM:HBG203856"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniParc:UPI00003B6159"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW06"
FT                   /transl_table=1
FT                   /translation="MDDFVSLSIQDEYDKSTKNEDLIGISNLCISEGSKLPQQLICKFM
FT                   PHVPVSPSPLRNAFHVEMLQEDMEIDEEGINVPPEDQVAPLSDNTRGSSPNSVFEEQRG
FT                   ASNGTAVESETEKEIEQGINAIGKISLGSTKDDDDLLDDSEVTEKGDESGDWSDINEEQ
FT                   SIDKKSVIKALLSPTTLGIAAATKHDPTLRPSLINAEMEKRTKVTEEPEIETIDKENML
FT                   EVNGVVDRSATEYIKQELRSRAKRNEPIHVSINTHNHYYPTPQQYMDNGISNSKQYEFV
FT                   GKDINIHQAALLHDELQQKKLYSLPDPWSPQSQPASRHWYAITSYLQYFLNVVTLGILC
FT                   AIFITLVHAFKADVQAIWHQHKVTFEQESLDCKRNFYENKCDRDTPLPALIDQCHTWSK
FT                   CMSRDNDKLFTARISLVARILGSILNSFIEPLGWKALLVLFIGCTIWCFSTNFLLGFAR
FT                   ARSYYGHNLEDRIKKLELTRYYNQDHSEPLQHSKLITYNK"
FT   CDS_pept        397039..398763
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434412"
FT                   /locus_tag="CAGL0D03982g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="1-pyrroline-5-carboxylate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG58500.1"
FT                   /db_xref="GO:0003842"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B615A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW05"
FT                   /transl_table=1
FT                   /translation="MLSARLYRGSVRGVAQFARASIPKHVTNEAVKPFSKDADSKDWDL
FT                   LRASLMKFKSSSLEVPLVINGERVYADRGRAVFAQTNPANHEQVLANVAQATRDDIKSA
FT                   IGAAKQAKEKWYNMPFYDRAAIFMKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCIT
FT                   ELSDFFRFNVKYADELYATQPIESVPGIWNRAEYRPLEGFVYAVSPFNFTAIAANLIGA
FT                   PALMGNTVVWKPSQTAALSNYLLLTVLEEAGLPKGVINFVPGDPVEITDEVLASRDFSA
FT                   LHFTGSTAVFKQLYGKIQSGVAENKYRDYPRIVGETGGKNYHLVHPSANVPHAVFNTIR
FT                   GAFEFQGQKCSATSRLYLPKSMSEEFFRDMFGTLSNNKVVPVNTSASAISGGNLHGFMG
FT                   PVIHEQSFNKLSAAIEEAKKDPELEILYGGQYDKSQGWYIGPTIIRTTNPNHKFLTTEF
FT                   FGPILTVYEYQDSQFKDICELINETGEYGLTGSIFSRDRDAIIYASEKLRFSAGNFYIN
FT                   DKCTGAVVAQQWFGGARMSGTNDKAGGPSILSRFVSIRSIKENMQEITDFRYPSNYE"
FT   CDS_pept        399319..400203
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434413"
FT                   /locus_tag="CAGL0D04004g"
FT                   /product="Similar to uniprot|P53210 Saccharomyces
FT                   cerevisiae YGR017w"
FT                   /function="FMN binding"
FT                   /protein_id="CAG58501.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG190556"
FT                   /db_xref="HOGENOM:HBG397751"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI00003B615B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW04"
FT                   /transl_table=1
FT                   /translation="MAPNSHMAPWVPMFTQSCKNAKQAFIPFQFATVAESVDGIPLPKC
FT                   RTVVFRDFLFDERKTNVLTFNTDLRSNKVEESFPNGNGTCLFEACFYFHETWEQYRFTG
FT                   ECFLVSRKQQAIVSNETLLRYGIVDPTTFKRSESNSSVSSCSSSDEGSLPAMVDSLKLD
FT                   DSKYDNHHDDGEEDIHNTDDGKVPLPTDEEWQQEIMRQWDTLSRATKSVYKKPAPGEPI
FT                   TEEMKKKIDKIERGVDGSKADYGLDNFAIVCLCIDKVDYLNLKGGKGGARWIFERVIDE
FT                   TGFETWEEQEVCP"
FT   CDS_pept        401513..402928
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434414"
FT                   /locus_tag="CAGL0D04026g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="gamma-aminobutyric acid metabolic
FT                   process"
FT                   /protein_id="CAG58502.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0009448"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG483813"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B615C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW03"
FT                   /transl_table=1
FT                   /translation="MPSPAEQYYPSEPKAPIIKTPEVPGPESKKRLAELNDLYDCRPAA
FT                   FMADYEKSIGNYITDVDGNVMLDVYAQIASIALGYNNPALIEATKTPEMIRALVDRPSL
FT                   CSFPPTDLEKSLNQLLKFAPKGQNRIWCGLSGTDANELAFKAAFIYYKSMQRGYDAEFT
FT                   AEEEESVMNNEEPGAPHLSILSFKKAFHGRLFAAASVTNSKAVHKLDFPQFHWPHAEFP
FT                   DYKYPLHEHEEENRKEDERCLANAEKIINTWETPIAAVIIEPVQAEGGDNHASKYLLQG
FT                   LRDLTLKYGIVYIIDEVQTGVGATGKLWCHEHADIQPPPDIVTFAKKFQTCGYFFHEPK
FT                   IVPNKPSRQFNTWCGDPARMLIGGAIGQEITDKKLVEQCSRVGDYLFGKLEELQKQYPK
FT                   KLLRLRGKNRGTFIAWDLETGEERDAFLKKMRANGVNIGGCANSTVRLRPTLTFEEKHA
FT                   DILIDVLKKVLQE"
FT   CDS_pept        complement(403135..403491)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000056545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434415"
FT                   /locus_tag="CAGL0D04048g"
FT                   /product="Similar to uniprot|P39111 Saccharomyces
FT                   cerevisiae YGR020c VMA7"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="CAG58503.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG370747"
FT                   /db_xref="HOGENOM:HBG402579"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniParc:UPI00003B615D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW02"
FT                   /transl_table=1
FT                   /translation="MADKRTLLAVIADEDTTTGLLLAGVGQITPDTQEKNFFVFQEGKT
FT                   TREEVGEMFDKFTEERNDIAILLINQHIAELIRSRVDSYTKPFPAILEIPSKDHPYDPE
FT                   KDSVLKRVRKLFGE"
FT   CDS_pept        403855..404727
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500289"
FT                   /locus_tag="CAGL0D04070g"
FT                   /product="Similar to uniprot|P53212 Saccharomyces
FT                   cerevisiae YGR021w"
FT                   /protein_id="CAG58504.1"
FT                   /db_xref="HOGENOM:HBG301472"
FT                   /db_xref="HOGENOM:HBG715231"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="UniParc:UPI00003B615E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW01"
FT                   /transl_table=1
FT                   /translation="MLRCSTSRVLSVLESPCASRLPTRTFSHARVMLSGHNKWSTIKHD
FT                   KAKNDAEKNKLINKFASQVTIAVKSGGSGDPAMNIRLQSAIDLAFKNNVPKKVIEGAIN
FT                   RGLGIGGEKNSSEVCVYEGIGPGGVAYVVECLTDNKNRSIALVRSAFNKIGGSMTPTLY
FT                   FFERKGYLVVESPKELTSEDDVLDAVLEIDGVEDIKLVEEEESNVSDTDEEPGAKYDVI
FT                   TEVQMNNKAANAFKEKGFKIHEMGLEYIPNPDTTVQVTDEEVLAKIEKLTNTLEELDDV
FT                   TSVYTNISE"
FT   CDS_pept        405613..406368
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043781"
FT                   /locus_tag="CAGL0D04092g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="catalytic activity"
FT                   /protein_id="CAG58505.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B615F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FW00"
FT                   /transl_table=1
FT                   /translation="MTVKKDNQFSVDVCLFDLDGTIVSTTVAAESAWRMLCAKEGVDPE
FT                   ELFKFSHGVRTSEVLAKFFPNIDNTDNKMTRELELSMANNFLDTVSLIPGAKDLLLTLD
FT                   KDTARQGAKFNERKWAIVTSGSPDLAFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGY
FT                   AKAKKLLCERLQYESASATSVVFEDAPAGIKAGKAMGAITVGITSTYDLQTLIDAGADY
FT                   VVKDLTQVEVLKNTEGDQITLEIENPLNQ"
FT   CDS_pept        complement(406872..408935)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194902"
FT                   /locus_tag="CAGL0D04114g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58506.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269581"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023208"
FT                   /db_xref="UniParc:UPI00003B6160"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ9"
FT                   /transl_table=1
FT                   /translation="MDKTDLLVLIGLTLVVVLYLKRETIKSFISELLFAEEDSATTVST
FT                   SSRDIAEVVNEHGKNYVVFYASQTGTAEDYAKKFAKELTAKFGLNVMCADVEYFDFETL
FT                   NDLPDGCVVSFFVSTYGEGDFPDGAVHLEDFLSNCGTTDLENVNFTIFGLGNCTYEFFN
FT                   GASRKCNKYLLEAGAKQIGAAGEGDDGSGSTDEDYLAWKDAILEELKSKLKLDERQEKF
FT                   VPSFKLETLETVTEKTSLGEPSLQYLPANKLSFNDEGVQLGPFDLSQPYVAPVAKSYEL
FT                   FKSGDRNCIHSEIDVSGSNIKYTTGDHLAIWPSNANEKVEQFLQLFNLKGDTIFNLKPL
FT                   DSTIKVPFPCPTTIEATVRHYLEITGPVSRQSFGSLIQFAPNEEIKQKLTALAKDKDLF
FT                   AKEITAKCYNLADALLYVSNGQPWSTVPWEFLIEAMAHIQPRYYSISSSSLSEKQTIHI
FT                   TSVVENSPNPVDPSLPPVVGVATNLLRNVQLAKNNEDTSSMPVHYDLNGPRNLFQGYKL
FT                   PVHVRRSTFRLPTNPSTPVIMIGPGTGVAPFRGFVRERVKFVEQQENVQLGKHLLFYGS
FT                   RNTDDYLYREEWPEYAKKLGASFEMIVGHSRIPGQPKVYVQDKIREHAQEVLKLIHEGA
FT                   FLYICGDAKNMAQGVNAALVDILSEDKKITKEEASEMIKMLKTTGRFQEDVW"
FT   CDS_pept        join(409387..409397,409461..410097)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194903"
FT                   /gene_name="SRB2"
FT                   /gene_synonym="MED20"
FT                   /locus_tag="CAGL0D04136g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 20"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58507.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG057934"
FT                   /db_xref="HOGENOM:HBG398796"
FT                   /db_xref="InterPro:IPR013921"
FT                   /db_xref="UniParc:UPI00015D7B0C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVZ8"
FT                   /transl_table=1
FT                   /translation="MSSAVIFVESATPGTLTEFKDLLAKQLLEVRETWSLEFRTYRTLV
FT                   KDFPSREKLLYSLTFPHHDKKTVLIRNSLAWVLGTAEIPDNLQTCSTGLSESIDQLLAS
FT                   KLSNMWAQRQVIRGDAGQTLLITGDVTVRIINLFAATGFKGLLIELDNLQSATSLANIT
FT                   DLLNEMKVKVFKVASAPGLKSEDVEVVDSSSTMESGNEALFTLAKQYIEVLE"
FT   CDS_pept        complement(410309..411127)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434416"
FT                   /gene_name="RSM25"
FT                   /locus_tag="CAGL0D04158g"
FT                   /product="37S ribosomal protein S25, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58508.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG124419"
FT                   /db_xref="HOGENOM:HBG324291"
FT                   /db_xref="InterPro:IPR016939"
FT                   /db_xref="UniParc:UPI00003B6162"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVZ7"
FT                   /transl_table=1
FT                   /translation="MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTRE
FT                   PHKINPSTDKKVSELKDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIR
FT                   TLFYKQHPWELARPKIVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNI
FT                   TDAYDQARLEFYRLRMQQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDA
FT                   ELQSELLSAKKENASKAAGDASAVSSEKQVEDDVVNFDESTDADQEVLHF"
FT   CDS_pept        complement(411498..413600)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434417"
FT                   /locus_tag="CAGL0D04180g"
FT                   /product="Similar to uniprot|P40498 Saccharomyces
FT                   cerevisiae YIL091c"
FT                   /protein_id="CAG58509.1"
FT                   /db_xref="HOGENOM:HBG333844"
FT                   /db_xref="HOGENOM:HBG597089"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniParc:UPI00003B6163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ6"
FT                   /transl_table=1
FT                   /translation="MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEKV
FT                   QDDGEKEDDKEQVYNALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAFAD
FT                   GESDDEDDDEDEQAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKS
FT                   IKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTE
FT                   SNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQ
FT                   KLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDP
FT                   SFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVEN
FT                   TDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWY
FT                   INDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQ
FT                   IFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMK
FT                   EKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKP
FT                   PSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQN
FT                   ETYEFK"
FT   CDS_pept        414049..415548
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434418"
FT                   /locus_tag="CAGL0D04202g"
FT                   /product="Similar to uniprot|P40499 Saccharomyces
FT                   cerevisiae YIL090w"
FT                   /protein_id="CAG58510.1"
FT                   /db_xref="HOGENOM:HBG058581"
FT                   /db_xref="HOGENOM:HBG398099"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniParc:UPI00003B6164"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ5"
FT                   /transl_table=1
FT                   /translation="MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTV
FT                   TLFNLYLISTTLSVLARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFL
FT                   SPVGSYQELDPDGSFLDLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPF
FT                   FTLLEGFFTILAIQAIGETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPI
FT                   WKLTIQSASLLGFVLSIVFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRAT
FT                   EEILDLVKDVWQTHQRNLLNRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRF
FT                   WLDVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRII
FT                   PALQRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFG
FT                   SKDQPRIVTDSWSFWNWCNIFWTVLVYANELIGTQAPNELT"
FT   tRNA            complement(416568..416641)
FT                   /gene_name="tRNA Val (AAC)"
FT   CDS_pept        complement(417103..417753)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434419"
FT                   /locus_tag="CAGL0D04246g"
FT                   /product="Similar to uniprot|Q04272 Saccharomyces
FT                   cerevisiae YMR077c"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG58511.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG371348"
FT                   /db_xref="HOGENOM:HBG592869"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI00003B6165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ4"
FT                   /transl_table=1
FT                   /translation="MGQKPSKVHITETDKAILQLKRSKDEIHKYTKKSDRLIAIEKDRL
FT                   KQLIHDNPKTYKKDTKVRFLLKKIHYQEHLLQQASDQLINLENMVSTLEFKMVEKEFVS
FT                   GLQTGNEILKKLNAEFKDVDKLMDDVQDQIEYQAEVDNALANSVVGTNTFEDELDRELD
FT                   QLDKEVNGLPELPTTEGLPAFDNRQKEKNEVERINNPQQNTEIQSKKEEALPA"
FT   CDS_pept        complement(418104..420269)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043782"
FT                   /locus_tag="CAGL0D04268g"
FT                   /product="Similar to uniprot|P49956 Saccharomyces
FT                   cerevisiae YMR078c CHL12"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG58512.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG058168"
FT                   /db_xref="HOGENOM:HBG203415"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00003B6166"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ3"
FT                   /transl_table=1
FT                   /translation="MDGAPNFSGFGGSVLFGDEGEKLVFNGCKGGSVVLEKRASANATA
FT                   TTSASATTTYNGAVWQAEDGYGINIAHLIDRIEARSDDSNGETAPAETVSGQRSPDCTL
FT                   WVEKWRPKKFMDLVGNEKNNRRILKWLRQWNFAVFKEQLPQPDQSKEQENFDPFERPMK
FT                   RILMLNGPPGIGKTSVAHVVAKQAGFSVAEINASDERAGTLVRDKVHNTLFNHSFTGEP
FT                   VCLIADEIDGSVESGFVKVLIDIVNADKRATDNYVLKKNARGKNNGKSNRYRPKLLLRP
FT                   IIVICNNLYAPALEKLRPLCEIITLRKPSDNSVRERLTHICMKERINLGMKTINELIDI
FT                   SEGDIRNCVNNLQFQSKGNHKTSNNDNVSEDTLGLKDISLSWFKIVNQIFRKDPHLDNK
FT                   RQFIRLARKIEKVDNYDRVVTGCHTLFPHVKYSDSGLRKPAAMADWLYFHEQMFKSMFE
FT                   HNGELLRYCAIVPMVFHQKFGDISNKDDQRIKNADYEQREARKAVESITESIMKKLSTF
FT                   SPLLASNMNKKDLGFEILPYLDSMIASDISKIKDAKKKQAVLNNIINLIDLFQLELLET
FT                   RGEHYTSRGVLMIEPPIDKVVLIDEMKKNEVTTKRAANLNLILAKQEEIKVRKRHLNQV
FT                   EANKGKSTVEETTSKRQKISIENFSKANNDKTVDMLKSQYTAIQQNTTDQNKSTNNESE
FT                   EVKIWIKYKEGFSDAVRKKVTWETLWS"
FT   CDS_pept        420985..421893
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194904"
FT                   /gene_name="SEC14"
FT                   /locus_tag="CAGL0D04290g"
FT                   /product="SEC14 cytosolic factor "
FT                   /function="transporter activity"
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="CAG58513.2"
FT                   /db_xref="EMBL:CAA65985.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG141734"
FT                   /db_xref="HOGENOM:HBG328476"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI00001355B7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53989"
FT                   /transl_table=1
FT                   /translation="MVSEAEFLASYPQKCPAGSLPGTPGNTDEAQEGALKQLRSELEAA
FT                   GFKERLDDSTLLRFLRARKFDVALAKEMFENCEKWRKEYGTNTIMQDFHYDEKPLVAKY
FT                   YPQYYHKTDKDGRPVYFEELGAVNLTEMEKITTQERMLKNLVWEYESVVNYRLPACSRA
FT                   AGYLVETSCTVMDLKGISISSAYSVLSYVREASYISQNYYPERMGKFYLINAPFGFSTA
FT                   FRLFKPFLDPVTVSKIFILGSSYQSELLKQIPAENLPSKFGGKSEVDEAAGGLYLSDIG
FT                   PWRDAKYIGPEGEAPEMFSMK"
FT   CDS_pept        complement(422482..425376)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500290"
FT                   /locus_tag="CAGL0D04312g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nuclear-transcribed mRNA catabolic
FT                   process, nonsense-mediated decay"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58514.1"
FT                   /db_xref="GO:0000184"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG034953"
FT                   /db_xref="HOGENOM:HBG333519"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="UniParc:UPI00003B6168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ1"
FT                   /transl_table=1
FT                   /translation="MNFPAESNDPELAILADLEDAEELEFMQEVQGNLQVEPVERQAEG
FT                   HACAYCGIDAPTSVIKCNSCSKWFCNSKNGTVNSHIINHLILSHHHSVSLHPESDLGDT
FT                   VLECYNCGCKNVFVLGFVSAKSEAVVVLLCRIPCAQSKNPNWDTDQWQPLIEEKQFLSW
FT                   VAEPASDEEIKLKAKLITPSQISKLENKWRSDKYATMDDVQDESKKVQDDILAGIGEEE
FT                   DIPPLLLRYQDAYEYQRSYGPLIKLEADYDKQLKESQALEHISVEWSLALNNRHLASFA
FT                   LSTFESSELKVAVGDEMILSYSGIQGEDWKGTGFIVRLPNSFKDMFTLELRPSKTPPPT
FT                   HLTTGFTAEFIWKATSYDRMQTALKNFAVDKKSISGYLYYKILGHQVVDLHFDVPMPKE
FT                   LSLPGYTKLNASQSKAVEHVLQRPLSLIQGPPGTGKTVTSASIVYHLSKIRKDRILVCA
FT                   PSNIAVDHLAAKLRDLGLKVVRVTAKSREDVESSVSSLALHNLVAKGAKGVLKKLLKLK
FT                   EEAGELSARDTKRFISLVKKTEKSILEQADVVCCTCVGAGDRRLDMKFRTVLIDESTQA
FT                   SEPECLIPIVKGAKQVILVGDHQQLGPVILERKASDAGLKQSLFERLISLGHIPIRLEV
FT                   QYRMNPFLSEFPSNMFYEGSLQNGVTEEQRTLANSTFPWPINGIPMMFWANYGSEEMSA
FT                   NGTSYLNRTEAMNCERIITRLFRDGVKPEQIGVITPYEGQRAYVLQYMQMNGALDKELY
FT                   SNVEVASVDAFQGREKDFIILSCVRANEQQMIGFLRDPRRLNVGLTRAKYGLIILGNPR
FT                   SLSRNTLWNHLLLHFRQKGCLVEGVLENLQVCTVPLTRPNVKKNRSTDYNYNFGVEMGD
FT                   LPNTNDMDTQSLLSFGGQAGNFSNLFSNDSEFNNYLNNEYWNYTRNGKNAKPSAQNFES
FT                   NTYSNEGPTLNSNYAQELAREQESVRNTLQSLEF"
FT   tRNA            425740..425811
FT                   /gene_name="tRNA Glu (CTC)"
FT   CDS_pept        426132..427307
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434420"
FT                   /locus_tag="CAGL0D04356g"
FT                   /product="Similar to uniprot|P48015 Saccharomyces
FT                   cerevisiae YDR019c GCV1"
FT                   /function="aminomethyltransferase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58515.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="HOGENOM:HBG288505"
FT                   /db_xref="HOGENOM:HBG299834"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="UniParc:UPI00003B6169"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVZ0"
FT                   /transl_table=1
FT                   /translation="MSLVLKRFNSTALKKTALHDLHVSLGGTMVEFAGYSMPVLYKGQT
FT                   HIESHLWTRQNAGLFDVSHMLQSRLTGAEATKLLHSVTPTDFANLPQGTGSLSVLLNEH
FT                   GGVVDDTIITKEQDNQYYIVTNAGCVDRDTEFLKGEVSKLDCSWDIIQGRSLLALQGPK
FT                   AQQVLERLVTRDSKLNELYFGERKEFTLDDATATRIGVARGGYTGEDGFEISVENGKAN
FT                   EFAQKLLDNELTKPIGLAARDSLRLEAGMCLYGHELTESITPVEAGLAWVISKSRRDAG
FT                   SEDQFNGYSKIIDQLKNKTHEIIRIAYKYKGKGPAARPGAKIFLEDGETQIGEVTSGSA
FT                   APSLNNINIGQGYVKRAHNKKGKTVLIQVRNKFYPAELAKMPLVQTHYHKA"
FT   CDS_pept        427971..431132
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434421"
FT                   /locus_tag="CAGL0D04378g"
FT                   /product="Similar to uniprot|Q12494 Saccharomyces
FT                   cerevisiae YDR017c KCS1"
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="CAG58516.1"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG124420"
FT                   /db_xref="HOGENOM:HBG203123"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI00003B616A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY9"
FT                   /transl_table=1
FT                   /translation="MPSHDGTRAKTKLRSKSRSQTHEYETEPFVHGSLEDEETVKNLKD
FT                   LNISNKQKLSPVMHGRKASTYLRIFQDDDEPVINNEKAGRHRGSRHHHKRLSGTLDESD
FT                   GNIPNIYRNIEGKQRRNSKNYGGHSPMGRRNSAYNQQRKPTKESLQNLALSNRTSPQSP
FT                   PSNRNKIALDNGKGTRYSYRRSSSSSKERPHEIPKHASRDWSNFNVNIATTRVGNIHNY
FT                   AQMDSSPGSKMLSSGNDQDLPLTDDLMLKPVSSATYYPHKSKEKKKLSDEFTSNKHNRT
FT                   DRQSDEFGNKGNEKNQSTNTEEKLEYDISPNSDIIDIVAPISSDSFDNQLLENIPKVKH
FT                   SPVDIEQNNVVTDESDIEDEDNDREYPLAVELKPFTNNVGGHTAIFRFSKRAVCKALVN
FT                   RENKFYENIEINHQELLPFMPRYIGVLNVRQHFYSHDDEMINNISKENEKINDDDEQIK
FT                   TTPIKQKIPSNDSEQIGSALTHIHSFPIERQQRSISCKDYMSSQQQLPEVVLNDNRHII
FT                   PDSLWGRYSHSPNSLPDNSPSSYLSSHSFDEKKFERALENRDREGERDAGYTVINTELK
FT                   NSVLEEVFAPICYRRHQKQRSQIQFKIPPGHSPSNSLQESRFPHDNSRRDSDTVVGSVR
FT                   NSQIDQPLLQKSVKDSISNCLESSHSVMDLKQFKRKEEIKEGLQGNTNEQPNPNLTSQT
FT                   MALSNSVSSCGTSKSKIDCEDDMDVFLMDEDNETLDHHNRKPQQNQLAEYRSASRESVP
FT                   TEDQEHTIVSQFILLEDLTRNLSKPCALDLKMGTRQYGVDAKRTKQQSQRAKCHKTTSR
FT                   KLGVRICGIKVWDQDYYIKRDKYFGRRVRAGWQFARLLARFLYDGKHKGSVIRQIPRLL
FT                   KQLETLNNEVNELKGYRLYGASLLLMYDGRAKETSIDNTSDLTKMLTSVGKAKVNLIDF
FT                   ARCVTKEDMVAGLSTFKIPPKNPKLEDKGFLRGVKSLKFYLQLIWNYLTNDAKIPEEEE
FT                   DMIEWMNSNLDSVLSPWDWLDSFADEEENEFNDPTSELRKKWRKYELIFDAEPRYNNLD
FT                   PEISD"
FT   CDS_pept        431539..431778
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434422"
FT                   /locus_tag="CAGL0D04394g"
FT                   /product="Similar to uniprot|Q12248 Saccharomyces
FT                   cerevisiae YDR016c DAD1"
FT                   /protein_id="CAR58013.1"
FT                   /db_xref="HOGENOM:HBG398797"
FT                   /db_xref="InterPro:IPR013958"
FT                   /db_xref="UniParc:UPI00017BD566"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMY9"
FT                   /transl_table=1
FT                   /translation="MNKQEISTADKDFIEQRDVLLQEVNELVASILNGLNDLNISLESS
FT                   ISVGKEFEKVSTLWKSFYDGLESVDNEHSDSGED"
FT   CDS_pept        complement(432126..432398)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500291"
FT                   /locus_tag="CAGL0D04400g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58517.1"
FT                   /db_xref="HOGENOM:HBG124422"
FT                   /db_xref="UniParc:UPI00003B616B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY8"
FT                   /transl_table=1
FT                   /translation="MFGRSYTVITNTNPVTGQLTQNRISKRSVTESDVVVQFSLTKDRS
FT                   SIKRVKSLKRVSSLKNLIAKANRTLYNVDSSKVVYKAGLSKKLRR"
FT   CDS_pept        434014..435159
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434423"
FT                   /locus_tag="CAGL0D04422g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG58518.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="HOGENOM:HBG124423"
FT                   /db_xref="HOGENOM:HBG204024"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniParc:UPI00003B616C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY7"
FT                   /transl_table=1
FT                   /translation="MGLPSISENKHLKTNGTVHRILCYTLATILGNYARQGLEYLTNYE
FT                   PSYVRPTTVLWANCGGCIMMGLCQDLRELFFYANEYHVLFLSITTGFCGSFSSFSTMII
FT                   EMFTYSASLTNENIATGSRLPNRAYGIMEFLSVMIVHLGVSLSGLLLGRKLGKEVLIPY
FT                   FISRPTKTEVSLTDNEPTEPSDNSGEVIEKTDSYVEPEYYTPRWCVYILFGLDLFLTYM
FT                   SIPILVMIIILTAFYGNYSRGVWTLPVLFGIPGSFLRYYLSKWFNNRKSLSMFPVGTFI
FT                   ANISATLILSILIMVQRGQKNSQTHERIINNKNTCHIVQALGSGFCGSLSTVSTFINEA
FT                   HQKDISYILRYYFITIFCAYCLCVITLGSYSWTRGLTLPVC"
FT   CDS_pept        complement(435564..437288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043783"
FT                   /locus_tag="CAGL0D04444g"
FT                   /product="Similar to uniprot|Q99359 Saccharomyces
FT                   cerevisiae YDR014w"
FT                   /protein_id="CAG58519.1"
FT                   /db_xref="HOGENOM:HBG124424"
FT                   /db_xref="UniParc:UPI00003B616D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY6"
FT                   /transl_table=1
FT                   /translation="MKVYGRRAHSYDYDTSHDIEFSDDEMTPVRSDLSMEPKSESSISS
FT                   ASNKQAKVFSNVAGQRSDNKLDLQGDSFDDLFNNIELPKRKKRKTTYRKKIEINQSNNV
FT                   LDGENFDGGPASDNNLEFETSIQDISDYLDQIKSDDDRKRTNALEDIDSLYEGQQVSIS
FT                   SLQNTKLSATKSELPMNRNLGNATVVHRQVSLYDSLDSDSKQVDGNKFKAMRKQGHALQ
FT                   YQDDVDELLLPLKAVTVETSAESFVLAIIKLLINMFTDSDLKDFIIQNYSDNLINTLDK
FT                   FSFKTDTVFKPLSQMLLSDLVTCLVDGDSKIGDNMVFTIANVIKFNIIDLNHIDFKEEI
FT                   AEIGRKYPQLSSSVNAYSAIIDHHDKNISAFVKLIVQFPSSLNFFDECSLKSIFTNIIK
FT                   YYESEANPIKNDIEDVLLKGLILLVNSGINFAGNSKKDKSFFIDMLEHIIDDIENENDL
FT                   DDIHLLKAVLSCNLLINDPITESCDLKEKIERFLCKILCEESERKIVEDNLMVFQYLSL
FT                   VYLLSGSKISSDKLALTLEQTKRLKLRFTKLLSSLHVENVKIQNKINDCMLSMDLIK"
FT   CDS_pept        complement(437489..438157)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192102" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500292"
FT                   /gene_name="PSF1"
FT                   /locus_tag="CAGL0D04466g"
FT                   /product="DNA replication complex GINS protein PSF1 "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58520.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG359786"
FT                   /db_xref="HOGENOM:HBG597497"
FT                   /db_xref="InterPro:IPR005339"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI00003B616E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVY5"
FT                   /transl_table=1
FT                   /translation="MYGDLANKLILEAKRTQQLNQRRVNEDLQSGGGVNLLSRLPIYHD
FT                   ELVRNILNEVDQLRRNAEFLRNNGNAEEFAHLDEKIVKCQYFVTLLCMERNKRCLLAYQ
FT                   KLRTDILDNIAWCNNGTGIELYSGSNEDETNSLSHYEQEYLKEYGELITELKSESMADI
FT                   DLSGSLEPPSDVFIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRQSDVERLIQQGYLQKI
FT                   "
FT   CDS_pept        438456..439238
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434424"
FT                   /locus_tag="CAGL0D04488g"
FT                   /product="Similar to uniprot|Q06109 Saccharomyces
FT                   cerevisiae YPR116w"
FT                   /protein_id="CAG58521.1"
FT                   /db_xref="HOGENOM:HBG124425"
FT                   /db_xref="UniParc:UPI00003B616F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY4"
FT                   /transl_table=1
FT                   /translation="MPRLERNVYKGLITSLSRKKPSNSLAVKESPLLTKFERWSGKRMK
FT                   LFFESEDSFEHYGLRDLKLPHNMLANKLASPIRAERNTRYRIPKEFLIKLNLYKDATNN
FT                   VLQLKANFNGVTGLGTTYIHNNKKCLEMKFCDISRWSSRQPLKVPPLPIVADKSALLKD
FT                   YENQLIRELNECFSKLKTTSKHDHNTVKLYVSTENNLLMDVDTQGSLCINLQSITDKLP
FT                   HTMLETVTNAPIHISAYSNMDFLTTLHRLLGYYRHRNR"
FT   CDS_pept        440080..447522
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001002" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043784"
FT                   /locus_tag="CAGL0D04510g"
FT                   /product="Similar to uniprot|Q06116 Saccharomyces
FT                   cerevisiae YPR117w"
FT                   /protein_id="CAG58522.1"
FT                   /db_xref="HOGENOM:HBG124426"
FT                   /db_xref="HOGENOM:HBG203992"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniParc:UPI00003B6170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY3"
FT                   /transl_table=1
FT                   /translation="MIELISVHNVLQLLHIAFKVLVAEVLLQAFIWLVLSFFNLPIKAF
FT                   SFGVLLGPAIRNVLVQFKGVKLTVRSITLRASLQPSIIFNSINVTLSDVIDKGDNDTDQ
FT                   NAPAVPRVRIKMNSWQLWLVNILTKFQFYFANVYITLADNHMIKVDLVSASISKVGKDT
FT                   TNIEFFAHEIEKGDEFTMNHVIYMLSFKTNRAKDDEEKGIVIELYEWNSYLKTTNTVID
FT                   YHSYQKKYYRVPKSVAPEVAEDSKLSSTPQSFDDSIIHKIIDMNRHLIKRLRIIDVKIE
FT                   NIDVVFCPSFKISVSSFQFCLKSMNKTEKRSVWELVEFNSSIWEEYEITLSMNSIICES
FT                   GPDTCLRLPLVNILITTDCMAHYTNGVPFENLKIVTTINVINPSFFTTSEQVLKLLKTF
FT                   LIKGNTESKNEDTLNSFPIDNFRMDKFPSFTLEYSFSNFTSTIGLSNEEDLNLSLFNVQ
FT                   AIICHSSVVDELSIPEMTLEKVQWSFIKSSSPKKEFSNYIKIVGLSISYLRSSHLADVP
FT                   PLSIPLCGLERLDTFIEDVFSKNSRVNSTLRHFSLTLDSLKVVDKLSGFMSKINSVMHD
FT                   NVSNKNENMPDLESHKGTSIKRKRGLAKLINDLNWTLRFRFKDVTISLIVSGFLPKYLD
FT                   PIDNADLNLTDIDRGIKITFKESLLLIDNDGKRFSLFNATLSRIIDNINKESEVGGIFV
FT                   LNDFVVYQPKNSNDISIKLPLVHMKFDVSTLWLIFFLKSIWERYSVTMLNASKEKVKKI
FT                   KKPTMRKTLRIQANEINIHVMLMSGNPIVFAIEDLNFDSLSMMVSLQNFRLLCKSVYIT
FT                   KIPVLVNLMQIRDLSVDLKKLGEHSAVPITTSLIHFQTEYHLRLYIIIDDIITMFKSYK
FT                   QIHLAFSNILYYRRLYPSRMFAAKIPKINFSVEKFLIDIEEDPFEQELGLIYKVGVSEQ
FT                   RERIRKEVEFDNEVRRLKEMTPEEQEEFLSRVNNYPYRGRMSENYYIQQARMRLLEHFS
FT                   TSWIVRYRKAKLLHHQAPYHVEEKRYIDTKYYVYSKERVITTANLIIDNLMLNIGPPSF
FT                   PVENHMDFIHKYGKGVPKSMEYTLLIMMGMNIYSDLFELNLRDYPIPVMSFSQVKTDGD
FT                   IVFAEKMPIEDSHRSIFVPFVKSASAVPYNIHNSFYGSHIIRTLNSIKIYYNLNSRTEA
FT                   ATPSFLTWGKSLQPAFESLMLWFDYLTKPPLDPSEKLGFWDKFRFIVHGRWVFKFEKDS
FT                   SFHLHIKGSYDPYKIADDGAGVSFCWSDNTAVKIHDSSDPKNFLVIDSSRFLLAIRDFT
FT                   EVDKFEKIFMKLHGNVTWKMGLLFEQGNYEKIGEEDREAPSRPHYDVDLVNPISVRNKS
FT                   THDSYSGFRSRFIHMSFGVYSYGANAYNNMFIAPNSFALFLRWWNLFHQYTSGPIRQGP
FT                   LFTELVQNKNKFGKALFTIKYQLHLEPLIISHTLRHMSSEYSSFEGKNVIFTGLKGRVS
FT                   SLKMDFHQKRIKLAHIYEKLELTNSVWKFRMFEGEMDCCDADVRIIAAEFAQSKIDDIL
FT                   SGMKKSEIIDRESPQKPLSTGNDEWFDLHDYHDVDHVPLDSEPVDFKAEPLLYSPRMSY
FT                   FRKINEDGFPVSYPFGDEDSHVCLIGRNHPESTQKMLARERKLEIETRLSEIESEFKDF
FT                   ECSKMTESHKYKLKELQSERHELKHSLHIIHNILRDLRLSEEISRIYTNDDLESSIGSG
FT                   VSSVSSGRNTNNEAALLRTNTIESFVSMRKNSSVNAVSSYDNRFMLHNIHLKINKSITH
FT                   HLLDYIHNWYERKSMRFFMTYKSICIVEELLKLSLKGTKSRFQEYGSLSEFFKTSNAEF
FT                   IEQFDRLNREVSNDSYEAIDSFLFRLVSPQVQIRSDCEPNDALILSARDIEVGIIDINQ
FT                   IYGENGKRLPTDVDTIVETRYCVVSKDLQLFALFKNDLIKHGARGFKSHGYGLEENSTF
FT                   WPPWIPLEMCYDGSLLEKNVVLRRRSMYLTFTAPNSLYFSQRNDQNIVTTCSNIRIAFP
FT                   GLLVTSTSQQYCSVYAIVQDLLAFASSADEKIEKLSRNLIEDEIRNSLESLDISHITNL
FT                   QDRVRNMYHVRAYMKLNEPSTYNEFLPLINFEAQVSIIKLTLLMTAIKETYNKLGSNDT
FT                   SNPQKLVWQISTEDLIWELFDEKKSPFVTIGLGPSKFIRVETSDGNNTNVVSINSLKCF
FT                   NQQENPIFSELFAPDFQHSHYHKDMPMVEISWVMGNPIGGISDLNDLTVILQPSIFKMD
FT                   HKTGDHLMSYLFPDVNSANVESDDSLSISLPRKSNSSIVSPAPAISYYGMSSILSAPRD
FT                   SGSWDVSSIKALSASGSGRSPSPEDDKIDRQFLNINEMVQRSGEYFTVRNIKIKHTYMS
FT                   VSYKGSRAIFTDVNKLKIKVPTLRYHNKIWSRDELFDAIKKDVVRIVIQHLGSIIGNKF
FT                   LPHKKEDKKSIKKKYTEMLKSDEALNPELAGTISNRRTLTSSSSKTTTDDNIDSILFEG
FT                   DSSPIAFYPGPSSNKQ"
FT   tRNA            join(447843..447880,447893..447929)
FT                   /gene_name="tRNA-Lys (TTT)"
FT   CDS_pept        complement(448106..449353)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434425"
FT                   /gene_name="MRI1"
FT                   /locus_tag="CAGL0D04576g"
FT                   /product="Methylthioribose-1-phosphate isomerase "
FT                   /EC_number="5.3.1.23"
FT                   /function="S-methyl-5-thioribose-1-phosphate isomerase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58523.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046523"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="HOGENOM:HBG682649"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniParc:UPI00003B6171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVY2"
FT                   /transl_table=1
FT                   /translation="MNALRAIDFKRDDPNNVSVSVLDQLLLPYTTKYIPIYTIDDGFTV
FT                   IKKMQVRGAPAIAIVGALSVLMESQLLLSEGFCKTQYYYNLNDWENIRSKIDERLAFLL
FT                   SSRPTAINLSNALDEIKIVLDSASDLQTFKNNLFDYVCKLIDDDFANNKRMGDNGAEFL
FT                   LNLLKKENFNEDFAVFTICNTGSLATSGYGTALGVIRSLWNDSKSKTQEGNPNKKVKLT
FT                   ESSPKMVQVFPLETRPYNQGSRLTAYELVHDDIPATLIPDSSIAYKIMTSKIPIKAAFV
FT                   GADRIVRNGDTANKIGTLQLAIICKQFGIKFFVVAPRTTIDKVTEEGKDIIVEERNANE
FT                   FKIVTGSAVDMQTNKPILDEKNEPITAKVGIAPENINVWNPAFDITSFEYIDGIVTEVG
FT                   VFTKNENGNFDLSALH"
FT   tRNA            complement(450020..450101)
FT                   /gene_name="tRNA Leu (GAG)"
FT   CDS_pept        453500..454930
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434426"
FT                   /locus_tag="CAGL0D04620g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58524.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG324636"
FT                   /db_xref="HOGENOM:HBG436276"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniParc:UPI00003B6172"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY1"
FT                   /transl_table=1
FT                   /translation="MSLSGNNFENPQNNGTSRLLKNVQRLALNNVTNTTAGPHVGFLGS
FT                   QSQDNSALRSFKSSIANLKGDSVPTYKVNPLSRPALVNNERDLTKTKLGIQEEKETRNY
FT                   EENKENHGPQKGHFTQYDERVEDKNQSESTVSSQTTTESTQITTSNGDDDQTEEENSED
FT                   ADSKKKRPISTIVEQDIPKKFKSCNRFGTEEYEWEDLDAEDANDPFMVSEDVNDIFEYL
FT                   HQLEIVTLPRKEDLYKHRNICQNRDILVNWLVKIHNKFGLLPETLYLAVNLMDRFLCKE
FT                   LVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFILKTLEFN
FT                   LNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGVLPSLCAAAAMFLSRKM
FT                   LGKGQWDGNLIHYSGGYTKNQLAPVCEMIMDYLVSPVVHDEFHRKYQSRRFMKASIISV
FT                   QWALKVRKNGYDIMSLHE"
FT   CDS_pept        complement(455638..456837)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500293"
FT                   /locus_tag="CAGL0D04642g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58525.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG204377"
FT                   /db_xref="HOGENOM:HBG436276"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniParc:UPI00003B6173"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVY0"
FT                   /transl_table=1
FT                   /translation="MSSMSSSSMDSAQRKPSEDEKMDRPALTNVEVNRALPGGRKAQPL
FT                   TEQEKKRHPMYRKPSRIRREDSDASYMANSKKRQVFQDNADDDEPTGKDQESRIKRAKV
FT                   QDRQIKWVDLDSKEKNNIAMVVEYTNDIFDFLYEREKNTIPMHNYLLDRKSKYHLRPAT
FT                   RAVLVDWLVEVHDKFQCYPETLYLGINIMDRFLSQHKVDINKLQLLAVTSLFIAAKFEE
FT                   INLPKLSEYAYITDGAASKDDIKVSEMFILTELKFSLDWPNPLNFLRRLSKADGYDGEC
FT                   RMIAKFILEYSLCSSKFVGEKPSELAAMAIFLARRILKRESPIWDDTFIHYSGGIDALN
FT                   DNHFQNLCTIMINEIAQPATKLTALCDKYKSIKGGTIYDKTIKWCKDQMERNYENVFSC
FT                   "
FT   tRNA            complement(457334..457405)
FT                   /gene_name="tRNA Cys (GCA)"
FT   CDS_pept        457938..461483
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043785"
FT                   /locus_tag="CAGL0D04686g"
FT                   /product="Similar to uniprot|P40851 Saccharomyces
FT                   cerevisiae YPR122w AXL1 protease"
FT                   /function="metal ion binding"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58526.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG060025"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00003B6174"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX9"
FT                   /transl_table=1
FT                   /translation="MITDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYN
FT                   SCSLTVAAGSHNDPATVPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTG
FT                   EQTSFYFQVPQVANSEGTLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTN
FT                   PGKVLYQATRLLANKNHPFSRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENIT
FT                   LCVRGPQSLNHLVKLCMQNFNDIKPLPVLPTAIGNNRDSDTELFEETLKRLNILYDVWA
FT                   PRYTSLPCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGN
FT                   EEVGSFCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLI
FT                   PMYLNMPSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLL
FT                   MKSPSFLHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIPTSEPFTKTVRNL
FT                   FKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVIFPYQFSFPGPNEFIPPKYRNLDTLL
FT                   EMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSKVVNADI
FT                   KSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSMS
FT                   FDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSV
FT                   KIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNI
FT                   DKIARYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPNNCVFS
FT                   YLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVV
FT                   VVSSTSPEHIEQEIESYYAHVRQYLSDNVDQIWRDYSKIINDRDPLMYLLDHDVWYNIE
FT                   RENSDIPEYSRDHVANCQRVFKYKDLIELLVVDTPISGRHPDYTPPFSMQEYLQFLDSS
FT                   IGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLVIPERDLADIIR
FT                   EAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSILHIPSKTTAQAKTTSKTTSKS
FT                   RSAAVTETTATIPAS"
FT   CDS_pept        462407..463558
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194905"
FT                   /locus_tag="CAGL0D04708g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58527.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057993"
FT                   /db_xref="HOGENOM:HBG203994"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI00003B6175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX8"
FT                   /transl_table=1
FT                   /translation="MSSMSSMSSMSSMMSSMMSSMMSMSMSMSTSSGSMGSMSMSMPSS
FT                   MSMSMSMHSGMSMDMPMSMSMSMPSSMSMAMDMGSHSHSTMAVDMGHSTNASAMAGMDM
FT                   GMGMMKNMHMNMWLTPTYNDYPVLFQHLRADTNGKAFGIFLLIVVAAFVYKFITFTSWC
FT                   LEVHWFKKWNKDSKYASIFPAANKKNNANDPEIMEAHVSGMPRVPNLLRDIFMPSFTDL
FT                   FHDFIRAILAFISTMIIYCLMLVAMTYVLTYVFAVVTGLALAEVFFNRIKIALMKRWDI
FT                   QREIALAAACGAKGECECGPNDPRSPSSGTSTEEEYDEKHGGHNHKEFRSASNMDDNCN
FT                   CETPVIAKSKQEKRIERETLENSRMQEQANTMAPDLTPADGLH"
FT   CDS_pept        464211..465512
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500294"
FT                   /locus_tag="CAGL0D04730g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58528.1"
FT                   /db_xref="HOGENOM:HBG252587"
FT                   /db_xref="HOGENOM:HBG395478"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI00003B6176"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX7"
FT                   /transl_table=1
FT                   /translation="MMLKRGIRKSYAGITPMIRNEAAMTARFGVYGTLTAYSALGRSFS
FT                   STPMYLQMKKSETESKKLTIWDKVKKEARHYWDGTKLLGFEIKISSRILMKSMTGYALT
FT                   RREMLQLKRTISDIIRLVPFAAFVLIPFAELLLPIALKIFPNMLPSTYESRSSKQKKLD
FT                   NLRKTRELVSEIMRENKTQLKPTGINEEQKTVFNSFYEHVRATGEPESREQLVTVARMF
FT                   TDDTVLDNLTRPHLVAMAKYMNLQPFGTDVMLRYRIRYKMLQLKNDDVTLYYEGLDQLN
FT                   EAELKMACASRGIRSAQVEDEVKLRESLRVWLSMRLKEKIPSTLLVLATAYNYGEVLPT
FT                   NIGRSPADSAAESTDNTSSLYDALCDVLSGIPDELYHEVKVNVVHHDEPAQKLNQLKEQ
FT                   AEIMREEEQQEKNELVHVQDKLSLDELDPVQEKK"
FT   CDS_pept        466450..467508
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043786"
FT                   /locus_tag="CAGL0D04752g"
FT                   /product="Similar to uniprot|Q06494 Saccharomyces
FT                   cerevisiae YPR127w"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58529.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B6177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX6"
FT                   /transl_table=1
FT                   /translation="MSKIQQIRNTIRSIGTGYGLMSLTWKAVPTEQEQAFGAMKKAIDL
FT                   ARASNHIAFFNVGEFYGKDRVNLHLVRDFFKKYPELREHVIISCKGAMDLSDLHAMGKY
FT                   DDVVKSVEACTEAIGGFIEIFEPARLDMDICKEGEVYPKESIQALKDLCDKGVIGAISL
FT                   SEVDEKVINAVAADFGEYLACVEVELSLFCDDILHNGVAKACSDHNMAIICYSPLGKGI
FT                   LTGQITKNSDIPDGDFRKMLKSFSDEALQHNQEIVSFIRTEIIEKRPAGKEITLPQVAL
FT                   AWIKHWNGDSSYPNAKFIPIPSGSSAARVAENFDEEKSTISDEEFKKLNKYAFNFKPVG
FT                   ARYEFVSDPTKH"
FT   CDS_pept        complement(467712..468680)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434427"
FT                   /locus_tag="CAGL0D04774g"
FT                   /product="Similar to uniprot|Q06497 Saccharomyces
FT                   cerevisiae YPR128c"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58530.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329967"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6178"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX5"
FT                   /transl_table=1
FT                   /translation="MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKE
FT                   EEKYKNVIDCIIKIFKKRGFLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGR
FT                   LQLKDDSKFIELSTIEELALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQ
FT                   IYEESNGDLTAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAG
FT                   ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIP
FT                   QVSKGVIVQGLLFTYKDEIVRVIRKLLFLYKNIIARNKLVA"
FT   CDS_pept        complement(469027..469605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434428"
FT                   /locus_tag="CAGL0D04796g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAG58531.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B6179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX4"
FT                   /transl_table=1
FT                   /translation="MTSIDPFEPSDLFQLNNVNLDTLTENFPLEFYLEYLILWPELFFK
FT                   SNETASNNALYSGYMMAKTEGKGPEWHSHITAVTVAPEFRRISLASRLCNTLEAITDAD
FT                   PHEVNFIDLFVKCNNDLAIKLYEKLGYSVFRRVVGYYNSQKDGYPSSLKKVNDDKDAFD
FT                   MRKSMPRDKGKSTRKDGRKHKCYPHDVRF"
FT   CDS_pept        complement(469863..471011)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434429"
FT                   /gene_name="IWS1"
FT                   /locus_tag="CAGL0D04818g"
FT                   /product="Transcription factor IWS1 "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation elongation factor activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58532.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG191292"
FT                   /db_xref="HOGENOM:HBG395904"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI00003B617A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVX3"
FT                   /transl_table=1
FT                   /translation="MSDSEVKDVPVAPVEEVEAPVEAPVEAALEPSVEAPVEAPVESTV
FT                   EAGEPAPERTRKHIESDDDDEEVQAPVEEQVTIDSSEDPKSQRQILEDRLDRLLKKTSG
FT                   RRQRADEHDLEQYLDEKILRLKDEMNIAAQMDIETLNKRIEEGENKSQDKKPLVAIQKV
FT                   KLLPKVMSILSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALDDLPIK
FT                   TEHLKESGLGRVVIFYTKSKRVEPQLARLAEKLIAEWTRPIIGASDNYRDKRIMQLEFD
FT                   SEKLKRKSALDSAKRKKNKVSKPSSSASKGSSAQTLYEQAAARRNRAAAPAQTTTDYKY
FT                   APVSNITSVPTNARTVGVGSSLNNNELYKKLSSRLAKPGKRS"
FT   CDS_pept        471224..471373
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043787"
FT                   /locus_tag="CAGL0D04834g"
FT                   /product="Similar to uniprot|P80967 Saccharomyces
FT                   cerevisiae YPR133wa TOM5"
FT                   /protein_id="CAR58014.1"
FT                   /db_xref="HOGENOM:HBG398798"
FT                   /db_xref="InterPro:IPR019603"
FT                   /db_xref="UniParc:UPI00017BD58F"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ0"
FT                   /transl_table=1
FT                   /translation="MFNMGQGESEEEKKLHQQRTQQTLVNATCVAALLWVSPMVWNFVK
FT                   RQWK"
FT   CDS_pept        471574..472164
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348114"
FT                   /locus_tag="CAGL0D04840g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58533.1"
FT                   /db_xref="HOGENOM:HBG124428"
FT                   /db_xref="UniParc:UPI00003B617B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX2"
FT                   /transl_table=1
FT                   /translation="MIVAFHLRSCREFAVFECIYRELQRVCGVEYMSVQRSVWAPFSRH
FT                   DHATLQAVLPGENEVLSEVIPRISGVDVTGGPQDADLHSIARDLAAGETPKGTLFRFTD
FT                   HIQYMRMKETLETGYYRKHYIAPLLKSHLKSHLKSNPSTTVPIVTQLATHPSDIPPQMA
FT                   KYIRGMDVTTEMTKKDRDTLDSLLYGGIDGFLK"
FT   CDS_pept        472577..475336
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194906"
FT                   /locus_tag="CAGL0D04862g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58534.1"
FT                   /db_xref="HOGENOM:HBG058028"
FT                   /db_xref="HOGENOM:HBG203996"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022100"
FT                   /db_xref="UniParc:UPI00003B617C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX1"
FT                   /transl_table=1
FT                   /translation="MSVVDKSVFDSGGRTTLALAQDNAHLCVGSKIGIVKILNTERVQD
FT                   EPRVLEVVKDLTSVCFGSKDDSKLLVTSVTGDAYLYDARDEGSTGKLLTRSVLPLRDCQ
FT                   IIHSDKYAVFGGDDLQLTLIDLDGGDRNTLKTEEQVSSLSYSKQSNILAVSFINGKVQF
FT                   FSVSSAVPNKVHELKDYIPKHSYVDSGDDALLTDVLGSDKEDTDVEADTLEDDKIKDPT
FT                   FCDNNRICTKVAWHPNGLFFALPTKEGGVSIFDIKDYKLQKTLSPTAKGKLFCDLQFDT
FT                   KNGNYMAAIDLDGQLTVWDWKRGEVKLARKIKQDITHLVWKIQESSGQFDLILGTWNGS
FT                   IITIKSVLPVIDSKVEEPLTSAGGEKNLFVEDDGNSDDEAKGSNLVDGEAEDDNGEEID
FT                   DENLFTQEDDINEGKRKYHFDDEDDFIDDDDGAGYVSEKKYRKFEDTSVNTFHNYNSSR
FT                   SRYAPKPFKYKPFSAGATPFASGDRRYLTMNEIGYVSTVKNGDQNSVTVSFFDVGRFRE
FT                   YHFEDLFGYDVCFLNENGTLLAQSRMGQINYRPHNSLHSNWTKVIPLLDGERITTIAAT
FT                   PKMVYIGTSFGYFRIFNSFGVPVALEKMTPIVALTAQDYKVFTVHFSPLHGLSYSLFEV
FT                   HTDTSKYFQRECPLPITMPQAYAGRVEPDFLSSNPLGIKSLFFSSYGDPCIFGIDDVLL
FT                   VLSKWRSGAQSRWIPVLDSNFELWKMSGGKDHTDVHVWPLSLNYDTLNCILVKGKRIWP
FT                   EFPLPLPSEMEVQIPVLVKSQLLKEYNKEKKERAEAGLDSDEDEDKDEETEVTIPQNLA
FT                   AEEEFLRSKILSGLLQDTIVNDGELFGNENRIIASLIGMHDKSLLRLFAIACSDQNPER
FT                   ALSIAQELKQDKALTAAVKVSERAEMLSLVQKINDIREARFNQQMDNM"
FT   CDS_pept        475678..477369
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188732" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434430"
FT                   /locus_tag="CAGL0D04884g"
FT                   /product="Similar to uniprot|Q06506 Saccharomyces
FT                   cerevisiae YPR137w RRP9"
FT                   /protein_id="CAG58535.1"
FT                   /db_xref="HOGENOM:HBG355976"
FT                   /db_xref="HOGENOM:HBG713247"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B617D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVX0"
FT                   /transl_table=1
FT                   /translation="MSGIRENRKRKRQESATPTVTDENITDISSSEEEAANEVDEDEEI
FT                   DSEEEFEGENPADKRRRLAKQYLENLKTEANEIVNADEAGELDEESRHIDNYNNFDAGD
FT                   LDREIISSRLKEDVAEQQGRVYRFISDRLDFDNVKTTFTRVGENNPTSLSCYQPQFNKF
FT                   DASSFGKQSKNKLFCYVVSKDMTLTKYDITNFNSRPKKIRSTKGGKQFIPETKFEYENT
FT                   SEGHYDEILTVAASPKGDVVVTGGRDRKLIVWSTESLAPIKVIPTKDRKGQILSLTFRR
FT                   NSDQLYVACADYKIRTYSISQFAQLETLYGHHDIVADISALSMERCVTVGSRDRTAMLW
FT                   KIPDETRLTFRGGEDPDRLLKKWLKTNATEKENGDLEYPQESEAPLFFGEGSIEVVSMI
FT                   DDSHFVTGSDNGSISLWSLAKKKPVFIERSAHGLLPAPEVDEISGESSKELRERQVQDR
FT                   KLVKPYWITSIYAIPYSNLFVSGSWNGSLKVWKINENLREFELVKELSNCHGVVTKIHY
FT                   VEAGKHGKEDFRILASVAKEHRLGRWVTRVPGARNGIYSAVLKSKA"
FT   tRNA            complement(477723..477796)
FT                   /gene_name="tRNA Asn (GTT)"
FT   CDS_pept        complement(478054..479412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348115"
FT                   /locus_tag="CAGL0D04928g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58536.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380231"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI00003B617E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW9"
FT                   /transl_table=1
FT                   /translation="MLARRGVQYVWDSGIAVSSTAFLVVASALVFFMVPGIGFLYSGLA
FT                   RRKSALSLLWVTLMASLVGMLQWYFWGYSLALSRTATNNKFIGNLDSFGFRNVYGLNAV
FT                   WTENLEVAYASFQMMFLCVTLSLVAGSTAGRGRFFPHMVYLFLFATLVYCPIVYWIWAP
FT                   GGWANKWGVLDWAGGGPVEIVSAISGFVYSYFLGCRNERFLVNFRAHNVSYVTLGTTVL
FT                   WFGWLLFNAASALSPNLRSVYAFLNTNISAVTGGMTWCILDYRLEKKWSTVGLCSGIIC
FT                   GLVAATPSSGCITLYGSLIQGIVAGICCNFATKIKHFFQVDDAMDLLAEHGVAGMIGLL
FT                   FNGFFAADWVIGMDGHTTHGGGWITQNYKQMYKQIAYIGAVTGYCAAVSALLCFIIDKI
FT                   PGLQLRVSADGEEKGTDDDQIGEFAYDFVEIRREFDIWGKEEDEDENEQSTDE"
FT   CDS_pept        complement(479807..480691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194907"
FT                   /locus_tag="CAGL0D04950g"
FT                   /product="Similar to uniprot|Q06508 Saccharomyces
FT                   cerevisiae YPR139c"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAG58537.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG190985"
FT                   /db_xref="HOGENOM:HBG203997"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI00003B617F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW8"
FT                   /transl_table=1
FT                   /translation="MEKFSNWRDKGTGIAPFLPPPVPASSKVSVVLNVAWYSVKMVLLL
FT                   PIMALVMVTGDKFWHRFIYRVLYGLREEIVVVGVKKREVVPWKHYPLRNNVYVCNSSSP
FT                   WDVLLLGLIAEGPAMFLVPNAGTLYRMNADQYYSYALAGSLDAKLFGKEITSFNDCKGY
FT                   VCFMFLEGTCSNGKSVLPFEITSKQLGEFLYGKDENDVPVKERINIFTVQLRLNSSIVT
FT                   PLAIGRREFFLRSIIKGVKAKIKISHEPYSAKNLDSIRAKLMDDDKYKLVSKSLGIEAK
FT                   RKFVSEFNKKHKL"
FT   CDS_pept        480931..482037
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434431"
FT                   /locus_tag="CAGL0D04972g"
FT                   /product="Similar to uniprot|Q06510 Saccharomyces
FT                   cerevisiae YPR140w"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAG58538.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG060027"
FT                   /db_xref="HOGENOM:HBG396440"
FT                   /db_xref="InterPro:IPR000872"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI00003B6180"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW7"
FT                   /transl_table=1
FT                   /translation="MSFYNVLKNGDDMLREYPRRSIIWRILSYGTCLFTYGVSRMILST
FT                   LYNFKVFNFERLENAMKRSKAENRGVLTIMNHMSMVDDPFVWATFPIRFYSSVDRFRWC
FT                   LGAENICFQNAALSYFFSLGKTLSTRRFGAGPFQDSIDATVRLFSTDETLLKDKDPNYK
FT                   PPVRQKSPPWVHIYPEGFVLQLQPPHSNSMRYFRWGVARTILESTVPPIIVPIFSTGFE
FT                   KIASEEAKGMMRQLMPRNYGSKIKVTIGEEISDEIIFRYRKEWQVLVEKYKDCNNPDEM
FT                   PDELKYGEEAEDLRSRLAAELREHVAKIRHDECHFPEEDPRFKSVSWWKKFNCSEGESD
FT                   PDVKIIGKNWAIKRLQTHLKNNENTKDH"
FT   CDS_pept        complement(482176..484254)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043788"
FT                   /locus_tag="CAGL0D04994g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAG58539.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="HOGENOM:HBG746568"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI00003B6181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW6"
FT                   /transl_table=1
FT                   /translation="MDEPATPAKQTGIGGAGQKRRYTTTPPREIRQYQSRSSFGVNSSG
FT                   NVDGKSIRSRTHLTSFYKENVMELNELQDKLFQKKGVLDGLKDEYEDLKSRYTALDLKW
FT                   EQKKEERKLKAQKLELKEKELKKIKDDFANKKTFLEESHKLKLEQLTANKNAELNKMND
FT                   EYRSKLEALKYEKIKKFENEKNELIEKIEEIRNKMITNDVALQQRMKDIEADHLEEKEK
FT                   WLKDYQKEWREVTEKNQESIRKTKELKSEIETVLTPRIDTQNKRLEELKSEIKKLDDTL
FT                   QNKNEQVGEIRKNIDLEREKKDKLLAEKEEILAYIEKSKKEVEEIKKILVKEESLRRAL
FT                   HNELQELRGNIRVYCRIRPPLPHEDDNIEHIKVQPFDDDNGDQGMTINRGNSQVIPFKF
FT                   DKIFDQQETNDEIFKEVGQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPGDGIVPATIN
FT                   HIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQENNDRNADSKHEIRHDQE
FT                   LKTTYITNITTCVLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEG
FT                   TGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRH
FT                   IPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTKMITRN"
FT   CDS_pept        484621..485307
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500295"
FT                   /locus_tag="CAGL0D05016g"
FT                   /product="Similar to uniprot|Q06511 Saccharomyces
FT                   cerevisiae YPR143w"
FT                   /protein_id="CAG58540.1"
FT                   /db_xref="HOGENOM:HBG060026"
FT                   /db_xref="HOGENOM:HBG626587"
FT                   /db_xref="InterPro:IPR012459"
FT                   /db_xref="UniParc:UPI00003B6182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW5"
FT                   /transl_table=1
FT                   /translation="MTTLKHKTKKEEETNSSAEEYSGAEASSSDVDASGSEESQGEDNE
FT                   DEDGDEEEGDEEEDEDFPRKKKAKMNKHDDGSAGFSQALNAILGSHLKAYDRKDPIMSR
FT                   NKSVLKQNESQKLELKAKKALLAEKKKLLNKTRKKEVIPTVSDENKSGEEIRKIIEKET
FT                   RLRKIAQKGAVKLFNAILSTQVKTEKEVSEGFTDIKNRKEKKQLITEVSKEKFLDMVKA
FT                   AADDDE"
FT   tRNA            485731..485802
FT                   /gene_name="tRNA Arg (TCT)"
FT   CDS_pept        complement(486065..487597)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434432"
FT                   /locus_tag="CAGL0D05060g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="metal ion binding"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58541.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW4"
FT                   /transl_table=1
FT                   /translation="MGATDADKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVY
FT                   FSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVVL
FT                   KAKPSDAAAKRALDICEKVIREERFRKAIGGGDSDSKPKLCSTLNLSSFDANSDLAKYD
FT                   GPSLEFEQLKNEKNEYAGVKITNMSQDFITKLVNDVFLQGKNIPKKYAAAIISHADRLF
FT                   RDEANLLELSNKESPDHKISVCGDTHGQFYDVLNIFKKYGKVSENHTYLFNGDFVDRGS
FT                   WSCEVALLFYSLKILFPKNFFLNRGNHETDNMNKIYGFEDECKYKYSQRIFDMFSQSFE
FT                   SLPLATLINKDYLVMHGGLPSDKTSTLEDINKLDRFSQPPREGLYMELLWSDPQQADGL
FT                   GPSQRGLGFAFGPDITADYLKRNNLKKVFRSHEVRMKGVLFEHNNKLATVFSAPNYCDS
FT                   QGNMGGIIHIVPGKGKLIQNGNDDEDLLVETFEAVKHPDIKPMAYSNGGLGF"
FT   CDS_pept        488733..490334
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434433"
FT                   /locus_tag="CAGL0D05082g"
FT                   /product="Similar to uniprot|P04838 Saccharomyces
FT                   cerevisiae YLL039c UBI4 ubiquitin "
FT                   /protein_id="CAG58542.1"
FT                   /db_xref="HOGENOM:HBG348259"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI00003B6184"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW3"
FT                   /transl_table=1
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
FT                   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
FT                   IFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
FT                   QKESTLHLVLRLRGGY"
FT   mobile_element  490639..492393
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="CAGL0D05093t"
FT                   /note="relic of gb|AY673967 Candida glabrata Tcg3 LTR
FT                   retrotransposon (Ty3/gypsy superfamily)"
FT   tRNA            492459..492531
FT                   /gene_name="tRNA Lys (CTT)"
FT   CDS_pept        complement(492687..493013)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043789"
FT                   /locus_tag="CAGL0D05148g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58544.1"
FT                   /db_xref="HOGENOM:HBG124430"
FT                   /db_xref="UniParc:UPI00003B6186"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW1"
FT                   /transl_table=1
FT                   /translation="MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAY
FT                   VICKVVVRDVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGK
FT                   TATI"
FT   CDS_pept        493897..495498
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434434"
FT                   /locus_tag="CAGL0D05170g"
FT                   /product="Similarities with uniprot|P07270 Saccharomyces
FT                   cerevisiae YFR034c PHO4"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58545.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124431"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B6187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVW0"
FT                   /transl_table=1
FT                   /translation="MGEQVEDMDKLYETPIDMQTTIFDQVDNYLHMVNSGLQHDEKEDE
FT                   HREHEDAIDGGASLNMHLYNINDTLNGVSTDNGHFDMVDLHFGPTLTTDDDPTKMAELQ
FT                   HTTIHHGHLDVNGNRSDSLFSPFDSPLVHDTPSLEARNSIQLTNEGSTSALTTPFLSGK
FT                   NHYDDHGNSINSQSFNYHNRNSSLSKVSGKFSPISSPALTSTNQEQQHWNTSSRRASNS
FT                   SSRSKRVLPSGNSSVSSTSNKVIKNSPYMNASSRRLQKTISNGNSKRDEWDEFMFSLPE
FT                   SSLANDLTTGNDENMDISLPAGHSPTKEYNSYPKVILPSHAAENESMETDNYERASLLE
FT                   DSQPDETQNNNPQNNNPHSNGSSISPVGKNDSVMLASGSPVLKPQNSSSNILQTPYSSK
FT                   RVFKSPADISSTEQTADEASNDASNDAKSKDKKQRKPSSSGPNKLKRTNTGGSIGRVRS
FT                   DSASQNSDYVQRKKEVHKYAEQERRNRLNNALSDLNSLLPQDWKDAVTVPSKAITAELA
FT                   CKYIRTLLEELEQYKK"
FT   CDS_pept        496431..496802
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348116"
FT                   /locus_tag="CAGL0D05192g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="CAG58546.1"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG058626"
FT                   /db_xref="HOGENOM:HBG103951"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="UniParc:UPI00003B6188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV9"
FT                   /transl_table=1
FT                   /translation="MISSITDLLEELKETIVPVVAEAAEEDPVEDEEEEDEDEDEDEDE
FT                   DEEEGVDQLDALREECKNTEEGKHLVHHYMECVERVTKQQEDPEYENLDYKEDCVEEFF
FT                   HLQHYLDSCAAPRLFDKLK"
FT   CDS_pept        498243..498422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434435"
FT                   /locus_tag="CAGL0D05214g"
FT                   /product="Similar to uniprot|P05747 Saccharomyces
FT                   cerevisiae YFR032ca RPL29"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58547.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG242797"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI00003B6189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV8"
FT                   /transl_table=1
FT                   /translation="MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHRH
FT                   ALRGTAKTLAAAKK"
FT   CDS_pept        499006..500337
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500296"
FT                   /gene_name="RRT5"
FT                   /locus_tag="CAGL0D05236g"
FT                   /product="Regulator of rDNA transcription protein 5 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /protein_id="CAG58548.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124432"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B618A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVV7"
FT                   /transl_table=1
FT                   /translation="MSVSRIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRN
FT                   EARSFGIAYVDFTSSEEAVRAVEELNGKEFGGRVLRVRTHNPYQPPKPIKERFGTKLQQ
FT                   LKKFAKYEDTAASGERAPTDAQDHPDQPQEGHMSPDVVLVNGTTDEEQQLANVINDPVT
FT                   NADAPGTEQNISKEKAISEDTVYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNVSNS
FT                   RFRFRNRNHTAALVTLSTELPLNKVIEELLGKKLLGTKISIKPAYIYKINEVKKIAEQS
FT                   HMLATEYRHQNGNSDVVIGTPNEALLNSTQVASQIIGSNPEIEVSNQNSSSIANVAETN
FT                   GNVGDTPITKLDSRNNIKIVNIGNPQDKTKKNQPNDNKELNKIDLETKNDSLHLESICD
FT                   PIISIDMSGMTKQSVGSNKKKNKKKKSARGKEVRKLSVSNTTTQ"
FT   CDS_pept        500858..504370
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434436"
FT                   /locus_tag="CAGL0D05258g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAG58549.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG505437"
FT                   /db_xref="HOGENOM:HBG629284"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI00003B618B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV6"
FT                   /transl_table=1
FT                   /translation="MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAI
FT                   CFVLGISSMATVRASNLQDLIYKRGQAGVTKASVTIVFDNTDKSNTPIGFSEYPKISVT
FT                   RQIVLGGTSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSEILS
FT                   LIEEAAGTKMFEDRKEKAERTMQKKETKLQENRTLLKEEIDPQLEKLRNEKRLFLEFQT
FT                   IQADLETTEKVVIATDYQKMLNSRDSIKTVLETSNSKMDELQKKIDLVNREISNLNEDL
FT                   QQTMKQKKKELENDTNIKAMESKEDKLLSEIAKLKANLKINGDNILDGKQKQKRLTVKI
FT                   EKSKQLLDSKSQLLEDSKSKSRNCEADLTRLNSIFKQKEELLSVLSTGISSTGGTEGGY
FT                   EAQISSVNDKINDNSIEIEKNKMKIELLKKEFMENEEKIGKSQLQVETHMKERKQLTEI
FT                   CKKLEEDIFSHGFRPEAFKELKNREYELDQAIYKTNRDCEGLRRRVAGIEFQYSKPFES
FT                   FDPNSVKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRKRV
FT                   TIIPLDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEVVKAMEFIFGNSLICDDA
FT                   ETAKKITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQYNTLKKELLAMN
FT                   EEKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDILERTMNSEPSLMMQNRNGEIENE
FT                   VKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQIKDLES
FT                   ESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIKINKMLKTSEEELM
FT                   SVQNDLNVERKRISNIDDELEELERTIKQKEESKNTYELELKQLHHDLSKYKNSTDGIE
FT                   KALNDIQEEHEWVTDEMLVRSICEQNAGVNVNEYRHRMEQLQKNFDELRRKVNPNIMNM
FT                   IESVEKKGEALKTMIRTIEKDKKKIEDTISKLNEYKKETLVKTWKKVTKDFGNIFCDLL
FT                   PNSSAKLVPCEGKDITEGLEVKVKLGNLWKESLVELSGGQRSLIALSLIMALLQFRPAP
FT                   MYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSV
FT                   VSIM"
FT   CDS_pept        complement(504512..507604)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434437"
FT                   /locus_tag="CAGL0D05280g"
FT                   /product="Similar to uniprot|P39692 Saccharomyces
FT                   cerevisiae YFR030w MET10"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58550.1"
FT                   /db_xref="GO:0016903"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177395"
FT                   /db_xref="HOGENOM:HBG326246"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI00003B618C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV5"
FT                   /transl_table=1
FT                   /translation="MSVVNPFEGPYGPATDAINAVLTAQVKDVFGYRTFSQSDLLFPGD
FT                   EKAHIRQLDVRAGAGATPLGYASGKAGRAGLVGIIAPSYSLPYFHRALAQAGDSRVVLN
FT                   VGALGYDSESGAVTNDYVTALDSAAKLGYGVVTPVSTKEVAATTLLTVAVSKFAKARGA
FT                   VHLFDGLNYSRAIGVVPALDFDKQADIIKKLEKLLPSIDSNSFEDVLGKFNEVSGLKIH
FT                   NFQTQNVESAEVIYVTHGSLESELFIDAVKNSFQSNVGVIAVRVPLPFNVEKFTAVIPK
FT                   TAKKIVVIGQSLTGDSSSLLKSRVSAALFYSNRRDIQVSEYLYKPDFVWSPAAIKQIIE
FT                   TFSPVDTISIGEDSKGTSKSFIYWASDKSINIDLASKLALSFSFTSGSHISFRSKYDNI
FT                   NNAGTYQAQLVNSDHETAILSNIDAADVSIVEDSALLNHFNIIATIKKGGVLVVATSKS
FT                   TKDVDLSQVESYTENLKFPVHFLNAVAERNINLYVVDKTAIESERFIGYIIQALVWNLT
FT                   TKRGLEQHIQDVWNSASAEDKTTAPEFADQILKGVESSVKVISTDLYPDFAKLEEPVEE
FT                   KAETDEEEEDEIRELPIFPIETSFNVSQSSQKLYPEAEVNSKSSIAKALAFKEAYETTE
FT                   ELRPDLPVKNFVVKVKENRRVTPEDYDRYIFHIEFDISGTGLKYDIGEALGIHARNNEE
FT                   QVREFLKSYGLDETDIVFVPNKDNNGKLEASSVLHAFIDKLDIFGKPPKRFYEALVEYA
FT                   TDEEEKKKLQKLVTPAGAVELKKYQDVEYYTYADIFELYPSARPPLEELVTIISPLKRR
FT                   EYSIASSQKVHPNEVHLLIVVVDWIDNKGRKRFGQASKYISELSVGSELVVSVKPSVMK
FT                   LPPSPKQPVIMSGLGTGLAPFKAIVEEKLWQKEQGEEIGEVYLFLGSRHKREEYLYGEL
FT                   WEAYKDAGIITHIGAAFSRDQPQKIYIQDRIRESLPALKSAMVDKEGAFYLCGPTWPVP
FT                   DITQALQDIYAADAGEKGLKVNLGDIIEELKESSRYILEVY"
FT   CDS_pept        508364..509071
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000151757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500297"
FT                   /locus_tag="CAGL0D05302g"
FT                   /product="Similar to uniprot|P38145 Saccharomyces
FT                   cerevisiae YBR256c RIB5"
FT                   /protein_id="CAG58551.1"
FT                   /db_xref="HOGENOM:HBG002544"
FT                   /db_xref="HOGENOM:HBG289809"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00003B618D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV4"
FT                   /transl_table=1
FT                   /translation="MFTGIVELMGTVREYNPYDDTESGGQGVSITIENAHDILGDCHIG
FT                   DSIAVNGICLTVTEFDSDSFKVGISPETIRRTNVASWTPGSKVNLERAVSQEVRFGGHY
FT                   VQGHVDTVATIMSITNEGNSILFGFKLRDAQYNKYIVEKGFICIDGTSLTVTGIDEDDT
FT                   FFISMIKHTQEHVVMPLKSLGDEVNIEVDLTGKVIEKQIEVTLQSQIRDENSALHAVIE
FT                   KLIDEKVKKYLNA"
FT   CDS_pept        join(509343..509405,509562..509861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348117"
FT                   /locus_tag="CAGL0D05318g"
FT                   /product="Similar to uniprot|Q3E776 Saccharomyces
FT                   cerevisiae YBR255C-A"
FT                   /protein_id="CAR58015.1"
FT                   /db_xref="HOGENOM:HBG398799"
FT                   /db_xref="UniParc:UPI00017BD601"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ1"
FT                   /transl_table=1
FT                   /translation="MAGKVQPIHHDTQTVQQLTKEIAIAAGIGAVQGALISITTALLLR
FT                   RYSTIYRNVRTQVRVFYHISWISMGAVFRADKQLIKFQSKYYENEVKRRERILDEAAER
FT                   GIFLEEESVAQSTVTK"
FT   CDS_pept        complement(510087..512450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043790"
FT                   /locus_tag="CAGL0D05324g"
FT                   /product="Similar to uniprot|P38335 Saccharomyces
FT                   cerevisiae YBR255w"
FT                   /protein_id="CAG58552.1"
FT                   /db_xref="HOGENOM:HBG124433"
FT                   /db_xref="UniParc:UPI00003B618E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV3"
FT                   /transl_table=1
FT                   /translation="MNSVREDESSKLQNLANLNTESNLEFGNVNPKRVKLLTKILMDNK
FT                   YGLLDDLNYSRPLISSADGIQAVGSGRDVPGYENAMNPMAQQITEQDVADSSGVNIQHL
FT                   INQQKQLPITGTTKAISRTTKLKADRVRIYLDYYYGILERSIQVDRKDHKHEGVEGVYN
FT                   PLQIIRNRKLKKKNNDMPVRELGISKTPFIAIKQFSSKPNKKMPWFVDITEKHTDMTWR
FT                   TSHWDELIGPDGKPWSGKTKHHYSEKIRHRPHIHHHKKQSEKEEHEETENQKQSQQNGP
FT                   PQINIVGDSTSKGSNDIASYNSSTTDLGSSTSKFQAHSGTNEGTADISTVESEGLAPPT
FT                   KINSSNSPNESLLSDKRKSSPDSTKNNSNSGKSDDNLHSHLEINATPNTRRTSINSISD
FT                   QYSNQSVNSSKYGDKNHLHRLEKVIGKKPKKWSKSANKLSKKVNDVTGTTMNIANIPEE
FT                   IGAPINIVTNGLTDAVNKAITVNSGTNINGTLTGQNSLSNISHAKDLKEALKEGKNSKE
FT                   GKSGSHGTETTKSVINSESSSNSSSGIIMGNVQYMSPAEALTNQKKSILLSDIPVEHLK
FT                   TDNQFDTIAENSKDGGDDESSNELSIRANIKNTNVDWQLQRYWQDMKYISSTMTLMKHR
FT                   RMTHDLVKKKEIHRRNMVKVDHDADATIASTTEVLNNYQNELVKVLKIGNDWTSKLLND
FT                   YSIRVDSLISSSDRILSDINTTLTLKLKLFQENSERYGNSKVVHAPKMTKLVYRLLEYT
FT                   IVGFLWSVWLVVFIVKNIKLAVIVVLKIAKNVLW"
FT   CDS_pept        513032..513550
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434438"
FT                   /locus_tag="CAGL0D05346g"
FT                   /product="Similar to uniprot|P38334 Saccharomyces
FT                   cerevisiae YBR254c TRS20"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58553.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="HOGENOM:HBG174334"
FT                   /db_xref="HOGENOM:HBG557740"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI00003B618F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV2"
FT                   /transl_table=1
FT                   /translation="MPQYFAIIGDHDRPLYEAEFTQGPQGFVQEIKELNPFILHASLDI
FT                   VEDLQWQQNAGTGVAGGAGNSFLRSRNNANTDNCYLGKVDHFYGLVVTAYLTYGGKKFV
FT                   MLHGSSVPGGNKTTTTTIDDSMVRSFYQEVHELYIKTIMNPFYQEGDELRSPLFDTRVK
FT                   ALAKKYLGK"
FT   CDS_pept        complement(513884..514225)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000733" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434439"
FT                   /gene_name="SRB6"
FT                   /gene_synonym="MED22"
FT                   /locus_tag="CAGL0D05368g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 22"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58554.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060022"
FT                   /db_xref="HOGENOM:HBG204217"
FT                   /db_xref="InterPro:IPR016530"
FT                   /db_xref="UniParc:UPI00003B6190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVV1"
FT                   /transl_table=1
FT                   /translation="MSNQALLETLNQTTELLSVKLAELAKLASMETNEDTEDCQLSVVT
FT                   NGLMMVNNQTLQLVRGVQDLILLTRNIREKWLLTQIPEQLTPKEQDSINHEELTELLES
FT                   CVSEIISDV"
FT   tRNA            516034..516104
FT                   /gene_name="tRNA Gly (GCC)"
FT   CDS_pept        complement(516301..517269)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434440"
FT                   /locus_tag="CAGL0D05412g"
FT                   /product="Similar to uniprot|P33759 Saccharomyces
FT                   cerevisiae YBR251w MRPS5"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58555.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG057990"
FT                   /db_xref="HOGENOM:HBG395685"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVV0"
FT                   /transl_table=1
FT                   /translation="MMFQRMFREAPMASRITRQVRLSSTSRDHLLKYYPPNLIKSIEMA
FT                   EDVIYKGNSKPEFKVPSGVNFAPPYLEDYSKLHPFWDYAKNEPHIHMDSLNEEVRKYQW
FT                   DDINFQQNSKLPPGTFEKEIVEAHVGKNSGSKTAELARGLNRQTGIDIDYITKKLVMKP
FT                   LVLKRVSNQTGKGKIGSFYALVIVGDRNGMIGLGEGKSRDEMPKAIFKAHWDAIRNLKE
FT                   IPRYENRTIYGDIDYRYHGVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGKVYKSR
FT                   NDMNIAKGTIEALIGAQKTLDDIAMARGKKLVDVRKVYYSS"
FT   CDS_pept        complement(518042..518767)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434441"
FT                   /locus_tag="CAGL0D05434g"
FT                   /product="Similarities with uniprot|P25042 Saccharomyces
FT                   cerevisiae YPR065w ROX1"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58556.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG124434"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI00003B6192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU9"
FT                   /transl_table=1
FT                   /translation="MQSNVTLPPISQLLATLPSGLESKLVPGASISLTATSCGTPQPQV
FT                   EAPSSPSSVASNNSSLSTASLSSLSSVCTAKSFFENRAYTTTSAMLNSNAVHKKMSFSE
FT                   DLRTTPLTAQNIALRGLEMNREKSNVSSMSSAVTKAASPRHIPRPRNAFILFRQHMHRK
FT                   LFPKLTKDKQKSSDNSSSFKTNSECSREIGQKWRNLDPEEKKYWNELARKEKEWHRMKY
FT                   PNYKYTPTKKNANSSPLVL"
FT   CDS_pept        521445..522071
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434442"
FT                   /locus_tag="CAGL0D05456g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58557.1"
FT                   /db_xref="HOGENOM:HBG124435"
FT                   /db_xref="UniParc:UPI00003B6193"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU8"
FT                   /transl_table=1
FT                   /translation="MEKELKNGTFEPSLKHSCAKKRASRIFFSVRENVFAAQYREKLEI
FT                   TDFTFQAETGSQDLCFEKPKKCPGDVTTASHRRHSDVYRHSDITVTSPGHFRHDPVSNK
FT                   PVRAPIFPPYQLPGRKAERADGHFVFFSFLDPRWIRNSGHYSRTFFPNVLFVYFYFPHD
FT                   YAFEPHTMDGVILPPPLPRRMREKERRETLQTITEQIPSIYQIFF"
FT   CDS_pept        522559..524733
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194908"
FT                   /locus_tag="CAGL0D05478g"
FT                   /product="Similar to uniprot|P41895 Saccharomyces
FT                   cerevisiae YGR186w TFG1"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58558.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG058074"
FT                   /db_xref="HOGENOM:HBG397129"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI00003B6194"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU7"
FT                   /transl_table=1
FT                   /translation="MSSGRGIRTAGGRSGDGPSDASPFIKPDRMRRNFLRNRRNKNIMV
FT                   KKNDPEDIESREKMMLMGGVEGVKQEEVKPDLSALKDKDNEVYNEFPLRAVSREALENM
FT                   RTHLLKFQSKKRIQPTENFHLPVRLHRKDTRNLQFQLTRAEIVQRQKEIAEYKKNQDGS
FT                   NAQNMTKPKTTPAALTDHPTASNAPAAPLVNSSATMPTGATPTGQVVASATPTPQVSLD
FT                   EKPMGGPVNAVSASATPGPATTNGATPANGTTDPAQPTVPGATILEDAGPAEDPTKVGL
FT                   VKYDGKEMDSADLAEEPTVDPMADVAPDGGGRAKRGGLRRKTRQLKVLDENAKKLRFEE
FT                   FYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLT
FT                   IDEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYDRTRRKLKAVADQRTADDEYNHSDNS
FT                   ENELDYDEEFADDEEAPIIDGNEQENKESEQRIKKEMLQANAMGLRDDEQVSEAEDTEL
FT                   FGEKKIDEEGERIKKALQKTELAALYSSDEDEINPYLSESDLEKEDEAEKEESEDSQSK
FT                   KGSPKKQEGKSRQGTPSAHTVREQNIRVKSIKDCVIVLKGKPSLLTSFPAGAWNPNAVS
FT                   LKRTADEVSIKKEPGSESPNKKIKVENGEIPLITEQDIINAMSGGKVNVKEFGKKIRKM
FT                   FPGPENKKLMFVLVKKLCRKVDDEHMELKA"
FT   CDS_pept        complement(524950..526083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434443"
FT                   /locus_tag="CAGL0D05500g"
FT                   /product="Similar to uniprot|P48362 Saccharomyces
FT                   cerevisiae YGR187c HGH1"
FT                   /function="binding"
FT                   /protein_id="CAG58559.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG181600"
FT                   /db_xref="HOGENOM:HBG329863"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU6"
FT                   /transl_table=1
FT                   /translation="MPTQLEELVSFLHSPQPAVRQIALDNLVGFSTGPSASIFKYDNYR
FT                   ALDDLKVLMKEKSRTLVQQSATVLANLCDDAVMRKKLADDKEFLEYLTWKICDLGNTSS
FT                   DIMCILLSNLSKEDSITYVFEIVREDNDKDLPPLDKDVFKSKRVIDCLMDCFVKGYDRE
FT                   LNKFANYDYLSYFFADVSRFKIGRTYFIETQEYDGVVPISKLLVFTEKYDSKTRREGVA
FT                   STIKNSLFDSETHERILTDEEINLLPYILLPIASAKDSEIDEEDMFNLPDELQLLPEDK
FT                   TRDPVPSIVCTHLESILLLCTTKAAREFMRSKSVYPLIRELHKNVEDEDIGELCYRIVN
FT                   MLMRGDPNAPVEEMPAKSVEDGDDEDEDDEDALMEVA"
FT   CDS_pept        526539..526862
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434444"
FT                   /locus_tag="CAGL0D05522g"
FT                   /product="Similar to uniprot|Q12431 Saccharomyces
FT                   cerevisiae YLL014w"
FT                   /protein_id="CAG58560.1"
FT                   /db_xref="HOGENOM:HBG058064"
FT                   /db_xref="HOGENOM:HBG397082"
FT                   /db_xref="InterPro:IPR008504"
FT                   /db_xref="UniParc:UPI00003B6196"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU5"
FT                   /transl_table=1
FT                   /translation="MSTDESYSSLNSGSNIMINKKSLLYVQDSTSLVFGLAAGILQLES
FT                   WDGFLAFLGCYTTVCLIFILWTCQLKPQKFFQSPIQDIFIESLFRELTGFVMAWTFSYA
FT                   LVG"
FT   CDS_pept        complement(527482..530217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348118"
FT                   /locus_tag="CAGL0D05544g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="RNA binding"
FT                   /protein_id="CAG58561.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG124436"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6197"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU4"
FT                   /transl_table=1
FT                   /translation="MMPNDGVWGSPADGAHADLLHSLSKTNSRTSDDHNMSTNSYLSLS
FT                   SMAYGNNANQGHLVDASIDAELASIVSSLSALSHTNTNTMPQQQQQQASLLSSPNLQKI
FT                   GTATSSNIGGFRRSSFTSDHNYGPEHIVSETPTASLSVGTAPPYYYSYSNQNNGGNTAG
FT                   SAGNMQGLTTSLSSQRLNYLNSNQYSASIAGPILFHSNNNGSVSGQNNNQQMGANSGFF
FT                   EKFGKTIVEGTKELESANYANDTDTIHSSKSYTSLHNNENTPVVEPIPNHQQAAYLSTS
FT                   AIDDTASSSSSNSQLTLESPDYVNSNMNMRKGPGGVWKNFTDSQSFKPNHFGPLPYPNF
FT                   QSPHPNFPMFNPFLPMGIQNHPPGLNNNNNVNINPANTNPGNDTVNRDPNLANTETQQE
FT                   QINAQNLNENGDHNLNNSNASPYYYYPINIPNEAQQPINSNASTAPKKKRGGDKKALHK
FT                   QQQGNMNPYLDSHHQLQRPFAQKKGQTPTSPPAARPMSPLSNQPINFYKKQQQPPSGQS
FT                   AGTQRTTSSASNSSSQNSKNTANNNNNFHRSALLEELRANPTNTDLTLKSIYGHALEFC
FT                   KDQHGSRFIQKELATAPPPERELVFNEIRDHALSLANDVFGNYVIQKFFEYGSKTQKDI
FT                   LVEQFRGKMEELSLQMYACRVIQRALEFIDAQQRIDLVRELSHCVLQMIKDQNGNHVIQ
FT                   KAIECIPIDLLPFILNSLEGHIYHLSTHSYGCRVVQRLLEFGTLEDQKRILEELKDFIP
FT                   YLIQDQYGNYVIQHILQHGSDVNLASEHMRVIKQEIINNVADNIVEFSKHKFASNVVEK
FT                   AIIYGTDDQKIQLMKMILPRDKEHAANLEEDSPLILMMRDQFANYVVQKLVVVSQGDDK
FT                   KLIVVAIRAYLDKLNKSASSGNRHLASVEKLASLVESVEI"
FT   CDS_pept        531295..532704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194909"
FT                   /locus_tag="CAGL0D05566g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG58562.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG124405"
FT                   /db_xref="HOGENOM:HBG202623"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniParc:UPI00003B6198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU3"
FT                   /transl_table=1
FT                   /translation="MIVSLCRKVFSLVVLHAALTVITVLALVKHFLAIYWINSTTHEDS
FT                   RDTRPASFAKVIDSNLKAINRDEQTTASDQQRTGGDYIHFDHATNNPFDNLILAEDLNL
FT                   VPNLQYYYNQYNIDIEEFKVLTNDGFLIDLWHLKSRDYKYGAGSPGPRPYEREPVLMLH
FT                   GLLQSSGSFASSGRKSLAFHLNDCGYDVWLGNNRCGFKPSAKTKLKDFWNWDMTDMVKH
FT                   DLPALIDFILHQTNRKKLHLVAHSQGTTQGFMALINHNHEYPFSSKIAKFVALAPAVYP
FT                   GPLLDEKLFVRLMVKYIDSPWVFGNKSFLKTMMVARDLLIGQSSFSFICYVFFNYLFDW
FT                   NDSLWDKSLRDRHFLFSPVHISVKLMQWWLSPDPNKVSFKNCSHVLFPDDKSWFNKDID
FT                   FDENRTNILMIFPRQDRLVDGERLINHFVYHENHNSFKIWYIDEYSHLDVLWAHDVIER
FT                   VGKPMIDFLRE"
FT   CDS_pept        533235..534668
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194910"
FT                   /locus_tag="CAGL0D05588g"
FT                   /product="Similar to uniprot|P33750 Saccharomyces
FT                   cerevisiae YLL011w SOF1"
FT                   /protein_id="CAG58563.1"
FT                   /db_xref="HOGENOM:HBG038618"
FT                   /db_xref="HOGENOM:HBG436413"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B6199"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU2"
FT                   /transl_table=1
FT                   /translation="MKIKTIKRSADDYVPVKSTQESQLPRNLNPELHPFERAREYTKAL
FT                   TATKLERMFAKPFVGQMGHGHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIA
FT                   SFKAHYGTITGLCITPKVNIDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVI
FT                   NTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGPRINLWDINRSKPLSDLSWGADNINTV
FT                   KFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRVNSMCWNPMEAFNFVVASEDH
FT                   NAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKGHSREIY
FT                   HTKRMQHVFQAKFSMDSKYVMSGSDDGNVRLWRAKAWERSNVKSTKELNKLQYDEKLKE
FT                   RFKYMPEIRRISRHRHVPKVIKKAQEIKNIEIRSIKRREANERKTKKDKTIVPERKKQI
FT                   VGTVFKYEDKRRKDDDDEN"
FT   CDS_pept        complement(534849..536192)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434445"
FT                   /locus_tag="CAGL0D05610g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="phosphatase activity"
FT                   /protein_id="CAG58564.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG124404"
FT                   /db_xref="HOGENOM:HBG603876"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B619A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU1"
FT                   /transl_table=1
FT                   /translation="MDIISSFFCCADEQVQESGQRKTMNTERTESKPSNRRDLPRNNGD
FT                   SRQVRSAELYKEENTDTTVSSGSTPKLRDSDSNKKKGDRSRDNAHMDRKHANNKSHIND
FT                   ADAAENSQKRHSTRRSQVNGKTHDKKRLADSDNKKGDDDVDEITEEEVPVPVNKNSSKK
FT                   STSNNSNNVKPSGSDLEKSNSNMDGEKYKKLSTEEEEELANQLEYGTKLSQVNSVGSDN
FT                   SEENYDSVPTYDEEDLDEVEEEEEYIDLTVLQPGQYHAPGLDTLLSPKGDAFKHKKCLV
FT                   LDLDETLVHSSFKYLHTADFVLPVDIDDQIHNVYVIKRPGVDEFLQRVGELYEVVVFTA
FT                   SVSRYGDPLLDVLDKSNNIHHRLFRDACYTYEGNYIKNLSQIGRPLSEIIILDNSPPSY
FT                   IFHPQHAIPISSWFSDSHDNELLDILPLLEDLAKPSLPDIGKVLDVTI"
FT   CDS_pept        complement(536855..537022)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194911"
FT                   /locus_tag="CAGL0D05632g"
FT                   /product="Similar to uniprot|Q12287 Saccharomyces
FT                   cerevisiae YLL009c COX17"
FT                   /function="copper chaperone activity"
FT                   /biological_process="copper ion transport"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="CAG58565.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="GO:0006825"
FT                   /db_xref="GO:0016531"
FT                   /db_xref="HOGENOM:HBG429228"
FT                   /db_xref="HOGENOM:HBG558801"
FT                   /db_xref="InterPro:IPR007745"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniParc:UPI00003B619B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVU0"
FT                   /transl_table=1
FT                   /translation="MSEPQKEDKPKPCCVCLPEKEARDQCLLFDGQESAKCKELIEKYK
FT                   SCMKTYGFNI"
FT   CDS_pept        complement(537378..538337)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434446"
FT                   /locus_tag="CAGL0D05654g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58566.1"
FT                   /db_xref="HOGENOM:HBG124437"
FT                   /db_xref="UniParc:UPI00003B619C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT9"
FT                   /transl_table=1
FT                   /translation="MRMVRSTLLCCLWFTTVICSLLQPLKLEIIQPVTYHKLERLFYRI
FT                   EQIGIDGETFRIWTLSGYHNIANEQSNFKYLTTKFVDSFERVLALRGLATRNISLNSLK
FT                   IQACIIDKIKTQELINTAVELDYLAVTNDIKINNTKYVIKVIFDNIAKNYLGYYLWRLE
FT                   WLTQRNSQVTEQELYYIYTRVETMVSLVKDKLNQLYSLPLTKFMESVLIPMDGLNCNMS
FT                   QVVDCLKKRRKKEECRDSKDHKCLESLFHLTFVTLIIPIPLVVLYRVCSVSAGYVCVEG
FT                   IGVLGLLITKSLTSQFFYLLFTRVKHDCLKWLFEVERL"
FT   CDS_pept        complement(538678..540639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434447"
FT                   /locus_tag="CAGL0D05676g"
FT                   /product="Similar to uniprot|Q07799 Saccharomyces
FT                   cerevisiae YLL007c"
FT                   /protein_id="CAG58567.1"
FT                   /db_xref="HOGENOM:HBG124438"
FT                   /db_xref="HOGENOM:HBG202607"
FT                   /db_xref="UniParc:UPI00003B619D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT8"
FT                   /transl_table=1
FT                   /translation="MTIDDADINNELSKVLESATENSLSADYAKCCFEYLRNSARDQKS
FT                   SSFQHLIWQFVSACPDDVLCSQIIPEDDFWDLIKDCATNMEPELLSSILNYLFNIFLSG
FT                   QDVHELGFTSLCNHLQKRHNIMEYILINLSLHSLHVNLVADTLRCIASFLKCSMLLSKY
FT                   DAEKAISIVPSICFLLLEYNFPTVVTLLLSIDELRPLIIDEYLPVKMQLAKFLESKTLQ
FT                   QASIELKQNLYHAIRNTNIFLRSYEMEFGSLNDSMAELNQLNTLQVYDMLSFLDNSNTV
FT                   FIKNLTEQLLFKSSPFPFFKVIFEVSSEMQNFLNRFDEDDDSKISMAGHILNRESLLES
FT                   LMCCILRFWSESQSTSRNDMDSLLQLVPIILDKMYCSIRDTNLKRSGSAFEVGIELLES
FT                   FDYSTARLWQLEMIRNLHYQQWSGQISGFVDILSNQVHDYVRHQRLLLLQKGTWAYSEN
FT                   PIDEGSTNPRVYFIVVSDNHANLLARRFDHKLDETPFVEDNVICTKSEANSFPNPNSTI
FT                   VVPIKIIDSFASKELRAENNAAEVPQVVNISKKNIYTEVKLLDKSQKCLLQMYLDTKEA
FT                   AYIWLDGLMLISKSKSRANISENTKSQIKTLIDLRKDVQLLNLPFHQELQESPEDIDEE
FT                   EFYDLDTLKNLPNEFYYQ"
FT   CDS_pept        541045..542340
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17434448"
FT                   /gene_name="MMM1"
FT                   /locus_tag="CAGL0D05698g"
FT                   /product="Maintenance of mitochondrial morphology protein 1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58568.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG192227"
FT                   /db_xref="HOGENOM:HBG397194"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI00003B619E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVT7"
FT                   /transl_table=1
FT                   /translation="MVSALEVKSIKDSNETLISLDDYIRNTLPSQLHEILLEEFQNQDF
FT                   SRGQDVSNSTHDQMIDHTLELTSDLLRNALDKQLMEVQSRTLPVRQSNQLISWSFAQGL
FT                   IIGQLSVVIFLIFFVKFFIFTDASSKMDNPLPSKVSKSYLKNRRESSSIKDKRKGVLVK
FT                   EESGETDLHGSLQLNDILEKTYYNVDTHSAESLDWFNVLLAQMIQQFREEAWHKDNILT
FT                   SLDSFIQKRSSDLPDYLDKITITELDIGEDFPIFSNCRIQYAPNSSDKKLEAKIDIDLN
FT                   DKITFGMSTRLLLNYPKKCTAALPIDLAVSMVRFQACLTVSLITAEELEFTTGNKIDDN
FT                   EKNGYYLVFSFTPEYKIDFDIKSLIGARSKLENIPKISNIIEYNIKKWFAERCVEPRFQ
FT                   SVKLPGMWPRSKNTREEVIHKTEDESSKTPHS"
FT   CDS_pept        complement(542407..545052)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195158"
FT                   /locus_tag="CAGL0D05720g"
FT                   /product="Similar to uniprot|Q07798 Saccharomyces
FT                   cerevisiae YLL005c"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58569.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057986"
FT                   /db_xref="HOGENOM:HBG202609"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI00003B619F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT6"
FT                   /transl_table=1
FT                   /translation="MDAAIKDHKCVATSNDIYVDTKSWNLTHKLISSFLNTARAGSAHK
FT                   DADMSVNSFFLGIGASAGYFLFQLFAFSLLRRIASNIYQSNSVLRRYENNSTLDFSNRN
FT                   PSIWERFTSKYVPRIFKESIDNYEAIVGLDGFLFMRFLKKLILLFSLLSLGIVPVLIPL
FT                   HLTSSDNNKNDLTRVFNSTQPQSNRIDKINMSNISMKKSDRLVCHFIFALIIIVAFQFF
FT                   IVAELKYAYGKINTTVITKSYQNIVFVDNIPAEVLKDDSKIMEYFNKIQPNSVVAAARL
FT                   PNNIFEIRKTHKNIERHAYIIEKIISKIILEKFFKVGHLLLSTNDPSVEIPPTSLMVLS
FT                   YHQLCQKILFNLRSFDKYFYCELKFKLQKIKPSKYFVYIPQFKRKSALEYQYDSLDREI
FT                   HYYQKYLDLWLTYFPKKNEPDSSTIPGNEKMQEYSNKAFLLFNSVSQAMQFYQLLQSSS
FT                   VCQWNYPMIGAHPKDIIWINIVGRNPITITLRKLAGRLIGVLVILGWIVPIAFIGLVTQ
FT                   IPYLTNLLPYSNHFNVTSKCLRDVTKAVFPLVTLIFLTEFVPYIFRVISYLKGCRTGAE
FT                   IEMDIQRWFFMFLLVHIFFVVTISSGLSLLLEKLLISPVSIPNILAHDLPKSSNFFCSF
FT                   ILLRGFAYSGGNIIRLKELFFEIVYYRPRMPTPHNKMQRLKKNLFFQWGSIYPLFTVIG
FT                   CICIIYSIIAPFILPLAVLSLSLVYYSFKYLFIYQFNSENISETHGKLYPEALSQLYAG
FT                   IYCMELSLIGLFALFNCYKLSTSMAFMSILTVLIHAEISKKFIRRLHNLHLNSLHDYTS
FT                   SDSISPRAESLESYIFPPITNEIWVPTDQMGIAENERPYLQASLSLKCDFEKAYITKFG
FT                   NICINPDISE"
FT   CDS_pept        complement(545384..546838)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348405"
FT                   /locus_tag="CAGL0D05742g"
FT                   /product="Similar to uniprot|P41543 Saccharomyces
FT                   cerevisiae YJL002c OST1"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58570.1"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057967"
FT                   /db_xref="HOGENOM:HBG396766"
FT                   /db_xref="InterPro:IPR007676"
FT                   /db_xref="UniParc:UPI00003B61A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT5"
FT                   /transl_table=1
FT                   /translation="MKAFAINWAFLFLFLGQVFGQAQEQKPYSGEASEKLAQEKPEWEN
FT                   LEYQRYLDLSGTGLAEEIRIVAKNVGDKPATDYHMLLPRNVIDNLSVFTATADNSSFVS
FT                   FRALSATLKQLNNTAIGYGFLGLPRSVEPGETINLRLIYKFNDCGTPKPKKIGLGEDQF
FT                   LVYETDRLPLSQYPTKMSILKITGSTDMSELDIGSVPEEYQGTFDDNVMTFGPFEDINA
FT                   LNVENKIKLRYLHNLALNEVIYLKRDIWVSHWASTIQFVEYNEYHNKGAELKNGFSRLE
FT                   VMKNVQAANSPTVRGIIENHLPEQATEHYFVDKVGQVSTSQVLNNLFYLKPRFPIFGGW
FT                   FYNYTIGWTNELSDFLRVSDMDSEEFILAVPLLNGPKDTAYDEVEYSVYLPEGATVIDT
FT                   KSPLPVVQTTTSFESSYFDLKNGHTKVTLKFRNLVSELADGKILITYKLTNANFYGKFL
FT                   NISLYGFIALMAIFLLNSINLRVSKN"
FT   CDS_pept        547259..549880
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044038"
FT                   /locus_tag="CAGL0D05764g"
FT                   /product="Similar to uniprot|Q12369 Saccharomyces
FT                   cerevisiae YLL003w SFI1"
FT                   /protein_id="CAG58571.1"
FT                   /db_xref="HOGENOM:HBG124439"
FT                   /db_xref="InterPro:IPR013665"
FT                   /db_xref="InterPro:IPR018907"
FT                   /db_xref="UniParc:UPI00003B61A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT4"
FT                   /transl_table=1
FT                   /translation="MNNEEGSVSTEALLNGDLDAATDSLIAGNVSSLMDKVHISHPVGE
FT                   SINTIRGGNRSTEYQVVTDSWDVLRDMLDPFFQRIAKFLELNGLSPTFLSVFKIYLRIL
FT                   KDNNLDPLADDYLLCLQNELGRSLVMSSVLEELLVYFLIRPANMYISMALFEHKQNRSI
FT                   SFSYLKQMESIYLLKSQERKMLLARDHALILRILERWRDELDVKGNLWYEKANEFKDVC
FT                   SKILGYDLWMKKAESNQNKMKLADEYFMDKSLKRVIKSLQKLKNAEQSLQFVQDKIMLK
FT                   HYMQIWQLSHRSKQFSVRNNNIMKISIRKWLNRIQCATSKCKIAYRFRERHEIQIAFTR
FT                   FKNEYDRRQHYNEGLEERGDQLIKRKSFKIFLHTFELRKLLRNVLIRNEYNSQRKYMEI
FT                   WKRRTNQIKLADDIRLSQLVRKSNQIISMWHKNVILEQLLTKHNTDKLRKQFILKWRLA
FT                   TKYKVFMRNTDKLLKLHKLEIWKSNSRDLQRANHFRKTKMLQNTYTNLTKIYGKINKMQ
FT                   RNSALLCEYHLKRNTLLQMKIFENKKVVLMGRQQRFVKVKYWKIIKDIYDTDIALKNLE
FT                   ATSLSAKLSRLLLKRYFRIWMENYQDVREIKLTVIENEVTKIMHDHLKKRFLKTLLFAV
FT                   YAIEADKTYERSLKLNVYLKWLVNSESLKENERQLTTLLAKQKIRHHYLLWKEHSKKVN
FT                   QLNIILDNKKSTLSSHHLHKYLQIWSNRLKNNSSLIEKIQLRWSRALLRGCLQSWKEKS
FT                   KNRGSASLSDELDTAYKTPHRENVRKYDVLNFSDAKYRQAMRTKKIASPIKASSVLESV
FT                   LKRRVDNPYKLTDENATQMTIENGKEQMKKIESSISKLAFSDVPQLTPNDARLRGSPGR
FT                   RA"
FT   CDS_pept        550165..551436
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435485"
FT                   /locus_tag="CAGL0D05786g"
FT                   /product="Similar to uniprot|Q07794 Saccharomyces
FT                   cerevisiae YLL002w REM50 drug resistance "
FT                   /protein_id="CAG58572.1"
FT                   /db_xref="HOGENOM:HBG057951"
FT                   /db_xref="HOGENOM:HBG202612"
FT                   /db_xref="InterPro:IPR013178"
FT                   /db_xref="InterPro:IPR016849"
FT                   /db_xref="UniParc:UPI00003B61A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT3"
FT                   /transl_table=1
FT                   /translation="MLQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTIK
FT                   TEHLFCLAYKGRIFYGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVT
FT                   LQLIRYVLSINPDYYLHRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIE
FT                   PEIFNAFYTKFHSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLD
FT                   NLLVSDFNLNKTKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMF
FT                   PDDPKSRFMKQLFEENRIQTTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTNYKP
FT                   STDVYRCRSKRQFHCIKNYITGEEYDTEEGALESYQNVNDYLSREGTSLLTVTGNADYS
FT                   KFKQNRTTTSTPVVVNTLQVRRKK"
FT   CDS_pept        552040..554370
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435486"
FT                   /locus_tag="CAGL0D05808g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAG58573.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG326669"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00003B61A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT2"
FT                   /transl_table=1
FT                   /translation="MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSIL
FT                   ETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQ
FT                   NNNESTTSLNDNNGASSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETAR
FT                   IAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVAT
FT                   PNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLY
FT                   PLKLGFVGVVNRSQQDIQMNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQT
FT                   LISHIKEKLPDIKTRLNTLISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISS
FT                   IDGTSSEISTKELSGGARIYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTL
FT                   FVPELAFDLLVKPQIKLLLEPSQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVV
FT                   SDLLRERLFPTRSYVESLIDIHRAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKM
FT                   LEKEKQNEIQENGTASQNSKSDIEPSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLS
FT                   LSNRDGRFSELNGYKDDFSSQFQQLNFNSNLNSDDDAFENANHPKLTEREDLECELIRR
FT                   LIVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQ
FT                   DRENALKSLEVYKKASALIGNIL"
FT   CDS_pept        complement(554761..557355)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435487"
FT                   /locus_tag="CAGL0D05852g"
FT                   /product="Similar to uniprot|Q07895 Saccharomyces
FT                   cerevisiae YLR001c"
FT                   /protein_id="CAG58574.1"
FT                   /db_xref="HOGENOM:HBG058383"
FT                   /db_xref="HOGENOM:HBG202613"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI00003B61A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT1"
FT                   /transl_table=1
FT                   /translation="MNIFVLIWFIGWTCAVGRNGRGQDEHDDFPFTTVVDILSQNVEFS
FT                   TFLTLIQKGGYIPYLNELDNFTLWAPVNSAFVEDEQELLMGTFDIDNYIIRDCMVITSD
FT                   IGNSTQFLSENVKFPFFLSRRSPESAYVNGIEIIEPDLLPNVQNATVQGISSLINNPPG
FT                   FAELIDREHRKDLGIFKTLTNNLYATLESMIQNRTILMIEDMAFDDAFNEIELNYLLDR
FT                   FNSTNSIGEDISRTWKEDSLRLMQAMILREMVAGSLEEEAISFDLNNKMIRVDSISNGN
FT                   QVKINDTIESTKGNLLYNRGVSHIFRDFSGLNSTVEFNAEKYLHGLNKSEFVKELYFRK
FT                   LQNMITSDENLTIFVSEDGNDDVTGYTKPSLLYHFAEEKIWIEREITSEGSQASKLYDS
FT                   AFCSSNKRLGGHCQKFKITKKGDDYFINDRYKITSIAPMVIKNTLIYTISDNLQLPGDL
FT                   VSAIPPLYHCYKSLRFLNELNLLDLEANHNGYTIFLPCFQSWDIMELNLEYLSGNKTAL
FT                   NELMRNLIIDGLHYTNNDTTEFTAHNKFGDEVTVDFSKSDTSEGVINVKMDSMDGILKI
FT                   ESLHDVFFNQGVIHPIDQIIFPHSLNISLNDLMKSDDCSVFKHLLKSINQIGEILNNDD
FT                   EYSILVPTSSSIISDGLSVNTTNLEKILKIHIIPGNYTQSLLDCNSVSKSLSGDSIYCR
FT                   KASQTSRLLSFMDGQDKEVRILKMGCSSSKSNSCIFLIDKPISPDWLKIPRTRLDLPGV
FT                   ALGIGVLLGSLFVVLLLGFIILMRMNSRADRLLANTPTSESSSPDDTERNPLLQQNAAH
FT                   GDQYNSISATNAGNNASQNSQSFEASYSANAQRLPIKQQRSTNSTIANARFS"
FT   CDS_pept        557894..559723
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348406"
FT                   /locus_tag="CAGL0D05874g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG58575.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG058385"
FT                   /db_xref="HOGENOM:HBG396177"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniParc:UPI00003B61A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVT0"
FT                   /transl_table=1
FT                   /translation="MSFLESLSDPVKVVEVSSEAPLEFVKDHVDNVIKLSKQSGLRNKF
FT                   DLEEVTISGLDANQVWWQAKIVQDNIEGELLDRIQELREVLGAGEASDVSGEESEEQVS
FT                   EDEEDDEDGSETEPLEQDQAVEQELSEEEDVESDNGEIEGTDLSDKEEQEAEVSEGDEV
FT                   IAESRHDKSDEEVIPESKQTESEVNDQFFNIDEFNKQTDDSKDPLAPKVEDDDEDDIDY
FT                   FGDIPSEDDEEAIYYDDFFDKPDAKSSRKLNRNDKEAENNESEDEFMDEPDLEDDDYYN
FT                   EAMDSAKLDLFADAEDESEEDGENDEEKLSTFEKRQLELKKQIEQLEKEAIAEKKWALK
FT                   GEVKAQDRPDDTLLTEELEFDRTAKPVPIITQEVTESLEEMIRRRIKEYNFDDLQRRTV
FT                   ADLNLGMRREKFELSDAKSSKSLAEIYEEDYKGVSEETAASEELQKEHDEISDMLTNLF
FT                   YKLDALSSAHFVPRPAKQSLEVKVESAAIAMEDAQPLTMTTASTLAPQEVYKVGKAEKD
FT                   TEIRLKDGTVMSKEELSREDKTRLRRAAKRKRSKALQNKSQQPQKKSKKSDVIDTLSKA
FT                   KNVTVIDNKGQKSDVGGKALKDKKSQQADFIKL"
FT   CDS_pept        560448..562775
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435488"
FT                   /locus_tag="CAGL0D05896g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58576.1"
FT                   /db_xref="HOGENOM:HBG058080"
FT                   /db_xref="HOGENOM:HBG396596"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniParc:UPI00003B61A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS9"
FT                   /transl_table=1
FT                   /translation="MKGSKGRTDFNQRKNFNAVSQSSGSGLFHETGDVTRGFSDRLDYL
FT                   LVNGIGSNVKVTTTAGIQYEGVLAAANTESTNGIDVVLKHAKVIDNGMVKDIDALAKSI
FT                   EDTLLIQGEDVAEVDLKSIDFSLDEKWEAAQQQLEEKKAAAVEAEAAKKAASPPSRSTS
FT                   NTPAEGKTGFRTDVDISRANKDIRERELQKWTPDTDSAFNVDTVALEDSNEKWDQFAVN
FT                   EKKFGIKSSFDEHFYTTKINKDDPNYAERLKEAERIAKEIESQDASGNVHLAEDRGIAI
FT                   DDSGMDEEDLYSGVDRRGDELLASLKSNAKPAAPKPKKYVPPTLRNQPHHMDPAIISST
FT                   GTKAVSPVTKHSAGLPRKEHRHKKVPNSKEAQIEELRKFSEKFKVPYDMPKDMPTSSKS
FT                   TSSSESAATEASVDTPNTTTQSQPQATVNSGSNLKSDPSLPPKPVNKSSSTKSSVPPTP
FT                   STAKGELKKSSSSTSGASPSSATSPQATAHGVSPAGGRASVSSRRRNAGSFFGSKKLQS
FT                   KDNVRKAFATSFNMFLRSKEAHDQKVAEHAASSSDEKKHEKSPAVTEQFFIEKPYFTAP
FT                   TWASTVEKSFKEFFPDERKALQKAQSRLQKRQMNAMNAGMMGSHAPGVMNPHMGVMGGM
FT                   GGRGNMSNFAMAPMSGSGANPAMMNSFGGMYMPFQPQPVFYPGMVPMMGTSTSANTGRG
FT                   NAGAHSDESAVPSGSMSPQAMSPHIPPAYMAGAPMAYPAPPGAAPFHGMMGGMPDRSHG
FT                   NYYHNNHGHRNNHHHYHSKQYN"
FT   CDS_pept        563388..565082
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435489"
FT                   /locus_tag="CAGL0D05918g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAG58577.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG124440"
FT                   /db_xref="HOGENOM:HBG204414"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI00003B61A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS8"
FT                   /transl_table=1
FT                   /translation="MAPNTKSIEQPLISKAKISGKGPDGFAIEESLLERGHSRRMGHLE
FT                   NYFAIMQRQKLYTNFNMYGELNKEVTREQLAVAIRQILLRHPIMMQAIIPKKFPEHEEY
FT                   YTSDDYYNTPFPENDFLRVITSKIKLSDIIINEQSEDYGEIIDMILSEYKKNGYKFDAY
FT                   MQELIGNIVIPIGNPNKPNWRLLCLPSAEGGGAQWKKFVYISNHCCSDAISAVNLFQDI
FT                   AENVSLIEQNSWAVPYADDVIVDYEQDVADIAKLPAPITERVEYRPPLSKLPKIMLVSF
FT                   LKTALNFKSDALETRCNDEYSGEPETSAVQMGDVCYDSILNYTCEEVAVIRDRIKHNVH
FT                   GKCTVTPFIQAAFFVAMHQSRKLLGQKQGFKEWMSEWGVDMATPSSTRRYLPEDPEVRD
FT                   MYKYGSNVGGIHYLYMISGMKVEREETEKFWSLVEYYHDILLASHSNGDQTVGLGTLML
FT                   DVIVDKKNVDKLIRDEYLYQKRGGVIMSNAGYFHQDPAQAYHVTDLVFGQRPGALKFSF
FT                   GVNVVSTNIGGMNLNVGMVRRTLRDRAEFREFIGILDRVIRDFTGLN"
FT   CDS_pept        566095..567564
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000174713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348407"
FT                   /gene_name="ERG1"
FT                   /locus_tag="CAGL0D05940g"
FT                   /product="Squalene monooxygenase "
FT                   /EC_number="1.14.99.7"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="squalene monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="microsome"
FT                   /protein_id="CAG58578.1"
FT                   /db_xref="EMBL:AAB69189.1"
FT                   /db_xref="GO:0004506"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0005792"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316608"
FT                   /db_xref="HOGENOM:HBG517657"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="UniParc:UPI00003B61A8"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13306"
FT                   /transl_table=1
FT                   /translation="MSLTNADETVTYDALIVGAGVIGPCVATALARKGKKVLIVEREWS
FT                   QPDRIVGELMQPGGLRALRSLGMIQSINNIDAYPVTGYTVFYNGEHVDIPYPYKADLKP
FT                   VEKLPGLVRDGNDKVLEDATVHKKDFEDDERERGVGLVHGRFLNNLRNICAAEPNVTRL
FT                   QGNVVEILKDKKNEVVGAKVDVDSRGKVDFKAHLTFVCDGIFSRFRRELHPDHVPTVNS
FT                   SFVGMSLYHAHMPHDMHGHVILGDKHMPILVYQISPEETRILCAYNAPKVPTDLKSWMT
FT                   KDVQPYIPKTLRPSFDDALAQGKFKPMANSWLPARQNDVTGLCVIGDALNMRHPLTGGG
FT                   MTVGLNDVVLLIKKIGDLDFSDREKVLDELLDYHFERKNYDAVVNVLSISLYSLFAADS
FT                   KNLKALQKGCFKYFQRGGDCVNLPVAFLAGVLPKPLLLTRVFFAVAFYTIYLNMEERGF
FT                   LGLPMALLEGIMILITAIKVFTPFLVRELIG"
FT   CDS_pept        568044..568502
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195159"
FT                   /gene_name="CBP4"
FT                   /locus_tag="CAGL0D05962g"
FT                   /product="Assembly factor CBP4 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58579.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058078"
FT                   /db_xref="HOGENOM:HBG395794"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniParc:UPI00003B61A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVS6"
FT                   /transl_table=1
FT                   /translation="MDTPVWRRWLKIYIYGGSIILGGVLLFKYTTPTDEKLIASLSPEL
FT                   RLQYEKERKLRQEEQRELMRIVQETAKSNEPIWKTGPIDSPWEKKKGGEVVKNENFFDK
FT                   IQKTRAEEAQKDELQRIREELDSLRAQSMKKTSDIVNERKSKDWWKIW"
FT   tRNA            569043..569113
FT                   /gene_name="tRNA Gly (GCC)"
FT   CDS_pept        569398..571182
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435490"
FT                   /locus_tag="CAGL0D06006g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58580.1"
FT                   /db_xref="HOGENOM:HBG189927"
FT                   /db_xref="HOGENOM:HBG396097"
FT                   /db_xref="UniParc:UPI00003B61AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS5"
FT                   /transl_table=1
FT                   /translation="MYRSRNRNRQGGPNSIKGPSSALTQFLKEEGISAEAIRNRWLQRQ
FT                   VKGGDKKEGSPDEDKDTAFTTNNDEEVKKDYDSESTLSDEPRLKREALEANIVSDEEDE
FT                   EDVEYKEITPAKDESVSYEERMKRFNQDSDEEEYDESASASIEPLVLPEKKVDKATIEK
FT                   KARTVIQNRRKKQRRAANLLDRKSNAVLSLQALCIAKISQNIYKWQKDSEENRNNDHNV
FT                   MFSHLREVLGGVSTENLNNLANALSKNRALNDQTLQLFLKTDLEALTFHDCSKVSFDGY
FT                   KTLAIFTPHIKKLSLHMCGQLNNESLLYIAEKLRNLTSLYLDGPFLINEKTWVQFFEIM
FT                   KGRLEEFHVSNTHRFTDKSLASLLINCGSSLKALGLSRLDGLFNYALIPQYLCNEEFHS
FT                   LELGYPYNDEDITDEVVINILGQIGHSLKRLVLCGCSDLSDSVIINGIGAFIGENNRLE
FT                   EIGLEELDQISNDSLLYLFSQIQFPNLRVCSFRRSIQIGDDTIMELFQNAAVNTLEILN
FT                   LNSLNSLTKESLLLLSCPHLKHLDVAFVRAVDDEVVGRLGKQNPKLSLMEVFGDPLVTE
FT                   KAKIRPGITLTGRQSDSI"
FT   CDS_pept        571551..573284
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435491"
FT                   /locus_tag="CAGL0D06028g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58581.1"
FT                   /db_xref="HOGENOM:HBG124441"
FT                   /db_xref="HOGENOM:HBG202241"
FT                   /db_xref="UniParc:UPI00003B61AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS4"
FT                   /transl_table=1
FT                   /translation="MSIRPANMMDYDLPETSFEDIDATFSRDVPTSSVRNTLDMQQSMP
FT                   VEDRKVLQEIVQPTPSSITTSDTGTIFSGSRKQSWLNNLASDEDKSDGFEDGEEFLSDF
FT                   QEFQNRKDDFDEAIKSHFNLQKRSCRGDYDLATDFERKVNINPNSQRRSLRQPRSMMDM
FT                   HPLRSENSFNPHRLQNSISTNNLHRPNRLGSLHFKKSMPSLSSYNPVIEEEPRYWKKSW
FT                   DIEEAEEDDDYFDEDFDEDGQETFDLDEKTLKNRVQSNIPTSKTPFKISPTQFDIIQQD
FT                   DLLTPRLHKKQKELRYKHNLEAFKETSKARRRRHTAKSKIQTIKQQIDHNTPMKSGLMY
FT                   YNPKKMAWEGNERVLDKFQDIISIDKRPLLIRNKSNISPNETLTYTGSDNNNVQDNGSN
FT                   STFSSTTNPRVVGKMMFDERNLRWVSVNNDEIDPFAEIEENIPEPILGKPKRSSPFLRS
FT                   RSQLISSNNPEVSFTESDVPGNDKFAIGVKKRDRYASTSAAISKRAGDRADMERVYRLS
FT                   SKELERLYHEENRWQRKVGGWFVLGDGDQQDRTMAQYDPSDKGNNFMYEIRKMVINSTK
FT                   N"
FT   CDS_pept        573888..575462
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500580"
FT                   /locus_tag="CAGL0D06050g"
FT                   /product="Similar to uniprot|P47114 Saccharomyces
FT                   cerevisiae YJR054w"
FT                   /protein_id="CAG58582.1"
FT                   /db_xref="HOGENOM:HBG124442"
FT                   /db_xref="HOGENOM:HBG202242"
FT                   /db_xref="UniParc:UPI00003B61AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS3"
FT                   /transl_table=1
FT                   /translation="MLGNDWKYSINSRTFDDLEEEEFKNYKFKTVLSYIFEIGVMNGLK
FT                   VAFFVSDIYTCVKLLAYNSWSNNVIKPYISFKVTKWLFTACIFASIVILLIEAAIGFRI
FT                   YRTRNISLTYVNNFSRNTYSIKSYSKFCVYNKITPKGFFQKVSFFTFFELRNCIRLLFT
FT                   DTPRQVFNALTLWSVLVTVNNGADLGRLETFHGLINKIKTIADTNHAEAVILSFMLFSF
FT                   VLWAFFMFKFCLALLSSIFVYYNLIRRHRYGSLKAFVCITIDKKVDEMVKQHKSKSAFQ
FT                   SITKTTLLQSNSMLDIKQDLEKNTAETTYEIYKKPNYDSVRSNLHLVNSSIEDGSTSEE
FT                   YELMYEEPMVRNSVIDGNDLLLDSKFNAKRDFNQYYQNAARNQSNSQDVIKEEYEPNFD
FT                   VMDYAYSNGSNECHDDDTVWKDSVRSGISDNINYGHSSSRELDDVTQSVYPPQTIEISR
FT                   QMPINMSTHTLEHVSSSVTLDQQPRRSRIPPPPIKTAFIDQDIQQLHVYTPDQAYFNEF
FT                   TRNQHKF"
FT   tRNA            576832..576903
FT                   /gene_name="tRNA Arg (CCT)"
FT   CDS_pept        577169..577645
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435492"
FT                   /locus_tag="CAGL0D06094g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58583.1"
FT                   /db_xref="HOGENOM:HBG059546"
FT                   /db_xref="HOGENOM:HBG397095"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI00003B61AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS2"
FT                   /transl_table=1
FT                   /translation="MSSGKECQICKKDDFKYKCPKCGIKYCSLACYKNEELHIHKDAVT
FT                   TELKTEQEDKTSAKDKTESSVIKFKTEKYQNIYDNSPEIRELLNYNTVKFHLAKVHKIL
FT                   TTTVADSNDSTTSMSSEAKKQLAIDYLNTLRYGGIHYNEALEEFCQLTVAKLHK"
FT   tRNA            578043..578115
FT                   /gene_name="tRNA Ala (TGC)"
FT   CDS_pept        578612..579634
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195160"
FT                   /gene_name="HEM2"
FT                   /locus_tag="CAGL0D06138g"
FT                   /product="Delta-aminolevulinic acid dehydratase "
FT                   /EC_number="4.2.1.24"
FT                   /function="lead ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="heme biosynthetic process "
FT                   /protein_id="CAG58584.1"
FT                   /db_xref="EMBL:AAB94926.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032791"
FT                   /db_xref="HOGENOM:HBG012673"
FT                   /db_xref="HOGENOM:HBG285270"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000012C445"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42768"
FT                   /transl_table=1
FT                   /translation="MHTADFLDIEPTEISSILSGGYNHPLLREWQSERQLKKNMLIFPL
FT                   FISDIPDEATPIDSLPNIKRFGINKLVDYVKPLVEKGLRSVILFGVPLKEGTKDPVGTA
FT                   ADDPEGPVIQAIKLLRKEFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRIAA
FT                   VAVNYAKAGAHCVAPSDMIDGRIKDIKKGLISAGLAHKTFVLSYAAKFSGNLYGPFRDA
FT                   ACSSPSNGDRKCYQLPQAGRGLARRALARDKNEGADGIIVKPSTFYLDIMRDASEICED
FT                   LPICAYHVSGEYAMLHAAAEKGIVDLKSIAFESHEGFLRAGARLIISYFTPEFLDWLSN
FT                   "
FT   CDS_pept        complement(579863..580138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435493"
FT                   /locus_tag="CAGL0D06154g"
FT                   /product="Similar to uniprot|P53182 Saccharomyces
FT                   cerevisiae YGL041c"
FT                   /protein_id="CAR58016.1"
FT                   /db_xref="HOGENOM:HBG398800"
FT                   /db_xref="UniParc:UPI00017BD679"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ2"
FT                   /transl_table=1
FT                   /translation="MDQIHANPAVMEKLEKVSKIMIEKNLINSDNHDANGQRSFKPMQM
FT                   IKILMDKDLRLAMNEFKSSLDKAGIQLGPDQLAPLMTVLGIEKEKK"
FT   CDS_pept        complement(580707..581627)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500581"
FT                   /locus_tag="CAGL0D06160g"
FT                   /product="Similar to uniprot|P07273 Saccharomyces
FT                   cerevisiae YGL043w DST1 TFIIS"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription elongation regulator activity "
FT                   /function="translation elongation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58585.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG131880"
FT                   /db_xref="HOGENOM:HBG716813"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR016492"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI00003B61AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVS0"
FT                   /transl_table=1
FT                   /translation="MMDAKDVVVHVRNLEKSKGNDESVLEILRILEKEVVPTEKLLRET
FT                   KVGVEVNKFKKSENAEISKLVKRMIGAWKDAINKHKKAKLRQQQPPQQGVSASSGGAAD
FT                   GSNNDGAKSGDEPRKTDKFVSSKIRNTKNDGVDPNVHNNKLRDQVIRALYDALAKDSEH
FT                   PPKSILQTSIAIEEEMHKLNDSSIKEKEYKDKYRVIYSNIISRNNPDLKVKIANGDLSP
FT                   EQLVNSDPKDLAPEHLKKKMEEIKKQNLFNAQGATIERSVTDRFTCGKCKEKKVSYYQL
FT                   QTRSADEPLTTFCTCEACGNRWKFS"
FT   CDS_pept        581992..582834
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195161"
FT                   /locus_tag="CAGL0D06182g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58586.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG395454"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B61AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR9"
FT                   /transl_table=1
FT                   /translation="MAPSQGNAVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVVSL
FT                   KMMFDSQTGKSKGYAFVQYQDLESSASAVRNLNGYQLGSRLLKCGYSSNSDITDQGVGN
FT                   ANNSAMDEYNEEMLSNSINRRFPQLPQGVDVNINMTTPAMMISSELAKKSPQEQKNLLK
FT                   VFQKWTRENPEDAVYLLQECPQLSFVIAELLLTTGISKVDELTQLAESNQTGSQGNITS
FT                   DILNNDKTIDPAVRAKKIELLRQVLQLSDGEIAILPYDEKMVIWDLKQKALRGEFGAL"
FT   CDS_pept        complement(583144..585093)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435494"
FT                   /gene_name="RIM8"
FT                   /locus_tag="CAGL0D06204g"
FT                   /product="pH-response regulator protein palF/RIM8 "
FT                   /protein_id="CAG58587.1"
FT                   /db_xref="HOGENOM:HBG059395"
FT                   /db_xref="HOGENOM:HBG204313"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003B61B0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVR8"
FT                   /transl_table=1
FT                   /translation="MAFIKLLRKTKDEPSRLAKAVRHLQVTLDDPHATYRPRDVLFGQV
FT                   LLDLKQNVANVRVRLTFIGEVKSKYGTAHKRGGCFMEKSTVLYGDDGDLDTDEMEPTVN
FT                   GLTKGVHKFPFSIRVPSGKKIHSSIKFERGSVSYHLMAVFESVVEPEGVSAKVRTKVNI
FT                   LVPIDVYRYSDVVVKTILLNSNAKSKSHKINSNDHNGHLNGDVTTLTTSDGSSEGTKKT
FT                   ISESQIINNLSQRQVLQKSKSEGSKSESIQASTGQINQLPETSSQVSYNAVLTNGMNRD
FT                   ADNQTVKIDVRLPHSGFVQGEYIPLTINVSHYREYYHPAGVIATLVRVCKVASGRKEDT
FT                   KEIYRKDICQSISPLLIESNKLENTISTYLKVPNDIIASMTSLPEHFTFQYFVEVVINL
FT                   SRKLEIYSHSQKPLSYILEKQKTKKPLTIPRDLKELNLPASVNENGAWEVPRPSLNNEK
FT                   SNGGIDSSRNDFQSKFGSAFNKSTLFGLKNIDEIHVAEQTIIFDDMVDVERLKRMRNVA
FT                   GLSIETIIGNKRSSPAIDLAKLEISKLSQGKVMKSNGTSKNTSSSGSIESNSIVRYRYI
FT                   SFEQDTQSSTDSYDEDITKMGNQLNEWLSPANAYEEYYPVPEYSANENVFASEDKQELE
FT                   YKRLHELESDPPQF"
FT   CDS_pept        complement(586395..588725)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500582"
FT                   /locus_tag="CAGL0D06226g"
FT                   /product="Similarities with uniprot|P39712 Saccharomyces
FT                   cerevisiae YAL063c FLO9"
FT                   /protein_id="CAG58588.1"
FT                   /db_xref="HOGENOM:HBG539104"
FT                   /db_xref="UniParc:UPI00003B61B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR7"
FT                   /transl_table=1
FT                   /translation="MLAQVLVYLLVLSLGAIQGNAQESTRTIKVTTTITTRICPSCVIK
FT                   TVLSPSSIPPNIPNIVDPPPMIPEDLPPTKPEDPPPHAAEVTITVTITETTRTTRTDLE
FT                   TSLTTLTEVETTVTTETKLTTETATEVTTELTTETKLTTETETEVETTVTTETKLTTET
FT                   ATEVTTELTTETKLTTETETEVETTVTTETKLTTETATEVTTELTTETKLTTEVEVITE
FT                   IQIDTQVTTKTELTTITQLATKFTTTTTIEVETLLTTETKFKTQTEIEIKTTLTTETKS
FT                   TTEIQKTTETITNTASITETYSETIYITSVTHTTDVVTRTDITSRTITSYVNETITNIV
FT                   YDTKYLSVNSIDYSILYITSTIIDRSTTTTTEFENQTITETDFETVTNTVQKTTFKEAT
FT                   HYTTKEVFSTITELISLTLSTIETVKMTDTATVTVTDTAYLNITSFIQLNNTTWVTAVE
FT                   TQTKTETAVESILSTLTTNVTFTYNRTETVLTTFTVFDNEFLACPPAVYTDCENTPDTV
FT                   TTTTTAQRTLTTTSTLTVLPERCRYNSTWSISVTTPHAIESMIITTVYKTTLQQNLAAT
FT                   NISINSPWNNASNEIHTGKDSALVSNYITVTTVLRETVTHTINGNISVLSTISENAPIT
FT                   VTKYIKETVHATVTGISMIPVELEAGPPESIYVGSAKTVTITEHSCPVTAVITQAKSTA
FT                   PIPSTKTAVEKSPARETVESAGETSTPDSESDLPTSPTIVSPVGSSRTVTSSHSVSIFE
FT                   GEATTLKSFWRLILIIFTLVIHI"
FT   tRNA            590298..590371
FT                   /gene_name="tRNA Val (AAC)"
FT   CDS_pept        complement(592585..593181)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435495"
FT                   /gene_name="ALG13"
FT                   /locus_tag="CAGL0D06270g"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG13"
FT                   /EC_number="2.4.1.141"
FT                   /function="N-acetylglucosaminyldiphosphodolichol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /function="carbohydrate binding"
FT                   /biological_process="lipid glycosylation"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAG58589.1"
FT                   /db_xref="GO:0004577"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG298336"
FT                   /db_xref="HOGENOM:HBG629711"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI00003B61B2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVR6"
FT                   /transl_table=1
FT                   /translation="MSAFVTCGATVPFPALVEAVLAPEFVGCLSREGYRVLCVQFGRGY
FT                   DFEAQFTSVTCTRMPLESAEVSELRQLVRDERVTVMGYKVQDVVVLGFAYSNNILQIID
FT                   RYGDVVISHAGTGSILDSLRLNKKLIVVVNHTLMDNHQKQIAEKFQNLGHILATNPTAI
FT                   ELCDAMKRLKHEDLIPLSSETNTEFMERLKSIAYS"
FT   CDS_pept        593556..594758
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500583"
FT                   /locus_tag="CAGL0D06292g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58590.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI00003B61B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR5"
FT                   /transl_table=1
FT                   /translation="MISKGMVHESGIKPYFEHKIQETELKIRGKTENLRRLEAQRNALN
FT                   DEVRFIKDELRLLQEPGSYVGEVIKVVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQ
FT                   RVCLRSDSYMLHKVLVNKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKH
FT                   PELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRM
FT                   VRELFVMAREHAPSIIFMDEIDSIGSSRVEGGGSGGGDSEVQRTMLELLNQLDGFETSK
FT                   NIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIHSRKMNLTRGINLRK
FT                   IAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISEAKLF
FT                   K"
FT   CDS_pept        595855..598827
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435496"
FT                   /locus_tag="CAGL0D06314g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAG58591.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG124481"
FT                   /db_xref="HOGENOM:HBG204409"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="UniParc:UPI00003B61B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR4"
FT                   /transl_table=1
FT                   /translation="MQNENPEPSKEDNTNTSYTNGNDKVNNGGNNYNNYNNYNNRNSYH
FT                   SNNYSRNYQQRNTGGRYNNPNKFNNGGTRVNSKNVNQQNNYNNYNASGTNRYMNNYNKH
FT                   NRNQKGTPGINPAAAMQWAGYYGNQMYYFPQGMAAMGNPAGMDMAAMMAAQQGMMTSPQ
FT                   PGVTASETPSPPPIKIEITKKTGEHLDLDEIRAQHKAAAANKEKSPSASIENDVADKKE
FT                   SEKEGSSIVESKDEEKDKQEVNATKPEPEQKEDASEVRRLFLEQVKLRKAAIEKAKRGE
FT                   STEASEASDSTDKAVGNNEPSTDESDSNNKDAENSEDQDTFFDSKDTITEKDNELESGS
FT                   KDSSPRPLTFAEKLKLKKKQTEEHKEEDSNKEEHEQVNIDTTENSGDNNQHVNEVELES
FT                   KEKNESDVPIIKKVTLEEPIKDTTETVEGVTNDEENVTGPLAKQPADILTMTEFLAKLK
FT                   EVEPVDDIYTFTYPPEFEEPDPKYKKQTVKYTYGPSFLLQFKEKARAFPDDPWQLSTAA
FT                   KIVIPPSISKSKSRDSNRFNNGPSGRMGEFRNGSMRNMDMRSGSKVSSKRKSKRMDDRK
FT                   STRTSYTSRKDRERMAEENRRDEPKVEVAPLVPSANRWVPKSKQKKETEKKLAPDGTEL
FT                   LDKEEIERKMKSLLNKLTLEKFEPISNDILAMGNQSKWETEGETLKLVIEQIFLKACDE
FT                   PHWSSMYAQLCGKIVKELDASIYDNTNEGKTGPKLVLHYLVARCHTEFEKGWTDKLPTK
FT                   EDGSPLEPEMMSDEYYQAAAAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMRDLTG
FT                   NPSEEILESVVELLETVGEQFETDSFRTANATLEGSALLDSLFQILQSIINEGKISSRI
FT                   KFKLIDVKELRELKHWNSSKKDAGPKTIQQIHEEEERQRMLKSNSRQSSRRVNNNSMGN
FT                   HNNRDRGFYRRENTMNSRDNFQSTRSPSTRYNSKDTKEDQAPAPKTTNMFSALMDTDEE
FT                   E"
FT   CDS_pept        complement(599074..599883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435497"
FT                   /locus_tag="CAGL0D06336g"
FT                   /product="Similar to uniprot|P53177 Saccharomyces
FT                   cerevisiae YGL050w"
FT                   /protein_id="CAG58592.1"
FT                   /db_xref="HOGENOM:HBG247204"
FT                   /db_xref="HOGENOM:HBG397922"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="UniParc:UPI00003B61B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR3"
FT                   /transl_table=1
FT                   /translation="MSKQNAFDQKKLAILQEINSDQLDLSPKGTIDVLCLPIIDLINSS
FT                   PDMVTTSSCSGRISVFIEGQKAINGDVKVGGKGDGGVWLFVSHEFKDIDNWFDRTTASK
FT                   NLNWVIDASNTKDINDDGSSSMILYKYEPFILHVKCRDFESASKLYNTAMACGFRESGI
FT                   GSNFIVAIRINIKLDVPIGYVKENGHLALIVDPSYITVLDRITKAKFIENEKKMTVLFA
FT                   KIKSEIVESPKDVNTQVKEETKEERRERKRREGLEKQRLLQQKQIGK"
FT   tRNA            complement(600222..600293)
FT                   /gene_name="tRNA Arg (TCT)"
FT   CDS_pept        601040..602083
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348408"
FT                   /locus_tag="CAGL0D06380g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58593.1"
FT                   /db_xref="HOGENOM:HBG124444"
FT                   /db_xref="UniParc:UPI00003B61B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR2"
FT                   /transl_table=1
FT                   /translation="MKVSNINSVLFLASQLASAAGGEIVTVTETSTVCSTKTLTVPMTV
FT                   TVTPKPAPPVRPSKVAKLANEMNFIFNMAGAIKSCLPDSGITVPPSWARVQCTFYVFNL
FT                   MLSLTINIIGGKDHHEFWKKRQQQWREWEEKYWQEAGDGEDEGDCSDEEESSTDPHGNA
FT                   VATNDNALLSFKTTKMLMDKLGVQVYPYMNETTLQECVHYKFVKDRYKDLLGQDLVEGT
FT                   VCLSQHGLATFVKLPDNSAEDTEDGKDSGTGATGGELLDYQSFMNKLRPQMYVKKFDKY
FT                   LHNIKQAKFMTTWQLINFKQYSKDIMRELAYVTDQLRDPDHKHISFELKNKEDPADLTP
FT                   MMSFNIL"
FT   CDS_pept        602973..604301
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195162"
FT                   /locus_tag="CAGL0D06402g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG58594.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B61B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR1"
FT                   /transl_table=1
FT                   /translation="MPSHFDTLQLHAGQENPDDNNHRPRAVPIYSTTSFVFNDSQHGAQ
FT                   LFGLEVPGYIYSRFQNPTNNVLEERIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNI
FT                   VSTSFLYGGTYNQFKVAFKRLGIEARFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNV
FT                   PDFENIVAVAHKHGIPVVVDNTFGAGGFFCQPIKYGADIVTHSATKWIGGHGTTIGGII
FT                   VDSGKFPWKDYPEKFPQFSKPAEGYHGTVYNETYGNLAYIVHVRTELLRDLGPGMSPFA
FT                   AFLLLQGVETLSLRGERHGQNALALAKWLEKNPHVAWVSYPGLPSHSHHENAKKYLSNG
FT                   FGGVLSFGVKDLPNADKETDPFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQ
FT                   LSDPEKLASGVTKDLIRVSVGTEFIDDIIADFEQSFAKVYGSN"
FT   CDS_pept        complement(605107..607440)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044039"
FT                   /locus_tag="CAGL0D06424g"
FT                   /product="Similar to uniprot|P19414 Saccharomyces
FT                   cerevisiae YLR304c ACO1 aconitate hydratase "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG58595.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG025113"
FT                   /db_xref="HOGENOM:HBG295973"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00003B61B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVR0"
FT                   /transl_table=1
FT                   /translation="MLSARTVVRNTGVRRLATVSNLTRDSKVNQNLLEDHSFINYKQNI
FT                   EYVDIVRKRLGRPLTYAEKILYGHLDDPHGQQIERGVSYLKLRPDRVACQDATAQMAIL
FT                   QFMSAGLPEVARPVTVHCDHLIQAQIGGEKDLKRAVDLNKEVYDFLASASAKYNIGFWK
FT                   PGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGLPWELKA
FT                   PKILGVKLTGRMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGEGVDTFSATGMGTICN
FT                   MGAEIGATTSVFPFNKSMIDYLKATRRDKIAEFAQLYHKDLLSADQGAEYDEVIEIDLN
FT                   TLEPYVNGPFTPDLATPISKMKEVAVENNWPLEVKVGLIGSCTNSSYEDMSRSASIIKD
FT                   AASHGLKAKSIFTVTPGSEQIRATIERDGQLETFKEFGGIVLANACGPCIGQWDRQDIK
FT                   KGDKNTIVSSYNRNFTSRNDGNPQTHAFVASPEIVTAFAIAGDLRFNPLTDKLKDKDGN
FT                   EFKLKEPFGNGLPERGYDPGENTYQAPPKDRNAVDVKVAPTSDRLQVLKPFKPWDGKDA
FT                   LNMPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANSVRNVYTG
FT                   EYKGVPDTARDYRDEGIKWVVIGDENFGEGSSREHAALEPRFLGGFAIITKSFARIHET
FT                   NLKKQGLLPLNFKNPADYDKINPDDKIDILGLTELAPGKNVTMRVHPKNGEAWDCELTH
FT                   TFNSEQIEWFKYGSALNKIKADKA"
FT   CDS_pept        complement(608505..614213)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044040"
FT                   /locus_tag="CAGL0D06446g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="binding"
FT                   /function="inositol or phosphatidylinositol kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="phosphatidylinositol phosphorylation "
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /protein_id="CAG58596.1"
FT                   /db_xref="GO:0004428"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0046854"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG058678"
FT                   /db_xref="HOGENOM:HBG325491"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI00003B61B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ9"
FT                   /transl_table=1
FT                   /translation="MAIATRTLRGEALKKLAQCVGSSNVHTDTTKNDMNDADDTLEMII
FT                   KALPIYYSTSPAKLYTIPLNMNEWEIIVGICASVPDSLSRTLEILENTVAPYFLHSPRQ
FT                   RISDLMYSKFRMRSLKNPNELCTFELTRFLIRSARKFPEVVPVVEKLFAQFVASVTEVI
FT                   FDNNTCLFSLLGFLNAFILEETPLKLSYIVWDLVSNFFINQNFFKDLDNVLSSNNGFDK
FT                   SLLIQYFDAGAEISSVKFWELLSSMQVKILRTMLEVPESYELVSEYLLDLQYQHFKDMH
FT                   KPVSERKESAKFEKFKRLLRDNHKMLLSLCQFSLSAYEAKEYYDLSNETRSNYTFGTDA
FT                   YLLQMLSVIPFLDFEANRERFMDVVVMMVSSGLEKNLLFEESIPFLIKTLISVSSILNY
FT                   FVKEVSLIQLRFFPILIASQHISMDIIANVTRNFSMGLKPLSEDAIVSTIYSINNLLAL
FT                   TEDGLIMPIIKERKQTITSSSDREVLNQPSAHILEGFDLKATTASIHPVKSSVQDLTGT
FT                   PATYHRMLFRNCVTAITRIASHYNTQSITALTISVLSQKVNVVSKELDDIILQSMAKLA
FT                   PYIGVNEFTLFLKFLKLTENAAIKQNNEALFNCLIRSKITLSAVLLEKSFNTDHYKFYL
FT                   HDLLESITSSGDVERSDHHRTQSEITRVADQIVIYLKPLAALLPPISQKPLDLSTDAKT
FT                   TTMFRNIWFNMVIHGFYFESDIVKINYNQLQRIAINSPPLTSDFPSNNKELSIDLNSIL
FT                   RRSSSSANIKQQRQSISEYLNSNIVQARTVSTPKVMFLAAAKLLETIRCEVGDCSKLVQ
FT                   YLSDPAMTSSSVENCISFMTIAMIKKYAEIAKRETTEQFNSTRIADQLNNLLLCLAHRD
FT                   ENLQNIAFQACDLFIKSIPSSLLHHHSLYTLLDLLTTLFDSIEDCERTKFDPNYEFLLK
FT                   YSQVRVLLPGSIYWRKETLARLHKSARTWLLIILETANQNSKILLNTYISGVAQFYRSN
FT                   TIEYGVSFAIEMAGSILNADRELSKMSFGGFQRPNAVAGFISQQSWRSKFLADTSISFT
FT                   PEVFADEIQKQADDIRVKVQAKRFVSGQEVSDLLDFCAALLIIGNYNGKSVLYNLVRIP
FT                   FEVFTSFSMKSATNIWLTVITERPDLAHVILSDVILCWKESIISKKGLFDREHDLLPED
FT                   YQMMEYAPYDKVKIDRDARIASSTFEPHRHIIKFFSSHFAGTQHQSDHLLNLFTTCFIY
FT                   GVQEFSKASLHPFARLIRNEYLLFGISILRANVRRNTNTVSSLCRLIINAGLEWFRKPF
FT                   SWPFGSNELKIRADLSILSDVYKATDSLSSVFSEHSGKSFKLFEYFIAHEIQQIQVWLT
FT                   PLDKIQGANSNDLPLNMLQTAFDINPDLALNIAQRYQSKKLDQALVDMIIKEPLKSVTT
FT                   ASALSLYLDERRLNKNSDLHHILYWVPVAPLKAINLFLPNWNQNEFILQYSIFALESHD
FT                   VNLTFFYVPQIVQCLRYDKTGYVERLIMETAKISMLFSHQIIWNMLANCYKDDEGIIED
FT                   DIKPILDRVRTHMVSEFDQPALELYQKEFSFFNEVTGISGKLKPYIKKTKAEKKKKIDE
FT                   EMSKVVVKPGVYLPSNPDGIVIDIDRKSGKPLQSHAKAPFMATFKIKKELQDSKTGDRI
FT                   TVENWQAAIFKVGDDCRQDVLALQLISVFKTIWSSIGLDVYVYPNRVTATAPGCGVIDV
FT                   LPNSISRDMLGREAVNGLYEYFVSKFGHENTIEFQKARTNFVKSLAGYSVISYLLQFKD
FT                   RHNGNIMYDGDGHCLHIDFGFIFDIVPGGVKFEAVPFKLTKEMVRVMGGSQNTQAYQDF
FT                   EELCIKAYLAARPHMDMILSCVEPMLGSGLPCFKGSKTMRNLENRFQPHRTDQEAANYM
FT                   KQLINKSYESVFTKGYDEFQRITNGIPY"
FT   CDS_pept        615364..615927
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233456" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500584"
FT                   /gene_name="UBC12"
FT                   /locus_tag="CAGL0D06468g"
FT                   /product="NEDD8-conjugating enzyme UBC12 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ATP binding"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG58597.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015580"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B61BA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVQ8"
FT                   /transl_table=1
FT                   /translation="MLKLRQLQQQKQQQLAKNAGSSVKANTNSTSPAKLRLQKDIEELE
FT                   LPPTVRVNIISLDNHKEMSLNIIIIPDEGFYKGGKFRFTATFLETYPIDPPKVICNNKI
FT                   FHPNIDPHGKICLNILREDWSPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKL
FT                   EFGNLVRLAMSGAMVGSTYYECVI"
FT   CDS_pept        616117..617181
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435498"
FT                   /locus_tag="CAGL0D06490g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG58598.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG058675"
FT                   /db_xref="HOGENOM:HBG397914"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI00003B61BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ7"
FT                   /transl_table=1
FT                   /translation="MCAKNMLCSYLLCNFSFGFHLCLRHAAYTSTVVFHVKIKLYSFHA
FT                   MLINKMRELLVYKLLVLTTISNLTKIVTAYSVLNKMNTELEQQFSKAPFPEWLAQFTQL
FT                   QDWPGMDPPYIPLDFIDFSKIPEATHYNQLQCETVPRDICSFDCHKCVATDDILSCDSL
FT                   TQTFDDGPTPATTDLLGNLNHKATFFTLGINIINYPQIYKAIIQRGHDVASHTWSHAHL
FT                   PSLSNEKIIAQLQWSIWAMNATGNHIPRYFRPPFGGMDNRVRAIARQFGLQAVLWDRDS
FT                   FDWQLLTPNPKTEEDILKDVCLWKKHDGRGIILEHDTTKQTTDLAIKIERIIGLSQKTV
FT                   AQCVGGSNYIRQFQ"
FT   CDS_pept        complement(617453..621379)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435499"
FT                   /locus_tag="CAGL0D06512g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58599.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG124445"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniParc:UPI00003B61BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ6"
FT                   /transl_table=1
FT                   /translation="MNTPNTPKPEVGFKPIDIVRAISDYYIHDEIKDHNKLTFFKGDII
FT                   YIVTKLDSGWWDGVLVEDNLVYTSRGSKTGSVVRGWLPSSYVRSLILTTDTANKPGSIY
FT                   SGTEVVPEIITPDISVLNNTEKLRNSITSMINEAPKAAKLKPDPECYDDATSYYIPADR
FT                   NLFYLNDSDIVTWNQLFVVLNHYLDKTKECFTKSYDEVSHISEKRKSYRPEFRYNYTLL
FT                   GAYVTYLIQACEILKESTPPETIDPVKKHKVIKLLSEDLIHCLGVISESAHVWYNHSYY
FT                   TSYSRSSHQQGNYSTNDTDIDKTLIISRCYDVALESFDKIHDQFNILFDMLNEFSVRHK
FT                   SFIIPQLFPRFMRLSFNGGSWSNPFLLPPNKLASQNPISSYYPPAIENVLGRTSGYHRN
FT                   KRRNSVLSSPFSGTNSLGSSRNSSSGNLSAAGQQRSSAGSFSTTSKHTDKPSRKSTGLF
FT                   AQYLHANKNYPVVNPSNINACKDKFKNYDNKIGKFPLSRDTLELLEKRKGQIHVSFSEF
FT                   NELDKNEEEDIPVKPSSIETMTSTAPSRSKVIQSLEANFRTYKEINTTVLIINILENLD
FT                   LTMFTKMRHIVVNGGIYGWEFEKYQDLMRHTLVSVAYSVEEFYKIKQTFHDIAMRLIMC
FT                   SQHTTLEDPYVFSTMKSNYPVGALDPISIDTLTICSKADISAYGSYLLKKEDIIRKSLY
FT                   ERLLREDAEFNYDTYYSVCADFRDARQKYVEMADAACAVVSKLVEERDKILNYAARTMQ
FT                   SELVAKLLEDEEINEYIEEEDSYYKNESNVVVCPDDKIEFVPWYLQPNYTAEVIFDSKG
FT                   RMKGANKRDLFEYLFQSSSLDMPFAITMLITFRTIFTSTEFIVNIIERFEEAPPENLSY
FT                   EEYNDWIEKKYLPNKERVIYLLWKLFTFFWNERYMDFPVALLENCIKTAQRENIAYANE
FT                   LYTSLNEIKANNQTSEYSYWSLLEPSTEILEYNNDLKRIGFSNLVHDAKFTANVYESIL
FT                   DIPAENVAQQLALIEENLYEKITIFDCLDRVWGCKQCDFGGSKNISEFISFANSITKYV
FT                   SYKILQYDTAAKRGQAIGYFIKVARISYEINNFSSMTAIISGIYASPVNRLHESWKLVS
FT                   RELQNTLRELDDLMISTKNFLKYRLTLKNVGNRPCIPFFGVYLSDLLFTHNGNPDYVDK
FT                   SRGTVNFTKRFRIFDIIQEIFHYKKVKYEYKADLDIIHHIMNVAENVPDVENQYHLSLQ
FT                   LEPRSKSTSTSSSGDTATIVDVKKEEESQQTPKKGIRKHFHMKSKNPENKVLVNKGKEK
FT                   SRKKSSGFRFFGSRKSRSISTDAS"
FT   CDS_pept        complement(622178..622492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500585"
FT                   /locus_tag="CAGL0D06534g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58600.1"
FT                   /db_xref="HOGENOM:HBG124446"
FT                   /db_xref="UniParc:UPI00003B61BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ5"
FT                   /transl_table=1
FT                   /translation="MVLCSFLLQVFSCHVVNTRVKGIFQSFCGTDSYVQQPDLSFPTAQ
FT                   PTRLALPPQTTSVATHYQPASSLHLPAFDHSVPPCAGTSPPPLKSSEQTRTHLDAQKSI
FT                   "
FT   CDS_pept        623770..625431
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195163"
FT                   /locus_tag="CAGL0D06556g"
FT                   /product="Similar to uniprot|P04802 Saccharomyces
FT                   cerevisiae YLL018c DPS1"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58601.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI00003B61BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ4"
FT                   /transl_table=1
FT                   /translation="MSAEEAKAASPEAPKEVILGEDGQPLSKKALKKLQKEQEKQKRKQ
FT                   ERAAQLEAEQKEREQAKANEVDHSAENYGPAPFVQSQFRTGEKRVKFEDLSKEDADKEV
FT                   LFRARVHNTRQQGATLAFLTLRQQSSLIQALVKADKAGEKISKNMVKWAGSLNLESIVL
FT                   VRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGLPVV
FT                   NLDTRLDNRVIDLRTVTNQAIFRIQHGVCALFREFLANKKFVEVHTPKMLGAASEGGAN
FT                   VFEVTYFKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGLDME
FT                   MAFEEHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYPVEEFKLPKDGKMVRITYK
FT                   EGIQMLKEAGKDIGDFEDLSTENEKFLGKLVREKYDTDFYILDKFPLEIRPFYTMPDPE
FT                   DPRYSNSYDFFMRGEEILSGAQRIHDHKMLMERMKVHGLDPEDPGLKDYCDGFSYGCPP
FT                   HAGGGIGLERVVMFFLDLKNIRRASLFPRDPKRLRP"
FT   CDS_pept        625655..625915
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435500"
FT                   /gene_name="COX19"
FT                   /locus_tag="CAGL0D06578g"
FT                   /product="Cytochrome c oxidase assembly protein COX19 "
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="CAG58602.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="HOGENOM:HBG203264"
FT                   /db_xref="HOGENOM:HBG756691"
FT                   /db_xref="UniParc:UPI00003B61BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVQ3"
FT                   /transl_table=1
FT                   /translation="MSSGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLA
FT                   ANENAHNCRLLAKDYLKCRMDHQLMDKDEWKNLGLPPDDKQ"
FT   CDS_pept        626571..628748
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435501"
FT                   /locus_tag="CAGL0D06600g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58603.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058670"
FT                   /db_xref="HOGENOM:HBG202569"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B61C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ2"
FT                   /transl_table=1
FT                   /translation="MLGFKRKRTNTNNNNNNTMNFAPDLLDDLMLDDRYLDENAILDDY
FT                   DTAEAALDPVRYKKQRTVSLPQLPHSRLSYSYFVNTLDGSNSAAMTHATANLSSANMGT
FT                   ANQGLPHQALGSAYTHHRYPADDNDMSSLLDASLYMGQNAHAALAQPALKSGNWVTPPA
FT                   RIQNDDELLHLTGSSSKTLEGNRSVQLKVAHSVSPFTNENSTGAASGISAGFKNSFKRL
FT                   LSHEQQPYDDNIPRRSSIASRRRSSVKRVQDAQGSLPNMNYFQTDKDGHYIYQENDVFG
FT                   SNGQFVVKELLGQGTFGKVLKCVDTYSPNNKFVAVKVIRAVDRYREAAKTELRVLSTIL
FT                   ENDPVGQFQCLLLRDCFDYKNHICLVTDLYGRSVYDFMCSNGVARFPGSHIQAIARQLI
FT                   RSVCFLHDMGIIHTDLKPENILLVDESYVEYDLPQNVIDSMSNRRRAASQGKRKILTNP
FT                   EIKIIDFGSAVFHKEYHPPVISTRHYRAPEIVLGLGWSFPCDVWSIACVLVELVIGESL
FT                   YPIHENLEHMAMMQRINGTPFPTKLIDKMFYKVRHKLGNLPSDLNTTVVRHFNRQSLTL
FT                   QWPEKNKRGEIVTTEKSMKRVMESCDRLDVYISRVLKQDYGERLSINWNLSPDKNWSLV
FT                   SSKLLWRGHQHYDGNIYEGSHMFPPQHKLDKDSFLFWYWFVDLCRKMFEFDPTKRITAR
FT                   KALDHEWFNLGIFDEGITNFANPRANYRNSI"
FT   CDS_pept        complement(629323..632859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435502"
FT                   /locus_tag="CAGL0D06622g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58604.1"
FT                   /db_xref="HOGENOM:HBG124447"
FT                   /db_xref="InterPro:IPR013724"
FT                   /db_xref="UniParc:UPI00003B61C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ1"
FT                   /transl_table=1
FT                   /translation="MSELTQSQLEDIKGYFVALKTFFNATNSNKDRSSSSRAQKARAKL
FT                   LKLSPSQFYELSTDVSDELNRRINEDQDQPEYLLPKTNFHVKRNQARQKLAKLSQTRFN
FT                   DLIDDILFEIYRRDYHNGSTKKPDGFDNFGNEKQSTKSEMPFDPKDDTVDNYNRVDDNG
FT                   DNTVNRHSNTDENSSSNNETTTSTTVQPIVVIPKKASIDWSSEEEDNNENLDGITKQVK
FT                   PITETDDVTSNTKNESTNLSDLIEKTFNNAEAVQEEEEEAHNKMSTRSTDNDDFNLNDT
FT                   PVTKNSNEEKNNLASKLFEFDQPQDVYSSTNDFSSLYRSAEDISDVKEGDQSLELGNGD
FT                   DSSNHIEHRYQKDFIQLNSQIRDLSIENEQLKQRISELELEMKSPTKSVKRETYLPPVD
FT                   TKKTLKNLMEDNLLNDSDNLQKFFDPNGYISFEHVDTVRKNVNLIYSTIYANYKSEQEH
FT                   FDVQGKTLFKYLAYISDAISRVLSELQLPEFHDQNVIVKAAVSHAITTLRYYTTYGPLI
FT                   PVVTLQASITEILFSFCTLIKSAKIKYDGKEIARLNSDNTNNMAKSESTKLPTFPSTPV
FT                   VDEKQKMTPFFQKPGELDSFLDQNEESPVKPLKITQKAINSPKLTPASTSRKPSGTGLF
FT                   SLKIESKSVDTLSRWKEENNGPDLTPSKISRDVKESGHLEIKTPSKDVTKDIDNNPKTS
FT                   NPASSVDPNIAGKSIPVVELKNQTDSNKTNDNTFQLQAEPAPISTNKKSEVEPVIDTVQ
FT                   SSRVATEPTSSMNNLKPDPSSTELTEPSIEKPSPPKGLSLMGSFTKSSLRKVDLSGEQN
FT                   KRDTDISKDQHPIELKKFESTSAKESSLAPKSDSESHSRSSFEGDDSVQYEPLTKSQGT
FT                   ANNSGLKDDIRAGPNTMEGITSHETKNLMAVDSIKKNVDIKKPDEPTKTIEDIKKDNVK
FT                   KVSSITTADTLNSVIESPQQNTIHTSKNAETKTDSEEEDGNDNEAGDEDEDDDEEDDED
FT                   EDDEDEDDEEDEDEDEDANENASDINFDIDAFDIENPDNTLSELLLYLEHQTMQVISTI
FT                   QSLLTSIKEPQATKGNLRSESNAINEVIGQMVDATSISMNQSRNANLKEHGSWVVQSLQ
FT                   DCAMRLTVLCKLNKNGTLIHEDNDGDYADKNFKQRLAGIAFDVAKCTKELVKTVEEASL
FT                   KEEIDYLNARLK"
FT   CDS_pept        634224..636926
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435503"
FT                   /locus_tag="CAGL0D06644g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /protein_id="CAG58605.1"
FT                   /db_xref="HOGENOM:HBG124448"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI00003B61C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVQ0"
FT                   /transl_table=1
FT                   /translation="MNNTDTSLLGNMLLPRGNGTKAYVTNNEFSDSKFMSQLKEEDEIE
FT                   DTGIDDGLNSNSSNSDSVQRGNQMENENENSVMYATVQQRSKKYNSSNDDIPQFRAFLG
FT                   NPNDQQNHNNTHVTMDLTSSNINNDIEIRKELPNELVVTQALDDISGYLNTNTFKRHDK
FT                   QNIGKDKRVEEHSNISAHYNDTDPALEAVNIFQNVLKNQKSNYAFNERIVSNPTVSDSS
FT                   YSDDLSASRLTRSNGINADHVNISRQEVTSANKPLGGKKQSRPESEYHPSDRNNSSSES
FT                   LSNMSTSSQTPPTSAENYTNVTTSRKPKPQQISELPLITPESIGLIFNQENGVWQEPDS
FT                   HNHDITNSHTVENTTSNSTTQNTEDSSIHIDTHLAENSNEDIRVHRRRINSRILQRDDQ
FT                   SLQIRGPVKPKFQNIHEEDEADYLSDDTPLDPPKINKKFLRKHSDYLQEGILTGDRKIY
FT                   QDVDYRETQFTEEENIKFNENLERLTSSQEGGIAKRSSSPLHHPGDLSYRQNKTDLVSV
FT                   LTDKLKDISDWEAVKEIVLSEENLPSVVGLNAFLPNLKHFEICNSRLSTLEGTPEGVVE
FT                   LFASKNCLSSTHILSTKFNHLEVIDISFNTISSLYHCFDGLLHLRKIIAHHNNISSIAG
FT                   LYDIPRLQCLDLSHNSFEGVIDFSMLQDLTGEYPSWMNSLKFLDFSNNPISDMRRINHL
FT                   TALESLDITNTNIKELECQNTYSSTNLTSIYFDAKLSIERCLFNNSFSSVIKLIVSGTP
FT                   NFQLSDIPKHIQRLAIRGESKDQLDNSKLSEFMGYIDGQSYDIKTTDKIYHGNDSNPLL
FT                   VHLEITGHLKLNKLPVTLQQKLPFLKTLNLDSNALDSAYNIIESIPTTYIQDLYLTNNS
FT                   LCSPFSSLSSSKLEEALRIACPNIKEVLI"
FT   CDS_pept        638537..638737
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435504"
FT                   /locus_tag="CAGL0D06666g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58606.1"
FT                   /db_xref="HOGENOM:HBG124449"
FT                   /db_xref="UniParc:UPI00003B61C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP9"
FT                   /transl_table=1
FT                   /translation="MKMYKLALIIKQQISAIADVWHDKLHAYKVKCTPFRGFLRLWMLQ
FT                   QKRPPLAVVPHLLKFTPSIML"
FT   CDS_pept        639883..641457
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348409"
FT                   /locus_tag="CAGL0D06688g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58607.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B61C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP8"
FT                   /transl_table=1
FT                   /translation="MFRSTTSNVLTRALRTRNAGVSSVMVLRAYSHLPLHVPIKLPNGL
FT                   EYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESAVQAADTAFKNG
FT                   SWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAINSARGDVQLVINYLKSSAG
FT                   VADKIDGRLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKT
FT                   AESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKKIAFTGSTATGKH
FT                   IYSSAAQTLKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGEVCCAGSRVYVEE
FT                   SIYDEFAQEFKTASEALKVGNPFDESTFQGAQTSQMQLDKILSYVEIGKKEGATLITGG
FT                   ERIGEKGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDHVVQMANDSEYGLAAG
FT                   IHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGREMSKEALDGYLQAK
FT                   AVRVKLD"
FT   CDS_pept        complement(641982..643127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435505"
FT                   /locus_tag="CAGL0D06710g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58608.1"
FT                   /db_xref="HOGENOM:HBG124450"
FT                   /db_xref="UniParc:UPI00003B61C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP7"
FT                   /transl_table=1
FT                   /translation="MKSHALTGYLIRQLAYAINRSVTSSNSRVNISKIFLLSLILLTIY
FT                   PVLGSNVSAFDLCETTAKSKSDIFSIGTLAQRDMGIEFLKDKVNQPNIRELINNVLHYD
FT                   VDLDLEMRIFFESIDLESIDYNVNHISVRWLSKRQCYILYSVLSIYRRNEQPNDFRHDI
FT                   VIGRLFDEGWNELHGRIITHTDVGLPENFKSRLELLYREFNLSELCFWRDDGNQINLEN
FT                   DVNECILKLRNLDPSRSEELNTLISDVFIAFPNIIKPMTLSYWGKNYIDQMMFLIAKKK
FT                   DEPILVYSERPDSANSNKRFFLAMPFHKRFTTLELFIPKMFANIIDDNWKIKLPEIIEN
FT                   NFQDDFLLDTNAFLFDINGKSEHKLFCQPELALCNSDLHLD"
XX
SQ   Sequence 651701 BP; 199617 A; 127239 C; 127527 G; 197318 T; 0 other;
     ttattcaaag gtatagattg atattgttat agctcttatt ctctttcata tgtcatttgg        60
     atcttgtatt atctagtact ttgaatccta tttatagtgg agccttagat atatatggac       120
     atatcatata ctctacaaat gtcttttcat gaatgtagat atacggcatg aaatatgtac       180
     agtgaacttt ttaatctatc tacatgatat tcaggactca ttgtggtgca cattatcatg       240
     ttcatgatag ctcaccttag agttatcacc aaaaatcctc tcctcattac caaaatatat       300
     atttctggaa ccctacacag ccctaattaa ccctaactgt aacaactata aaccctactt       360
     acccagacaa atgaatgaaa cacaaaccct aatatagccc taagagtttt accataccct       420
     atgtaaccct aaaaaagatg aaaatctgtt ctccaaagat gtttttgtct cgaacaaaaa       480
     tgctcttcac agaaaagtaa cagtctggta aaagtactgc acagatattt tcgtattcat       540
     aagcaataaa ttcacacatg atattgaatt gatgtgtgtt gtgttgtgga ggaattcatt       600
     gtttcaggaa tatatatggg aatcctacca agtcataata actacatcat gatagcaacg       660
     tcatctcatg atcattgtga agtaaatgtt gataaagtaa atactggtga caagtgatca       720
     aggcatatat gggaaagtca agaaaacctc ataaaataga ctggattgtt catttcatcc       780
     tcctgcatag tattcaacca atgatatatt acagtagaaa aagtcttgag tatttcaaag       840
     gtttccactc ttacaagatt acagtaatac attactattt taatatatag atagttttat       900
     cccatctcaa tgtgaacctt gtatgtctaa ctcccaccat caatcctatc aatgaatctt       960
     ggtcagagtt cagattcatt cagatgaact gcaacatttc aggaagaact gttgttctag      1020
     aacagagtgg ttgttctact tcaacaacgc ctcgttgaac acaacatctc gcgtttttcg      1080
     caactctcaa cggggctggg taaatcaaat tgctttgtcg actgtctcgt agaatgcaag      1140
     gtctcgcgtt tttcgcaact tagatatctg gacttgcagg ctcagcttgg cctactaccc      1200
     ggaacaaagt acgtgacagt ggcatgctac tgtgattcca ccatctcaca aaaggtcttc      1260
     tgtaggaggg taggtaaatg aggagataga taattataca tggtataaat taaaagcatt      1320
     aatgttcaag gttgaacata cttaatcaac atgttttact tttgaatttc cgtccgtaaa      1380
     cttgataggt gtggaaacac acagctttac ctaaaacatt tgcaaaacag tcgtggtttc      1440
     cgtatatcaa ctactttaag agagttagca aaagatataa gtaagtggca tccttttgat      1500
     gtataaattg agatgtttaa ccatatttta acagcgaaac taaagaataa ctctattgta      1560
     caacccttct cagacacgac attaatacct taccaggtta gtaattattc cattcagaac      1620
     aattcacact tatagctact gttcgataat acatgcctca tgccaatcag ctgtcctcag      1680
     ttgcacggag atcaggttag gttatctata tgaaatatgc cgtgtagttt actttactca      1740
     tataatacag actcaatgca tgcaatctcc gtagaataat gtacaatgtt tggattgaaa      1800
     ttcacatcaa aatccttgag caaaacaata tactatgtct ggaatcacaa ctctcaattc      1860
     atcgacaatg tactctcgaa ctcaaataag aaactttcta atatccacat atgaatagta      1920
     tcacgacctg taaattcatt gtacaagtct ttcaaaacta ttattggttt atattaagcc      1980
     atgtgtgcgt aagagaataa tacctatagc tcacacactg taaactaaat acctccactc      2040
     tcttcgattc gatttaacaa ttgtggtaag tattgaatga tgcaatcttg aacaactgca      2100
     gagtactgtg gacttcgaat ctgtatcaat tgttcggtag aaccaactat aaatacaacc      2160
     tttatgatgc cagttcttat taaatataga gtttgtcaag ttgccctagc gataatgagc      2220
     taatttgttt gtatatactg gccatcttaa tgaatatcaa catgctatga aatagttgaa      2280
     caacaagatc ggcatccatt attgggatgt atggttgtat attttaatgt gactgatttg      2340
     tttagagtaa cttgaataaa tatgatgaac caatttgacc accgaacctt gatagagaca      2400
     tatcattgat caaaatgatt gttttaaaac atatctttta gtatggggat tattaattgg      2460
     acacctataa atacacttct taatattata gtattgatat gggtgaggca agaaggtgta      2520
     ttaaataaat tacatgtttt ggtaacgtca atgaaactta aagtgtcacc cagttgtgtt      2580
     tcgataactt tagggaactt caacacctac gagaaatgcc aacatattta aaaatattcc      2640
     ctctcgtaca attatacata ctctcactca catgattacc gtcactgctc acatctcgcg      2700
     tttttcgcaa cttgtcagtt ttcatttaaa cagaggccca tgttcggcag cagtggtcca      2760
     gaaacacatg aaaaacatat tatcaaagag aaaatatcta ttattataac aaatacataa      2820
     atataaaaac tccttaaaaa atatattcaa attctaactg gattacaata aacccagcag      2880
     agtaaatgaa tgttgcagca taacgaacta gataattagg ggatctctcc aactttatat      2940
     gaccttaaga ctataatagc attgccattg ctttccccca atagtagtgt gattaattaa      3000
     taaaacaaac atcatgtaaa gttatatcca tgattcaacg aacgtgcatt tagcacaatt      3060
     attatcttaa ttcagataat agtcggctta agccatgcct aacagaatca agatagtcaa      3120
     tgatgtggat agtagaatgg tattaaattt gatcttgaat gtagaacctg caccatggaa      3180
     gatggaggca gtttgggtct gggacacctt attgccactt tcaacagcag aagctcctgt      3240
     aggagcaaac atctccaaag agctaccttg gtctgtcgaa taaccggcat tagatgtggt      3300
     gccttgactt agagcaactt ctgtaacgct agttgggtta ggcttgtcat tgacagtctt      3360
     agcactaaca ccgttttcag aaccaacaag tgaggtggta tgcatgcttg gtgaagttgt      3420
     ttggttctca acgtgggatt ccgaattaga gcatggtgca gtagtggtta tagtagttgg      3480
     cttgccgttg gagtcggtgg tggtgatgtg ggacacaact tcggtctcaa cactgcccgt      3540
     gtgtgacttg cgtgacaact gtggtgtagt cctgcgttgc tggagcatga cagtggcatg      3600
     gaacagtggg tgacaacagt tgtaggcttg ccattggagt ccggtagtgg cgatgtgaga      3660
     cacaacttcg gtctcaacac tgccgttgga cttcgtgaca actgtagtgt agtcaccatt      3720
     accattgttt tcagtacatg gagcagttgt agttatggtt acaacctggc cgttggagtc      3780
     ggtggtggtg atgtgggaaa caacttcggt ctcaaaactg ccgttggact tcctgacaac      3840
     tgtggtgtag tctgcgttgc ttgagcatac agtgcatgga acagtggtta cgatggtggt      3900
     aggcttgccg tcggagtcgg tggtggtgat gtgagacaca actgtcggtc tggacactgc      3960
     cgtcagcgtt cgtgaccaca gtggttctgt ccttaccgtc gtcgaaagca gatgaggtca      4020
     tgttgttgga attcatattt gatggctgag atgagataga agtaggatta ctcattgtgt      4080
     tattagctgt ttcgactgta gtgattgttg attctctacc atcactaaat gtcgtagtta      4140
     ttgttgtggt aactacagaa ggttgcgttg gtctcactat tatagttgta taataagtta      4200
     ctggtgaacc gttgacatca acagctacaa ctctactaac aatttcagtt tcagttgtag      4260
     tattatcgga tctggtgact gtatagacag gtggtggtgt ataaaacgtt gttgttccga      4320
     ttaatggcag gttatcgcta ttataagtag agtagaagga tattgtttca gagaatccta      4380
     attcatttgt agtctcataa gcatctggaa ctttaaatgt gtatagtgga atttcaacac      4440
     atggttgaca aattgaaggt tgtagcctgt ggtggacttc ctttgtaaat aaagaaacta      4500
     ttcttgtagt gattaccttg gatgtagtta tcaggaacaa tttcaaatag ggtctgatta      4560
     tagcccttac cgtattggaa ttgtaaaact ttgcaaaacc ttaaatattc ctaacagtaa      4620
     aggtatacaa taccagttta tataatcata attgaaactt ttgattggaa acaatggaaa      4680
     tagaaaacca ttaccgttac caaaaccaga aacgggcatg ttttgaccat tactaactgc      4740
     aacaaccgaa gtaggatctg acaagtaaat tgattgttgt tgcaaattga tatcatgaat      4800
     attaaatact gagttagcac caacagaaac acatccaaca ccttggatag acttctgtaa      4860
     atcgaatgta gtgttagcaa gacagatagt acccgtgttg taccagttat ttgcattatt      4920
     accaattttc aattgttgag gtctggctgc gttagtacct ttggagtaaa taataccggt      4980
     gttagtcaca gatgttgcag agatatcaaa agtatctcct tgactagaag tgaacatgat      5040
     gttaccagta tttgtgaaac taccatcatt aatcttccat gaaccagcag aggtactcaa      5100
     tctatcatca acaacaattg taccatcatt ttggaaaaca aaattgacaa accaattgtg      5160
     gttagaagaa atactaaaac ctttcaaatt gttattaata taataaagag cgcccccttg      5220
     attaactcta acagtctgaa acattgaaac agtattcata tcttgaaagg ctaagtatgc      5280
     acctcctaaa acaatataac cgttactgta tccagtagga ttatttccat acgtgatagt      5340
     gttgctttga ataacagctt gtgccataac attaccaata agtaacatca agctgactat      5400
     ccaagacaat ctaaacgaaa atggtggatt atctttcatc tcaaaaaacg atattgtgga      5460
     atacaaacta ataatctttg tatgtcaaag aaaattatcg atatatcaaa ctaccaaata      5520
     aaacaactgt tataagtagt tagttagtta ttccttgaag ttctttttct ttctgacttt      5580
     tagaaaatag tttgataatg aatatttcat aaagcaaaag aaaaatgcta aagttgggtt      5640
     ccttatatat gatggaatat tggtaacttt tgtgagttta taaaatgcaa attgaaaaaa      5700
     catggaaatt agttggtttc agatatggaa taattgcagc tcaatattga ttctataata      5760
     tgctcagttg gcatattcgt tttaatttgt accattagat gaaattaact tggattctca      5820
     aaactatcta tattggcagt agatatttga agagtccgta tttttcctgt caaataaaaa      5880
     cctgttatgc ataggaagta ccttattcct cgataaatac agggcaggtc tgtacatatt      5940
     tgtaacagta tatctgagtc atactgtcat aaaccaaaaa gcccttaaat ccgcaccaag      6000
     tttcataatg aatataatac tatcaaataa accaataaga ctccttaaac agcaaattaa      6060
     tgacaatctc atcaatcaag ccaaaaagga ttgcttatga ttcaaatata gtttcttaat      6120
     gaatcatttg ttcaatcctt aatgattatg caacagaaac atatttcact tcagtttcaa      6180
     aataattaaa aatagagact gatattcatg aaataggcaa tgtagagcat atttgatata      6240
     gtttatttga tacaaccact caattatatc acttggcatc taatgagatt aaaatttagt      6300
     tttttctgct ggctatttac atttcaaaag gaagcagttg attcacaaaa cggaaaagaa      6360
     taaagagtaa ttaaaggaga atcaacataa aaaatgtgtt gcagatctgt tactgttaat      6420
     ctcaataaag gctaggaacg cttcataact aaattgtatg atttgtttaa ttgcgtagca      6480
     taataatttc taaagcaata gaaacttagc caaataagta gaatttctga gaagcatagt      6540
     cagtgtaatt tctgtaaggc ttcaggagaa aataatgata ttatcatata tatgtattag      6600
     ctaatttaat ccctttctgt tgtttactct cgattgtcac tgggacattc tgaccatgcc      6660
     ctattaatag gcaaactaaa acaaacattt tcgaagctcg tctcggcctc cactatacta      6720
     ataggtgctg acattatttg aacggattca ttttaatgtt gcaaactaat actcacgggt      6780
     atgtggctgt ggggggggga attaatggat tataatgaaa atgtattcat gaggaacacc      6840
     tagtctagaa tcaaatgtac ctgactaatc agataaacaa taatttaatg aggccttttc      6900
     tttctcatcc ctatttcagc caagaagaat tctctaaaac tgtctatata atcaaaaaag      6960
     caattataga gagtcgctct ataagatatt gacaaaactt ggttagtaaa ataaaaacaa      7020
     tgtttcagaa tcgaaggtca gagtgtaagt ttcttttttt tatcgtaaag tggtgataat      7080
     ttccgtagtt cattccaaaa gcaattgcca atgtatgaca aggccgtttt tctggccgct      7140
     tttcaataca agcttaactt taggtccaaa ctgaattaac cttttatttg tcaaagatat      7200
     agtgagtttc acatttccct taaaaccttg agaacaattg gtccaatcat aattgtagtt      7260
     ttacctaaat aggaatgctg ttgtattaag atctaaaact cagctcagct aatgactgac      7320
     gtagaaattc atattataac ataaaaagga gtgatgtaat aaataaattt gaaagagact      7380
     tcaatataat gaaagagtgc tgattatgct atcgtttccg atcaggagta attaaggcaa      7440
     ttcacgttaa gactttccag tcacttcatg tagggtatcc ttatgcatgt taaagggaat      7500
     ttcaccatta gaagatagtt caaatacatt aacaatgctg tgcgactgct ggtaattctc      7560
     ttctatatcg tactatagac aaatagacaa taaagattag tgcaagcttc ttgctttgat      7620
     atttagtagt tcatattttt agttatacta atcatttgta tatggtggtg acattggttg      7680
     aatcaacctt aatacttcca tagaattctt aggaaatgtc tttccaaaac tgtaaaaatg      7740
     aacattgcgt attatggctg caaatttttt aatgttgcaa accaaaaatt aagcagcaca      7800
     cccctattcg tgtgatagat acttctttgt ccaaaattga gtcaacaaaa aaagtacgat      7860
     atgggtaggg taatttcagt tgaaaatcaa gaggaattcc aaaaccgaaa gaaaagcaag      7920
     tcaggtaaat ctttcaggac agttttctat tcattaacct ttggaaagag ctaacgtact      7980
     cacgtaatat ttagagctct gataaaggct tgtggagtaa aacaaactgg atttaccaaa      8040
     gaattggatt tggcggattt aatggtagta tagttatctg tcactggcta tcaatacaca      8100
     ttctcttgag aaatacataa aggagacaat gaaaaaatcc gttttgcaat actttctgga      8160
     caaaacttaa caatggtttc ttcaagggca tacccgttgg ggaaataaat tgttgcaatt      8220
     tgtaatctaa aaaaggaaat tgtagccaaa aggtttcttt gccttcattt cttgcatatc      8280
     atacctggga agccaaagtt tgaacagtat cctacatcaa tttttgacca gcttacatac      8340
     ggtgctcaaa gttgttagtt ttgacaatat caagaaaaat caagctatca caatataaca      8400
     aaaaaaattt ttaacatttc tggcactata caaccccaat tctcggaatt agtcaaaagc      8460
     tggcttttgg atttacaaag aattacaatt actatcatga aataactgat gttaaaaaaa      8520
     gttttattga ttattcccct tttttattga taattcaagc tcttctttca taaattagct      8580
     atcaaaaggg ttacttcttg atctgcgaat ttttactctt ttactatgct gagctaatac      8640
     ctatttatct gaaattgttt tccttattga gatatagaaa ctattaggtc ccataactga      8700
     catctactcc ctctttgtta gtacagaaat gaactgaaga tattacttca attgcgcaag      8760
     tcacaagtaa attgttcata aaaggaataa aacttacaga cagctggcag atatactgtc      8820
     tttatcatta ctagttcagg aaatattcta gtattagtgg tagagcatat ttaaaagatg      8880
     attttttagg gaaagatgat ttgtaaggga aagatgaatg atagaaatat tcaaatttaa      8940
     tgaaacaatt ctcaatatgt agctaagaat tggatgacca atttccgaca atgtacagct      9000
     atcaggaagt gcagtgtcta gtaaattcat gaattccttt cttgaagtta atagcattta      9060
     ttataagact tatgctttct attgttggct ctttattgtt cgaattgtca attttttttt      9120
     caaaacagta ctaaacacca gtgagccatt tttattatta ataatatcta caacaagaca      9180
     ttcccatttg tgcatttgtg attgtaaact gtcttgtgtg taacagttca tatcatactc      9240
     ttacattaag atttataatt atcattgaat aaaagctata taatgttcaa atgtattgat      9300
     caacactgtt tttgagtttg tttatcatac ttgggcaatt aatagcaatc aaatttgtga      9360
     atataaatta atgacttatt ataatgtatc ttttactcaa taattaactc cactagctga      9420
     gaagtagtaa ttgttccgat gtgagttcag ttacaattgt atatcatttc ttttttgtaa      9480
     tagaaatata atgttataaa aagaatgacg tcacttcctt aaatagtaat tatccattca      9540
     ttcatcaaaa tttgatttgt cgatctaact aaaacaatga gatttcgcta tgtttagttg      9600
     aattctcgca tatcagaaga aatgttgtgc tttatatctc atccaattac ataaaaaaac      9660
     aaggtggata tgaaaactct ttctttccat gtcttctatc tctctatctg atactcctaa      9720
     gcacatagga aaagatatat tattaattta aatactttaa atatttgatt aaccgtgtgt      9780
     ttagttagaa gacatactgg attgtgaatt aaaccgatga aaattttaca tccttactaa      9840
     ttttcttgct tatacaagta ttttaaagct gatatttgtc gtttttttct gtacattaat      9900
     aatttaattg aattggttac gtttggatat atcaagaaga agctttcata ttcaaggtga      9960
     aattacagtt caacgttgta aatataaatg gtggtgcaaa tgaataaata gaaggattgt     10020
     tgataaagtt aacctcagta gttaaaaaat cctacatatt aaagtaaaga tagtgttttc     10080
     taaaattaga gctggttata tcccataaaa ccttctaggt acgacagttt ttaatgataa     10140
     agttaatagc aacataaata gaataaacta ataatttata gcaacatgat gtgcacatag     10200
     ccaacgctta tagacttgat ttatctaaat tcattcgcca aatattaaga aaaacaatgc     10260
     actattttgg atatcaaccc ttgaggaaaa aattaagtat attaagttga tttgttggct     10320
     cgcgagtaat aagtagtaat tttgaagttc aaattatatt ttattttggt acctactata     10380
     atgatgaatc aatctttttc tcataaataa gttgaactat attgatgtta ttacaccctc     10440
     aagtaacatt attcaaggcc tatgtcttga cactatttaa gttcaaggta tgttatccct     10500
     tatttgtaga tacatattta tttgttgtaa tataccgcag gataatgttg attttcccat     10560
     gtcctcagtt tatttctttt tttcatctct tgtcgattat aattaccaaa ttgttatgag     10620
     taataatctt tgaatttttt cgtaattata gaaaacaata tgtcctaagg aattgatatt     10680
     agaggttttc acaatagaat ttttttttat gaaacaaact aatttaatag aaatgcttcg     10740
     gatgtttcat aattattggt ttgtactttt caaaatagga gattcacaaa actagaatac     10800
     ctgcatttat ttacagtcgg taataagacg catttaatgg cattatggac aatattgtta     10860
     cgactattac aattgtaaac ttttttataa tttaagtacg caaatttctt tgacatatcc     10920
     tttccagtta aaaatagtag taacttgatc ctggctcggt cctatgggtt gattcagtgc     10980
     aatcccttaa tataaatgct gattcgacaa acacagctat tgttcagttg aataataagt     11040
     tccagaacta attatagact ttttgtataa agtgggcact attgtttaat cccatttatt     11100
     aagatatcta tattttaatg agaaacaaca cctgtgcagg tgaaaatatg gtcgagttac     11160
     tagcagaaat ctacgctaat ttcagatttt cattgactta ttgttttttt tttcaattct     11220
     cattcgaagt agctcaagtc aattactcgt taggctctta gtccacaatt atactaaaac     11280
     tcaatataca atcttttttg aaaccccaca gaaaagaagc attgaacaag tatgtacttt     11340
     aatttaaaag ttactttgaa taaattcaaa atttctttaa tagattctat caaatattat     11400
     tatactcaac gagcattgta aacctgaaat attttcattt aatattccta gtacttatta     11460
     tattaattta ttagaagatt ataagcatac tatttatatc aggaattgat agtattgtac     11520
     tttctaggtc atatagtttt tgttaagctt attaattcat tgattccaga tacgtaagtt     11580
     ttatatccaa gagcatttta tatcacatat actgtgtgtt gccaaaatag aaatacaatt     11640
     agtatattga caaacacaaa gttttgtccg taatgtgatt aataacaaat ttacttattc     11700
     gtatgataaa tttaatttct atttaatcaa ttctaaaata tccatgttgt cttaaaaaat     11760
     agttgtatta tacaatgtac ttaaagcata gcgggctctt ggtgggagtg ttaataacat     11820
     tcacttattt taaaaaaagg aaaaacggtt gacatcagtt ataacatgtt accaacttcc     11880
     ttcaagttga gctcgataat ttcaatttga gtatttggta aattattgta tttaaggtgc     11940
     attatgatac caacaccatc aatagaaaaa cttattcata gagtgtatct aaaactcaaa     12000
     ttagtaattc aaacttattt gatggaacag tctaaatact atagctggct attcttgtac     12060
     aacaatgtta gcattaatgt tttctatttt gggatatgat aattgaacta ataagccgac     12120
     ccaatgatga tgctatgagg tcgttttcaa gtaattattt aaactcagtt tcattttagt     12180
     agtaacatga aattaagcag aaatttgttt tagttttgaa agtatataga gtaatacata     12240
     ttatacttat taccaaaact ttcatatgca atacaagacc ttagcacttt gggaatgttg     12300
     atcaattact tctaaaaaaa tcaaatttat aagtttccta gttctcgtat tttattctaa     12360
     agagaacata atagtttatt cttaatttac gaaatagacg ctttatggca tatttcaatt     12420
     caagacatgt tgagattagt cacaaagccg gttttatatt gagcttttgt tgatgataaa     12480
     cttctcattt cagatagttg attagaacct acataaattt attctttaag agattcacgc     12540
     taccgaaaga agggattgaa acgtttgact tgatgtatca atcacaattc tcgtaaaacg     12600
     atagtttttt catcttaaat acaaaagaaa tttattcaca ctggatgaac cgattgatac     12660
     taaattctgc tttagatcag actaccaata tctgtattta tagataaagt aatacatata     12720
     tattttttta gtaaatttga ttggttattg tcagttttga ggctatattc tgattgctag     12780
     attcttcaag catgtgtgat tcgattaaaa tactcaggtc aaatacgttt cccataattt     12840
     gatcacactg ttattaactc tatgtacttt ggtgtgaagt gtttccccag ctacaaattt     12900
     ggccttttat atatcatatg gataacattc gactcatatt attagttttt aataatatcc     12960
     aaggtatgta caatttatta ttccttaagt atctcccaaa agcatattga ttgaacataa     13020
     aaactcatgg atttactgat cacattcgat ttaaatttat cgactctgat gacagataaa     13080
     gatttgagat tacttaatta tatattattt gggcaattaa gtatcagaac ctttagtatg     13140
     agcaaactat ttctaatact tagtgatgcc gcatgccaaa ttatatagga ggacatttaa     13200
     ccatttatta aagaataatt tataccaaag gatgaactaa gcagttaggc ttcaatccaa     13260
     tactatgcta ttgtagataa accatttaag gagagttttt cttaacatta aataggtact     13320
     taactctcag agtcgtaatc gaacattctt gtctatacaa aagctactat tttatttcca     13380
     agtacaggca aagatattca ataacaaatg aaattgttga ggccattaaa tattgatttc     13440
     actttcataa caatatgtat aaagatgtgc tgaaggaagt attgaatttg cattcactcc     13500
     aatttaaata catatctcta aattgtttgt atttggtttt aaaaagaaag aactaattag     13560
     acttgtgact tgaatttagt gttgaagtgg aaagtattcg ggttgttagg ttattaaggt     13620
     cgctcagaat atattgttag tcaatagtaa agtgttcgag taatatatta atttaagttt     13680
     tggtatgaac ttgtggaata tttaacaagt gtaagccaag actaaatgca cgtaaaaagg     13740
     tatattatgc agtgaaatgc cttcccaact aattttttca tgccaagaac tcagtacttg     13800
     gcttgtatta ttgttatata ttgtaagttg accttcattc tttttccaaa ttataaccag     13860
     gaataacaaa aggacacata tcaaaaagct tatcatatac atgtgcaaaa ctaatcagaa     13920
     ttgtttatga agcaacttga cagttcgcaa ccgctagctc agcaatggac gttatcaaag     13980
     accccgactg ttacaactaa tagtaacaat ggcatttgaa ccgatagcat gattttcaaa     14040
     acaagatggc cctttggttc tgtgtaaacc atggctattt attgtatgtt ctctaataaa     14100
     ggttggattt tatgatagta agccttcata tctagctcct ttggtgaaag tattgagaac     14160
     caatatatac tgtgtcattt actgctaata gttacttatt agtcaacgca acattttcct     14220
     caataaacaa acgggaagaa agctcttgta cgatgctttc ttttcatcga tgctaccata     14280
     ggacactcta gtgccaatac tgcagagtgt ctataaaagt gtgaaggaat gtgtagtgga     14340
     gttttgtagt gacttcatta gttagagttg ccattaggat gtgaattgga ataactaaca     14400
     tggttaacta aacgggaatg aaatgataat gcagtaggct aacagtatta acataactca     14460
     tccatcatca tatttgaatg cattggataa attaggtaaa ttgagaactg cttcagaaat     14520
     attggctaga atctttaatt ttgtaaaggg gcatgtatta aaaattttcc tagaataaca     14580
     ctatcgtcag cactatcatc aacatgcatt gaaagggatt ttgagaatta taatgtgtcc     14640
     ccattctgga atattgttca atctgcaacc aatatatagc aatagattgt gatatgataa     14700
     tgcctatttt actcaaggaa gcactcccat tatatctgat acaagggtaa acaaattgca     14760
     taaaagttat tactagaata tgttaggatt ttccagcatg atagaaaggg aacctagact     14820
     ataaatggct cttgcattgg tcttagtgat ataataacaa tgactttcaa atgtgctagg     14880
     tgatccatga agtgttcctt taaaaaataa tagaaaatct atgatctcgg tgtatgacag     14940
     cgtagaaaat attatcggcg aattatagct aagaacattg atagttctaa attttttgca     15000
     tttttcagta aacttccatt tataatacta aatggggcca ttttgcaaga caatgatctt     15060
     ctactaaaga gcgtcaaaca atcaaaataa atcaacgatt tgcaaaaaga aactgtaaga     15120
     catagaaata taacaagata aaaattcctc ctaaacttct gcgatctttt agcgatatca     15180
     caaatattat tattttaagt ttattaccag cttatccata agctaagacg agacttgaga     15240
     ggaaagttgg ctagctgtac tcggtcagaa tttacacatg tttcaccttt accacttcag     15300
     acaggaagat atcacttgtt tagtgtttga aacgaattgt aacatttatg attttctcat     15360
     agactgatct agcaattata gtaatgagta tgaaatcctt acttacccta attgaatctg     15420
     aaaaccatgc atatattgct aaaggttaac tttactgtac ttaattgatg atgaaataat     15480
     accctagaaa tgtatagtaa caataacaac gcgtcatcct ttcatctata tatgatattc     15540
     gtgtgaattg tacgtggctt ttcgagttag tttacaaaaa acataagcgt ggcaaacagt     15600
     attattgccg tgaagacttt tagcaactaa tgaaagcaga tattgaaaat gaaacccagt     15660
     gtatgactct ctaccattaa caaaagcgaa aattcaacaa aattaaaaag aaataagatt     15720
     ttttataggt ttaagacttc tttatgatat cctattattt cttagaacta ttaactttac     15780
     agacactatc tatgaataga aagtaatcta ataaaacact ggtacatccc acaaaacttt     15840
     atttattttt caattgataa attcgcgtcc tatagcctaa cttttaaaat atgcaacaaa     15900
     agagaagaaa atagaaaaat taagtcaacg aaaccgatta ttttctaata agtttcacat     15960
     gaatacaata tatcttttgc taagactcaa cttctgctgc aatggataat attcagtctt     16020
     catctcataa aaccaaaata attatgtttt gaactcacca atttggtgac tatttgcatt     16080
     aatctttcca gtagtaaagt tgcagtacaa ccaaactcaa aatgaataac ttaaaataaa     16140
     ttttagtatt ttcaaatttc atgcaatgaa atatcagaaa gtcttctatg aagtcatcaa     16200
     gttttcaatt tcttatcact gaaggctgta aaaaagtaaa acacatgaaa gataattgta     16260
     tttaacacag ataaatgaaa aagcagtagc ctttagtcta gcagtgtacc tttacttaaa     16320
     tcttttcgaa tgcccgcaaa cattagtttc aactgtaatt aacaaaagct tgccgttgat     16380
     ataagggtga atcaactagt taacaagata accttatttc gtattgcaga aaactctctg     16440
     gggtaactga taatgacaac ttgtggacta tttaatttgc ctttgaatta ttttagtgga     16500
     aaaacaaaaa gtagaggtaa tgttatcgtc cacctttagt attggttcta ttgcgaagtt     16560
     atcataattt tgaccaattt tttaggattt taaaaaaata atttgaattt ctgcattgct     16620
     aatttgtaag agtcaaataa tgagatagaa atccactgaa gctttatatc tcttaaagat     16680
     gtgtctttct gcatcacaag tgatatattc ttggcatatt aaaaacttac tttttggaat     16740
     taactatcta cacgagttca tgaatagtac ttaaatatga acaatggaac actcaaattc     16800
     gataaacttc ccaccgacat tgttgactag taattatgga tagtaataat ctcgtggcaa     16860
     tgatttattt gtatcaagtt taggatatta atcatattac tgaatccgtt atggtaaaat     16920
     aacatgaaaa gactcaaatt ataaaatatt atattagata gatattaatg aattaagctg     16980
     aaaaaaaaga aaatagacta ttacgttgaa gggcttgata gatatgatat taatagatca     17040
     tttagggttc aaccattacc tttgttttag cagctgcttc cttttctctg gttacgtagc     17100
     tgctatagtc taaccattga agcacttgcc acacgaacca ggccaaaata gcacctagta     17160
     gaggaccaat ccagtagatc cagtgataca ctgggaagga tcttgctgcc aaggctgctc     17220
     caaatgatct tgcaggatta acacctgttc ctgtgtaacc ggttaatgca agatgcccaa     17280
     taaacagaga tataccaatt ggcaatgcac acatgaaatt ggactcacct ttctccacag     17340
     ctgtcattag tactgttaaa cataaaatag ttgtgccaaa catttctaaa aacaaacctc     17400
     tagttcttga acagccgttg cctaaagtgt ttgcgtacaa aacaggacct ggagtcatac     17460
     cactagcagc tccaccagca gccatacctc ctaacatttg agcaacccac atcactatac     17520
     atctcattgg tgtaatagtt cttgaaagtg ctagtgatag agacacagct ggatttaaag     17580
     caccaccaga aacacctgca aaacaccaga ttgaaaacat cactgagaac ccaaaaccca     17640
     gcgcaatcat tatcaattgg cctggatggg aaccatctgg atatacatct aacaagacat     17700
     catgatttgc aatatttgca ataacatagg cacaccataa aaacatgaat gtgccaacca     17760
     actccccaaa aaaggcaata acatgatttc tcatagtgtc aggtcctaaa ttgaacctag     17820
     agcgtaatgt actatattta ttggggggag caacggttga tccactgtca taacccaatt     17880
     ccgcattttt gtctgcctga tgttctgttt ccatattata ttaattatta ctgagactta     17940
     tttgagatga gatcaaaaaa tagttgaatt caataaaaaa attgtttagt attcaaatcc     18000
     gcgaatatta aatcaccttt gatttatggg tgatcttaga aattctaatt aataagaact     18060
     gaaagcaatc ttaacttgat gtatttatat ctttctattt cgtcatttca aagaccatga     18120
     aaatgctaat aagaccacat ccaccaaaaa taagggttga acaatctaag gaacataatc     18180
     tactaaaaat aatcaaagtc atgatctatt tactacaaca tagaatcatc aaattgtcag     18240
     ttaaaatgcc aaataaatca atagaattgc aaaaagtaca ccaagggaaa ttaatttgat     18300
     atgtgtaaat tgaatgtcaa aataacttac tataataaaa tcggctctaa ttgggatatg     18360
     cccacaaggt tcaaaaaaga actaacaaaa aactttgatg atctaggtaa aaaagtgcca     18420
     tcattggaga tacatacatg aattttaata tagacaatga gatttaccac atgataaagg     18480
     catagagaga tatgaattaa atttgacaaa ttcctacaac aaaaaggccg cattgtacat     18540
     accccagcta aacgagatca agagccattt agacatggtg tatgacgtgt tttagtttga     18600
     tatatgattc ataggtagtc agttctcaag aatcggtggt attgctcagt tgccagtccg     18660
     tagagctgac cttattagag aatgatacac agactataat tattctgtcg tgagtgtagc     18720
     cagattactg ttaatgcagg gggtaaggca ataagaaatc ccattctagt gcgtgcgatg     18780
     aacttgtgac taaaattcat caattcatcg caatagaacc gataaaaccc atcaactatg     18840
     atgtatttaa catgactgag gtgcgggtga agctccagaa ctcttcaaac aactccattg     18900
     tccaacataa aaatttacgc accgtttcag tggtttgtgt agttatgggg tatgaatcac     18960
     tcccacttat ttcaattgga gtgtcctgtg ctccagagta gtttaaacat atacggggag     19020
     ttttcattca aattaattga ccctttgaat agctaaataa gtcatcaaat aatatgttta     19080
     caaaatgtac attattaaac tcatgtattt ccatatcccc ttagtgacga aattcacact     19140
     ccttcaatat ccttgagaga atagaactca ctattaaaaa cgcagccaca tccaacccaa     19200
     ctgagggtgt aaccacgatt aatcaacaga tgattaagta gtatccactc ttgattgacc     19260
     cgtatgcata gattgttgcc acttccgcat ttatttttaa atcaagaatt tattttttta     19320
     agggagatcg aattttatcc atgatatccc ctactcaacg ttagtacgta gaaaccttca     19380
     ctttccgaaa ttttaagggc gatgcgatga ggtaccaatc tggtccgcta ttgcgtttca     19440
     atattgacaa acaatacaaa ctctctgtgc ggtgttggga taccggatcc ggtgcggtgt     19500
     gggtttgcgg ttcttattag gagcacacct taattagatt tagtcaatcc actaatctaa     19560
     tcaaccgttg aagtattgtc tgatatctag gtgtaaacaa actatcccaa ctcaatttcg     19620
     atctagtgaa atgctgcata cgaaccgacg tccctatatg tctcccatga aacctataca     19680
     tctcattcca atgttcgggg attagtattg tcgcgccctc tgtactgaat ttacagaggt     19740
     atctacgcct cggaagaata gctatttttg actcattatt ttgcatttac ctgcctcttc     19800
     cccacccaaa cttttacccc ttgtgaatta ctcttctcaa cgctagagga gctgtgagac     19860
     gggattttgt agttgcactc tacatgtctt tgatggataa aattaaaaat tatatccttt     19920
     ttttaacaaa gcaacgacgg aaattttaaa agcaagtcgt gatgccttgt tgatatttca     19980
     atacattaat tccatatgca actaggaagg gttgatttgt aggcagcttt ttctctatga     20040
     ttgtatagaa gcacatatta gcgtaaatac tcaacttttc atcatttctt gtgaatgaat     20100
     tccgtgaata tttttttata tcaagctatt gcatcacttt tatgtaacga tgacgttcaa     20160
     gcatttcttt ttcatacttg ttgctatagt accatacact atcactagat atgattaatt     20220
     atacaataag ggggacgtgt tcttcttatt ccaactcaat gcatgtgtat atatgcacaa     20280
     tgacttaatt atttcaaagc tatatttatt ctatcattga atatgaaaat atgatggcgg     20340
     tttttacaag cagtttatgt ctaaaacgtt tgtgaatgta tagcagattt tgaaaatata     20400
     gtcttctgct caacctcact tttatacctc aagttctaat gccattaatt agctagtaga     20460
     agagaaatct atataatgaa atgtatcaat ttatttcaga ttttcttgaa ttgtattaag     20520
     tactatcagg taataccaat gatatacatc tgcaagcctc tgtttgtcaa gatattcact     20580
     catttaaaat agaaaccaag ctattttttc ccttaaatct tatagtagtc gaaaaaacag     20640
     gtttatatta tatatattct actcaatcaa aatgcagatt gcaacttgaa ttaaatgata     20700
     ctcaacccca tagaatgttt tactggaacc cattttgtgg gagctatagg aaaattactg     20760
     gctggtgaat gttcttggaa tagtattgaa aaacaatgca agtacactat tttgatacga     20820
     ttatacacgt gaaaatatac ttaaaaagtg atgatagtgt tattcaggac cggtaacggt     20880
     ctatttgtta ttaaacattt gaccaaaaaa cctacactgt gcgtgttaga cagtacaact     20940
     ccactctgta actaaataaa tgattcattc agatactttg ggtggaaaat agtagacagt     21000
     ttcgtgagta cagttgcaga gtttcaactt catgcgattg tgaagaaagt catcacttct     21060
     tcgagaactc tttgcaacgg gttgtctgcc taatagataa agattttgat atcagttgag     21120
     gagccaatag ataaggatct ctcaatggac aatctttttt atggcaacgg ttcattgtca     21180
     gtatcactct aacacagagc agcagggaaa gattcacgaa ggctcgtaga agacggagtg     21240
     gagaatgatc aatattgtgt gaggcaataa tcaatctcta ctatgtagac actcttaatg     21300
     ttcaagtagg ccagtttgtg agagacaccc tattgtattc tcccccccct cttttctctg     21360
     aaaacagttg cagaactgaa aggaaagcca aaaggtctta tcgatcgcct tatctattgg     21420
     tcagattgaa actgataaga gatagtagga aatgtgcgag ttatgtaacg tttgaccaag     21480
     aaacaatcgc acaaacagaa ttgacatgac tttgctttaa ctcattttct ctgcggtagt     21540
     ttcacacagc gcagaaaaca gagtcaaggt ggagctgtaa cccccccttc cctatttttc     21600
     ttctgggaag acgtattttg agtttttttg gctcctgcat acgaactcaa aggcgtgttt     21660
     gcagtggagg ggtcccagaa acaaaaatga aataaaaacg attcttcccc cagtatcgtg     21720
     ccttccttta cggtcatttc ttagcgatgc ctacttctac gaacaaatgt aagcgcttcc     21780
     acatggcttc tgatagcgta acacagggca ggttatcgtg tcgactattc ccaatcctac     21840
     tagagttgag catattcata ggatatccta actacttcct taatggtagc gcaaaagcct     21900
     tctcgttatg aatcgtgtgc tgcacagtta cataccggcg ttcctactat tttttacatg     21960
     tataacaagc agcgtcgaga tcagcttgta gtcaaataag agtgtgtttt agtatctaaa     22020
     acctcgaaaa ccgctcgcta tgcagccctg cgtgtcaatt cagtagagaa gttgatctac     22080
     agtttgctct tcttattcct ctttctatac ttacaattcc atttcccttc cctccctcga     22140
     tattctatag aaggctggtg ggacatatca attagcacac cagcaagact gggcatctca     22200
     aatgatgacg aagcaagaaa aacagttgct attctattca attccttcta ctctttccag     22260
     ctgaaactag tatcattcag taaaactagc gtaccagtgt tggccccagg gcaagcctaa     22320
     tttcatcact atcagtagag cattctattg gcttatgtgg aaatggatga ctttcttttc     22380
     ccctgttatc agtcttatct gtttcgtaat ccccaaggtc tttggaagga agatgccaga     22440
     ggacccgagg aaatgctcag aaactactgc agtagaagtt gcaacagtac acatacgtca     22500
     taagaacaat ccgacgaaga gtggacccca aataacccaa ccaacgccca tattccctcc     22560
     ttcccacaaa aatcgccctt gcgagaaacg accactcaca tggcagatag ataacagaaa     22620
     ctgcaaaatt gcatgtaaga taaagaatat tggcattaag gtaccaagtg aggagacacc     22680
     cgtacgggca tttggaagga aagctaccat tacaagcacc gaagagcagc aggactgggt     22740
     cttctaagga gaaagatacg tacaagtccc ttcaagctct tccatttcca tctgaatctg     22800
     ttcggtctac gaagtttctc agctacgtgt tcatgaaaat tccaaaaagc actcaatatt     22860
     gcgcacgaag aaacacaacc tctgaaaatc gaagatatcg aagcatctct tctgcctgag     22920
     tgagagaaca atcgcggagc aagcaaatcc aaaacagaac agatagatcg aagggaaaaa     22980
     aaaaagaaag aatgatgaaa agcaaatcct aacgaagaaa cccatgcagg tgcaacatac     23040
     ataaatgaaa taaaacaagt aaaaaagaag catatagccg gtactgcact ttctccgtac     23100
     actttgaatg gtatagctag ctggatagct gaaggtattt tgactccacc ttgaattgta     23160
     taactttggc tgagagaaga tgggcaagga atagagcgat gtgtttgaag caatcacttg     23220
     gtaaacagct aacaagatga gctttttgga tcaagatgag cctttgaaca ctgtacaggc     23280
     catgtactcc aggctatcca gaagaaatat caaaagaaag aagctagcac aatataacaa     23340
     aacaagaaca ctcacacagc tgaacagaag ataaagccgg ttttgaaaaa aaaaaaaaaa     23400
     gtgaatgaaa gtgttcttta cagtcaagat aaactgatca gttagcagga ataagaaaaa     23460
     aaccatcata gtaaacagtg tggaatgaaa ggattagcag tcctttttgg aatttatcct     23520
     acaacgaaaa atatataaat accaaaggat gattcattat cataccattt atctaaattc     23580
     ttctctcttg gtgttaatgt aatattttaa tttagagttt tacttagcaa aacttttaca     23640
     caaaaaataa aacactttca agtgccacac aaaacatcaa agtaaatctg caatgtcttc     23700
     tcaagttaac gaaccagaat ttcaacaagc ttaccacgaa gttgtttcct ctttgaagga     23760
     ctcttctttg ttcgaaaagc acccaaaata tgctaaggtt cttccagttg tctctgtccc     23820
     agagagaatc atccaattca gagttacttg ggaaaatgac aaccacgagc aagaagttgc     23880
     tactggttac agagtccaat tcaactccgc taagggtcca tacaagggtg gtctacgttt     23940
     ccatccatcc gtcaacttgt ctattctaaa gtttttgggt tttgaacaaa tcttcaagaa     24000
     cgctttgact ggtttggaca tgggtggtgc caagggtggt ctatgtgttg acctaaaggg     24060
     tagatccgac aacgaaatca gaagaatctg ttacgctttc atgagagaac tacacagaca     24120
     cattggtgct gacaccgatg ttccagctgg tgacatcggt gttggtggtc gtgaaatcgg     24180
     ttacttgttc ggtgcttaca gacattacac taactcctgg gaaggtgtcc ttactggtaa     24240
     gggtttgaac tggggtggtt ctttgatcag accagaagct actggttacg gtctagtcta     24300
     ctacacccag tctatgatcg actacgccac caagggtaaa gaatctttct ctggtaagcg     24360
     tgttgctatc tctggtagtg gtaacgttgc tcaattcgct gctttgaagg ttatcgaact     24420
     aggtggtatt gtcgtctctc tatctgattc taagggttgt atcatctctg aaaccggtat     24480
     cactactgaa cagatcgctt ctattgccga agccaagatc aagttcaagt ccttggaaca     24540
     aattgtcggt gaatactctg cttttgctga aaacaaggtt gaatacgttg ctggtgctcg     24600
     tccatggacc ttagttggta aggttgacat tgctctgcca tgtgctaccc aaaatgaagt     24660
     ttccggcgac gaagctaagg ctttggttgc tgctggtgta aagtttgttg ctgaaggttc     24720
     caacatgggt tgtactccag aagctattga tgtcttcgaa agctctcgtg ctaccgcctc     24780
     tgctccaggt gaagctgtgt ggtacgctat gggtaagaac tctaacctgg gtggtgtctt     24840
     gacctctggt ttggaaatgg cccaaaactc tcaaagaatg tcttggacta gtgaggaagt     24900
     cgaccaagaa ttgaagaagg gtatggttaa ctgtttcaac gactgtattg aagccgctga     24960
     aaagtacagc aacgaatcta acaagaacgc cttgccatct ttggtcaagg gtggtaacat     25020
     tgcaagtttc attaaggtcg ctgatgccat gttcgaccaa ggtgatgttt tctaattcat     25080
     ttgacagtag aaaataattc tttattgtca ttttataaaa aaggtgttac gttattcacc     25140
     tgtccttcct ttctttcatt tcaaacattt agatgcatta tataactaat agtatataca     25200
     caaggcgata aattttcatt tagtgttcaa gctgtggtat tgtttttgca cataacgaat     25260
     aggtgaatgt gtaataagtt caatagcatt ataataatat attcattacc ttttatactg     25320
     gttgttttgc ttaatgttat ttatggctag tattttggag tctgtatgtt tcgatggtaa     25380
     ggaggtggag tggatggatt attagttaac aacctgctgg aaatgtaata tatatagtga     25440
     tgtgaggcaa ttaatatttc atgcaaaata aataccttcc tagacgagtg tacttacgat     25500
     accattcata tctactcctt aatggtaatc aactactaaa cccgaaacgt ctggatattt     25560
     tagcatatga agtaggtaaa catcattcta tatcgttcta tgattgatat tgctcctatg     25620
     ctacttacac aatacgtatc atgaaagtga gtctgtcatt tcattgtaat tctgttacaa     25680
     cttgtcggtg ttataatgtt tcgataatca atcttgaatc ccctgctatt gaagtacgta     25740
     ttagtgatta cgtcatcggc ttgtagaggt tacttcaaat gacatttgtc agaagagtag     25800
     gttgttgaaa cattcataac gacacactta aacacaatgg cgatctgagg actactaact     25860
     tacacttttt agtcaaaatt ggtgggggtg attacagaaa gcacatgtaa gataaaaaag     25920
     taagcagtaa atacagagaa gaaattactt ctggtttgca ttgtagttca ataacaagta     25980
     tgcggggata aagacactag tgccatacta tgtgaaagtt tgtaaaagta acacaacgga     26040
     tccatgtatt ttgctcatat ataccttcca agtctcaata gatgtattgc gtcagtattt     26100
     tttgtttttt attcaattta cctgtatttg tgtttactta atagaacatg ttacagagtc     26160
     aagaaaagga atgcctttca caacaaatgt ttgagacttg gaaggccttt caataattaa     26220
     agtttgataa tccattccca tttcgcgaga tcttatttgt cgttaagata catcctgcga     26280
     cctgataaca atgcaggaat atcatgatgt aattcaaaac tttgaaatcg ccttattatt     26340
     ttctgtattt ttactacagt ttacggatat tgtattgaaa atgcgaatat cacagtagtt     26400
     attattaagt aggccaattt catcatataa tgcttttcag gttatacaac aaaaacaact     26460
     gagatatcta actttttgac ataagaagtt tacgggagag ggcagggata aagaatcctt     26520
     tgagggctac tcattatgag taagtagttg atagaaattg acaacaacat aataccgatt     26580
     tgcaagagcc ctccacaact ttccacccct tcactcccac atattacccc tgactattta     26640
     aacatagaaa gctgttttct gcaagatatt agaggtgcaa ctttggaacg gcggatgtag     26700
     ttttaatgca tccgatcgtt ttatcccaat acgaacgagt gtgcttggaa cctgtattac     26760
     tgttaagtta catttcgaaa taggactatt atcggcgcaa ttgtttgtat cccacaatgg     26820
     agatcaatga cgttttaact atacggaact agtgctttta tttccacaag gtgtgaacaa     26880
     aaagactaaa ggccttctac aaaagaacag aacacactgt aatatcctga ttgcccaata     26940
     tccccatcta ccagcagaga tagcggcgtt atgtagtcgt gtcactaaga atagaataga     27000
     atagagccaa attttcaact atacaaggat tgtaatacag aaggctattt tgtaggaatt     27060
     tggttacaac gaatatttta atcccgacac tattttctgc tcccgggttg ttcctttcga     27120
     agagccactg atgaaaaaat tcgttgagca tcccttaaaa aaattccatc ccgcaattcc     27180
     ccttgaaatt tttcaatgtg gggaggctct cgagaaagtg gtattatgaa gcttgttgaa     27240
     cagtagtaat ggttagaaga cgagcatgat tgtttcaatt ataatagtgc caaacaaata     27300
     aaacctcatt acataatttt ttgtagtttt tgaaatgtat ataagcagac atcatattca     27360
     acaaacatgc aaattcaatc caaatatttt cattctttct tattaatttt tgccattgaa     27420
     tcatacaagg ataatcatta atccaatata gaacacaata caattcaaaa ctatttgttc     27480
     tattaatttt cagatacaaa gactacagat tcagtttttt ctttacactt cagttccagc     27540
     ttaccaaact attacaagat gagatcatta gcttacttta agacaggtga tattcatttt     27600
     actgacaaga ttgatactcc aaagatcaat aatgatcatg aattgatgat cgatgtggca     27660
     tggtgtggta tttgtggtac cgacctgcat gagttcttag aaggtccaat tttcatgcca     27720
     aaggatggag atacacatta tctttccgga cttgatctac cgctaccaat gggtcatgaa     27780
     atgtcaggta ttgtgaagga agtaggtaag ggtgtgactc gctttaagcc tggtgacagg     27840
     gttgttattg aagctaccac aagttgtggt gatactcacc gttggccaaa gtctaaagtc     27900
     gctaaaggtg aactatgtcc tgcttgtgaa atgggtttac caaattgttg cacacacggt     27960
     agtttccaag gtttaggatc tgttggtggt ggttttgccg aacaagttgt tgttggtgaa     28020
     aagcatgttg ttaaaattcc agacaaattg ccattggatg ttgccgcttt ggttgagcct     28080
     ttgtctgtcg catggcatgc cgctagatta gccgaattca aagaaggctc taatgctttg     28140
     gttttgggtt ctggtccaat tggtttggcc atgattcttg ctttgaaggg tatgaaagct     28200
     gggaagattg tggtttctga gcctgccaaa ttgagaagag aactagctga gaaattgaat     28260
     gtcgttgttt tcaacccaac tcatacaaga gcacaaaatg caattgagaa attgaaagaa     28320
     ctatctccaa aagatcacgg ttttgactac acctttgact gttctggtgt tcaggataca     28380
     ttcaatgcag cagttaaagc tgcttgtatt cagggtcaca ttgtgaatgt ggctatttgg     28440
     ggtcccaaac cggtagcctt ccatccaatg gatatgacct atggtgagaa gaagcttact     28500
     ggtactatgg gctatgttac cagagatttt gaggaagttg ttgatgccat tgataaggga     28560
     tatatttcca ttgaggagtg taagctattg attactggta gagttaaatt ggaagatggt     28620
     atggagaagg ggttccatga attgattgag cataaggaaa ctaatgtcaa gattttgttg     28680
     accccaaata atcatggaga gttacaatga gtactctcta gacgaagtaa tgatataaat     28740
     gtcaagccat tgaggtttag ttttctaacg actgatgaga tgatacatta ttagtaagtg     28800
     agatagaaaa tatcttcgaa ctactaaaag tatatataaa tgatgattaa aattaacgct     28860
     caggaacttt ttttagcaat catagtgtcc ttttacccaa aagaaatgac tgtaatggca     28920
     tcatgcttgt gtatattttc ttagcttttc agtatttaaa tgtatagttg ggaataaaag     28980
     aagtttctaa agtcaagctt ttctaaccgc attaggacta gtagctacca gcccttaata     29040
     tcaaaaaagt cacaatagat atagatattg atgattcgat ttaaactggg aaatgtttct     29100
     gaatcactat caatggtcaa attgggcagt gatgatcaga aacatccttt tttgtcgtgt     29160
     ctacgtattt tctctgattt ttgaaaattt ctgaaaattt gcgatgagca tcgcatcgca     29220
     ataggtatcg tcaacttatt ttatagtagt aaccgaaaag ccaatcattc aaaataattc     29280
     tgtctttcat ataatcaaga ttttattgaa ttccaacatt ataaagtaaa acgttaccgg     29340
     taaaatggct aagaaaattt caaaaaactc cagagctgca agacaatatg atctaactga     29400
     tttagctccc aaagaactcc agaatcttcc gagagcagaa aatactgatc taactaatat     29460
     aatgatcaga acagctgcaa aaaatgagtc tcttttagaa gcaaagataa ggaagaagaa     29520
     ggacagcaag aacaaagtgt caaagaaaga ctttgaaaag aaaattgcca aatcagtcaa     29580
     aatcatggag aaagagcgtc tagaaagggc tttgaatatc acaaatcgtc tcgacggtaa     29640
     aattgccaaa tctatttcaa gagcaaagta tgtgcaaagt tcgagaaagg ctggctggga     29700
     tagtataaat gcgtcaatta aaaaggaatt gctggtacaa gctttggaag cagaagaaga     29760
     ggagaagaaa aatgaagaag ctgaaaagga aggggacatt gaggttgatg aaatgtatga     29820
     ctcagctaag atagaaacta caacagaagt caaaccccaa tctgttgagc cacaaaattt     29880
     gtttgcattg cttccgcttg atacagacga atgatttaag gagtacaaaa catttttcat     29940
     aattttatat actagttttg aaataatcga ttaaaagtat tgcatttata gacatatttg     30000
     tttaccatca ttaagtatta taagagataa gaaaataaaa tccaaaatat tctgcagtga     30060
     tacactttct gactttacca attttgcgtg atcatcatta tcaagattag aaaattaaaa     30120
     tttaaatgag ggcagcttac tgcatgagcc gattgacaga tctagtacta aattccagca     30180
     taaaaaaatc aaccaactac aaagggtaaa cagattcaaa atttagaata atactcacac     30240
     tttagtacta ttgtttaatc tatcgatatg aaatcaattg gcttattggg cctattcttt     30300
     acagcagcac atgtccatgg acgtcaccta cctatcaaca gtacaaatat atctggcttt     30360
     tgggaggact ttgagactta taagactaat gaggatctga aggaagtatg gcattcttca     30420
     gaagcagttg atgagcatgg tagaaaatta tttcctgcct cttggaagct ctttcataat     30480
     ccggactatg tggaatcaaa tcggaaaggg ttgcttgtta agtcacctgg gaagtatgct     30540
     atgattggta gaaatatcga aaaacctgta aacttatcag actctgaact gttggtgata     30600
     caatatgagg ttaagagtac gaaagatcca cattgtgagg gtgccttcat caagttattt     30660
     cataatatgt atctggaaag ccttactaac tatgatagaa aagctggagt caaatatgat     30720
     cttttatttg gtcctgattt ctgtctacca gatacaaaca tggtccggtt cgaatggagg     30780
     aataggaagg acaaagaaga gaaaaaacta atttttagcc ccaagagtaa attgaatgat     30840
     ggtcagcaca agaatcatct atatacaatg atattggatc taggtaataa aatactagaa     30900
     atacgaattg atgggaaagt tgtattagct acatcgctta atgacagtca acattttaag     30960
     gataccaaat acatgtctac aactgatact catgaggatt catcagagtt taatttttca     31020
     attgatggtc ttacgtttga tatctggggc acattatccg gtattgtgtt caaaaatgta     31080
     tatatcggga acagtattga agaagcagaa attataggca ataatacata ccttcccaat     31140
     gctttaaaag aaaatgatct catcttaaaa aagttgaagg tcaagaatga tggaaaggtt     31200
     ccaaatgcaa aatcccctta tgatgacaat atatattcgc agaatttgtt tgatattttg     31260
     tttgataaat tggtaggttt attggaaggg ctatcgataa agcatatgat aactgtgctc     31320
     ttagtactaa ttccatatat gctttattat ctggccagaa atcatgaaat gaaaaaaaga     31380
     attcggacgg aagatattgt agaaataaat aaataaacat atatcacaat gagacgccct     31440
     acaagatgct ctgatcacct tggtattata aattatcata tctagtttag atattagagc     31500
     tggatatgta agtattcata ttgaattatt catttataga agttacgaat aagtatgttt     31560
     aatttacaaa aaaagttttt tatgatatgc aactgttagc taaactaaaa acttcagctt     31620
     ctatctgctg ttgatatcac tctcgataat ctcattttaa tcaactaaat gaacattttc     31680
     tattatctgg caggcaattc gaaaaacatg ctcataattt tgggcagttc ttcgactcaa     31740
     ttgtttcgtt actgggtttc tacaaagatt gatgtatttc aattgagttg taggtatagc     31800
     gcgaagaata ttttttaaat catgtaagtc attatctgta agatccagac gttgaactgt     31860
     agggataatt tgatataaat ttgatggcaa ttcccgtagt ccactaatat ttgaaatttt     31920
     tagtattttt aaatttggag gaaaatattc ccattttgga atatcacaaa ttgcaccatt     31980
     acatatctca aaaacctcaa tatgtggcgg acatattttc cattctctta agcatttgca     32040
     tgcatcaatg tgtagctctt ttaactgcat taaaggaagg cattttaatt ctaaatgagg     32100
     taagttgaaa ttcttcatta aacttacagt ttccaagtaa cgtaataaat gcaggttgtc     32160
     taccttctct aagttgttat tgtctaccaa taatacacgt agattggtta acaagtgtat     32220
     attttttaac tctttaattt tattgcccgt tagacacaaa tattctaatg aagcccatcc     32280
     taatttatct cttgatccat gcattagttc acgaaagtca atgcaacctt ctattaaatt     32340
     atatgaaagg tctaaatgtc tcagcggagt attttctaag gtagttaagc ttctaacttg     32400
     attatgagac atattgattt gtgtaaggtg atagccatca ttcaagaatt cgagatcggc     32460
     tatacaatta taagagcagt tcaaagtttc caaatctcta taattgttta gattcaaatg     32520
     taataatcct ttaccttgaa catttaattc tctgattatt tttgttttcg gtttaaatgg     32580
     tatctgcgat atactagcat ctgtattaca taaaaaagag taaggtttcc cttgtgtgtc     32640
     tgtcagattt acccttccag aaacgtttct ttctttaaag accaattcat ctctacttaa     32700
     atccaagcta ttatcgagtt gtgtagcata cttgaattta tcactgcttt tgctaccatt     32760
     cgagttatca tcaatatcat catctttgaa tgaatgactg ctatacggta tttgaaagcc     32820
     tccatttaaa ttcagtggag ttaaggctcg atcaggggca atgtgcatga ctaatttaca     32880
     ttaatatcca ctctcaagtt tgatatcacc cttttcttac cgataacaag aatggaggaa     32940
     tatatgaatc caaaagtaga ctaaaattgt aaattattct cttgaaaata ggaaagtgtt     33000
     aagatcctaa gtagctaata agaaatttca cttttttaat tgattgtatc tgtataacaa     33060
     atcaattcaa ccacaagata ggtaataaga aatgagcaac cgataataag cacagatagc     33120
     cttcagtttt gtgtaaatcc gcaaagtgaa ctaggaccta tagttaaagt ttgtgaaact     33180
     tgtggtttga aatatatctt atttggtgtt ttcgacaatg atgtcacgga tatgccaaaa     33240
     aaggtctgta tgaatgcctt gtacttggtc tgctatgtca aacagcccct gtaagaaacc     33300
     ggattctcaa tctaacaatt attccttggt ttaactgtat ttgtctttgg aagatatatt     33360
     cctattccaa tgaatattta aaggtgtctt gacagccgta ggtttgtact gtaatttcaa     33420
     cacaatttcc tggtgatctt tatgtgccgg ttcttagtca agttattatc tccctttagg     33480
     aaatcacaga tatatgagaa agcttgaagt tgcacaaaat ttgattataa tatgaggtag     33540
     tactcaatga tggttaatga gaaaagagac agttaacagg acaatcagta ttcagtggtg     33600
     gaaacacaaa gtcatccgat cttgagcagg caaggtctgt atcttagtat agaccaattg     33660
     atgtttacca aactaatacc aatgttctaa acctagatat tcaatgatta ctccttgtga     33720
     gattttggtg ggaagagatc agccactgaa ctgagacctt tgtgccgcca aggggagacc     33780
     gggagaaata acatcatatc atgaagcacg atatagtcgc atggtatgaa ttttaataca     33840
     gatcataagg aatgtgcacg taaaacgtat aacgaagcta catctgttaa ggagagacac     33900
     agcagtctat aacgctgttg gcacaagcca tgctgctata gtatggtgca ttggtatttc     33960
     tttacttagt atagattgtt tttattcgtt tttgtgagaa cgatattata tgctgggctt     34020
     aagtccttat acaacaagtg acatgatgtc attagtgaat ccccttttca tctagggagt     34080
     gctttaaacc ggatttttgt tttgcgggaa gagatgataa cgacggcaat atgtttcaca     34140
     ttacactggc caaaaattag tctctaatgt gcgagccgta ttgaaacctg tatgctagac     34200
     agttcataag tgcatttcag aatttgggca tcggttttag tgatcttgtc cctgggcacc     34260
     accaattctt ttcttttaac gttgcgcatt atgtattcga caagaggcat gaggctctat     34320
     aagctgaaga ggtaacaaga ttcgcattga ttctttccag cacagagaca tcctatgttg     34380
     ccattcactg ctctacagta ctctcaggca cattaattcc ttccccccac cccctccgcc     34440
     attgttttgc gctattctat gtgcgaagta tcttcggctt ggaagtacaa accagcacac     34500
     acatacacac ccaaaattat aggcagacat aaagctacga taaagaaaag aaaaaagaaa     34560
     tagtcaataa acaataggca ggcttttaca gccctatact ctcagaaagc cgcgcaccag     34620
     taccaattca catttattgc ccgtattgtt atactttcaa gtggaagaaa aagaaaagcc     34680
     aaatcgagat cccagacgca tcagagtaga accagtacgg aacactcaaa cgttccctgt     34740
     aaatgggtag tgtctacggc acaggagcgc tacatttgag agcacaaaac caaagaaaac     34800
     acccaaaaag gaaggtgcac agtaaatcag cacggatatc caatatagga aatagtgggt     34860
     gagcgggaag gggaagagtg taaggctacc aaagcaaggg ccctacaagc tttgagaaaa     34920
     aagaatgaat agctaaacgg tgcattttct ctgcctgcca cacagaaaac gctaggcaac     34980
     cactgtaaag aaaaaaaaga gtaagaggtg acgtgaactt tcaaacactc tacgctcttt     35040
     cttagtttga ttacccttcc cttgctaaga gacttacatt ttccattatc cttacggtag     35100
     agcttattat ttccttgtag gataatatta agatatattt aagattatac cggtgatctg     35160
     tacggagagt actgtgaata gggactatca aagacaaaaa aattatggaa gaaaaaaaag     35220
     aaaaaagcag cataaaaaga aagaaaatgg gaaaaaaaca ctcacaaaat gtcgtagagc     35280
     ttctcattgc catttcccat ttttcaacat atattttgat aaatggagtc tcgttgcact     35340
     tagaaaaggc tgtagcaaca ctgtgtaata actttagaaa agtaaacttt taactgcgta     35400
     aaaaaaaaag aaaggttcca tgtgaaagaa aagagaggag ccctgtctat ttctagagat     35460
     tccttgcaca tattgtgcag agcacaccgc acaagaggaa gcaaacaaaa aaaaaatggg     35520
     atagaagaat attcggccac ttcttaattc tctacagtga tgtatgagaa gttcagggat     35580
     tggaggacgt aagacaaatc cccgcacaac cagagaaaag ggctagtagt gaaatgaggt     35640
     agcacttttt cttgctgcta attagctgta gccgaggaaa taagaggaac aacagaaaaa     35700
     cgggaaaaaa gaaaggatga atggaaaagc ttggtaaagt aggtcggatg tttctacgga     35760
     gaagtaagag aagggggaag agggcaggga ggggaaggga agggatcaga gaatcgaaga     35820
     agaaatggta tgacgaaatt atatacagac aaagagagta tggaagggga tctctgataa     35880
     gttaattggg ataactctcc caagagaagc ttccattttc tactttggga cagtagaatt     35940
     caagcttcga taacttatct tagcccacca aaggaaagga caagggaaat acggaatagg     36000
     atgaggctat atttctgaac aaggactatt aacggcagac acgaaggtcc ctattactat     36060
     ctataccaag gggcgaaaaa tatcattccc atcagttgga gagttgttac gtcgcagagt     36120
     gtatcttccc tggctctggc cggtgtttgg cgagagtcac aggagagcac acaaacagag     36180
     gaaggaacac aaaaatgacc accaacaggg ccagtagaca gaggtacaag agaagactct     36240
     ctgcacgaaa tgaatgactg aacggctttt ttttcctttc tttttttccc tatttttaag     36300
     gttgcctcca gaagtacact gaacacgaaa gtgggctgcg gaacttcttg tttgattctc     36360
     tcctgttatc acgacctgca gctctgcgac ttttattact tcccagacct ctaccgcaaa     36420
     ctcataagaa tctggaattt tctcatgggg agtcactgaa ccaagtgcac aattatgatg     36480
     tgtccgggca cagtaaacgc cgcacagtat ttatgctctg ttcttcctcc ccccaccctc     36540
     cacccctctc actcaccact taccgtcttt ctaacccacc cgctaccctc tggccattga     36600
     cctgttactg aaggaccaat gcacataaat acgtcattcc aaggcgaccc catatatcct     36660
     ctctctgtgc ctttctaggt ataactcctc tagaaccctc aaaatgcgta gaaacctact     36720
     cttgggagcc tatatcatcc tgcagatgca ccactgcagc tagaaccacg ccaaaaatac     36780
     gttctagcct aacttccacc tccgagtaac aatgaaggta ctggaagaga ctacaaagtg     36840
     ggttgactac taagggaggc cagctgggag accagctgca cgtctagtgc tgaatgccta     36900
     aattcatctg aaatggcagc cattaaagct tgacacggcc agtagcaaga taccctttcc     36960
     ctccccactt cccactagag agatcggaag ggcattgcac tagcgtagct aaatggctat     37020
     tatatgttcc tgctacagat ctcttgtaca tttccctctc agctgctatc tcttccttcc     37080
     cattgtctgg ctcctgtcaa ttgctgtgcc agttgttgaa ctgctcattg taaaaactct     37140
     aaacagaaca actgcaatct acagtacaaa gggaaaaggc aacgagtgag ggtcctcttg     37200
     caatcgaaat tggtactgag tctgcattgc tgtgttactt cctcgattct aggttctgga     37260
     tcgcagaggc aataggtgat tctaaagagg gctgtcagag agtcctgaaa gaaaagataa     37320
     ataaactaaa atagaatatt ccaccatcgt gaagtgatta cgggttcttc cttacccata     37380
     cccatttata tatatattca gatgccattt ttgagattct cgtgtataca actgtctcta     37440
     ttcttgatat aaatattttg cgttgttgat tcttgctggc gtttagcttc taataaaaag     37500
     tctttcagac gtactattaa aatacaacaa aataaatata ggaactttac tagaacaaaa     37560
     aaataaaatt agaaagaata atatgagtag gaaaaacagt aacatcagtg ggctcagtag     37620
     tgagtccagt agcgaccaac tatatgcaga cgctaaaacg gagagtctcc cgatggagga     37680
     ctttgagagc tcacaattcg atgatattga gagcgggctc attgacggca aagatgacgc     37740
     taatagtaag aggaacaaaa ctcacataaa aacttccttg aacgacatta tacagcaggt     37800
     tcgccagcgc tcgcgattac tagccaatag gaccggttta acctcaacta agaatattat     37860
     tattaggctg ctagtggtta atgttgtact tttcctaata tttatacact tcagcagctt     37920
     tagaagtcac cacttgaaga atgaggccaa tataggaaat ggtggtatag aagagcaagg     37980
     caatgaagaa tctattgcag gtttggatat ttccatcgga catggtttgg agaattccgt     38040
     gtcagtgaaa ggaaggataa aggattataa tagaaatctg aataaaatat tacaaggcgt     38100
     tcctcaagta aacgataaat cagaaatgtc ccaatatgat acatcaaaat ttataaaaat     38160
     gcaaaggttt gacctgatgg caacagccaa cggattccca aataatactt ttctgccctt     38220
     cgaattgacc tcttatcaat caaacatgta caacttgact gggagtgagt ctaataaatg     38280
     cgatgccata agttggaagt caagaataca ttattcacaa gagagattac cgatagagga     38340
     agacttagtg gcagcgagaa taaaatttgt aaaagaggat aagcaccttg gtaaaattgt     38400
     ggaagaatta cataacgcca gtaagaaaga aactatagag gaaagtgtaa agaagcaatg     38460
     gctaagattt ggatcatcag cgcagtggct ggaggatcac caatgttatt tagtgtttag     38520
     taggattatt gtaacagagg ggggatttaa aggtgctggt aaaatgtcac tggtgagcgc     38580
     tcaggcattt gataaagatt ggaatgaaat caaaggtaaa cgtattccat tcattgatac     38640
     tgaaatacca gatgatctag aacaacaact aattgccatt gacaagaagt atgatttatt     38700
     caagaattgt gatgaagaag ataagacaac ctaccagtat caagtatgcg ttcaaagtaa     38760
     gcaatacatg aaagaaaagg cagaggaaga gaaagatgaa ctattgggta actattatag     38820
     agtatatcca acaattttga aaattccttt tgcaatggaa aagaagtggt tttacaaagg     38880
     accagaagat ccgaagttga tactaagaac taataaagat ggcattcagg aaccaattgt     38940
     tgtgtacaat atttatgatc ctacacatca agaacgtatg atgcaagtag tattgcctca     39000
     cagaaaaatt agtccggtca tacctctaat agaacaggat gctatagttg ttggccgtca     39060
     aaaaaactgg actccattta ttaaagatga agatgctggt ggccaaatct caagaggtag     39120
     tttacacatg ttttcaagag cagctccttt acaaattgtt aagtgttcac ttgatactgg     39180
     ttattgtaag tttgtttttg atgctgcaga atactccaag aaagattttg aacccaatga     39240
     aatcagggga ggcactcctt taataaaact accgccagtc gttcctcaac tgaaaggaag     39300
     gaatctttgg tttggtttga tgaaaggaca tataaaggaa tgtggaatat cggatcgtct     39360
     ttacagacca tctcttgcta tattagaaga ggaaaatggc aaatactttt tcaatttaat     39420
     aacggatact ctccatttca atactgaggt gcttgggtgg tccgagaaga atttcaaagc     39480
     tgatggttat aatgtccttt caccaaacag tgtcatttct tgggatgtgc taagccaaaa     39540
     ccccgaaact aaatcttatg atgattatat gcagatatca gtaagccaat cagataaggg     39600
     aagttatgta ataaaaatga aaggcgtgct ggatttcatt ctacaatcat acaccaagga     39660
     aggtcttaac aataatatgg actgggaaag ttctggtttg gaggatagaa tagaacttgg     39720
     tggggtatgt tttagaaagc atttaagaaa ctattgtgaa gaatacagca agtcacatag     39780
     ctgaactata tatatatata aaaattgcat tggtatttat acacaaagta acatacaagc     39840
     atcgtctaaa gaatttctta tgatcgctaa tttggacatt gacaaatagc cgagtataag     39900
     tatcttaatc attcctcaat tattgagtac actggcccag cataagggaa gaattataga     39960
     gaattaatat agtatacaaa tatgtgcttc attacccgga ataatctgga agactaagta     40020
     tataaagctc tacaaaccct tgttcgttag aaattctaaa ttggagggtt ggccgagtgg     40080
     tctaaggcgg cagacttaag atctgttgga cggttgtccg cgcgagttcg aacctcgcat     40140
     ccttcattaa tttttttttt attttgggac atttctataa tgaaagagaa cactaacttc     40200
     aagacgagaa gttaatgaaa agttaggaaa cgacttcgtt tctatgaaat ttaagcgtac     40260
     gttatcggtg aacttggaag aacttagaat caggttcaaa tgcggactgt tttcctttca     40320
     gacagttatt cttgcacgaa aatctaaagt caagaattgt aaagacaagc actatcatgt     40380
     tcatatttat ttcttgtcta atgataaaac atcctgtact agtgtaaaag agtcggcttt     40440
     ccatccccga ttagtagtag acattgcacc ccatctacat attcatactg aaagggacat     40500
     gtttcaactc tcttactcat agcaaacgat tctgtagagc agaaatgaaa cttgaccata     40560
     aatgtcttcc gttcaagaaa tgtccttagg agttcagaga ttgttgctat aaacaatgaa     40620
     tacaggcgtc acttatattt gtacattgct atagtcgttg gttctataat tacgataagg     40680
     tattagtggt tactgttttt ctcttgaatg atagatcgct agactcagaa cttcataggt     40740
     aataaaaatt ggactaattt gtgcttcaag aaactaagat ctagataaac aaagtcacat     40800
     gtagttgatc tatcaaagat attatataaa ttgtagcctt aatggaaagt gcggaggtca     40860
     tcaaaatggc ctgttgtctg ttttgattat ctagaaataa aatgctgggt tttacaaatc     40920
     tttcttgatt tcactataag gaggcacgaa aatcttgaaa tttttcaatt tctttctgaa     40980
     atttatgaat ggcaatcttt tcaccacctc atcgcgagac acaaatactg ctgattacca     41040
     aagtagtcga ttctaagagc agttttgata attgtgatta aatttaagtg attgtcattt     41100
     tacaagcaaa tattctagtt aattcaattc cttaaaagga gttcctatta cgaggttgcc     41160
     cagttgttaa tctattcgat agccatcctt tttagatttt gcgatttcaa gagttttgct     41220
     gagcagccat ctatctattt gttaggttta ttttaccatt aatggtatta taaaactaga     41280
     atagtttgat atttagtgga agacaaagga cttggatagt tttctttgct ttccatcaag     41340
     caaaataata ccttacgcaa agttttcgat caactacatt gctcttatat aagacattgc     41400
     tataataagc ataatcagaa tttgaaattg atatcatgtt caagaagtac aaaaaccagg     41460
     acttggatgt ttcattctgg tggaagaaaa atccaaagac cccatctgac tatgtgaaat     41520
     tgataaatga acagttgaat aagatagaac caacacctct tcctaatggt accaatataa     41580
     cttcgtcttc ctcagataat aagcgaaaag cacaggaaga ggttgctaag tatttggttg     41640
     gaatgaagca ttatattctg ggtgatgtgg accccaagcc gacatcagag gcaatagacg     41700
     aattttattc tgcaatgctg tcttcagata tatttcataa tcttttggta catattgcag     41760
     accttgattt tgagtcgcga aaggaagttc ttttaatact ttctatttgc ttaaactatt     41820
     caaaggataa taagtttgtc actgtagatt atctggtgtc tcaatccaaa acactatcat     41880
     taatgctacg aacaatgggc ttgacccttc aaagaagaga tacgtatgat atctttatca     41940
     ttgtcgggaa catgattatt gaatgcatta agtatgagca actgtgtcat atctttttaa     42000
     cagatactca attgtggagt ttgtttgaat ttgcaggaat tgctaacttt gaaattagta     42060
     cccagtcaat gcaaatttta aattctgtac taactaccca tcccaaactg gttgcaaggg     42120
     agttctttag tcaagagaag aatattaatt tatttatcag gcatattaat aagttgatgg     42180
     ctcacggtag ttatgtgaca aaaagacaga gttcaaagct tttagcttca ttgataatta     42240
     tcagagctca taatgtcctt atgatgacat acattaatgc accagaaaat ttaaagctga     42300
     ttatgacttt gctgactgat aaatcaagaa atctacaatt agaggcattt aacattttca     42360
     aagtaatggt agcaaatcca aaaaaatcaa agctggtctt tgatattttg gtaaagaaca     42420
     gagataaatt actggcttat ttagaactgt ttggcaaaga agttcaagac tcaacctttt     42480
     tggatgaaaa agaatttatt atgagggaaa ttgaaagtct gccaagaatt aagccaaata     42540
     caaatgaaca taacattaac atgtccaact caccaccaaa aggtttatta cattcggatc     42600
     aaaaaaaaac ggcatcaagt cagcagttca atgaaaatca taatgagtta tctggtaaca     42660
     attcttctgg taatgttacg aaaagcttag catcaatagg ctaatgagtg aatgtagcaa     42720
     aaaaataagc agagaaaggt tttgctaact aaccgtaacc tgcttctgtt gagctttata     42780
     ataagtattt tttcctcttc ttaaggcaag cttattttgg caaaccccat acatatatca     42840
     gactaatttt gtaggtagat ataaattaga tgcaagtatg atattaatga atatataaat     42900
     gaatgatttt tcactgaaga atattaatta cagatgcaga tcatgttatg ttttcttttt     42960
     ctgcttcttt tttagaagtt ttgaactttc actgcctttt gaagatagta ggggaagtct     43020
     tccattgtga ttaatctttc tagtcgctga tttgctagtg aacttctctg tgtcagctct     43080
     ggtcaactct ggtatatcag agtcagtagt tgcatttgcc attttttgaa gagtttgcaa     43140
     atctgtttct gatttccgaa tcacattaga tttcttagca tctagcaaat ccctaagtct     43200
     tttttcccaa agaggaactt gctggtctaa taagctattc aattcattca accttttctc     43260
     agtttcgagt ctagttgtag catcgaattc accgaattga taactaccct taccatcaaa     43320
     cttaagtaga taattgtgga aatgccacag agttgtccta tgacagacag atataaccga     43380
     gatacctaag ttctgcgcat tttcatacat tttttgttcc atttctggtg agactgcaga     43440
     ggtacactca tctaaaactg caaattttgg tttgtggtaa tacattcttg ccatagctaa     43500
     tctttgctga acaccaatgg acaattcttc tgaccaattt ctttttaaat caaaggccgc     43560
     tctaatttca gtaagatttt cctcatccaa gttatcagac ttcttggtcc cctttccagc     43620
     caaaactaga gataggtttt cagtaattaa atcagtcaaa tccaaaagct caagaacaga     43680
     aatcagcttc tcgtcaccca tattgtaatc cccgttaaat ctctcttcga aatcttcgat     43740
     agtgtcagga taaattatct gttcgcggaa cgttgaaccg ttacccatat aaggtttctg     43800
     tggtaagtaa aaaattgcac agtcttgtcc tatcttgcgt ggaggtacag ttaatttcgt     43860
     ttgaacacca gtctcaatct gtcttattgg ccataatcct cctaataatc tgaataacga     43920
     tgatttacca catccatttg ggccaataat aagtaaatgg tctccatgtt ttagttcgaa     43980
     gttcagttca ggaactaata cttggttagc tggggtaatt aggggaacgt gctcgaactt     44040
     tatcaaattt tcattatact caacaagatc taaaacgtcc tcatctttct tatcaatatt     44100
     cccaactgca tacttgtcaa gtaaatcgtt taggtaattt agtcttaagc ttgtaccgcg     44160
     caattcttgt atatttttct ttaattcgac aaatcttcct acagaactgg atgctgtcaa     44220
     aagcaatctt ctatttgtga taaagtcagc agtcgcatct gtagcatcag gttgatcccc     44280
     attttgaacc ttacctttga agaatattgg tattgaacat aaagctaagc cagctgcacc     44340
     ccatgtgtat ttaatcacaa acgtagaagc tagatcataa aaggcccttg cttttatctc     44400
     gcgccccata aaaaacgcca atcggtaaaa agagaagtct aatgaggtga gctccctaga     44460
     ttggccacga agcaacgcta tttcctcatt gtttctgtga acactagaat gtaaggatcg     44520
     gaaccaactt tcaagagatg atctcatcat tgtaatctta gtgaaatttg gttgaattag     44580
     ctttagcatg gaattagata tgtaaacaat caatcctaaa actaatgtac cttctcccat     44640
     aactccagag ccagacatca gcaatttaaa tgagcataaa atcaaatcta acattggttt     44700
     caaaagttga ttcagtaaaa ccgaagtatt gtttgaaaac ttgctaatgt ccttagttaa     44760
     attatcttgt acttcagagg cgctgtctgc tgcagccacg gcataaaaag tgcggtggtt     44820
     agaaaggtac ttccccatta aatggttggt cactaaccta tttatagaga cagaacacag     44880
     tttagtgaca tagttaatca gtgaattgat aaaacttgca ggtataccta ataccatcca     44940
     ttgacctaac agaatcttta gaaattttcc atactgggct ttgactaatg acgatactaa     45000
     tctaccatca agggttgcaa catgcaggga aagaaatgtt cgtaatacca gtaagaaagc     45060
     ctgagtcatg aacaaaatca tgactttctt atcccccagt aataacttca tcaaaaagtc     45120
     agttctcttc aaattaacat ctgtagactt ttcaacagga gaggtttgtt ctactacatt     45180
     ggtgttctcc tggacattag aagatcttcg aagacttagg cttctcgttc ctcttgtttt     45240
     gagtacaatc tcgtcactct tggagtcaga ctgttcatcg ctgctaacat cagatgccag     45300
     ctcatcggga cttgaaatag agtccttcct gtctcttaat ttctcactta gtctacttaa     45360
     agtgctcttc tccgataaag tttcgctcct gtctctatta gatgatgttt tcttctgttt     45420
     tgtagatcca gaactggaac cggacccata cagcgataca aaaagcagga gtatatatga     45480
     agtcctcaga atgttcactc tatgattttt atatgcagtg agaagtgtca tacttggtag     45540
     taagtattgt acagaaaaag gtcccgtaaa gaactccgag caataataat atttctgggt     45600
     agagctgtaa gtgttcttat cctttggtct aggttactaa tctatagctt tacctgataa     45660
     tacagtttac cacctttcaa agagctatta tgataggcgc aacttagaaa ccacatcttt     45720
     atttatatag tgaataagaa atcaagaata gggaagcgat gactctcggt tattatgagg     45780
     aaggattcga tcaccagaga cgtagttgtg gggaagacct tcattcttaa cttaaagagc     45840
     ggaccaaaat taatacaagc accaacacac accaaacatc aaagatgccc aaagcactct     45900
     ccatactctc cattttccaa agacgatatg gtggagtcaa gaggcaagtg taaccgaatg     45960
     tatagagtaa gtcatcattc cagagcaaca caaaaggaac tgtattctga tgaaaacgaa     46020
     aaacttgatg tcatcttaac tcaaggtaga acagttagtt tgaatagaag aaaaaacatc     46080
     ccatagtagt ggatttgtaa ggcttctact gtaaagggtg ctctgactgt atcatctcgg     46140
     ttgggaaaat tatcaccggt cagcaagtcc cactttgatg tccccgtgaa gtcttgcctg     46200
     gaagctactt ttgtagggcc aattttttgc tcgtcagtca agaagatgtg tttcggttta     46260
     aataattatc gccgaaatgt gtactatttt atgagaaaga tatctctctt gtaggtcaaa     46320
     gtgcaccgta gtctcttgga cgttctatgt atctagttgc aattggtttc aaaaagctac     46380
     aatgtggtct tgtgaagacg ttcttcaaaa ttgcttctac gtagaatatt ctaccaagag     46440
     caagatcagg ccagttattc tctctgtatg gtttgggtgc tatgcgtgga tactgtattt     46500
     tatgagtgaa tcgagactgc gtcttggtag aaaccgtagc ataaggtgct gtgttcatta     46560
     tgattttctt gtggaactaa ccccggaatc atagtctcga gacattgttt caaagcccgt     46620
     gttcctttta tttttagcca acattcaccg aacgcatgtc tatcatctca gtgaattaaa     46680
     agcccacttt accttcgcag ctctaaacga atagccttat gcccaaagac taaattcaga     46740
     gttccacaag gtctcgatta catacttctt aaagaacaaa agttgctgta aatctcgggt     46800
     tttgaaaaat taacagcgtt agggacctat taattcactt agcaacagca atatatatat     46860
     aagaagcgga tatattcata atcctgcaga tcttgttttc aataataatt atgttaaatc     46920
     gattttttaa gtacttaaat aaaatttgat atactaatag atagcccaga ttgatagagt     46980
     gacatatagt atctttctaa aacacattga tagagagata agctattaat tcagatatat     47040
     ggggcatcag cacggataac tttgttagtg ttgtctttta tggttaacag ggtattgttg     47100
     aaagctctaa cgactaatgg ttgaattata ttatcatcaa gttcagatct ggtgaacact     47160
     gtcttttttt ctttcgagaa gaagaccata tgattcgcgt catatgaaaa cggtacacat     47220
     tacctgagct gaagtatcaa ttaactaata tcgtatcttc gttacgagaa aagattataa     47280
     aaaatattat tgtagaaatt aaaattaaac agtgaggtcc cattaattgt gtattcgcaa     47340
     ttataaaata atagcgaata acatcagcgg caccttaaag aacttcggat tatgtggaaa     47400
     ataaatgata caatcaatgc acatttatac caattaactt cacggaaaga agaggttaat     47460
     aaaaataaaa ttaaaattat cagataatga aatgcaagag aaagatattt gactatgggc     47520
     agggacgggg taattttctg gtcattatta gtgtcacaat tatccttctg aataaatgtt     47580
     ataatagaag tacgacaaac tgacttgctc aatggatgga caaaaagtag agacgatgat     47640
     gtatgatgac aataaaagag tttgtcaaac tttttaactg aaccactaaa attcagaaag     47700
     atgtaaaagt gtaccgtatt tttacaaatt tggatgcaat gtaatcacaa tactaagagg     47760
     aaacaaagag aacacgattc atatttcaaa caataatgtc tgtgtccttt ggttgttgtt     47820
     tgttaacttg ctctggcgaa gagctatcgt cctcatcaac gtctgcaaca tcaacggttt     47880
     gaacaacctt ctcagattca taattgttat tctcactact attggacata ctggacatat     47940
     cattatcata tcctttctcg tcaccaaatg gttgaccacg aggtttacca actcttgcgt     48000
     agaaggcgca atatagaact atcaagcatg caaagaatgc cactgcaaaa cctgcccata     48060
     cacatccaga gtaagcacca ccagtgctga aaacgacatt gaatttatca tgacttgtac     48120
     cagatttaat gatagagatc ataatggcga taataccagc acccagacaa ctgaataagg     48180
     cagtggatag ggtcaataca actgtgtaaa tccacagacc tagttttctg ttatactttg     48240
     gagctattaa cagaataaaa ccaataatgc caaagaatga ggtgataatg gttaagatat     48300
     tcatagcaag aacagccttg acagcaggta catattcgtg ttgtctgtgt agtaatttgc     48360
     cttctaggta caagtcatat ttgctaatgt tcaatgcttt caaataaggt tggaaatcgg     48420
     agtccaataa tgcatcatag atgatagacc tgaagtccag attttgaaca gcgtgtggag     48480
     agttacagtc ggtaatttct ccctgtccat taacgtggca aagtgtgaag atagatagtc     48540
     taaagtcaac aggaacatgc aggaagtcaa gtaaagcagg tgtcattgcc ttcagttgtt     48600
     cctgggtaac aggttcgacg gagtttgcat cctctagaat gctgacaatt ggtctgaaag     48660
     tatctgggtt acttgtagcc caggatgtta aggcaactaa ggatgtgaat gagtttgcag     48720
     ggttgtcaga agctgaaagt aagttgaaca gagctgggac tgcatcagtg ttagtgtttg     48780
     gatcggccat acccgcttgc aaagctgcaa tgatgcccag agtttgaact gggttagtac     48840
     tgacctgtag cattccttgt agaccttcca actgagcttg agccaatgta gtgttccgaa     48900
     cagcggcaag aattggcaaa ctttgtagaa ccatagtttg gttgttggag tgatcaagca     48960
     aggtagacat ggcttggaaa gctgcttttg cagatgggga ggtagtaaca ttttgtctta     49020
     acaaacttag taagttgttg atggtaccgt tcttgttgct ggagtcgttt aataaagctt     49080
     ctaccgcttc tactgattgt ttgttatctt ctgggacaga tcctccgatt ctgtcaaaca     49140
     gtggcgacag atcttggtca gcctcaccgt tcaaagaact ttgaatggtt gttagtagag     49200
     tgacacctaa ttgagttggc acattagcgt tcatcaggtc acccaaggca tcgacagtgt     49260
     tgttaatgtt tgtagtgtag ccaaatagtt ggaacactgg tagtagcttg gtcttttctg     49320
     ccaaggtcat gttgttcaag gtaatcaaag agtcaacaga ggcaactttg ttgtctgatc     49380
     cttgtaggat acttagtaca atggaagtcg agttatcgga aggttggccg ctcttcaatt     49440
     gtgctagggt tggcatgacc aggttaccta gggattccaa agtttggtta gtgttgttgg     49500
     agaacgagag caggccgctg attgcgatca gttccttagt agacgaggag ctgtcgctgc     49560
     tgatagctaa aggagccaac tcagtcaagg ccactacgga gtccgaagtg ttcttggcgt     49620
     tctttagcaa gtttagcagt ggggtcagag ctggagtatc ggcgatagct ttcaatgagt     49680
     tgaaaacttc agacaaagag ctgtttgggg ctgacagagc tgtacccagc actgttagga     49740
     taggagcaat ctgtggcaag actttagtga cgttaatatg cttgatgtcg gcatcaccga     49800
     tgtagatgtt atggattggg gagtaattag cagtggaacc tgctgtagcg acgatgaaag     49860
     tgatgaatgt ggtgaatagg aacaagatgc acactgagaa cagcaacact tcagtggatc     49920
     ttttcaactg ttttgcgtta ggataagtat ccggatgagt atattttttt gcagcacggt     49980
     gtgcactacg gtggactgct agattaacca ttttgtccta tttctttaat tgtaatattg     50040
     tagactaaaa ccaaataaca agggttgatt aaaagggaag ttgaaaaata ttttggagtg     50100
     ccagatgaaa agagttacta ttttatacta gatttttttt ttttcctttc taaagccaag     50160
     ttatcttcaa aattgttttt gttgcaggca agtttcaata aaaaatggtg tcttggttgt     50220
     cagttttttt tttcccacaa gttggagagt cggagttcag ttcaacttaa gcgtcaagag     50280
     aataatggct atccttctag atattggtat tttggtatct ttcttgcaag agaatatttg     50340
     gagaagtcgg ggataagtgt ttacagcgat ggggtaccat ttgcctattc tttttatact     50400
     tcatttagat gggaagttgc cctatgtgtt gcacagttgc atcccgtccc atttctttgt     50460
     tcaaattttg gcagtatcgt acagttctct acaactcagc ttggagtcgg caagttgcag     50520
     gtagagttgg tgtttgtatg atctgctcgg gcagggcaag tggtttaggg cttcgaatta     50580
     agtgtccttc atcatctgtg agatgtcttg tagaagtact tcggtaagtt cttcggtaag     50640
     ttcttcggta agtactttga ttgtgcttgt tgttgagttc acttgccgag gagtacagga     50700
     gggggggggg ggggaagtgt ctctcactac aggatctctg tttgttggat ctgactcgta     50760
     gcaaccgagg ttggggtttc tagtttgtgt acttgtgtat cacccttgcg tatcagcttg     50820
     cgtacatctc tgtgcaagtc tcttgtaaaa gtagtttccg ttttagggtt agggcttttt     50880
     tagtggaagg ggatgctgtt tttggttgtt accgatgccc caagaacccc aacagaaacg     50940
     agtcgggagt cgggatgaag atttactgta gagcggagaa tgggaatact gttttttgtt     51000
     gaattgggtc aagcagagag cttcgtagaa agtttgtagc ttgctgagag gatgctcgga     51060
     gggtgcctgg gggggagaga gtcatctcta cggtgcgtgt gtgacccttc cactcagtct     51120
     ctgaaagatt agacgagaaa gcggggaagg gctatcaggt agaaggaaag tgatttgtta     51180
     ctcgggggaa aggcaggaaa cgttctctgt acgatatctg tttgcgatct ctgtgtgcga     51240
     tctctgtaga agcttttggg gggagggggg agtggagagc aagggactgg caaactggca     51300
     atcgctggta aattgtctgt aatgccgtcg cggtgatgta atgtcgaaga acgagcgagg     51360
     ggttgggggg cgaggaaaag aaaaaaaagg ggaaggaatt tggcggatca gagacgatca     51420
     gagaagataa ggtagggaag ttcttgactg tgccttcttt ggggaactac ctttggggac     51480
     cacctttggg ggccaccttt tgttacctta tttgggaact ccacttctct tagacaaaca     51540
     tattctgttg agaaacccag tctgtactgt gctgtcctgc ggcacagatg gtccctgggt     51600
     gaaatcagat tcggggtttt aagtaatccc acagagcgca aggattactg ggaaaactca     51660
     acaaaaattg catttccgtc tcaaacccac aattcaagaa actacccgat taggaatagt     51720
     gatagataca ctcccccccc tcccatctca tctcatctca tcattcacac acgccatgta     51780
     tttctgccgt ctgctcctgc tgatactccc gctgttacat cctgtaatgg cacatgactt     51840
     caaatggtgt caatcgtgat ttgtcgcaac gagagatgtc gtgtctctca cactagggga     51900
     ctccttgcac tggacatcgt ggtgtgggtt tatgagtggt ttaccatgat ggtattgtca     51960
     tcgttcctta cttcgtgtta tgtgcaaatt cttttcctgc atggtaatgt tattgatgat     52020
     gatgcttatg atgatgctga tgatgctgat aatgcatttt aaatcctatt tattttttta     52080
     tcgggttgag gatattatgt atatatatat ttcttcaact tcaattgttg agttttctct     52140
     tcaattgcgt cccataatac acaacatatg gataaaaata gaaaattatg acgttgtatc     52200
     tatctcttaa tctccgcatg tagaatataa atcgacgatt atctcaattg atcttgatga     52260
     gagagtcctc tggcttgtac actatcttgt agttcaacga cgttatcaca ccgttgatgt     52320
     cattgcggaa tatacggtcg tcgagacata gctgcaagga cacgccaaag tatgagcccc     52380
     acagcggtct attgttgttc atcctcttgg caccactggg tcccatcggt atcacactgt     52440
     cctggcccat cttgtcacgc ccactctcat caaaccgcac tttgcagttc acgttgcata     52500
     ttatcgtgtt ggatgcgccc gtgggtatca cgtggaaatc tagagcagaa atgatgtgct     52560
     gcgtttgtac cacctgctgc gaccacatag tcaagaagat cgatgggtcc gcgaagggca     52620
     tcgagttgta cacaactttg ctcaccgttg gcgagggtgg catgttctta ctcgattgga     52680
     acagttgtag aaagttcatt aatttgtttg gatcctgttc atctaagtgc gctaacactt     52740
     tcttgacgaa gatgtctatc agatgatact ggctgttatt gttactattg ctgttcatgt     52800
     tgtttcgagg ttcagtccac ctattttaga cctagttttt agttgtagtt gaacaaaata     52860
     ggcaagctta gcggatatat agccaatttt agttttgagg gtctctggca cctgaatttc     52920
     cagcaagcac ttcgctcaga aactattgaa attgaaattt cagcgttttg gaacttctga     52980
     tgaatttttt gtaataaaaa aaaagggcat attatttacg tgtgagatga tgcctacaat     53040
     ctcagaaaca tataaagatg tccaaaaatt ggtctattct atctcatata atagttcatg     53100
     tagtgataca aaaagatgaa tacatagcta ttttaattac ttccattatc agatatcaag     53160
     aacaatagaa tctttattgt atgtccccac cacagtagac tctgccaaga tgacattttt     53220
     ttattcattt tcttacttaa tatttcctca gtggatattt ttgcaattca tcatttttta     53280
     atatatagaa tacaacggta catgtttcat agcgctgttt gaattatctc catgtagaat     53340
     atcatcttga tttttgtttg gagccttcac atacatgccc aaagtaaaat attttgaacg     53400
     tgcaagatgc acgattagta taattagaac ctacaccaaa ttacaattcg ttatggaggt     53460
     tataagaaga attcagaata ctctctgtcg aaaaagaaac atatatatgt acaattgttg     53520
     tatattcaaa gccttttttc taagctaaac cttaaacgca cagattttgc tattcttctt     53580
     ttagtcgcat tccttcttta ctcgtaactg tgatacacga acataacaat acaaatcctg     53640
     aatcgctagt acatgggaat acagtgttat tggaattcgc aagagcaatc acaacttgtc     53700
     caaaatcaag tacgatgccc taagcaattt tccttttcgt cacaatcgaa gtgggctaag     53760
     acacggtatt tcccttttcg gaaaagtaag tagttgacca attacccatt taggaaatgt     53820
     gattagattt tctattgtac catatttaca agagaaccca gccatctgta ttttttttcc     53880
     actatatgat ctgtctgtag tagaaatcta ggtagtggga agtgctggtt cttcggtacg     53940
     ccttagtgat tgggctaatt tgttctaata ccatctccgg ggttcttgta gcaatatcca     54000
     ttttggttga gattcactga agcaagtagt agctcaggtg gaacgtacgc tgattcaaca     54060
     tcagcttttg agtagtccca aaagggatat ttacatgggg atcagatccc ttgaagcaag     54120
     acgataacca gaacactcga gcacccactg acttctcgaa gacagaacta tcgctagtag     54180
     tgcctctgtg ggcctcgaga tttggcagtt gtatatgcgt tagttttata gacagtattc     54240
     tgttcattat cttctagtgt gattatttgt aggaagctga tcaacatttt aaagaaaata     54300
     aaatctgaat tgagtctatc tctcatagat acacagagat caagcagagc ttgcggatga     54360
     atactagact cagagtatcg agtcttgtgt cattcctttt cagaaaagaa aatcctagtt     54420
     accattggca ttcaccgaaa aacggtgggc aaatacgagt tgtgttattc aatatttgga     54480
     aaggctggtt ccaaaatggg aaggataact cagttgcgta ggctcgcttt atttcttgtt     54540
     aaatgacgtt catgaataaa gacaaattaa ttgaatgaaa aaaaaaaaaa tgagctgcat     54600
     aattccttga tccaccttcc acaagctttc ctaattgcat tactattcta atataggaaa     54660
     aaacagaaat actaaaaaaa atgctggtct ttctatttta ggaattagca atatattata     54720
     ccagcagtcg caatgatact atataagcat cacggtttta tatgtaaacc tttcaaattt     54780
     gtgctatgac tatctgcttt gatctatctc gtaagacctt ttgattcaat tttttttttc     54840
     ttgatctgat ttaatacata ccttaattat tttttctttc atgctattat tattatatta     54900
     tatatattta tactcctcaa tagaaaaacc aagaataaca ggaataaaaa acgcttgtac     54960
     ttaacaatca attggtatca ggattaaaaa aactgaaaat ttatcactca ctcatttcat     55020
     tcattttaat atcggcccat aaatacttca agtttttgat ctgaccaaat tttcaatcat     55080
     tttaagtaca caaaaagcta taatcaatag aaaaatcaag ccaaagacta atcttcattc     55140
     attcattatt aatccttacc attgaaattc attcattctt ttgtctttgg acccaaaaaa     55200
     aaacgcaaat aataatacat tcgtttgaac cctttcttta aatttaagtt aatcaattac     55260
     aacattcatc aagataaaac tattttactg gaggtgtaat ttatatgtcg ctcccattga     55320
     atgagttacc agtgcctatt ttaggtaaaa cttcattttc atctgcaaac agatcatcgt     55380
     acatttcttc tgctggttca gaaagacatg ctgccctaat ggaaaatagt gaagcattga     55440
     ggtcaccatc tcactcatcc aatcaaggct ttcgcttgca atctaatgca cacactagcc     55500
     ccatctccaa aaattattct tacttctcat cgcctattcc ttccactagc agattatctc     55560
     taaatgtagg taaaaccgga ttagcaaata ttaccgctac tgatttgccc agggaatcaa     55620
     ttagctatca ggctagatct tcttcatttg gtccacaaat tgaatttcca tacagaaaat     55680
     caaatacagc cccagcttcg cctcaccatt ttagcaccag caactatgtg tctatcatta     55740
     caccatcgac gtcccctgct ggcttagaaa atagaatggt aggaagcaca gcccaatttt     55800
     ctcacttacc ttcactaaga gccgcaagca ttccaaacat atcgtgctca ccaaccttcc     55860
     aggaaactac aaattcctta tctgatcact attccggcaa tagtacgacg cacatttcta     55920
     gcgttaaaag cggaactatt ctgccatcgc ttagacattt acaattgtta cctgatcgtt     55980
     cactacagga gcattctaaa ctctatccag acactgcgaa aatcaatggt gcttggagac     56040
     aaaatgtgat tagctggtgt aaggaaaaat cctatgaaga ttatgtcaag gttcaagaag     56100
     aagttgcaaa agttagaact caattcccaa tcagtcagtt gaggagtcat cctgagagca     56160
     cgaaaaatcc taatatgcca aaaatccctt cattattaaa tgctaaggat caattcgaga     56220
     gtttatcaaa ttctccttgg agctatgaag ctccagtaac tccgcctatg agcccaagtg     56280
     tttccaagag gagacaaaac tccaacacat ctagttcgaa acttcaaagt gttacctata     56340
     atttgacacc taaaacaccc ggtgatgatc ttaaggattt cacaccgatc atcagcgaga     56400
     ggctggtgca aaccgtaaaa atgaaacaaa tggagactta ctatcaatct tcacctggcc     56460
     gccataaaaa aacaaatagc tttaaggctc ttcaaattaa gaaattattg gacaacaggg     56520
     atgtgctttc aattaactct aaaagtggtt ttaaagtttc aaagcctgga aggccaatgt     56580
     cctctgtgat tgtaagcggc atatctacgc aaatagcctc aaagcttgaa tcaatatcgt     56640
     ccaattccag ctcctccagt gcaagtagca gtccaaagtc aagcaaacga agcttatcac     56700
     gctcccctac aaggttcact acatttgtac aaccatcgac gccaagggaa tataatcaaa     56760
     aacaaaaaat aaattcttct cgttcgagat caaggtcccc aattagacca tctacgccaa     56820
     ctcaacaaac tccaatttac aaaaatacat tccagaattc ggataacagc aattacaacg     56880
     tcaatagcgc tagtgtattt agtacacccg ctttaaaata cggacaatcc tcgacagagt     56940
     ctccaaatag tgctacattt aatagtattg gtgcccatac gacgtccatt tcggttacaa     57000
     cttcacctaa acactattat agtagcaaga aaatatcggg gggctctaat tctcccaaga     57060
     gacgcaagtc gaacccaacg tttaccagtg tcacaagcac tccaactgct agccatggtg     57120
     caaagagtaa aagcggaagc aacagtccta agaatggtgc gtatcatcta aggaagtgtg     57180
     tttcgtgtaa ctctagtgat tcgccatgtt ggagaccatc ctggtctggt aagaagactg     57240
     agcaattatg taactcttgt ggattgcgtt acaagaagac gaggactcgt tgtctaaacg     57300
     acggttgtcg gaaaattcca accaagggtg aactaaatat aatgaaatca cagggattgg     57360
     aaaaggagta caacacacaa cttcaacgtg aagtagaagg ctacaaatgt ctgttctgta     57420
     accacataac tgagacacgc taagaaatcg aatctaatat aacatgcata agccagtaat     57480
     tggtaagata agacatttcg cttctttttt ctatgtggat acaggtatct atagaaagaa     57540
     aagtcaaaac agaattctta tggtatggcc taatggctat tccaatacaa tttgagatgg     57600
     gagttgatct cctgataaag taacaaaaaa tttatttcta cacaacaaag cagaatagaa     57660
     aatttacttg taagtgttga gcgaaatgta atttagagaa ttttggtggt attcttataa     57720
     tacattgtac tcaattatac aagtagattt tctattactg ctttatgact tttttaaatg     57780
     cacactgtgt gtgctcaaag gcactaacgc aagtcttgac attttatttt attttatttt     57840
     tatatcatat tacatttaac ttattctaca tatattttat ttttacataa agaggcctta     57900
     ataatattaa tgatcattaa catatttcaa ttctaataac atcaagtccc aacttttccg     57960
     aactatttgg ttctgataca gagatttata caaaaacata aaagggacac actccttgcg     58020
     ttggtcccat acccaccata atcacgttag taacctataa cggcatacgt gcaagttgtt     58080
     agaaagcaaa ataatcttac ccggctagtt tttccaggga agaagtcaag gattgcgctc     58140
     tctttgcatg ggggcagaga cacccccccc ctactaaata ccggtttgtg tatttcggag     58200
     agggttagtg ctaaggggga gttgaagaga cgatgatatc atttctcatc agtagcgtca     58260
     gttagcgggg agatctgccg ggtaaagttt cacatttctt tctttttctt tttaccctcg     58320
     ttgtaagaga agttcttaga agggggagtg tctgcaagtg gaagctacga ggcagtttga     58380
     ataagactag acagcgacga gatagaaatc gatattgcag tgccctggca ggacagaata     58440
     aaggccttca tgggggattc catgcctgga tatctactga cctttcttag ataaagaggg     58500
     gggggagaat tgcgaggatt gaaaagccga agaaaggatt tcagaaggcc ttcttttgaa     58560
     tggggggctt tctcactcgc atacgtttgg taattcgagg ggggtgggaa accatggacc     58620
     tgttagaatt cgagatgagc tcttgaaaga aaaattcact gaaaatttga ttgctttttg     58680
     cgaaaaaaat gataaaaaaa aaattaaaat taatatttaa aataaaagca ctagtagtag     58740
     ttttgttttg gattgacata tacttcaaat atataataga atagtggaat aagtaaaaaa     58800
     gattctatcc ataaatatca gattgctgtg ttggtagcaa aaaagacaag atactaaggc     58860
     agaaagcaag tcagatcaat caaagtcttg gaattgcatt acttccctca attttcttta     58920
     atttgtgaag tataagagtt atttatttct gaccctttgt gaaaattatt taattcattc     58980
     aactgaacta gaagttttaa cttgggctta aaaaaaaaat taataataaa aaggaataag     59040
     ttttagatta gtaaattgaa agaaactgtt tgtgtgataa acccatttca ttagagaaag     59100
     gttaaaatac cataaaatag taataataat acaaaagaga gataatacaa aatggcttct     59160
     caacctgaaa ttgctaagaa tttatttgct tccactacca ctttggttga ttatcctgca     59220
     aaggaggaga aaaaatcaca tgaggacaat gtcgacacat atttggaaca acttttctat     59280
     aagttgaaga atgaccctga gatcagtaag ctgcctcaca atgaagctca cttagagata     59340
     tacaacgcgt tgaagaagag ggtcgatgat atcaacaatg agacttgtga accaggtgaa     59400
     gaaaactctt tctttgtatg cgacctaggt gaaattgaaa gattgtacgc taactggtgg     59460
     aaagaactac caagagttca gccattttac gctgtcaagt gtaacccaga tttgaagata     59520
     ataagaaaat tggctgacct cggagctaac ttcgattgtg cctctaaatt ggagatagac     59580
     aaggtcttat caatggacgt caacccagaa aggatcattt acgcaaaccc atgcaaagca     59640
     gcttctttca ttagatatgc tgccacgaac aaagttatga agtccacgtt cgataacgtt     59700
     gaagaacttc ataagattaa aaagtttcat cctgaatctc aactattcct gcggattgca     59760
     actgatgatt ctacagcaca atgccgttta tctaccaagt atggatgtga aatggaaaga     59820
     gtcgactcct tattggaatg catcaaaaca ctgggtctaa acctggtagg tgtttctttc     59880
     catgttggtt ctggtgcttc agatttctca agtttatata aagctgtcag agatgctaga     59940
     atcgtctttg ataaagcagt caacgactat ggtcttcctg aacttaagac acttgatgtt     60000
     ggtggtggct tccaattaga atcatttaag gaatccagtg ctgttctaag actggcattg     60060
     gacgaatatt tcccagagtc aagcaaggta gacattattg cagaaccagg cagatatctc     60120
     gtagcttctg ccttcacatt gtcagcaaat gttattgcta agagaaagtt aaatgaagct     60180
     gaatcaatga tttatgtcaa cgacggtgtt tatggaaaca tgaactgtat tctttttgac     60240
     catcaggaac caacaccaag aactctatgg catgataaca attatcatta tgatgatttt     60300
     gattctactt caccaaaccc aatcacaact tgcccataca aagtttctat gtggggacct     60360
     acttgtgacg gtctagactg tattaccaag gagtattaca tgaagcatga cctagtggta     60420
     ggagactggc tctacttccc aagattgggt gcctacacct ccagtgcggc cacgccattc     60480
     aatgggtttg accaaactgc tgatattata tacatcaact cagagaacca tgacaatata     60540
     tgagatgcaa tggagccctc atccggttct tctgactgta atgaccatcg caatggagta     60600
     gaaagcttca ggaataattg atcgaagccc gagtcatatt tgagtacaaa taatcattta     60660
     gttatatgta tctgaccaat acatgcaact tacatatgta cattatttca tgccttattt     60720
     agacatccat atcatgaata tctatttatt cttatccctt tattcaccgt agtgtcaggg     60780
     actctacgtg ctcgttttga aggtggttca tcaaaggagc agtttgcatc ccctaacatt     60840
     acaagtgaaa aaaaattcca ttgtttaaga taatttacag tgcaatgccg aaaattttga     60900
     aaatctaagc tgtttaagaa caaagaaaac ggaatacaat gtggatttgc catatatggg     60960
     cacactaagg gctactgtgt tgacaatagt gtattatctt cgctaattca ttctcaccga     61020
     agtttgtata gagattcttt ccagttggga tgtctgaaag caagcttgtg ttcttcaagc     61080
     ctacacttga acatgtgata ccgtggaaaa gatatcagtt agagcaaccg aaggtgctgg     61140
     tcaacaacga gctctatgat gataaagaag gcaagttgat tctatatggt ggtgggagag     61200
     agtttctgtt aagagacata gacagaggtg aagaggtaga agtagaggtt tacatccttg     61260
     aagggcggtt aatgctctgg atcaaacatc ctgatattaa caaaggtgta gagataccga     61320
     atagtagtat aatatatcat ggctcaagga tcaactacga aggtcgtgat ggacatcgac     61380
     tagagttggt cgtgagtgtc tgcagggaca agatcataga cgaactattc ggcagcgata     61440
     aatcacgtga cactgatata tatggtggca ctgtccttaa tggtggtaac gaactcaatg     61500
     caggccatga gggctccagt agaggtgttt ctgaagagct gccgatgtat acgctttcga     61560
     gtgttgagtt agtgctgagg ccgaaatatt ccagttttga tagatattac agtgaggaga     61620
     tagagcagct gtttacattt gacaattttg gactgaaccg tggtgatgat ctgatagaga     61680
     actgtcacaa tcagctggca ttgagtattg agcacagtgc gcaagaggaa gaggtattgt     61740
     catcagataa tgctgggatg aacgaacagc caggagaacc tacatctatg agcacacttt     61800
     taaacagcat gaactcaacg aatggtatgt atcctacaaa catcgcacag tccgaccagc     61860
     gatttgagaa ttctaatagc gatacgccag ttatcggtaa taccggcaac tgcgatgatt     61920
     tagatgatat gaattttggg atggagatcg gcgatgcttc aagttttgca atcgagcaga     61980
     accagctcaa ccctgcatcg gctattctag ggagacgcag ccgtgattct taggaggggg     62040
     gtagtgatat tcaaccgttt gaactccaga actgcaagtc ttgcaacttc caatgtcttt     62100
     ctttttagtt tatttttaat tttttttgtc tttcatatca tcaaaacatt tatcggtttg     62160
     caacttccac tctctctccc ccccacacgc acacattcta cagtgcagac tctatttatc     62220
     gatgaagaaa ttcatcatcg gactttcaat ctaagtaact gttttcgtgt aatactagtg     62280
     tatattgtga atactatgtg catcgaagta cctgcagtgc caatgataca aagatacaaa     62340
     gatacaaaga tacaaagatc agcacagtac ttgtgtagga cctagacccg aatcaggcat     62400
     cccagaacag agaacacgat gggccaagaa aagggaatgt ctagttctag tccagagtcg     62460
     gtgtgaatct caacaactca acatcggtga ggactaatat acgtcatgca ggggagtatc     62520
     aacctcgaga gatcctacca aggccccccc cttgcccttt gtcactggaa gtgtgaaaaa     62580
     acccaacaaa aagccgaaaa atgcagccgc caggaaagga ttccacgcca aaaaataatg     62640
     aacgaaaaca atccatatct gtgttgtccg caactgctaa tatgcttccc cagacggtgg     62700
     taggggggcg gggagagatc ccaggtagag atcccaggaa gattttatcg gtgacgaaca     62760
     acagaatgcg cttcccaatt tttgttgaac aaaattattg aacatagttg acaggcagac     62820
     caaaaaccgg gtaacccgtc aagagaaaaa gtaggcgcaa gcaatttaca agtttcgcac     62880
     aatccaacac tgaaaggaca gtgccgggtc catctactga agaggtgtcg tatagtaata     62940
     tcttagctac ttgcccccca gcaccacaac gaagagaaag gaacttcaca tggaggtaag     63000
     ccggttaaat gctgtgcttg gttccagctg tgcaggctct ctacacgtaa tgtcctctca     63060
     gagctggagg ggaaatctcc actgccccag caattttagg ggctacgaca agagagtagt     63120
     gaaaacggag tgggaacact aacgaacctc gcgaaagagg tattttagct actgccagat     63180
     aacccgggta gagaagtcgt agaaggccaa aaggctcgga gaaacactta acacacacac     63240
     agacacagac agagacacgc actacctaaa gcaacgtacc cgaagccctg cctcaacatc     63300
     ccacgtaccg gtggttcaag gaatgggaaa aatggcaaat ctctgtgggc ctgaggcaga     63360
     gaagcacgta gaaatccatg aggaaatctc caaagatggc aagacatgtg aaaaaaaaat     63420
     tttttttcac atgtcaaaac ccaagggtgt cttgtgtgtc ttgtcaaggc tctctttcag     63480
     tttcagagaa ctacgcgtca gtatcttcct caacatgcca aaagcaagag atagctgcga     63540
     gagtggtcct tctagggaag cagaactcac tcacactaag ccaagtgagt ggaagagcga     63600
     ccagagagag agagagaggg ttgacatggg acgaaaccaa tggaaaggtt gttgaatcgc     63660
     actgctctcg ctatcacact caccactcac actatacagt agccctaccc tatcaacttg     63720
     cgattgctac gggtactgcg aacctggcag gtcgttgttg aattttcact ttgtgcttca     63780
     cactctctaa cgtaatagag tggagagtat agtacttgga caaagcgagc gaggatcgca     63840
     gtagaaagag ccatcccata gttctctctt atagttctct ctttccagtc ctttatttta     63900
     ttttctggat tatattttct ttaacgtttc aatctgattt tatttttaat caattgaatg     63960
     ggttgcctct cgtcgcttgc tccaggaacg tcgacaaccc gacaaaaacc aaggaaagaa     64020
     aaaaaaaacc taaaaaaata aaaaaaaaat ttcttatata aacttgatag atcttaaact     64080
     tctcattttt ttttcacatg ctattgtatt taccaatcga atcagatata agtgactccc     64140
     aatcccccta tctccagtta tacaaataaa gagctatcct tttggcaaat tcccaaaata     64200
     attctctcta aatacagaat ctgtgataga ttataactac aaaggaaaac catagcctta     64260
     agtctcctta ctaaagatta tagatttata gaatatttta gttctctgac aactaaaaaa     64320
     aagataaaga aatttcattc tggggaaagg tactggacat atcctgaaag gaaattagat     64380
     aagaaagtaa ctaaccaata gcaatggata ctagaccttt cacgatatca tatggctcaa     64440
     ttgagcatac attggttatt ccaatctctc aatttttttt agtgtctcaa ttgaacgacc     64500
     agttcttgaa actagaatta cctaaccatc agcaaccatc ggaagatttc caaagtgacg     64560
     aagagcctac ttctccagtg gagttgttgg gtaagttcat cggctacgtc acgtctttga     64620
     tcgacaccgc tggttctgat gaatcccagc agaagaaaat tacctcgata ctagagttga     64680
     ctttcaagga cttcgagagc tcttatttga acggtaacga tattcacact ttggcagcta     64740
     agttactcca ggacaatgat atcgctctgg aagaacaagt agaagctgtg gagaacaaca     64800
     cgaataacaa gcaagaagtg ttcccaacca cattaccaaa agttaaggaa ttggtgaaga     64860
     actacttaaa cgccaaagtg cttttgcaca agcttggtgt catcactgtc cagaatagtc     64920
     aaaacaagat aaactctgca ttgttcggta gcgatatcac caaaatttac gccatcttcg     64980
     gtggccaagg taacaccgac gactacttcg aagaactgcg tgacttatac caaacataca     65040
     gctacctaat agaagatatc ctagattttg tctctaagac actaaacaac ttactgaaaa     65100
     actcttccca ggatatggaa aagatcttca ctcaaggttt agatgttaag cactggttga     65160
     aataccctaa cgctacccca gagaacgact acctgttgtc tattccaatc tcttgtccat     65220
     taattggtgt tatacagctc actcattatg cgttgactgc aagactatta aacgttaccc     65280
     caggagaatt gagaagcaag attcaaggtg ctactggtca ttctcaaggt ctagtggcag     65340
     ctgtatccat tgccgaggct gactcttggg atgctttctt caaatctttc gaaaaggcca     65400
     tcactttact gttcttcatc ggtgtgcatt gttacttggc ttacccaaaa acctctctac     65460
     caccttctat tctacaagat tctctagaga atggtgaagg tgttccatct cctatgttaa     65520
     ccatctctaa cctaaccaaa gaacaagttc aagaatatgt ggataagacg aacagccatt     65580
     taccagctga gaagcatatc gtcatttctt tagttaacgg tgctagaaac ctagttgtat     65640
     cgggtccccc acaatcccta tacggtctaa acttgactct gagaaaggct aaagaaccaa     65700
     gtggtcttga tcaatcaaga attccataca gtgagagaaa gctaagattt tccaacagat     65760
     tcttacctgt tgcatcacca ttccattctc atctgttgga accagctaac gaagcaatta     65820
     ttgacaatct aaaggcattt aatgttgagt tttctgccaa ggatttgaaa attcctgtat     65880
     atgacacatt cgatggctcc gatttgagag ataactctgg atcaattgtc cagagaatta     65940
     ccgattgcat tatcagatta cctgttaact gggaaacatc gactaaattc gaagctaccc     66000
     atattcttga tttcggccct ggtggcacat caggtttggg tgtcttgact caccgtaata     66060
     aagatggtac tggtgttcgt gttattgtag ctggtaccct agatattaat ccagatgatg     66120
     actatggttt taagcaagag atatttgaag ttgcaagcaa cagtgttaag caaaatccaa     66180
     actggttgaa ggaattctgt cctaagctag ttaagactaa ggcaggtaag gtatatgttg     66240
     acactaagtt ctcaaagatg attggtagac ctccactatt gattcctggt atgacaccaa     66300
     ctactgtttc gcctgatttt gttgctgcta ctattaatgc aggttacact attgaactgg     66360
     ctggtggtgg ttatttctct cctggacata tgacccaggc tattgatgaa gttgtatccc     66420
     aaataaagaa gggttacagt ttaggtatca atctaattta tgtcaaccca agaatgctac     66480
     agtggggtat tccattgata aaggaactaa gggaaagagg atatcctata caatccttaa     66540
     caattggtgc cggtgttcca tctctagaag ttgccacaga atacatagaa actctgggtt     66600
     tgacacatct aggtctaaaa cctggttcta ttgatgctat ttctcaatgt atcaacattg     66660
     caaaagctca tccaaacttc cctatcgtac tgcaatggac tggtggtaga ggtggtggtc     66720
     accattcttt tgaagacttt catcaaccta tgcttcaaat gtattctaag ctaagaagat     66780
     gcaagaatat catattaatt gcaggttctg gttttggtgc tgctgaagat acttacccat     66840
     acttaacagg tgaatggtct gcaaaaatga actatccacc tatgccattt gatggtttac     66900
     tgtttggttc tcgtgttatg gtagcaaagg aagcaaagac ttctctagca gctaagaaat     66960
     tgattgttga ctgtgtaggt gtccctgaca accaatggga gcagacatac aagaagccaa     67020
     ctggtggtat tataactgtt cgttcagaga tgggtgaacc aatccacaaa attgctaccc     67080
     gtggtgtttt gttctggaag gaaatggatg acactatttt cactctaccc aagaataagc     67140
     ttcaagctgc tttagatgct aagagagact acatcattga aaagttaaac agtgtctctc     67200
     aaaagccttg gtttgctaca gtgaatggtg aagctcgtga tttgactagt atgacatatg     67260
     aggaagtcgc caagagatta gttgagttaa tgtatatcag aaagacaaac tcctggattg     67320
     atattacttt gagaaacttc acaggtgact tcttgagacg tgtggaagag cgtttcacca     67380
     ctcaaaaaac atcatctgtt attcaatctt atgcgatttt ggaaaagcca gacgaggcca     67440
     tcaagctggt ctttgatgca tacccatgtg ctaaggatca atacttaaat gctcaagatg     67500
     ttgactattt cttagctctt tgtcaaaatc caatgcaaaa gccagttccg tttgttcctg     67560
     tcttggacca gaggtttgaa tttttcttca agaaggactc tttatggcaa tctgagcatt     67620
     tagaagccgt tgttgatgaa gatgttcaaa gaacatgtat tttacatggt ccagtgagtg     67680
     ctcaatacac cactaaggtc gatgaaccaa tccaagatat actggatggt atccacaacg     67740
     gccatattga tatgctattg aaggactatt atggtggcga ttcatccaaa atccctgtag     67800
     ttgaatactt tggtggtgaa gatcctgtag agatcaataa cacagaaatt gtcaaagatg     67860
     aagacacttt agtattggat gcttctacca tcaaggatga agcctactgg ttcaagctac     67920
     tttcaggttc taagagaaac tggagacatg cgttcttctc tactgataga ttggttcaag     67980
     ggtcatctta caccgaaaat ccagcaagaa aggttttcaa accaagtaag cacatgtttg     68040
     ttgagattac caacgccaac aatgaagaaa aatgtgttat tacattgaag gaaatggttc     68100
     aaggtgaact aaagaagaca gctgttttga agttaatcca aaaagattta attgaaatgg     68160
     acatgattga gaacagaaca atggatggaa aacctgttgt tttgccattg ttgtacaagt     68220
     ataacattga agacggtttt gctccaattt cagaagttat ggaggacaga aaccaaagaa     68280
     ttaaggagat gtattggaaa ttatggattg gtgaaccatt caacttgaag tttgatccaa     68340
     gaaaggaaat taaaggtagt gattttaaga tcactaaaca agatatccaa gaattcaccc     68400
     acgctattgg taacaattgt gaagattttg taccaagatc gggtagagac cttcttgccc     68460
     caatggattt tgccattgtc gtaggctgga gagctatcat caaagctatt ttcccagaaa     68520
     ctgttgatgg tgatttgtta aagttggttc atttatccaa cggctatcaa atgcttccag     68580
     gtgctaagcc tttgaaagag ggtgatatta tctctacttc tgcttcgatc aaatctgtcg     68640
     tcaaccaacc aacaggtaag atcgttgaag ttgttggaac cttaagcagg gactccaaac     68700
     caattatgga ggtcacatca tctttctttt acagaggcaa atactccgat tttgagaata     68760
     ctttccaaaa gactgttgaa ccaatttatg aaatgaacat caagtctgct aaagacatcg     68820
     ctgtgttacg ttctaaggag tggttccagt tagatgatga agatattgat ttattgaata     68880
     aggttctatc atttgaaacc gaaacagaag tgaccttcaa ggatgcaaca atcttttctt     68940
     ccgtcaaatg ttctggtcct atctttatgg aactaccaac taaggaaaag attgaaattg     69000
     gtattgttaa ctatgaagct ggcgaatcct acggtaatcc tgtaattgac tttttgaaga     69060
     gaaatgctgc tacgctagaa cagaaagtca atctagagaa tccaattcct attgctgttc     69120
     ttgattcata cacaccaagt actaacgaac catatgccag agtctcaggt gatttgaatc     69180
     caatccatgt ttctcgtcac tttgcagctt atgctgatct accaggaaca attacacatg     69240
     gtatgtattc ctctgctgct gttcgtggtc tgattgaaaa ttgggctgct gatagtgtat     69300
     cttctagagt tagaggtttc aactgtcaat tcacaagcat ggtcctgcct aatactccac     69360
     tgaaaaccag tattcaacat gtcggtatga ttaacggtcg taaactgttc aagtttgaga     69420
     ctaagaacga gaatgataca gttgtcttgg tcggtgaagc tgaggttgaa cagccagttt     69480
     ccgcatttgt tttcactggt cagggttctc aagagcaagg tatgggtatg gatctttacg     69540
     aaaaatctgc tgttgctaag gaagtttggg acagagctga taaacatttc aaagagacat     69600
     atggtttctc tatcctaaat attgttaaga acaatccaaa tgaatttact gttcatttcg     69660
     gtggtgaaaa gggtagaaag atcagagaga actactcaaa tatgatcttc gaaaccattg     69720
     ttgatggtga attaaaggct gaaaagattt tcaaagaaat cgatgagaca actacttctt     69780
     acactttcaa gtcaccaact ggtttgttgt ctgcaactca attcactcaa ccagctttaa     69840
     ctctgatgga aaaagctgcc tttgaggatt tgaaagccaa gggtgttatt ccagtggaag     69900
     ctgcctttgc tggtcactct ttgggtgaat atgctgcttt ggcctccctt gctgatgtta     69960
     tgtctattga atccttggtt gaagttgtct tctacagagg tatgaccatg caagtagctg     70020
     ttccaagaga ttcggctgga agatctaact atggtatgat tgcagttaac ccaggaaggg     70080
     tttccccaac gttcacacaa gatgcccttc aatttgtagt tgaaaaggtt ggttctagaa     70140
     ctgaatggtt acttgaaatt gtcaactaca atgttgaaaa ccaacaatat gttgcagctg     70200
     gtgacttgcg tgctttagat acattgacca acgtactaaa cttcatcaag atccaaaaga     70260
     ttgatattgc caagttgcaa gatgagatgt ctctagaaaa ggttgaagaa catctatttg     70320
     agattgttga cgaaatatct aaaaagtcta ctgctaaacc acaaccaatt gaattggaga     70380
     gaggttttgc ttgtatccca ttgcgtggta tttccgtccc attccactct tcatacttga     70440
     gaaacggtgt gaagccgttc aagaacttct taaacaagaa tattatgaag gacaacgtga     70500
     aggttgacag attgattggc aagtacatcc ctaacttgac tgccaagcca ttccaaatca     70560
     ccaaagaata ctttgaagac gtctacaagt tgaccggatc cgacaggatc aaggaaatcc     70620
     tggataactg ggagaaatat gaagcttaaa tcgcttcaca caaaaattca agcttttata     70680
     tagcataact aaattgcatt tactgttttg tactataaat tttgttgatt attgtaacta     70740
     ttgtgaaaat gtttctgtaa ttagactcta aggccatacc tatgactatg ctatgtggag     70800
     acgtgacttt cagcatctaa agagagcaga agtcacatgc gtggctgcgg gtaactggta     70860
     actagtaact gaaatatttt tcatttcgaa aaaatttgaa aattttctca ttgtgaacaa     70920
     ttccgatgct catcgatgac cttccgaatt aggattacaa tcattggtta agcaataatg     70980
     gctacaatgg taaggcattg atccttttaa tttagctact agttgcaaga gtttgaactt     71040
     tttgatatac tgggttttat ttttgattag tttattgttt tgtcaaaaag taatgattct     71100
     cgtctaaccc accagcgatt acccatcttc taaaccaaga ttaactttgt tctatcaaga     71160
     acctgttcca cttttgagta cagttcttta actgagaata cattacaagg tatcaaaaaa     71220
     gtagctatta ctgttttgta cacctgagga tacttttcag agttttgaaa tatatttatt     71280
     gctataagac ctatttcttt ttatttgcca actctcttaa agtacttcat tgaaagaagg     71340
     acaacttata gaggagctta agacattgac ttattaccaa caagataata ttaacagaaa     71400
     tgcgtaagtg caaagttttt gttggtaact ctcatcctga actaggaaat ctagtttgtc     71460
     agagattagg cattgagcct gccccatgca ctctaaaaaa gtttgctaat ggtgaaacct     71520
     ccgtccaaat tggtgtttcg gttagagacg aggatgtcta cgtgattcaa tctgggtccc     71580
     caaatattaa cgaccacatt atggaactct tgattttagt ttcggcctgc agaggtgggt     71640
     cggctaagaa aattactgct gttatccctc aattcccgta ctccaagcaa tgtaaaatga     71700
     agaaacatag aggtgccatt accgctagaa tgttggctaa tcttttggtc atggcgggag     71760
     ccgatcacgt tgtctcaatg gatcttcatg catcacaaat gcaaggtttc ttcactaaac     71820
     cagttgacaa tttatatggt ggtccaagtt tagctaactg gatcagagaa aatgttgaaa     71880
     actatgagga agctgtggta gtttcaaaaa atccaggtgg aacaaaaaga gtcactgctt     71940
     tagctgacgt cttgaagatt aactttgcca tgattcacac tgatcgtcgt cgtgccaagg     72000
     atctttattc ccaacatagg gatatgaagc aactgagaca aagaaagcaa tctttgttga     72060
     ggaagaacaa accaattatt agacaaggtg atgaccctga tgaagaagaa aatatcattt     72120
     tgactaatgg tatccaaacc gcaagaatta ggaacggtca tgttattggc gatgatgaag     72180
     aagatttcat tcctgaatct gcagatgaag ttgctatgga gtctgatgca gaagacgctt     72240
     ctgttactga cacgtatggt ttggggggta cttacgatgc cgttgattct gaggatgagg     72300
     aagaagtttc ggaagcagtt aaggagaaac ttattacttt agtcggtaat gtcaacaacc     72360
     gttccgctat tatattagat gacatgatcg ataggccagg ttctttgatt agtgcagctg     72420
     agcatcttgt caagaactgt ggggcaaaga aggtctatgt tgtcgctacg catggtctgt     72480
     ttaccggtaa ctgtttggaa gaattggaag agtctgaagt aattgataag attgttgtca     72540
     ccaatacata tccaatctcc aacgaccgta tagaaaaatc ggaaaagctg gttgttattg     72600
     atgtttcagc catctttgct gaatgtattc gccgtgatca ctatggtgag agtatttccg     72660
     tgctttttga ttctttatct accctttaga atctagtcta cagattttat ctgtatgttt     72720
     atagttaatt atattatcta acattgtata ttaatgtcaa tgggtgctaa atccatataa     72780
     cttcatttct attatcatta agtatatttt aaatattcat ccataatcta ttaaactatt     72840
     atttcgtgtg attataagta gagtgatagt actatagctt aagagatatc ttgaagctta     72900
     ttattaatca catgttggcc cattttggca tagagaatgg ctaccactat tcaaagttgt     72960
     tctcattgtt tatgttaaat ctgccaaagt tttcattgcg ttttttgttt tatctgtcct     73020
     ttgtttttca agaaatattc ttcgacaaga caaatgcatc aatttgtcat gttctctatc     73080
     tttataccat gtcagttttt cattggaatt gttaacaagt tttcttttac aaagactgca     73140
     caacattgcc tcggatacag tggtatactt tgatttctcc tcgtttaata tactggttgt     73200
     tttgataatg tttgtcttta ctaggtcctt ttcgatgaaa gaatcttcta catgaaaagt     73260
     gctcatcttc attatttgag ataataggaa tgtcaatttt gagagaggaa tagaagttgg     73320
     aattttctgc aaaagttgca atgggtccat tttgaggaaa ttatcttcta aaaatgattg     73380
     taaatgcatt tcgctataat caccgctttg cagtattttt tcgaacagag tcagaaaaca     73440
     ttcagaaccg atttgatcat tcacctcata aacactgtta caatatgaga tagtcttttg     73500
     aaggtcatgt aattgatcaa ataaaatgtt taaagagtca acatgacgat ttagatgaaa     73560
     taaaaagaag gtttgtagaa acataacaaa cttcttatcg gattgtggca agcctggaag     73620
     cctctcctga agagtttcta ggcatttagc tggataatca tcttttatta gtttgattag     73680
     tgatgctaat tttgatttgg cgtcttgatt tgataaattc tcaacatatc tagatattag     73740
     ttcaacttca ataaattctt gcctagcatc atagacaccg ataatatatt ccagatattg     73800
     caaagacaat gtactgtcgg acctttttat aaaattgtat acgcgttggt actcatagct     73860
     tctggaattc attgtttccg tcatgaaaat tggtgttata atttgaactt ttgattttgg     73920
     aaattttcgc aacagccaat cagtatagga aaaaaccacc tcaagatcat cattggatag     73980
     cttttgtaaa tattgtatta ctagaacggt tattgcttgt tctttggctt ggtatccatc     74040
     actcttggta ctatcatcaa taagctcagt aatcaaattt aaagcaaact catgttttcc     74100
     tctttgaaag taaaaatcta ccagctcttg ggttagtcca gctattttta aatcattgac     74160
     tacaatttca taattgcaat catttggaat tcttaaaaat ggcgccaaca gtgcgggttt     74220
     gtagtttaga tatactttga atagcacagt atctatcaat gataatagag atttggcact     74280
     agtatcctca tggtcatcta ttaagaagaa attaatatct accagtaaag tttgtgtaaa     74340
     tgaggtatac tgaagtagct catttggttg cgatacgagt cgacgaatgt atctcctcac     74400
     gtctataaga taagaaatca ggtttggggc aattagctca tattgtattc cagtatcatc     74460
     ccctttggat aatgtcgaaa aatcatggta ctctccggtt agagcaccta ccagctttgc     74520
     aattgatttg ggtaaacttc gagaaattac taattgcgga ggagcccaaa aattactcaa     74580
     gcttccgaag atctcagata ttattatttc tggtaaatgt ggatccatat aagtcaaatt     74640
     attgttgtta ttaatcctgt taaagattga aaaaaacttg tccaacagtt gtaaattaaa     74700
     taaaacggtt acatctcgaa gtcttgagac aagtaacctt gtttgttcat cttcatcatt     74760
     attgttgcaa aactgtggta aagatgtcga ctccacaagt tttgtgtaaa taaggacctc     74820
     tttccacagt ttctcgaaag atgaatgatc cttaacagag gtggttaagg acatttcatc     74880
     cgaattgcta tcatcttcaa ggtctcgaag ttttaactta aaagacttga aacaatcatt     74940
     tcttgtatga ataagtaaaa attggccgtt aatttgtttg aagtctttta ttccttcctg     75000
     aacatcaatt tgtaagaagg gaacaccgta ctcacagtct gttattaata gataagtatc     75060
     ataaatctgt atcaaggaat caatactact cagatagtgt acatctctca ctccattgtg     75120
     ccacctgaaa ttttctgacg ttttattaat taataagaag ggctcgttgc tttcggaggt     75180
     tttcaattgt acaatagagt gatttttcat gtccattatt gtgataccac cacttttccc     75240
     cgcagaataa agaactttat caagatagtc attttgcaaa ttggcacgtt gtataccctt     75300
     gaatttcgac cagatgttac ttcttgactt cttttcagaa actgaagtgc ctgagaatat     75360
     tgaagattgc atatcaattg agtaatcaga tgcatcatcg aaatgaagtg actgtctttc     75420
     cagttcagtt agtgcggtaa taatattgtc aggtgtcctt tttttaacca tttttgtgat     75480
     tttattcata actggcttcg ccgttttgta gttccataaa taggtggctt tattcgttgt     75540
     gacaaccaaa tcatctttga tagtactgac atcgcaaatt atctctgtct tgtcgaggtt     75600
     tagaggaact tcgtaaacgt tttggaagct tctctttctc cattcaaata atcttaaaac     75660
     tcttggagta tgggtggtat atactagaat ggtgctatca gatttactca gttcagattc     75720
     attggtatct agcgattttg ttcggtcgtc gacaatccaa catctagata ttccccttct     75780
     ctccgaaatt ttgtcatatt catgtaaatt ggagctattt aataattgta atgacttgtc     75840
     agacctcaca aaaatagttc caatagcgtg tgcataaatt agctctttac aagagcctgt     75900
     gttatccttt gccttaagta atccaggata agtttgataa agtttaatag tatcagcgct     75960
     tcttgagaat acttccacat cgccattctt ttttactact aatagttttt gggattcata     76020
     tatcgggaga tagtcagcaa tatcactact ttgatgggta tatattagct cggctgttag     76080
     catccctgca tttaattcca agccgtgatg tagttgcgga taatgggtgt gggatgttta     76140
     aaaactaaat tttttgcaaa taatgagaga taaaataagg tacacttgct gcaacttgct     76200
     gcttgataaa agatcaaata tctgctatta ttttggtgag atcaatactc aattgttgcg     76260
     atttcctcaa tgttattgat taaaagtata atctttatat gacaatggaa tagtgaggaa     76320
     gaatagagcc taatgcggga tgctaaatgt tataagtatc gaacctaacg ttatcggtat     76380
     tgtttctgta tgctttaacg tccaattgaa tcgagagatg cgcaactata ctgagtcagg     76440
     aaggtattat ggtagaatcc ctaagcaatt aggctgacac ctaatttgtt tttgttctgg     76500
     ggtaacgtga aaatcacgtg acatttagat atcgaatgaa tgtatataat acttagcaag     76560
     tcagagttaa catattcagt aaaggttttg atgtgggtga gaataggttg gttctaagca     76620
     gtatatctga ggtcatcata gtcgttatag tattactatt attgctcata ttgattttat     76680
     gtaaaaatat attaatgttt ctgcctcagt tgttttcaga atttaaaaaa acaaaaacga     76740
     agtagcataa aatcgatgga gtattaccat tcgactgcat tggcagttct tggttttatt     76800
     acaattttgt gaataccgta gctcaaaccg tcgtgtgcca tagtttcaat tgggtagata     76860
     ttttcttcga gactgacgtg catactcata cgcaaatgta ctgtatacgc atctactttc     76920
     aacggagtgg tcaatttacc ccagtgtcgg gaggttatcc catatctttt aacagagaag     76980
     tactgttgta atctcggaag tagcaatatg tccacatcaa gatcgaatgg ctttaggccg     77040
     tgctcatcct tgggtatctc tccgacaacg ttatctttgt tggtttgatt tactggtgtg     77100
     cgtctcaatg gggctggtgt gcttggcttg tgacttgctt tacctttgaa atgtgttggt     77160
     gttaatggag gtgggtcaag acacgtgaac ccgcagtgtc tcaacgctag aattggatcg     77220
     gtatcatccg tgtatacgtc gcacccccat atttcgttat taaatgtacg cgggcactct     77280
     cctgagtcgt tgaagctctt cataaggtct tcatacttga ttgatatggt aattatggag     77340
     tttgcgctct cttctggaaa ttcgggcaga aacggtacgg gtagcacgcg tctctctaaa     77400
     tcatacggaa acggtacagt agttctatcc tttctatcca ccacgttaac agcgttaagc     77460
     acaccctctt tcgcataatt gtattgtaaa gtaccaagat accgcggcgc ctcagtcggt     77520
     attaccgtgt tcgacacgac ctgtaacact tcctcgacct tcttagaatg cctcttggac     77580
     ggcctatcct catctgtctt cctcttcttg ctgctcttca ctttcttctc tttcttcttc     77640
     tccttatctt tatctttatc tttatcctta tccttgtcct tgtccttcac atcggcctta     77700
     gcactcttgt ttgagtccag cagcgtctct tgcaaactgt atatctgcga ctgagtggcc     77760
     ctatacgcat catccgtcat cacccaattg ctgtcttgga ctatctcggc agtataatcc     77820
     tcctcctcaa gagctagtta tactctttat agtaatgaac tcaatcacaa ggcatcccct     77880
     tacgggcgac gcaccggcag tcctgcgaaa ccctttgatg cgagagtcag agaaccttct     77940
     ttacccggca acagcactgg caaatcgcta acgcagggga ctccggcgat taggccttca     78000
     cgcgtcctgg gcctccttcc cttctgccaa tacatttgaa aagcagtaca gctggtacac     78060
     ccagacacat tcataaacac ccagacaata acagtcacaa cttttttttc tgaaattttt     78120
     ctcgtttcgt tttttctgaa acttttttat ttttcaaaac tgaaaaattg tttggatcct     78180
     gcgaattgct ggaaaaaatg ctcttgttgg tgtgcctgag tccctggctc tggggctggt     78240
     gtcttggaag atgggaactt agcctggggg ctgggaggga agttaggcag ctggaagggg     78300
     atctcaaagg ggatctcaaa ggggatctgg aagcctgcaa gcctgcaagc ctggaagtct     78360
     ggaagggcaa gacgcactgg gctaggatgg cagggacagg ctttcccttg ggactggctc     78420
     ttggtgggtg gggagcgagg gaaggagccc gagggaatcc ttgtgggatt cactgtatgg     78480
     gaataaccta cctgtaacga acttgtaact tacaatttat ttgagatggc ggttaagtgc     78540
     gatgggtata agtgagtctg tttgtgcttg tgtttctaaa tcataggaca cagtagtcga     78600
     tcgacaaaga ggatatcaaa gatggccggt ttgaaggacg ttgttactcg tgaatacacc     78660
     atcaacatgc acaagagggt atgttaagaa atccatttag aacttataat atagacccaa     78720
     ctatatgagg ctttattttt tgaaaccatg cttattgaac tgaattataa aaggtgaatt     78780
     gctgtgagaa aaccaaataa ctatccaaaa tagataatag gtcaaacaac agtgaagtgg     78840
     ttgtcaatgt gcacattcca caatctaaat acagcactac caatagatta aaagaatatg     78900
     cacacacaca atagattaat tgaaaccact tataatattt gagtccgatt gtgagaagaa     78960
     atattttttt attatgtgcc ataagttggc acttcacctt acatgtaatg tggaatcaac     79020
     atcattcaaa gcagtttaca aaaaaataaa tgaaaagtct tgggaattac aaatatgaat     79080
     tatttttact aacaatcatt ttattcttta tttcatggaa attcgtggat ttattatggt     79140
     ttttgttatt gcatctgttg tatgaacaaa ctttcacatt aaatgctgtg tttataaaac     79200
     tgttatcaac tggaaatcgt attatgtggc tgtaatgatt gcagtgctca aaactgttat     79260
     tttgttattt agatttccga tacggaatat aacactgttg tgtggtcatt ttattagagc     79320
     atccccagtt atgccaccga tactgttttt gtaaatttga attggaagga ttagccagct     79380
     attaatggaa caagtttgga tcatagcaga tgtgattcta ctatcttaga tcacacttgt     79440
     taaacataaa caagaatatc ttttattaac agttgcatgg tgtttctttc aagaagagag     79500
     ccccaaaggc cgtcaaggaa atcaagaagt tcgctaagtt gcacatgggt actgaagatg     79560
     tccgtttggc tccagaattg aaccaagaaa tctggaagag aggtgtcaag ggtgttgctt     79620
     tcagattgag attgagaatc tccagaaaga gaaacgaaga agaaaacgcc aagaacccat     79680
     tgttctctta cgttgaacca gttttcgtcg cctccgccaa gggtctacaa accaccgttg     79740
     tcgaagaaga tgcttaaatt aatctttaag ataatacata acatttctta tttttaattt     79800
     ttaaagtaat agcctataaa aatatcatta ttcggtttca acaagttcca taactatgta     79860
     taaataaaat taccattggc atttagaaag gtggcatagc tgaagtagtt ggcgttttag     79920
     gtatgatagc caggtgtcgt atgcagttct acttattcaa ttctaaaact accagatctt     79980
     cagcatgaga ctacaattcg attaggcata agagttacat tataaattca acgagcaaga     80040
     catatctact atgataaata tatgcaagtt taacatacgt gctttaactc agtgtaacta     80100
     tgactattgt aacgttggcc actcattaca ttaagaagct cccagattct ctaagaaaca     80160
     gaacgtttct ctcccatgag ggcaaatgag agattcggat cttgcaatcc aaaggatggc     80220
     ttcaaaagac aacttgcggt cgccttctgt tctcaatagg ccaacaaagg tttaaaaatt     80280
     atcatcatct gttaaaggca caatttcttg atatagtttc gactgatata atataagcca     80340
     atataattta acttaactgg cacattactt ctgaatcttt acgactgttc taaaccattc     80400
     attggttcaa aacagcagga tatacttatc cagaaagctt ccagcagtca tttactcgga     80460
     ttgtcagtct aatattcgga tttaaataga taatattaag tgcaaactaa gcatttgtta     80520
     gagcgccttt ggaagttgca tttatgtctg caaacaaaag tttgagaagt tgtaatcgag     80580
     cttttatata gattgaaatt tttcagaaat cgatgagcct agcgtcgtaa tgtaagatac     80640
     gagattgatg tatcgtattg gtttagggct tatgttgaat atgattttaa taaagtttga     80700
     tctatcgatt tgtattgata taaatccata tttatgctaa ataaacgtta gtttttattt     80760
     actggcttgg ggggacaaag aagatttgaa tcgcgtcagg tgaacttttc cggattctag     80820
     gtatatgtcc atgcgggatg gtctttcaga aagggttaaa taacatgttc aataataatc     80880
     atttaaatag ttcatgataa ttttttggtc ccgaaataat attttatgct tagtcatgaa     80940
     tgaacttcac agatgtacca tcagcaagtc attagaacta aatggtttgt tacaagtagg     81000
     acattttctc attcttgctg ccagcctttc tttgcagcaa tcttcacaaa atacatgccc     81060
     acaagttctg attgccatat ttttccagtt ctttgagcac aaagagcaat ataccagcgt     81120
     tctaaaattt tcaagttctt cggccatgct gtcttcatca agatttgtgg ttgctaaaga     81180
     ggatggcttg ttcatattgt agttttcctt tgacaaaaat tcctccagtt tctcattctt     81240
     ttttaatgcg gtttgaagtt cattttcttt gaattcaatc tccagttctt ttgacttcaa     81300
     cataccattt gcttcggtaa gttcgtttat tagttcattt ttttgagacg aagtgaagtc     81360
     tagtagtttc ttttgctttt gaatttcgga atttagattc atgactttta aattagctgc     81420
     tttgttagag tctaccagtc tcttttcgtt attttgtgat agtgccaact gtttatgaag     81480
     actttcaatt ttctgcttgt ataatttatc tgtgtccttc aattgaagaa ttaattcatt     81540
     agctttattc aaactttttg ataaattttt gttttcaaca agaatggaat ccttagaccg     81600
     catagaggca aaatattttt gatctgcctt tgttttttct attgttaact tcgatatcac     81660
     gctctcatga tttaggtact cgctgtattt tttgtgagtt aagctagaca gctctttgaa     81720
     tgcactttca aggtcttgaa tctccttcaa tagagcatcg gaacttggtg actgattgtt     81780
     tctaaattca attttttccc attggtctct taaaatatct agtgcctgct tcaagtctga     81840
     tattaaaact gatttggaag tttctgcttc aagaattgca actttactaa tgagctcgtc     81900
     tctggttgtt ctaactctta caaggtcctt ttctaaagcc aggttttgag ccttcaaact     81960
     ttcaagggtt ttctcgaaat cactagaaat cttctcttgg aaagtatcct tctctttggc     82020
     taactcttga aactttgata agaaactctc attggtaaga gttaggtctg tattgcttgc     82080
     ttttaatttc tctatttgat gtaacagatc ttctctttct tcttcgttcg aatgcttttc     82140
     agataataaa ttagatattt ccaatcgggt ctgtgcaagt tctttttcgt ttaactgctt     82200
     ataattttcc agttcttcta taattctgtt gagagaagag ttatgtgatt ccagatctgt     82260
     tattttattt tcatattgta aaaacaactt ctttttctct tcctcagtta taccagacga     82320
     ttgagagcta tcagtatggt tattgagtgc ttcttgttct gttttgactt catttttaac     82380
     atgcgtggct ccattagtta ggacaggtga cacgcttgta ggtctttgtt cagtatttga     82440
     aatattatct gtattatcgt cagtcttttg cttgttaaag actcgtttaa cagtcattga     82500
     atcttctcta tcataactcc gtactagtcc atgatagtag gccttgagtg agtcgatttc     82560
     atctgtcagc ttcttatttt gtaagcgtag ttccgattta gtcttattcg ctctttgaag     82620
     ctcaagcccc agtgagtcaa ttttagaatc tgagctacca ttgctattgg tgtatttcct     82680
     taaaagattt agaaactcat ctgtgcgctc tttatcgaca gattcacccg cgtttatcat     82740
     ttcatcgcat aatgttttct ctgactcttc attgcatagc cctcgaagat gtgatgctgc     82800
     agtggaaagc acagacatta gtgtagcaag tgtatggaca ttttgctccc atttatcatg     82860
     aacagtgctg tactgctttg ttaatgcttc aagttcaacg cgtttactat tcagacatct     82920
     aaatagagcc tctttttgaa atgatattac atcatgctga gttaaaggct cgtcaggatc     82980
     gctcagttca agcttttgtt tttttattgg tggttcttca ctggacatga tgtaatctat     83040
     aaggcaaaca gttgtagtta ttggggaata tagaaacaat agttatttaa aaccgtttgg     83100
     ttagtaaggc cgttctttct ccgtttcttt tccttttttt tatccgttag atctaaagct     83160
     tgatagcaga attcaaataa aggaagttag atgataactt gtcactattg agatgagaga     83220
     atgttgtatc agatgctgat atattatcac acgtcttatg agagaagcag gttttatctt     83280
     aaagtgtatt gtggtgtata ttctgtgttc tagcgtcttc tcaataaaag tcttcctaat     83340
     ccttacctaa agcactcggt gcaacagata tttggcgaca gtattgcagg atagcgtgtt     83400
     aagcacttag ttttttgtag caagccctta gcaaagtagc aagacagttt caaacttatg     83460
     tgcttctcat cgtggagaca cttttcaata tttttttctt gtcgacttca tgtttttaga     83520
     gcaacaggaa tttttgcgaa aattgagaaa gcaaaagtat gtcgttatat gtgatatcga     83580
     taagtcaaca attataagga ctaataccag tagtggctga gacagctgtg actactcctg     83640
     aagtatcaca ttcattagat agtggcagca gttactagtc tgatcggtta ctatattttt     83700
     atgttatctg ctcaagactt ctcttgctcc ataatactct cttcaacgaa atagtcccat     83760
     gtctagtctt ttgtggatat gtccagttgt cattcacaac aatcattcag gctcaggaag     83820
     tagtgacaaa gtatcggtga tatattagac ttcatatcag cagtatacta ttattttgcg     83880
     ttgatctgcg ataatgtata tcatcactat ttgatctctg gcaggatgag tttaccaaag     83940
     tcaatgcgct tagccataaa aggaattaat gtttcttctt accaactatg ggttaatgtt     84000
     aatctctagt tttcattatt cttgtaatcc gtgatttgcc atacatttga aatatgatcc     84060
     ccatttctcc cagctagcta agagcactag caaatatagt cacttgatga ttactatgta     84120
     gtacatttta aggcaaaacc caaaagatct ggaagcaaca acctctctcg tagtacatca     84180
     ttcctgaggt tggctatgtt tcccactttt gttttccact ccacaattcc aattcagcaa     84240
     agtgattgtc acttctactt ccatattatc tcctttgtcc tcttcccccc tcggatcctt     84300
     actgttaaca tatcgccaag gcctaacaca ggcatccaac tttcgttgac atcaaggacg     84360
     gggttagggt tttgtcctat agtctcagag aagttcgcga atgcatatca cccaaaagga     84420
     aagttcttca gtctaaggct attttcaatt tcttcgccac ttccacacat cactgccata     84480
     tccttccacc agtatatctt gtgtacatac aaggagatac tctctcttga ccctctctac     84540
     tcacccacca ttgtttcttt ttttctttcc ttggaagcct tcttaactta gaatagaaaa     84600
     atgttgcatt tcaatcaact aattgagtag tcttgtaagg gtgtaaaagt aaacactaga     84660
     aggtttttac gtggcctctt tcactcgcca ttctatgcac atttatcaaa gtagacaagc     84720
     ttgtgcagcc tctcttgcac ttttgtttgt tggtaagaag ttccatttat tttgaaagaa     84780
     atagagatct tacttgcagc tccgtctctg caactggaaa actgctagta ttgataataa     84840
     acgtgtgcag agtttaaata actgatttta ctgtctctga agccttgctg cattagcata     84900
     tgctgctaaa tttgtaccgg ggctattttc acttagaatt tgttatatag gattcttctg     84960
     agaacgggta aagtctctag caaatcgcat ttgggtccat acataaaagt atgtgccaaa     85020
     tgggcacagt tttagcttgc aagcactcat aggcttctga tttatacatt gttcttgtat     85080
     ttctcctttt tgtgtttgtt catgtttgcc cttccacaaa agagtacata aatcttgatt     85140
     caaaatcctg ttacaggtcc tgatactgat cctgattctc aacctctctg gaatcatcaa     85200
     ttaaaagtgg gctggactgt aacattacat ataaagagct ggcaaataat agaaaggatt     85260
     attacgcatc agcaagtggt ttgacataca gtgtctaaat atagaattct gcactaccta     85320
     agctttttgg gattttgtgg aagcgcatca aatagctaga cagccagtgt tagctgaaac     85380
     tataaagttg ctgctagaca agtactaaaa aagtaggcgt ccgtttctag ttgtattata     85440
     ggttgttcga aaagtattct gatattgaag taagttgtgg aacattgatt gcatcggcct     85500
     cctattctaa acattgtgta acaaaagtcg gttagtgctt aggttttagt atcatgactg     85560
     ttaaagatga agaggaggat actaggtcgt ttaatgtttt ttatgaacaa gagatgatgg     85620
     aacaagagga agatgagaag catcttttca gggatttgaa cgctttcatc ggtatgatca     85680
     gtgccgaaga ggtggaggtg gagcgtacac atagtaggaa gaactcaagt tcatctatca     85740
     ctgatctcaa aagaaagagg agtctcagtc tgaaagattt acgaaagaaa gttgagccta     85800
     acgctttcca atttttgaag aggaaaaaca gttcactctc atcattgcta aggttgcatc     85860
     ttctcaacta tttaaggtca gtacaaacaa tgcagcataa acacaatttc ccgctagtta     85920
     aagaaatcaa gaaaagagag atcctactac aatggtggat aaccttgttg aatttcctat     85980
     caagtaaact taagtttgat ttcctactca aaaccgaatg gcctgaagaa gtcccagaca     86040
     cggagctcat atcgatagtt cttgaggcca taagtaggat aattacctta ctgatagttc     86100
     ttcccaatca caacaaggtg gatcatgaag tttacgctca acatctaaac ctaacaatca     86160
     aatttgtgtc tgatatactc atagtcaact caagaattca gaaaaaatac acagcaaggc     86220
     attcatcatc cgcatcatct tttgcatcct caaatatcga ggcagaaact acatttagta     86280
     gtacagcagg ctcagttaaa actcaatcaa atggaaatat atgtgaaaat gcagcagttc     86340
     tccagaatag tgttttgagc atgattgaca actacaattc tttcttaact actttcatag     86400
     gtaaagttaa tgcttatgct tttgtctatt taccagatga atgtcatttt gaatatctaa     86460
     ttttatctac gtggtatcca cgcttaaggg caattaggag gcaaaacagc ttattcccat     86520
     ggaaagaaac acgttatcaa gtatcaagat ctccaatgga ttcaaacaca aagaagtatt     86580
     ttagctgtag gaaaaataat gaacatcaaa aaatttgtgc atcctatatg aaaaataaat     86640
     caatattttt gacattttat tggcattatt ggtatatcgt tttacgctat tcagaaaaca     86700
     tttctacaaa ctgtttcaca aagggtaaca ctcatcagct gcccggtgct gagttattgc     86760
     ttaattttat cgttgaaata tcctttaaag ttgatcttag gatttttgat aaatttgttg     86820
     gtggaagccc tatgagaact tcaagaaaag gcaaaggtaa tagtacgtca tctggtctct     86880
     atggcgatga tattgatgga gcagctattg cactagctcc gtctagtaag agatacctta     86940
     ggaatgaaac agtaaacgat ttcattttta ctaactttgg gactataaaa ctatgggaaa     87000
     ctatcagatc tgttgctggt tgcatgaaaa gttctaaaaa cgttgaaagt atgcttggac     87060
     ttcatgactt agcaattctg aaacaagtta ggaaaatccc ctctcatgat tatacgacag     87120
     ccaatctggt atacaacaaa atatttcagt ttattatttt tcaatttaat tcgctccctt     87180
     ctattaaatt cattcattgg gagatttgga ttcaaggact gatgaaaatg cttgaaaact     87240
     taaatactaa ctcacaaaca gttgcgctaa tttcattctt caatatgtgg ccctatctga     87300
     atgtagctaa gaagcaagct attattgagc agattgtttt aagtgaaaag tattggacct     87360
     taatgttaga ggaaagccaa tctaccatta tcagaattct tttcataaaa ttcgtggtgt     87420
     ttagagctat tccttctatg gatatggatc aaaggaattt actcgcattg agattacatc     87480
     agattgaact tcaaatgaac aacttatttg ggactcttaa aaaggaaggc tatacgacag     87540
     atattccata ttcagatcca tttgcttttg ctctgaacaa tagatttgtc atagttaata     87600
     gcagatgtta tgaagaagat tacctgactt ttgagtttca tcaaagacca agaaagccaa     87660
     aactgattgc ggttttgaat aacgatatat atcctatgga aaaatttcca aatattggca     87720
     gcgtgtctaa tgtgagacca acatatgtgt taaaaaaggg taggtatccg tatgatgttt     87780
     ttgatgaact tctagaagta gtagcaaaaa ataagtctag taaaaaatgg ggtatacgaa     87840
     atgatattga tgatggcctc gaagacttaa tgttagaaaa cttcgatgag tttgtcacta     87900
     agtgtaatgc caatgatcaa gaatcttctg tagtaaaagc gctaacaaat aaagtcaata     87960
     tgtggttttc tgggatgtcg gttaatgagc caatagctga gtccagtaaa gttgatacaa     88020
     aggatatacg tccttctaca gcgcctacaa aaacttctga gattgaaagt caaaacattg     88080
     atcaaacaag tacacgctca tctgtgaaaa gttctggtgg ttggagtttt ggattttcca     88140
     gcagaaaaaa ctccagttcg agtatcagga agttttctga cactgcacta aattccaagg     88200
     ctgtaaacct cttaaagata ggaagtacta agcaaggaaa tagtcattcg gcaaagaata     88260
     ataaggtatt tgaaagttta tatggccatc ttctcctaaa acagaaagtg atatttgctc     88320
     cagaatttac attttctcaa gatgttctat caaatccatc cgtggttggt atcatcaaag     88380
     caattcaatt gcatcctgaa aaatctttaa atgataaatt agatattgtt aacaggaaat     88440
     ggggaagtat ttcaatgaaa aacgttccta gtaatgcaat ccaagtagaa gaaattgata     88500
     aaaatgatat aaatgtgctt gaaattcctt tgacatcatc ctcaaactct atgttgtcag     88560
     aagggcaaga attagatcaa tcatcttctg acacttttgg aaaagatgtt aaacttccca     88620
     aattggatta cgaaaaacta gaattgggaa caaatatccc ggatgaggat gtactacaag     88680
     gtgtgacaca agaaagcaat ctagaaaaag atggtctacc cagcataatg agaatgagac     88740
     aacagactgc atttgagaac ttaattaaga tcatcagaat atttaatgcc acaaaggacg     88800
     aatttcttga ttaccgcgat gatcacgaga aaatactgat tgaatttgaa ctatacagaa     88860
     atggctatca aagtttatta gctatataat ggcattaata taatcaacat gcatatatag     88920
     aattattcaa gttcagtact tgaaatatag catctttttt ttgtgatata tttatataca     88980
     acacaacaat tcattaatat tcaaggactt agaaaattaa tggtaacttg atgttattac     89040
     tttgatcgga cactaattta ttgatatata ttatgagaat gttatgtagt tacgaagcat     89100
     tctaaaacaa aacttatata actgaatatt gaaaaattga taatctaaaa gagaaaactg     89160
     aaagtaaatt aagaaaacta acgaaaaata aaatcaatgt gtagaatggc cacgatgata     89220
     tttcagacca tttaagtttt tataacgttt accacatgta tcacatctat aaggtttatc     89280
     cttgatatct tgtaaattct ctaaatatat ttcgttggat tcaggatcaa caacactgta     89340
     agttccatcg ggattctcaa ttaatgtttg attctgatga ccatgaagtc tgtgatattt     89400
     taagccgttt tgatttttat aggttttacc gcagcccagt acaggacatt taaatggttt     89460
     attttcatca ttttcgtaaa acacccttct agccggatca atagattggc ttgtaagtag     89520
     cccagcgttc tttattcctg ggtgatctgt cttgatgttt gcgttgatct ttggcgctga     89580
     ttggaacttc ttggttgcac taggttgacc gctagaatta tttttcatgc caattggcac     89640
     cgtttgggtt tcttttgagg tgttaacatt tctaccatca ttcagatttc cattttcatc     89700
     cgtattagac ctgcttagtt gatctggagc agcatgactg gcagcgaaca cttgagatat     89760
     gcctgatttc gtctgtgaag tgtttagaat atctggtctg gtgttgttct cgagaggatc     89820
     attcatttga gagttgtcaa gtggctttgg cattatatta cttggtttag cgatgttctc     89880
     ggagaagttg atgttataat tggagaacga gatcgtgtgg ttttgaaaat caggaggtac     89940
     tgtttttgaa tcgttgtttt ggttcatgat gttcatgaag acatcattag taggcacgga     90000
     gtctatcagg ttgccgttgt ttcgcatgcg gtgccctgac tgtccgaacg aaggcgtggt     90060
     gtgaacagct gacagtgcag tatttttgcc aactagtgga gtagtctgtg ttgatgtgag     90120
     ttgggaggat gtaggagatg gtgattcaga gacggttgaa tgaggcacat gacccatgta     90180
     ttgctgacct aaagcagcgt tagagttaga gcgcatttgc ctgtctgtgt atacctggtg     90240
     ttcatgtaag ttgtcatggt tcagctgttg ccgtattatg ttcatgtgtt gaggggtgtt     90300
     caggtcattg tttgttgaag aagtagccag ctgacttcca actgtcccgt taacgggggc     90360
     caatgtgcca tgtttgtgtt tgtgggtgga gtgggatggc tctatgtgag catcttcata     90420
     atgtttcagc aagtcatgca agcccggcaa ggagataccg cagcaagagt aatctttaca     90480
     gtactgttcc tcgaggttgg gtaagatagc gttgtatgac actgggggag agcccgcctt     90540
     catgtggtgc ggatgcagca ccgaagacct cctcccgcta gacatggaga ttgggtgcat     90600
     caagttgatg ctttccctcc tagaaccctg gctgggtttg ttgaaagccg tgtgcagcat     90660
     gacttcatcc ctcagccagg aaccgatgct gagagaaccc cagctcacac cgccaacacc     90720
     ttgcaagtgt gcaatagaat ccctcctaat gcgaggatag tacttgtgat catctattgt     90780
     gatcctgtta gaatcctcca tgtaatccgc aaccatggta tccatggctc tcttcgtaat     90840
     ttcttttgtt tgttttttgt gtttagtatt ggttattgag agccactatt tttttttttc     90900
     tttagtctgt ttcctactct ctctctctct tgtcctgggc gtcttgcgag aaaagaggct     90960
     attattatat acctccctgt tgatctacac cttccaaaaa ctattcccaa aaggtttatc     91020
     cgttagtcaa tggagaaagc atcggctgtt gtgttagatt aggttgtgca atgcccatcg     91080
     ggaaagcttt tggctgtaag tgatgagatg agctcgctcg ctgaaaaaaa atcactgcga     91140
     tggaccaaaa tgttttgttt gccaagtagt gggttttttt ttcacatttt cgtcatacac     91200
     gatatacgta atacaatggg cttttctgca catcaatctc tcttccctcc cactatcact     91260
     tcttgcatgt ctctgcgctg ctgtctgtgc atttcctccc tttcctttgc ccccctcccc     91320
     ccattgcccc ccccattgat gcccttctcc attggattcc acccagacct cgcacactaa     91380
     gttacagttc tacttgctat cttaccgtag gggccaccgt accagtctct gccgtgatca     91440
     ccagcgttct gcagctgtta tacagccttt ttgctggagc cctttggtaa tacggggggg     91500
     gaggcaatcg tatactgttt tgaaccggta tcgttagaaa ctgacgcaga ggaccattgc     91560
     ctcgccactc taaccatggt aactgcaata ttggaaatat attgcacaga cagccgcgta     91620
     gaagatggat tccccccccg ctcctcgctc cctcgctccc tcgcttcttg ccacttctcc     91680
     catattacca gcccctgccc acattatctg gcttttacgt aatcttctcc ggctgtttct     91740
     gttgcaacct ttttcacata gcggagcggt ggtgtgggat actgtagcat tcgtgcaaag     91800
     agggttggtc ttgtgatttc gtagtagggt atttgaagta tgacgtcatt tttgtaatac     91860
     accttatttt atttcttcga aagttgacct ccgtaaaacg ctacatgtat agcatattgg     91920
     gtttctgctc gatgagcatc tctagcttat atatggttat ttcagtattg catatacata     91980
     tagttatatg agtgtgtgtg tgagtatctt tttagaggat atgttcttga gttttgaggt     92040
     gcaggaatac tacatctcct tctgtagcaa ggtagccttc tcggttaagc ggttgatctc     92100
     tttttccttg cggtcgatct cttccagcag ttccttgcgt ctcttctcgg cttcctctgg     92160
     ggtcatgccc ttggtgtcct caccctcagc ggccctgtag ttgtccttca gctggaatag     92220
     ctcactcacc aacgcatatg ttctcacaac aacgaatgta aggaacagcg tgatgccagt     92280
     caggtacatg ttcctctggg ctagaaactt gcgcgacaca acctcgatgc ggtcctgcgc     92340
     aaatacagtg ccgccagtgg caccagcagt gttgctctgg cccttgctgc ccgcattcag     92400
     ctcccggttg atgttgtaca ccttagtgat gcaatcgatg aaaaggatca gaatgaaccc     92460
     gagaatacac ttgataccaa cctgtactgt gggtgcccgg aacggcttca gcaacaccag     92520
     catcataggt ctcctgatcc tggttggtag cggcaacgac agcaccgaaa acaccgcaat     92580
     ctccagcact aatatgccaa acactaacgc atagtacaaa gacatttctt cctttcttcc     92640
     taactctatt ttatgctttt cttgcctatt aatcgaacaa ttctcttcac ttcaactagc     92700
     aattgtttga tcttgcaatt gcttatctgg tggagccctc ttcagcaata tcaaaacgac     92760
     taagacttat tcccgaaggt cattatatat tggacctcat cccttccata tataaattat     92820
     ttgtcacttg tccccttact agcaccggct tcccttgttt cactgcgggc aaactctcga     92880
     catccttggt ggcacacaat gtacgtcctt agtgatcaaa ttaatgtgat gtataacgcc     92940
     attcgaggca aagtatataa agttagttcc ccatttgtat taatgtgaga cttaaagaag     93000
     tgcatggtaa tgataaataa tcagacgtga attgaactgt tatttgagaa atggtatatg     93060
     tagatcagtt ttttagtcgt gcctttatgt ttattttctg gcaagttttt aatattttgg     93120
     tcatgggatg ttgataatga aacaactaac actgccaaat gatattattt ggcttctcca     93180
     gataataaat gtgtgccaaa attaatcgta tattgtaaac atctatgcat tatatataca     93240
     agtacgttat tactatttac tatccttgat ttcatgatat caaagggttt attatcttta     93300
     tgattatgct acgattgatg aagttgatga gtgtgggttc actgttcaat aatgatatgt     93360
     aacccattat tcccaagaat gcttgtaagt cttgcctctt ttgtagccga gagctgaccc     93420
     gatcagctgg gatttctatc cgagcgatgc ccttcaagtc atggtccctg agatactgta     93480
     catatagacg cgtgatgtcc cgttgcctca actctgccaa tatggaagac ttctcagaat     93540
     agttaaaatc aaacccattg agattatcag gtgttcgctt gaataaccta agcatcgcta     93600
     tgttccattg taaattgagc aaatgacggc cttgtcctat tagcacttta tttcgtactt     93660
     ctactttacg atccgcatca attggaacca atatatcctt actgggataa aggcaccgtt     93720
     ttagggactc ccggctatac tgcacattgt acttatcgaa ctctagttgc ttgacaactc     93780
     tccccactat ctccttattc cgagaatcat gcctactcgg tattgtatgt tttatcggaa     93840
     cggtccccag ggactttacg tgcgttaact tgtttttaat agatccctgt atcatatagc     93900
     acacatcaat gatctctcaa aatttatata acgagcctat tatcagttcc ggtgtagtct     93960
     gctccccttc ttactataaa ttcctaagtg gatttgatta cttacaatct tcttgaataa     94020
     cagcgttctt ctatgataaa aaatttaatg tttcttaacc ggttcagcac tgttgattgg     94080
     atatcactgc taagcaagac ctatatgccc tctgtgtagt tactatactt ataactcatc     94140
     ctggatcaat ttttttttta aatttataag atgaacatta ttcagattgt tagaaaaatc     94200
     acatcgacta ttgtcactat tcatatagct atacataatt ggttaaaggg acacagaact     94260
     tgaaaagaat agtaatatat cttcagatta atacgataat tagtagaaaa aagatacaaa     94320
     taatctagaa aatgctcaag tcttgtataa aaattataag tgaaataaat aatatatgtt     94380
     gaaaaaaaaa aaaatattca aagcggagac cacataccgg cggaggtatt gcaaatagcc     94440
     tcatattatc tcactcagat gtcttcattt tgagaagtct tttcgattaa cataaatcag     94500
     taatggaggg gtgtattggg aatattaaat agaaaaaaat aggataaaga atcaaaatat     94560
     aaggaatcgt tatttggaag agatactgtt gggtagcgtt ttcacatctc ctcagttttc     94620
     agctttcttc ttctcagcca agtcagcata gaaagcctca cgtctgtcaa taacgttctt     94680
     gtggaaaccc caccaccagt aggatgccat tacacctccc agactgaaac cgataactat     94740
     atcagtgata attctcttct tcaaagtacc tgtgattgga gctagcgcag acattgtagt     94800
     tttatagtat atttgtgtgt taataggcgt gtttggctct attaagaaaa gtaatacaaa     94860
     attaaattcc cccccgaaaa gacaaacctg caaaatatta aaaagttgtc taaattatat     94920
     aacaatagaa caagcgaaat taatcgtcga ttaagttgct tattgttcct aaccaatgta     94980
     cttcaaagac accactttgt tttaccttgc agaattatta ttggtccatt atctccgtta     95040
     ctttgttccc tcaagctctc ttctcgagta gttgcaggtt gcaactctgt acaggtttga     95100
     gccaatcaga acgggggatg cctccttcgt tggattcaca acttgaagac gaacccgagt     95160
     cacaagcaag actagtgata aacatcaatg ctcccccatc tggaacagag aaattatcat     95220
     cccagtagtg atttcactcg agagaagtcg ttatcactta caatgcatct tgcttacttc     95280
     gcaactgtag aggaagtgaa actacttgca agactgaagc ctgaaatcac tagaagtcac     95340
     caacacggtg ataccaccgg gatttctgat tcttcccaat cagctacaag caaaaagtca     95400
     cagctttgat atcactcatc gcagaataac aaacgtccct aagtctggtc tgagtctgac     95460
     cagtagggga ctgactcaaa acggacatca cagtacctga accggtacta gatagagaaa     95520
     ccggcatcac caagcatccc accctatctt tactcgacca tctgtctcac cataatagtt     95580
     gttctttcat cgcaagcaat ttatatataa aacaatggtt atgtaaaata cactatttgt     95640
     ttggcatact tgtcattggc actgattatt gaataactag cgagcgacat taaactaaat     95700
     ctataagaca caacatgctc ggaagaagat gttttgcttc ctctgcgaag cttgccaaga     95760
     tcaaagtgaa gaccccagtt gtagagctgg atggtgatga gatgaccaga attatctggg     95820
     acaagataaa gaagcaactg atcctaccat tccttgatgt cgatttgaag tactacgact     95880
     tgtctatcca gtcccgtgac aaaaccaagg accagatcac acatgactct gctgaggcta     95940
     tcaagaaata tggtgtcggt gtcaagtgtg ctaccatcac cccagatgag gcccgtgtta     96000
     aggagttcaa tttgaccaag atgtggaagt ctcctaacgg tacaattaga aacatactcg     96060
     gtggtaccgt cttcagagaa ccaattgtca tcccaagagt ccccagactg gttccaggtt     96120
     gggaaaagcc aatcatcata ggtagacacg cccatggtga ccagtacaag gctactgatg     96180
     ccgttatacc tggtcaaggt aagctagaac ttgtctacaa gccaaacggc gacgcctcca     96240
     aggccgaagt tatggaagtt tatgactata agggcccagg tgttgcacta gcaatgtata     96300
     ataccgacga atccatccgt ggttttgccc attcgtcttt caaactagca ctacaaaaga     96360
     aattgaactt gtttttgtcc actaaaaaca ctattctaaa gaaatacgat ggtagattca     96420
     aggacatctt ccaagaggtc tacgattcag agtacaaaca gaagtttgct gaattgaaca     96480
     tcacatatga gcaccgtcta atagatgaca tggttgctca gatgatcaaa tctaagggtg     96540
     gttttatcat ggctttgaag aattacgatg gtgatgtgca atccgacatt gttgctcaag     96600
     gttttggttc tctaggtttg atgacttcta ttttaatcac tccagatggt aagaccttcg     96660
     aaagtgaagc tgctcacggt acggtcacaa gacactacag aaagcaccaa caaggtgaag     96720
     aaacttctac taactccatt gcctctattt ttgcttggac cagaggtcta gctaagagag     96780
     gtgaattgga tggtactcca gacgttgtta gatttgccaa cattttagaa tctgcaactt     96840
     tgaacactgt ccaacaagat ggcattatga ccaaggacct tgctttagca tgtggtaaga     96900
     ctgatagagc ttcttatgtc actaccactg agtttttaga tgcagtagaa aagagactac     96960
     aaactgaaat taaatctatt gactaaatgg agcgaaagta atttttcata tatcaacttg     97020
     atttgttttt tgtaggaatc tctaccttaa tgcgattaga tggttaaata ctatacagtt     97080
     gtacataaaa tttcatgttt tttatgcatt agaattatca ttcattgata cacggtgctg     97140
     tcagtaatgc ctatttcatt atatacatac aattgaggac cattatagtt aaaaagactc     97200
     catagtagaa ttatatcatt atagtatcac atcaactatt gttgtttaca cgtatcggct     97260
     agatctttat ccagatcagc cagtttagga tcatttgcat ctatattcaa catcttagac     97320
     atttcatcga aatcattagc tgggtttcct ccgttgaaat ttttgctcac tggtgaatca     97380
     ccaagttgtt caagctgatc aagcagctct gtaacttcat ctctatcttt gtcattatca     97440
     taatcgggtt tctcatatat gacaatcagc ttattaacca gctcaaattg tcttttatag     97500
     gtatccatat tatctttatg agaagggtga tctttattat cttctagcca ttttgaaaac     97560
     tcaatttgca tatccttcat tggttggtac agaacctcct ttgacgacat tttattcaat     97620
     atacctagta tcgcattatc catttcacca tctgctggaa catcacctga atcacttaca     97680
     agatcattta gtaatttgga tagcacttca tctgggttgc cagagccatt gatactttgt     97740
     ttcttctctt cttccagttg ggtatcaact ttattggcat tctctttcag tctatccaaa     97800
     gtgctggata tgacatcctt aaatccacct ttacctgctt tctcaccctt tgaagttgtc     97860
     tgagtattga gactttctag ctgttgtgta gtggtttcct tgggaacttg cccaacttct     97920
     tctagaatat ctagcagttt cttgaagttc tcagcagcct ctttgtcctc tatgttcaca     97980
     ttggcaccgt caccgttctg tttcattaag ttctgaaatt cctgttgtaa atcctcaatc     98040
     atttccttca ctgcaggatc atctttatcc atcacaggat cagctggctt cttcaaacca     98100
     tctgcctctg tggttcctcg gctctgcgtg gtttctgcct gcacatcctc tagcttagat     98160
     ggatcctcat ccagcaaatc atccaagtca tcgtagtcaa aatcttcagt cattatacca     98220
     caaaccacaa ccttcactat tggtggaatt tagattaatt taaagtaatt acagctatca     98280
     acttaagcac tgttattctt gtactgtacc tgatcattaa ttctaagggt atgtctagtt     98340
     cttagaactc atccttgaca cttcgggttt tattctatca atttttgccc acagtgacaa     98400
     aaaattatat aaactctgtg gaacctgtga aagtatttca aaagattagc actacaattt     98460
     aaagtgcatt ctaacaattg caaagaggta gctaatttca ttcttggtca aaaacgttgt     98520
     tgaggaaaca ctagcagtgc ttgctgtcat ttttggaaac caagagctca gggtttagta     98580
     aagaaggtat gagtagtttg tgtttacaaa ggttacaaga ggagagaaag aagtggcgga     98640
     aagaccatcc ctttggattc tatgcgaagc ctaccaaggg acctgatggt actttgaatt     98700
     tgcagaaatg ggaggctggg ataccaggta aagaaggcac catatggcag gatggtgtgt     98760
     ttcctatcac ggttgagtac cctgatgagt acccatctaa accaccaaag gtgaagttcc     98820
     cagctgggtt ctaccacccc aacatatatc caagtggaac tgtttgcttg agtattttga     98880
     atgaggacca agactggaga ccggctataa ctttgaaaca gattgtgctt ggtgtgcagg     98940
     atcttctcga ttcacctaat ccaaactcgc cagcacaaga accagcttgg agggcattct     99000
     ctaagaataa agcagagtat gagaagaagg tactcataca agcaaaacaa tacactaagt     99060
     gaactaatcg aagaaatgaa atcacagatg tgccgttctt ggaatggcaa cattatgcca     99120
     ataaacaaca acagacaaca acatcggata accttcatgt atttccgtct cttcaaccca     99180
     tgccaaagga ttggttaaga gtattgtgtc ctcttgaagt tccaaatcaa aaagaatgta     99240
     tactgcttgt tataatcatt tcaatgatca gatattttca ctttatgaca gttttggtca     99300
     acatatatgt attccttcta ccctagaata gttgttagat ttttatgctt cttatccaag     99360
     catttgtata agtattttgg ataataatgt aatatttacg aataagaaac ttaatattaa     99420
     aatttcggaa caataatgca ataatggaca agtgcagcaa gaaatagttc atgtgttgag     99480
     gactacatgg aaataatata cgtttgaaat tttaaagtcc aaacctctac aattacaacg     99540
     cttttactaa atataaaaaa atgatataat tttctattaa tgccagtata taattaaaat     99600
     gaaaaataac tttgtgaaaa aaatcactgt ctttctacat ggtctatttg gttgctctat     99660
     taatcccaat aatgccccaa acccgtccac taaacctaat gagcttcgct ttctttgtag     99720
     tttataaagc tacccagaat gttgaaagtt tctgttgcgc gctcctttag ctctggtgac     99780
     ttatttctat cgacaaactt gaaacgctcc ttcaggttag gaacaacttt ttctttcaat     99840
     gtttgcaaaa aactatcttt aacaaatact tcagtgtcgt aatcataagc agagtcagaa     99900
     tatatctcaa atatgaagtt tgtcacctcc actaacaata atggatccga ctccttactg     99960
     gtcagtattt ccataaaaaa gtgcccaata aatctattaa tttctacctg attctgtacc    100020
     aaagccaatg acgatagaac accaatacat ttttgctgca attcaatttc attacaggtc    100080
     ttatactcat ttatgatagt ttcaacaaat gccatactat tgttcaaacc aagctggtta    100140
     ataacagcaa gaggttctga ttgtagagta gctgccttca acattgccca aaccacactc    100200
     atcaaactaa ctttcaatga aatatctttg ctatctgacc cttcttcttt tttaataaaa    100260
     ttccatagca aggtatgctg gttgtttgga agttcataga agtttacatc aatagacata    100320
     tatagccaca acaaattatt ccacccaata agaactctgg cagggaaaga agatgctaat    100380
     ttattaaaga caagcggaac gaatgacact aatgtctcgg acagcgattc cggaagcttc    100440
     ctcttatgct cttgctcaaa cttagctgct ataatttcaa taatcgcggt tataaggtct    100500
     atagtaattt caatactttg gagttgcata tgagcaagag cccttttctt agtatattct    100560
     ttgattttag cagcaacttc tgaatccacc gtattggcaa tatcttcatc ctgtgtaata    100620
     gatgataaat ttttttctag ttcaaccaga tcaataccat tgattgcatt gcatgttgtg    100680
     tgaatgattt cattagcttg ttcatatgtc atatccatat ctaagaattg aaggtaaata    100740
     ccttgaatca aaacgtatgt aagctcattg aatgacttgt gatcctcttt ctttaacgtc    100800
     ggtaaaacct taacgaattc agacagagta gggtcactag aaactgtctc tataaattcg    100860
     aatgattccg agctgaaatc gtatattaaa tccaaaatag tgttgaaaac actaattggc    100920
     aatttctcaa taccatactc tagtaaatta accaaaacag taaacaattc cgctagtttc    100980
     tgtgtggtaa ggacttcttc taaaatgcta tcagccccat tacataatgc gataaccaaa    101040
     gataataggt tttccgcaaa gtcaaagagc aagcgcctag attcttttga ctgaggtgta    101100
     gtcttctttg tatcttcaga agcatcttgt gctgccaatg ccctcaagga gtcacttaat    101160
     ttttcaaacc cagataatat gcttgtccag atgtctgatc tccacaaatg cacggcaaca    101220
     tcatagcctt cttctaaaca tagatttctt aataaaccat aagcctcgac tactatttct    101280
     gtgttctcat cggataacaa tttagttgtg acagttggta tcaatttttc ttttaatagc    101340
     aactttctca tatgtgcatc ttcacatagc actgtcgcag aactcaatgc catactcctt    101400
     tcatttggta caacactatt caaattcttt atcaggggtt gtaattttct ttcgattaga    101460
     ttagcatcct ttttggaaat accaccattg tttgggttag cgagtgggtt caaacgggat    101520
     gccgatgttc ttgatctctt cttcgatcta cccattatag tttaattaat tcagagctta    101580
     ttaccaaatt tagcttttcc ttttgccaat gctaactgct agtaagttta caaattttca    101640
     aatatctatg cacttttatg atttgcgatg agctataccc agttcaataa actgggtata    101700
     ttccaaaaat tttccagcga tgagatcaca gtaaaatcga tataactgat cacatgaccc    101760
     atgaatggaa accaattgtt gcgcaaacca ttgagttaca atgtatgaat catatgcgca    101820
     ttgcaaccat agaattatat tcgatcagtg acggatcatg tagagactat aatagtttgt    101880
     atttttaggc tatatattta gaaaacatca atacaattcc tatcaatatt agaggtcaga    101940
     attgcttttg ataatgggtt ttttataata ttatattaat gacagataga aaaataaaca    102000
     ttcattgtta gtagtaacta aggataaaat gttaaaaatg aatccactta tctgtacttg    102060
     ttgaaaccga tgtcagaggc tctttctctg aaacattgac ggcagatgtt caagtcgtac    102120
     tttctgatca aaccggtgtg ggaagagcag acacggcatt gacgagagcc cttaccgaat    102180
     cttcttgggt gagagaacca gacgttttcg tgagccattt ttatcgacta ttcaaaaata    102240
     tttatagtac tatccatatt agccaatcga atactagact ttatttcaaa tttcaatatc    102300
     cagatgtttt tcttggcaag atgtgaataa ccataaggaa aacttgttag taaaaataat    102360
     tccatctatt agatttataa ttgtgacacg ccttttgtat tgattagttt gacaatgaaa    102420
     ttgaatatcc tgtgacataa atccatttca taaagctaca atttattcat catttttcaa    102480
     gcataatttc acccccacaa tgtatctatg atacagtttg aaatcgaact gaaatgcttt    102540
     taactcataa tctatactcc atgcttactc attagcttgc aaagcaattt taccagtgac    102600
     gcaacaaacc ggaaagataa tagctttaaa ccgtaataat ttcttctcaa tttctgattt    102660
     cactggttac taggtcatcg gcctttcata tttaccatta acttatgatt tctgattcta    102720
     atgatgcctg tcaggatatt tgatatttaa cctacccgaa cattcgttat ttccactcaa    102780
     catgccaact ctaaaaagtc atcaatacag tgtccttctc ataactcata ttagcacata    102840
     cattattcta ttgtctcagt ggtgtgtctt ttaactggtg aataccaaat gaaaataaac    102900
     gctgagaaat cactaccatc actattatac ttgttttacc aaaatttcac ctataccttc    102960
     caacattcca aggctaattc caagctagct gaagtccact gccacaaacc tgtctgaccc    103020
     attgcaagct tgacgcaacc caacaccgaa ccaccaccat ctcgtgaact gaaagttcag    103080
     agctggaacc catggtgagg gctctagtgc caccagccaa gccaactgcc attggctctt    103140
     ctgcctacag catatggcag actccttctg ggaacagatt gctatcctca ccggcacctc    103200
     tactaccaca agccaccgac ctctaaccac tggcagtctc tggtagtgaa gcattcgtta    103260
     gcctacaaga gtaacagttt actgggatag tctcgcaatt gtgaactctc caatgaccag    103320
     ttcgtaggac caaagggtag gatggcacag ccattgagta tctacaaaag ttcccttgcc    103380
     cactctgtgt tacacccaaa atggcattgt cgtaatcacg cgaagtgcct tcagccatta    103440
     tttttcaagt ttcttacgtc ctccataaat gtacaggtgt taaggagtaa tgtacggatg    103500
     taaagaaagt gacagtcaca agaaaagttt tccaaacgga tgtcattttc acatcattct    103560
     gacgaacatt tcagtttttt ttttaatgca atttttgcga tgagcttact cgatgagcat    103620
     cgaattggca ctagtattgt ttacatacca taaccttact gttctgcggg cgcagagtta    103680
     gtagtttgat ttgctcgatt tgagctgtaa atacatatgt aagtattgtc ttgacaaatt    103740
     cttaggttat atttcttagg agaagaactt tagtgtctag agttagtaga taggaaatat    103800
     taaacttaca agcaaatcaa cctttcaaat aaaggacttg agatggcagg ccactcccac    103860
     agatcatctg ttaagaatgg gcataaagcc tttaaatcga ggcattcatc caagaatgcc    103920
     ttaaagagag ctaacaaggg taaggttgaa agagaaagta taggtactgg tagaccaatt    103980
     aagaatgctt ccaaacttca aagaagaaac aaagctaaac aattgagagc ccagaaaata    104040
     ttagatactt tacagattag aaaactgttt gaaggttcta atggggccga gaagatcata    104100
     actgtaattc ctctaactga ggatgttgac gcccatgata tcataaccaa gattttgagt    104160
     tcagctgatc ttgatgaaca aactttatct cagtttgtgc ctcagggaat gccaaattct    104220
     gcttttgtta aggatatcca cattaagaaa tttaaatcaa acttgaaatt cattgttcca    104280
     gacatgtcca actttttgaa cattttagat gcttcaaagg ttgcagattt cacaattttt    104340
     gggctcagtg gtacctccga agttgactca gaatttggtg aacaagttat tcgtgctttg    104400
     gaattacaag gtatagcatc ttacattggt gtggtatcta atctatctca ggtacaccca    104460
     aaggagaaat ttcaactaga tgttaaacag tccttagaaa gttatttcaa gcatttcttt    104520
     ccaaatgaag acaaaatata caacctggag aagccatctg actcattaat tgcattaaga    104580
     acactttgtc aaaagtttcc aaggggtgtc acctggaggg ataatagagg ttacatggtt    104640
     gccaacaaca tcgactttat tgacagtgaa acccaacctg atgtcggtga tctagttatc    104700
     agtggtacag tacgtggttg tggattcaac tctgatagac ttatccatat tccaggctta    104760
     ggtgatttcc aagtgaataa aatcgaaagg atagccgcca gtaccagaaa aactaaaaaa    104820
     gatgctgatg agctcgatga gatcagttcg ttactggaaa actcatttgc tgctacttcg    104880
     gaacaagaca ccttagatga atatgctcct gtcgatatgg aatttgaaga tatgtctgat    104940
     gaagatgaat ttgaatacag taatctaaaa gctgcgaggt acgacgatca cggttttcta    105000
     cctggcagag aacaacaatc aaagaaatat aaaattccaa aaggtacttc agaatatcag    105060
     gccaaatggt atcttgaaga tgttgtggag gtagatgatg atgaagagct agaaccagat    105120
     cacgaagaga ccgctatgga tgatatggat atggatgagg ccgttgatga atatgctcac    105180
     gagggattca atgatgaaat ggaagacgac tttactgatg ctaagacgac taccgaagat    105240
     ttatttgtgg aattgtcacc agaggaagaa gaacgtcaat tgagagaata tcgtgctttg    105300
     gaaaaggagg accgagaatt ccccgatgaa attgaactag agcctaccca atctgctatt    105360
     gaggcattga agtattatag aggtttgaaa aacctataca actgtgtctg ggatgtcgaa    105420
     gaaagagatc ctcgtacacc acaggagtgg aacagattat tgagaattgg taactacaaa    105480
     aatactaaga acagactaca gaaagaggct gtcaagacag cacaagtagt tgcaggcgat    105540
     agaatcaagc tacatataaa ctttcctaag aatttactat ctaaggttaa cgatccttcg    105600
     atcatatcat tccctgtgta cggtttgcta aggcacgaac ataagaatgc tatggtgaac    105660
     ttcagcattc aaagatggga agaatatgaa gatcctgtac catctaagga gactttattg    105720
     gtacaatatg gtgcgagaag atatgctatt caacctttgt tttcagggga tgccaacagt    105780
     tcaaacaatg tgcacaagta tgatagattt ttacatcctg aaacggcatc agtggcgact    105840
     tgtattgcac ctgttgattt cactcagtca cctgctattt tcttcaagcc ttcttcgaca    105900
     gacagaaagg gcatagaatt ggttggccaa ggtactttca tgaacgcaga ccacacaaga    105960
     gtattagcaa agagagcaat cctaacaggt catccattca gattccacaa gaaggttgtc    106020
     actgtcagat acatgttttt cagaccagag gatgtcgagt ggtttaaatc tatcccattg    106080
     ttcacaaaaa ctggtagatc tggtttcatc aaagaaagtt tgggtacaca tggttacttc    106140
     aaagctacct ttgacggtaa attatctgca caagacgttg tcgctatgtc tttgtacaag    106200
     cgtatgtggc ctagaccttc cattccatgg aatggagaga gcattgaaga aattcaagac    106260
     taattatagc gataatataa tcattaggaa ataatttatt ctgcattgta cattatatat    106320
     aatcatacaa taatatctgg gtattgatat ttaactttct tgtttactgc tatatattat    106380
     gataacctaa agtgatcacg tatcttttga ttaacgtttt ggggaggaca aacgctatta    106440
     tttaaaaatg cataacacta tcattatcat taattacgcc aaaatataga tatatctaac    106500
     attttatgta agcttaagct tcatgtattg tctaatagaa cattaaacta cacatttgga    106560
     aaccatttcc tatatttttt gagccttaga accatataaa ccatcaacat aaaagtcatt    106620
     tttggttttt aattcatgct caaggattat cttttcaaaa cttaggaggg ctttcttcaa    106680
     ggcatcgttg accgcttctt tcttagcttt attgaaactt tcaattttcg aaggcgttgt    106740
     agctctacta aagcccgtca ttctggtgtt agtcccgtcc ttcaaggtca ctttcacact    106800
     tgcctctgct ataacggtat atctatccgc aagagctcct gtaccaccac cactgtccgc    106860
     actgattttg tcggcaatac taatagatga tgtcgatcca gggaacccgt ccttggtctc    106920
     cacaaactca atatcagttt tccacccgtc aaagccgaac acttcgttcg caaacccgac    106980
     caggacatgt ctcggtatca gcttcgataa gttgtgcttc ccatacctat tactatgata    107040
     tatctgatac gtgtagcgct cgatcttcga ctgcagcacc ccgatccgct gcacagacca    107100
     ctcactagca ggccgcccat cccagtcctc aacaaacact atatcaccga cttcaacacc    107160
     gggccctgaa ctgtacacag cgccctcata cgtgacttta ccatccatca ccttcgcaca    107220
     aatatataaa caaccaatgg ggggggggat ttctaccgtg ctttaatcct ataaacgcag    107280
     ttaactctat cgcaaggaca tctgagaaca caacttaagc aaacaagaaa acccagctaa    107340
     agcaaaccta agcttatata acagctagtc acagccaatg gcagatagct aatggtttta    107400
     gggttcaggt aaaagatcaa tatagcccta aaccaaaccc tctcagcaat agtgctaata    107460
     acccaaaagt tcctatagct tgtacgtagt actctgtgca cagagagatg actttcccgc    107520
     tcaaaataga actgaatcag tgtgaagggc tcttgcttcc accttcaaat gtggtagtta    107580
     gcccactttt gacacagttg ctgcgtgatc gagaaatatc accggaattt tgttctgcaa    107640
     taacgaaaaa caccgagcct tagaaagtaa cggagacaag tctttcctcg acccctaccc    107700
     attcatctcc cagcacatga cattcttatt aactctatcc acaaccacca caatttattt    107760
     cttctttttg acgtgaaatg aacttgcctc ttgcttttta ctgtgccact ttgaacatta    107820
     cgggcagttg aagcgattgc tataagatca tgtgcgattt acacttttcc ctttttttct    107880
     ttttttttca gttttaagtc ttcgttgttg tgtatttaca tgtgatatag cgtatagtat    107940
     tatatccagg cgtgtagaat tatattaggc gtgatccaga ctaatatcac aatgtacgtg    108000
     agtttcgcgt gtcctctctc tgttatctct ctgtaggtcg atctttctcc agctcgttgg    108060
     gctcggcggt tctttttttc tcccccctct ctcttggaat cgcttcttgt cgttcttggc    108120
     gcgcagatct cagcggctaa ttatacaatt gacttcttaa cgccagctat tacttactag    108180
     tgttcttgga agtatagtaa ggatttcgtt cccattgtct gcggtctttc tattgccttt    108240
     aggagaaatc ggcaggagag aaggagtgag aaagaataca ggaactggta tttagctcaa    108300
     ttgaagtggt taaagtgact tgaagtgatt tgaaaggaat atggacatta tacaagggct    108360
     gatccagccg ccaaaggttc agtctgctga tgagacgatc ccgacgctgt gtgatagagt    108420
     ggagaactct acgcttctga gcgacagaag gtccgcagtg ctcgcattga agtcgttcag    108480
     cagacagtac agggagaccg tgatcgcgtc aggactgaaa cctctgctga acaccatgag    108540
     cagggacaat attgacgacg acttggtcaa ggccgtgctt gagacgttgc tgatcctgtt    108600
     cattcgaggt gacggagacg acgacttgac gagaaactgg atatcgttgc actcaagggc    108660
     gcgcaacggt aaataccctt cgccattggt catgaaacag gaggaggaac aagtcgatca    108720
     gttttcactg tggattgcag acgcattgac gcaatcagag gacttgttga aactgatcat    108780
     agaactcctg gagtctgaga attttcacat caagctgtac acaatccaat tgctggaagc    108840
     tgttcttgtg gctagacctt ccagggccag aaacgccatg ataaactccc caacttgcat    108900
     atctacactt gtggcattac ttgacgatat acacgaaccc ataagagacg aatcaattct    108960
     acttttgatg gctgtggtta atgattcgcc acatatacaa aaactagtgg cttttgaaaa    109020
     catcttcgaa agattattca atattataca agaagaaggt ggtcttagag gatcattagt    109080
     agtaaatgat tgtttatccc taatcaataa cattctgaag tacaatatct caaaccaaac    109140
     tttattctta gagacaggca atttaccaaa acttgcgctg ttgttaaacg aacctatatc    109200
     agaaaaggaa gaattctttt ggaacgatca gcgtatcaat aatgtgaaga ccgttttaga    109260
     tatagtcagc ctcacagtgg aagcaggaac tactgtagtg aaacaacatc aagccgcctt    109320
     acttgattcc cacattttat tggtcgtatt gagaatagct ttcttccaca ctatcccaaa    109380
     aaaggttcgt gctacagctt tgatggtagc agccgatatg attaaagaca atgaatacgc    109440
     acaaactgaa tttggaaaca ttgatgttcc ttattttgac ccatcactgg caagtgatac    109500
     acaatttgat aatagccact tagttccagt ggttgaatta ttaatcaact gggccttata    109560
     tgcaaattcg atacacacat ttgacacaag ggttgctgca agcaatcttt taaaagctta    109620
     tctatccaat aacttaggac ttcagaaaca gttcttagaa agacaaattt ctgcattcaa    109680
     agaaattgaa aaaggcagta aagttgatgg tttaaaggcc aacctgctgg aagccatatt    109740
     aatttacgat gcggatttga aattaaatcc atacaaactt tacttctcta ctgatattct    109800
     catgtatcta ttcgagcacg acaacgaagg caatgccgaa cttagagagc tattaagatc    109860
     aatcaaactc ggtacagcga ttgaagacga ggaaccattg acttcaattc agacaataac    109920
     agaaatcgtt attacatttt tatcatgtga agataaaaga gtgccaatat tttatctttc    109980
     gttcctagca tattggctgt ttgcagactt ttctgccgta aatgatttcc tttctgcaaa    110040
     ggaaaacatt cattctttac tggacttctc acatcaaata gaagacgaag atgttactgt    110100
     aaaatgttta attactatat tgctaggtat agcattcgag ttttcatcta aatcatctcc    110160
     aatccctaga ttggaatatt ttgatattgt atcaaactct attggtagag acaattacac    110220
     atccagagtc aaacaattca aagaaaaatc attgttttca aaatctcaaa ttgaaatcga    110280
     tatgtttaat cctccgttag acgatacagg ccttccaaaa atctatttca atgagtattt    110340
     cacaatttta ttcaaagaaa acttctatag aatactcaga tgtttctatc atgatcctac    110400
     cgatgagcca attgcaatcg tttcctttga agctttcgaa gaagtccaaa accaatgcac    110460
     ttccttgaag tctcatcttt cagagttgga aatacagtcg agtgaaaaac gttcccagtt    110520
     ggagaaacag ataaagtcgc taacctccaa ttttgaggcc agtgaacagc taaagaaaga    110580
     gttggaagac aaattaagca ccatctcgga gaaacaacaa acactagaat ctgaatacga    110640
     ggagaaaaag aaagaacttg ccgaaatcac agcgaataac accagcttgg aacaacttaa    110700
     tacacaaaaa gaaaaactaa ctgaagagtt gaagaagcag ttagctgaca ccaaagagaa    110760
     gcttacacaa atggagaagc aagttaaaga actgtcagaa cataaggaaa aaaacgaaca    110820
     aggcatcaat aagatgaatc gagatctgtt ttccttacag agggaaaaac agaagctgga    110880
     agaagataac aaacaatcga agaaagatct agaaaagacg aagaatgatt ttactaaaca    110940
     ggaaacaaag ttgaaagatc aaatcaaggc aaaagaaata ctgatcaaag aaacaactga    111000
     aaaattgaat gaggctacta cccaatccaa ggaatatcat gataaaattc aaaatataac    111060
     ttctgaaatg aatgaatggc aagctaaata taagagtcat gatacatttg ttgcaaagtt    111120
     aactgaaaaa ctaaaagctc tggcaacaag tttcaaagaa ttgcaagcgg agagagatac    111180
     tatcaagtct gaacttgaaa aaataactca agaaagagat acaaatatcg ccgctattac    111240
     ttccgagaag aaatctttgg aagaacttta caaaaacatg gaatccgaga aagatggctt    111300
     gcttaaaaaa atcacagaac tggaaaccgg tatagaatct gataataaga aatttgaaga    111360
     tgaaaagtca gcacttgagt ctgaaaccaa aaggctaact ttagagatcg cggaatttaa    111420
     atccaatgct gagaagttgg atactgaaag agagagatta caaaccttga cagaatctta    111480
     caaagaaaaa cttaatgaag ctaattcctc tatcgacgag aaaaataaag acttgaacaa    111540
     cattcaacaa caaattgagg gatctcaatc agaaatatct actttgaaag ctgagattac    111600
     tcagttaaaa acatctttga atgaagagaa atccactagg aaggcattgg aaaaactaaa    111660
     ggaggaaaat gaaacctata tccaaagtgc acaggatgag ttacttcagt tacaaaaaga    111720
     ggtagacctc ctgaaatctg aaaacaaaga tgcccttgac aataattctt ctctgaaaca    111780
     gaaatacgac gaacttgtaa aggaattgga attgaaaaat ctagagtcaa aacaattaag    111840
     tgataattca ttaaatttga attctaaaat tgagcaacta gaaggtgata ttaaatcaaa    111900
     atataacaca attaaagaac tagaggagaa attatcaact tccttgcaag aacgggaaga    111960
     gaacattgct aatattgcag atatagaatt gaaattaaat agtaaagaag aacaatacac    112020
     tgagcaaacc aataaattgg aagaattaag gatttcattc gaaaagaaac aaagcgaatg    112080
     caaggaattg gaaagtaaat taaagtcttc taacgatgat ctacaagaga aaaataggct    112140
     tacaaaggaa ctacaaaaaa atctcgattc tctcatgaaa gataaagaaa aaactgaagg    112200
     ttcactacaa tccttattag aggataaaaa acaagaagaa aaaaaatata aagaagagat    112260
     agatcaacta ggtaaggaaa atgaggatat tacaaaacaa aataaagagt taaatttgag    112320
     actagaagac tatagcgcta aaattgacgc aaaggatgaa gaattgaaac ttgcaaatga    112380
     tgcagtggct tctaccaaaa agaaaatgtt gaagttagaa gaaaagataa aagatttaga    112440
     agacacgcag catattttca aagattctga aaactctcta aaatctgaac tcgaaaagac    112500
     tgcgttagaa atgaatgaac taagaagcga taatgataac ataataaaac ttaagaacga    112560
     gttacaacgt actaatgata aattgattga agaaaataag agaacggaag agaagttgag    112620
     atcagaagtt gctaagctca aagatgaatt gaaaacaaaa tctgatactt ttgaaaagga    112680
     gagaaagctg atgaacgagg attcatcaac aataatcaag gaatactccg aaaaaatttc    112740
     atccttggaa gaaaaagtag aaaccatcaa gtctgaatat gataaagaga ttaatattct    112800
     tgaggataag aaagaagttc ttgaatctga actctccgat aaaaagcaag aaattatcga    112860
     ttataatcag aaaattaaag agcaagaaac taaagccact gaaaaagaaa aagagatcca    112920
     ggtagccaaa aatgctctta agaatgctga gaaaaaaaag aaggacattg aaaatgattt    112980
     gcgtaccaca attgccactg tggaaaaaga aaataccact ttaaagagag aaaaccaact    113040
     aaaatcagag tcaatagata aacatcagaa caatattcat ctattacaag aagagttgag    113100
     caagcaaaag gaacttgcag ataaaaaaca tgacgaaatt agaaaactag aaaaagagaa    113160
     tagcaaaatg attgacagaa ttgataaact tgaaaaacaa aaagcagata cgaatgagaa    113220
     aatagccaat attgagaagg aaaactcaag tttgatatcg gagaggaaaa cactagtaga    113280
     aaaggtcgaa aatttccaag atgaaatcac taacttgaaa tcaagcctag aaaagaatga    113340
     ctccttgagt tcttctcatg atgaactgaa ggataagttc aatgagctgg aaacagaatt    113400
     gaaaaggaat ctaacggagc taaacaaact agagtcagaa aacaagcaat tgagcgataa    113460
     ggttatcgaa catgaagaaa aagtatccat ggtcgagaaa gaactgtcta ctgctcaaaa    113520
     aactctgaaa gaaagagaag atgttataaa taaattgaaa gactcaaaca atgagctaaa    113580
     taaaacaatc gacaaacatg gcgcaactga gaagcactac gaggaaagta taaccaagaa    113640
     agactccgat atagctcaat tgaaaaagaa aatcaaagac atagaagata aattgtccaa    113700
     cattttagaa gaaaaagcaa aggcagctat gttaatgaca caacttgaga aagacaaaac    113760
     tgaccttaaa aacagtgaaa gtgaattaaa acaggaattg gagcattata ggtccaaata    113820
     cagtagtcta gaaagtaaat taaagtctac ggaagaggct aagaaacatg tggaagaaga    113880
     atctagagaa caacaccaat cgatgtcctt ggatttaaaa gccaccaaag ataaattaaa    113940
     atctgccgag atttctatct cagaaatgga tgcaatcaag aaacaggtag aactgctaac    114000
     taaggagaat gttgacctaa agtcaaaatc gaataaagct gacaattcag cgaaattaaa    114060
     atctgaatta gatgaactca agaaagaaaa cgaaaaacta caactgaagg ttaatgacag    114120
     atctgaactt gatgacttga tgctgcttgt tacggaattg gacgaaaaaa acagtaaata    114180
     cagagaaaaa cttagcgaac ttggtgttga actatcatct gatgaagagg atgatgacga    114240
     tgacgatgac gatgacgatg acgatgacga cgacgaacat tagtatgctc aaactgtttg    114300
     accattgtaa ataccagaaa ctccagaagt tgatgatgct aatgatgtgt tgttgaactt    114360
     gttaataaca caagcactaa caaccaatcg gtgttattta tagaaataca cacaactttg    114420
     taaaaacatt tatacataaa ttatcttaat taataagcac aatacttttt caacaatcta    114480
     aacgaaacac agatattggc ggatatttag taatctggaa aaaatcacta gctttttaat    114540
     tctattgatt attatacaac caaacttccg tctatatcgt atctagatct tgaacgaatg    114600
     tatgggtcaa gttcacaata atttgctgtc aattgccttc ctaatgctat tcttgagtac    114660
     agaagatttt gggattcagt agcatttgat gattcaatcc acttgattgt tgtatcaaca    114720
     aattgtttta taatgagttc tcgttcagat aataatctat ttttagtgtc cacatcttcc    114780
     atttgattgt catgatctgc agctatttct tgataagtat caagattaat cggattacta    114840
     ccttctaaat attccggtaa ttggtcgcac gcaataaact ccttcaaatc atttgacgat    114900
     ttagtgaaga caatctttga agctaccaca gggtcaagcc attttctaat tatcttccag    114960
     atgggagaaa aaatccaagg ggccttatga atatataact tacccaaaca ttcaggataa    115020
     tgagcctcaa aacaggatat taaaaattgc actggtgcat agtccatgtt ggacatagaa    115080
     aaacctgata gatcaaagat aacagttgct gtatctactg gatctttcaa gaacaatctg    115140
     gcttgttcaa ttatcaacaa tgagtagcgc tgcatctcct caagtgattg atcctttgaa    115200
     tgatgtaact tcggtctaac acaaacaatt ggtcttcctt ccttgtcctt accacaaata    115260
     acagctttct gtaattctaa atttttgtag aagccaggca ttgtaccatc ataggctgct    115320
     ctttcacctt catagattat cttatcaacc ttggagtcgt ttaccctcca atcaagtgta    115380
     ttagagatca ttgtcatgga tttatttaag tcccattttc ttgctctgat gaaacggagc    115440
     aacaagctat ctggaaaatc agccctaatc atattccaga attcttctct agtatcatct    115500
     gggtttgagt ttttgagtgc ttcatggagc tcaaaatcag atataccctc tccttcattt    115560
     tcctccaccg aggaatgaat cttgaatata gttgacctcg atctgggtct gtttgttttt    115620
     aattcatggg ctgccagact ggtagctctc ttcctcccac tacatcccga gtcatttagt    115680
     aaaggccttt catccacttt gattccccag aatttcagca gatgtaacca aacaattttt    115740
     agaaactgta gttgttcctc attcaaagtc tttactctaa acgcatagtt atcttctgtc    115800
     attattttgc tacagttata cagttgcgtt tgtcctaaat gttcgatcag ttatacctca    115860
     ttatttataa tatataacaa taatacatgc ggctgtaaac cataaatata tatttgatgg    115920
     ttcggctcag cttaagtggt ccattcccat tatatcgaaa ccaccaccag tgacataacc    115980
     tggttataaa tcaataagtg tcccctttat cgagatgcta ctagggcagt agttccgtgg    116040
     agattgctga aagattgcca ttcaggtgtc tttccccact tgattagaga gcaaggaacg    116100
     agatgcccac tttagcaacg tacatagtat aggtaacaga aaccgtactt cttagccggt    116160
     gctacataat tggacgtgaa gcagcccatg ccattacaca aataaatcca cttaactcac    116220
     agaagattaa gcacttgagt tgcttgctat agctgaaaaa agcaaagagg tgtgccataa    116280
     ttaaagaagt ttcccaaaag ggaaaaatct ttaaatctgg gatctcgcag cgccatgcca    116340
     aaagaggaaa gctgtacgaa gctactataa acctttgtag gacaagaaat ccacggtgtt    116400
     gtacgagcat ctctgagaga acaatgggga ttagcaaagt gaagatcact tttctccggg    116460
     taaagccatc gggttatgct atgtaagctt aatctgtgtg gacatattct ttgaggagca    116520
     atgcacatct ggtagatgat atcccaccgc tttcaactca atgttagcat agttgagggt    116580
     atatgctatt attttgttaa tggctcaacg gcaggcctta ttctatctca atggaatttc    116640
     acagcaatgc tattctagct gaacgtgcga gctatttcca catggtgaaa gatatgctcc    116700
     cccccccctc cccgacaatt agttaaatgt cactagtgct agtcaagaag ctctacgtat    116760
     tttctgcaac tattcatagt ctacacactg taaatgctta tacatattta ggaatttctg    116820
     aaagcgtata ttctattagc acccaccatg catgatggta gcatattctt ggtatgccag    116880
     ttgttagcag acatatggca cctcaaaact tttctgtctc acgttaaaaa ttcaaaatca    116940
     taactaatgt ataccttttg ggcacgtttc ttcttgattc aattaatcct gccacaaaca    117000
     atttgaatga gagcttgact cataatacgt aatacgaatc cctattaaca ataacttcag    117060
     attcaaaatg agcaaatgcc atatatatga cgacacggac ttcatattcc taagagaaga    117120
     aaataacacg aatactatca gaattaatga ttgaagttat cgattttgaa ccagatcaca    117180
     ttgagtgcca ggagcacgaa agattcatat acctttatga ctcaacatac catcacagca    117240
     gaggcattgc ttgcatagta gcatcaccga agagacatag ggcaaagaac aagctgatag    117300
     tgctagtaca tggaagctta tcacataaga atgcaatcta ccagcctcta ctggcacatt    117360
     gtttggctga attgggttac cattctttga gattagactt tcgaggtctc ggggactctg    117420
     aggatgttcg tgatcccaaa cttggaagaa ctatagaaga agatattcac gatattaaaa    117480
     ctgtgtataa ggccacccaa gaggcccaga tttgtgcaaa tctgttcgaa actgagtcaa    117540
     tcacatttca tgcaattgtt ggccattcaa ggggagtact ggctatgttc gattttgccc    117600
     tatcgatagc accatctatt ataccgattc ttgtcaattg ttccggaaga tttgatggcc    117660
     agggattgtt gaaacgttgt tctgagaata atccaaactg gatcgagaaa ggaggctttt    117720
     atgcaacaac actacgccaa ggaaaacttc agaagatatg gattccaaaa gaggagtctt    117780
     tttctgtgat aagaactaat actttgaatt atagaaactt aagtcacgat acaactgtga    117840
     tatccatata tggtaccaat gatgaagtcg tccctccgat ggaagcatca ctggattact    117900
     cttcagtgtt caaagaccat catcaactga tatacatcga tggcgctggc cacaacttct    117960
     acggcaaact tggggaacag aacacaaggg gtctaccttt gagaagaggt atgattaatt    118020
     ataaccatga attggtggaa tacttgcaag atatattcac caaatcagta taactctcat    118080
     gggagccatc cgcaattctc gatacttcct ttactcactt tttaaactgc agtttctcgg    118140
     aatatcttaa tacaattata tgataaatct tgtgtcacag cgtctacact tagctattta    118200
     attattaata tactcaatca ctatttataa ctttccggta gcttatattc atacttacag    118260
     acgaacttgt ttttttttct caattcctca tgcattaaga atttaaaggt aaacaaagtg    118320
     aaggtagtca agcagttcat gctcataatc aaaattcatt acatgtaatt caattaactc    118380
     aaaaattact atttctcata gcacaatatc cttcagtcaa aatagccgcc attgtcacaa    118440
     tttaacacag aatagttctg aattccttga ggataacgct ctgcattgat aagaaacaac    118500
     gcactactcc cgttttctag atatcctagc ttcgaaccgg aaactgaaat aggtcattca    118560
     attcatatat ttccatcaat aaagcaaaaa tacaattggc gctgtttttg atattagaag    118620
     gtgattaaag tcgttagaaa agtgcatgat agataatttt atggctcccg aagtttcaag    118680
     ttgaaagaaa ttgtcagatt gattaaacac cactgattta tatagcttaa aactgataga    118740
     attccgagaa taccttgaat ttaaataagg tgtcaaactt tttttgttcc ataacgtcat    118800
     tccaatttat tgggttgtaa aagtaatact acgggatagt ttagaactgc ggttaacaca    118860
     caacagtact gtaaatcatg tcgaatcaaa tatattctgc caagtactct ggtgtagatg    118920
     tctatgaatt catccatcct acgggatcca ttatgaagag gaagaatgac ggttgggtca    118980
     atgctactca tatattgaaa gctgcaaatt ttgcaaaagc caagagaacc agaattctag    119040
     agaaagaagt gctgaaagaa atgcatgaaa aagttcaagg tggctttggt aaatatcaag    119100
     gtacctgggt tccactcaat attgcaataa atctagctga gaaatttgat gtgtatcaag    119160
     atctcaaacc tttattcgac tttagtgaag agaatggaga cgcagcccca ccaccagcac    119220
     ctaaacatca ccatgcatca aaggcgtcat cagcaaaggc caagaaagct ggtagaagcg    119280
     tgagctcacc tgcaatgaac gattctaaaa caagggctag tacaagaaaa gcaaacacac    119340
     catcaagcaa tgacataacg tctgattctg gcgctgttgt taatccagta gtgacacgga    119400
     ggaggggtag accaccaaat agcactctga ccaataaacg aaaattagga actggtctgc    119460
     aaagatctca gagtgaaatg gcttttctga aacccgaaat accgaatgat ctgaactcta    119520
     atgatattgc aaatatccag caggtaaata gtggtgattt actgagaaat gaaaaaatac    119580
     agaagaatat ccaattaaaa gaaatagatt tagatgatgg attatccagc gatgttgaag    119640
     tacaggagac agacacattc caacctaacc atcaatcttc attattagga gctgagggtc    119700
     atgagttaag aaataatgat tcgcctctat ctccatcatc atcatcttct ctgccaacat    119760
     ctcctgccaa tcttaacgac agcaatccat ttgatcaaag attaggaggt gggggcactt    119820
     cacctataat aagcttaatc cctcgatatt cagtgcaatc acgcccacaa gtcacggata    119880
     ttaatgagaa agttaatgat tatctaacta aattagtcga ttatttcatt tctaatgaaa    119940
     tgaagtcaaa taaaactgtg cctcaggagt tgcttcatcc gccaacacaa agtgcacctt    120000
     ttatcgatgc tcctatagat ccagaattac ataccgcctt tcattgggct tgctcaatgg    120060
     gtaatctacc aattgtagag gctttatacg agacaggcac aaatatcaga gcagcaaatg    120120
     caaacggaca gacaccattg atgagaagtg caatgtttca caactcatac acaagaagat    120180
     cttttcctag gatatttgag ctactgagtg aaacagtttt tgacattgac agcatgggtc    120240
     aaacagttct tcatcatatt gtaaaaagga agtcatccac tccttctgca atatattatg    120300
     tcaacgtgct actgtcaaaa ataaaggata tttctccaaa gtacaggata gaacttttgc    120360
     taaataccaa agatgccaac ggtgatacag cactacatat tgcggcaaga aataatgata    120420
     gggaattttt tgacatactc ataaaaaatg gttctttgag cactatatcc aataatgatg    120480
     gacaaacacc aacggaaata atgaaccaac attatcaaga tctgcatttg caagctcaaa    120540
     ccaatatcgc tggctccaat acatcagcat ataccgatag cttttcgtcg tttggcggca    120600
     aagtaaaagg cagcaaacta cattccatct ccgaattaga tgatgataaa aatacacaga    120660
     atccagaaaa cacagttact aacatagtgt ctaatctaca tttcagctcc aatgcagcta    120720
     tcaatctagt caaaaatatt ccagcattta ctgactcgat gaaacatctt gcagaaaagt    120780
     tcgatgggtc ctataaaaat catgaggaga gctgtagatc tactgaaaaa atgctgggca    120840
     gtatcaaacg aactgtacat tcaacagata atcgaatcag agaaatactg gaaacggatg    120900
     ctgacgccga tatttcatca gcaatcctgg ctcaggagaa ggatataact gagttgaaaa    120960
     tagaagcaga gaatcacttg aggaagttga aaaaccaatt tgagtatttg caaaagcaac    121020
     ggttgttgaa actgacagaa tatcacaatg gcgaacataa tgatacagat aacactctgg    121080
     ataacaagat tgaaatatgt aagcagatta gtgtattaca gatcgagcga aagagaaaaa    121140
     tatcagagtt aatctcgcat tatgaggata gcagaaaaat ccataaatac agaaggatga    121200
     ttagcgaagg tacagaaatg aagacagaag aagtggatgg ctgcttggat ataattttac    121260
     agaccttgat aaataatagt tcgtaatcta cttcgtaatc tagcatagcg taaaattaca    121320
     ctgtaacaaa ttgcaagatt caagatgcaa actcatgcct aagagttttt cgctttagat    121380
     aaaataacat ggaaacataa catgcattaa tttatataaa agattatatc ctcatagaat    121440
     ttatagaact gaaacagcgg atgataaaaa tctgcaatta catccactat atgcctttac    121500
     ctataatttg acaaaaatgg aaaatcgaac cgctaacaag gtaatttcag gtgtagaatc    121560
     aggcctaccc tttcattatt tggagttata acaaaattta ttaggaaacg attaactgaa    121620
     caatggggaa agaaaaaaaa tgataaaata taggaaataa tacaaacgat ttcactttga    121680
     gaattcactt atgttgtgaa gttcaaagat gttttggata atgtcatttt tatccaatgt    121740
     gaattaacct taatatcgaa cgcaataggt ccaccatcat gatgttttta atgcaatggg    121800
     gttaattggg atcgatatct ttgaagttta gaatgattgt aaaagaatta acaggaaaat    121860
     gtaggttttc tcaaaagaaa aacaattaaa atccagtcaa ggatctctta cataataatg    121920
     gcttcacttg gaacgttagc agagatggac ttgtgaggca agaccttacc accgttaacg    121980
     taaacttcat ccttgacaac aacgtcgtca cccaaaacag tgacaccttc caaacgacac    122040
     cacttaccaa cagtagactt ccagccgaca atggtggact ttactaggga gtggtcttga    122100
     atactggagt cggaaaggac aacggatctg gtgattctga caccttcacc gatagtgacg    122160
     tttggaccga taactacatc tggaccgacc ttagcagagg cagcaatctt ggcagatggg    122220
     tcaaccataa cgttaccgac aatgttgtca cccttggtca acttttctgg gttcttcttg    122280
     gagacagagt tcaagtatag aacggtaccg gacaagaaat cctttggttg accgacatcc    122340
     atccagaaac cttccaagtc gaaggagtac aaggactttt gttcaacaag gattgggaaa    122400
     gtctcggttt cgatagaggt tggcttcatt tcgatcaagt caatgacttc tgggttcaag    122460
     atgtacaaac cagcgttgat tctgttacca acgaattcct ttggcttctc gacgaatctg    122520
     tcgatcaagt ttggagtggc aatgtcatgg acgatgacac cgtacttgga tggttcgtcg    122580
     accttggtag cgacaatggt acccttacca ccgtgggcct tgtggaagtc agccaattcc    122640
     ttgaatgggt attcacagat gacatcggag tttagaacga agaatggaga gttgtccttc    122700
     tttaaaacct tctcggccaa cttcaatgga ccagcggtac ccaatggctc ggtttcgacg    122760
     gagaaagtga tgctgacacc atactccttc tcgtactttt gcaaagtctc aaccatgact    122820
     tctggtctgt agttgacagc caagacgata tcggtgacac cagcgttggc caaagcttca    122880
     atctggtgca agatcattgg tctgttaccg aactcaacca atggctttgg gacagtcaaa    122940
     gtcaaaggtc tcaatctggt accgtaacca ccaactagaa ttaaaccctt catattattg    123000
     tatgtatgct atagtcttga gaagtgttaa aaaataataa atgcaaacct tcgctagtat    123060
     tatttttgtt caaagagcta ttctttaaat tgaactttaa gagttaaaga gaaagcaaat    123120
     gtttcaacct aatgaaatat caccaaatat atatatccaa agaatttttc cattagtgct    123180
     ggctggcaat attcaattgc tagtattgat aacaatactt ccaaaaaaaa aatttttttt    123240
     catgtgagct agtgaatccc agtacaagag caaggtatac tagagaggac ttgcaaagaa    123300
     ttgggtcaag ctggctgcat tcgaatgttt ttggcaaatc cacgagaaca ccaaaaaacc    123360
     ctccaaaccg tcgtcgaagt tcgtgtcatt tgttgcctga atttgaaagc acttttttct    123420
     tcggtttggg aatcctcgag agaggtggca cagctcccac tactctcgaa ggctgcccaa    123480
     ttctcactaa agcaaattgc aatttctcga gacttctgac ataaagttcg cgaaaatggc    123540
     aatagctgcc caatcgagct ggcaattgtc ctgtcgaggt attgtataaa ctcttcctcg    123600
     aagctttgag cttcctacaa aatccaagat agcgtgcatg attttttttc gcgtgctgtg    123660
     aaagtcccgc agagagtgga gggcctattt tctttctttt cttctttgaa tgtatagacg    123720
     gtgggctcag aggcagtgtt gagcaccatt catgagcaat gtggatggcc cagggtcctc    123780
     agtgtttcta tttatagatt tctatgctta acgatggcta cttaggttaa tcattgggta    123840
     tcatagacaa ttatatgtgt gttctgcgtt tgcgccagag tactgttacc actacagtta    123900
     gaagtatagc tgcgcagaac tcgagtgcgg tggtttcgta cactggggcg atgcagcttc    123960
     tcgtggttga gttggcacac tcagagtcgt atacatctgc gtagatgaga cacgagagtg    124020
     ctgaacccag agctggtgcg atcattaatg taccgtacgc tgttccgaac atcttctctc    124080
     cccagaccat caaggtgatt gtgggatata tcgtaaacag gccaccatat gcgatacctt    124140
     gcattatgcc aatgtagaac agtttcctgt ttatggttac catgtggcta tggtccagac    124200
     ttgacatgga caacatgtat atcttaccct gggtgactaa acccacaacc aggaacagca    124260
     ggagaatcca cttcacagac agctgcctct tgttgaagta atctaccgtc agaccagtgc    124320
     caagtctagt caacgtagag gtcaatgcat atatggataa cagcgcgcta gacatggcgg    124380
     gttcgtggcc accagcgagc acattggtca atgaccccat attggcgata aacatctcca    124440
     atgggcctaa tgcacagaaa atcgtagcac caaatatgta caatacggga tctctaaaca    124500
     ctttcatcaa cgtcatctgc tgggcatgag ttgcatgtaa tagcctggat tgttcgttgt    124560
     catcgtaatg attctctaca tcgttatccg atggctctgc catccggtct tgttcttcca    124620
     taatatccgc ctcgtgctgg atctgtgcga ctttgcttgt cgcaatccat atcatcacac    124680
     caataacagt gtagatccag gcgaatgcct tgaataccct tcctaggtct aggtaaggat    124740
     aatcaactgg gtggaagtac ttcaccctca aaaactgcga gccaataaga cttgacagac    124800
     cataacatgt agttggtata ctaatagaaa gcaatttggt accggggaat agctttgcac    124860
     atgtaattaa ggcgctgaag tacaatccac tggttgctac accaatgata aagaaacaca    124920
     ccaaggtcgg cgtaaatgat ccatctgatt cattagtgaa gctatgatct cgatggaaag    124980
     tatatgccaa atatgcatac gaaggaataa aacccagaac tgaacttaag ctcagagtga    125040
     tggggccatg tatatcggcg attataccca gaattggtgg agtaaggtac atacccatat    125100
     tgatcacagt tacaatcatg ttgatctgcc atgaactgta ggacagatgt tcctgccatg    125160
     gctgtgcata aagagatatt agtgaaacga atcccgacgt gatagctgcg aataatgcaa    125220
     atatgtacgc aatattgtgc gatgacttag aggaaagcac ttgcggaagt aggacccgca    125280
     agtggtacga caaatagtgc tcaatactag agagagccat ttcttttatc catctaccag    125340
     atcacagagt tgataacctt ataatcagtg cttgactttc acaacttcct cttcaaatta    125400
     ataccttcaa ctgcacttaa ttagctttga ctaattgtca agcacatagt caaagctgca    125460
     gctccaaggg tctcaaatga tgcaattttc tgatccctac gtacttttct attgataatg    125520
     tgatttacaa ttttctcaga aaaaaccgca gagtattaag atctaacatc atcacctaaa    125580
     tgaactcgct cacgtgatat atatatatac catatttgaa tatttaatca aatatagaag    125640
     gtaaaggtat tatatgattt tccgacatcg tgcttccatt tcttattata aataatgtct    125700
     cagtttttcc atttcatcta gtattttatt aattttttaa aaattttcct atgttataat    125760
     cgatatatac gtaaatatta tatgttctac aatctaatgg gtttaatgcc gttaagggac    125820
     tttaactcct tcattattta tttagtttat tcttaagagt ttgcaagaac tcacggtaac    125880
     tttcagtgcc aagaaccttg tcctcgacca agttactggt ggcccacatt ctcaatggtt    125940
     gcaactcacg tccagcagca tggccaactg gttcgctgac tgatggccct ctaacaatgt    126000
     ataatgtctg ataagttata acatcgtcgt gctcccttac cttttggatg atatttctga    126060
     ccctctcgtt aaattcagag ccttcgacta tagccaattc gtgtttacca tttggaattt    126120
     ggaagatatc ttgtaaacca aaaacatcat taaccaattc cggaacagcg tcaccaccaa    126180
     cccaaaggaa taactctgag gagttgtcaa tcaagtatag accgtatctc tcaaataatg    126240
     aggcagatgc attaataggt tctggtagca cgatttcacc attttcatct ggataaccag    126300
     cctcatctac catatcatgc agggagtaaa ctctagcata agcactcttg actaggtatt    126360
     ttagtggcat agactctaag ttgtttagag ctgctgctct atgatcactt ggaacaatac    126420
     cagctctgaa agcggtatgc ttagacaaag cgtggaccag taatggaagc attcttaagt    126480
     tagcgcagaa tcttagtgga gcaccaccag cagtgtttga taccacaatt tcctttttgt    126540
     atgttgcgag aatgtcttgc aatgacttgt ttagtaggtc tctagcgtct tgtaagcttg    126600
     agttcatagc cttttcaaca gccttcttgg tgaagaaatc agcgattgcg agttggtcgg    126660
     cagatgcgta tacttctgag agagattcag tggttggaat agccactgta ataattctga    126720
     tacgacgttg gctagtgttc aaggacagca gcaccgcaat ttgaacataa cagtattcgg    126780
     tacctatatt ttcgtcaatg ctcatttcaa atacgtatga ttgatctctt ggcattgttg    126840
     agaaagcaca caagtcagaa gatctgttga aaaagtgacc ataaaaggca ctcattctaa    126900
     taccggtgga gccacgagct ctcatgacag tttctgtaga taagtccata gacaagaact    126960
     tggagaactc ctttgtgaac ttggtgacat cagcgatatt agcagctgta aaacctgggt    127020
     agaaatgtgt ttgaccaccg gtgaaacgac caaggtttga aagagatgcg acatccatgt    127080
     aatcttcaga ggccaagaat aggtctactg agacctgaga tttactacag gtaatagtaa    127140
     agttcttgta gaatgcatct tgacaagaca gcaactgtgt agactctttt ggtgtgttag    127200
     caacaccaga ctcatttctt ctttgtagtt taccaatacc gatatttggc aaagtagcag    127260
     aaactacaac aatcttacca cctagattag agatcatgtt ttgagcagcc tttaatgctg    127320
     gacctaacgc aaacttgctc atgatgttga attggaaaat ctctggaagt tgagtcaaca    127380
     acttttctaa gttgtttcta cattcattca atggtacaat catcgagtga ggttttggta    127440
     agaatggctc gtcaatgtca ctgatgtcca tcattctaat ttggtcggac tcttcatcta    127500
     gtggaataga gaaataatgc aaagagttgt caaccgccaa aatggatact ctggttctgt    127560
     tatcatggtt tggcaaaaac tccaaggtgt ctagaataga tctggcagtt gtagctaaca    127620
     atccgttttt gacagcgttt tgagaaacat ccaaaacaaa aatgtaagta gatggtggtg    127680
     gctgtctgac tgtgtactct tttggtgcca agtattccat gacggagtgt ttgatttcat    127740
     ttctttcgta acgattggct ggagcacctt caaagctttg atccaattgc attggaacat    127800
     cattagccaa tctacagaag ttacatctcc atcttctacc ttgttcaata aatgtcacaa    127860
     aaggattcat gtaagaacga caacgacgac aacgaacaac taaaccatcc tcgttcaatg    127920
     gaggtgggtt aacttcatcg tgtagatgtt gatatggtct aatgactaac gccaatggta    127980
     acttagattt tttcaaaaga ctaccgttct ttggcatggc gttcagggta catctcaaat    128040
     agtcagaact ggcattggca gtttcagatg ggaccaacat tttgtctgga gaaaccatca    128100
     atggtggtgg tggcaacatc agatcatgga ttggaggagg cagttctgtc aatagatcaa    128160
     ctgggtacaa ttggttcatc ggtttgttag aatgacccat tagaccttga gattgcccat    128220
     acatttgtgg ttgtggggtc atttgttgtg gcatttgttc catcattggc gtgccaatgt    128280
     tcatggctcc catattagta gttactgaat tgatctgttg gttcaattgc tgttgagcag    128340
     gagtgaacat ttgcgcttgt ggtgcttgtt ccatttggtt catggttgga gtttgattat    128400
     aaggagggat catgttgtcg gtggcaccta cttgtggaga ttgaacctga ggtggtatta    128460
     tggatgcatc actaacaggt ataccagcag gtgggacacc tgctccatat tggaattgag    128520
     cctgtggata aacacgtttc ttatggtgag acattggttc ctgataaaat attccctatt    128580
     gtattgtatt tcccacttta gtgaaacctt tataagatca atattgaccg cagagtgctc    128640
     tcaatgtaac ctgcaaggtt taatatagga atcaaatgat atcagagtag tcaacttgtc    128700
     ctcgtttaag aattgctcaa cttttcgatg ttatgttttc caaaacgaag aataatcgat    128760
     ctgatccggc ttctttctgg actaatatca gctaaaaagg aataatcaat tgattacaga    128820
     tatcctaccc tttctcacta gttaaaacac gcaacaagac ctcacaacaa tggccaaact    128880
     aacaatatta ttgctatttt attcactttt ttttccagtt tctgccaaaa tttctggtgg    128940
     aagcgatttc cacgtcgtcg ttgcaatttt ggcagaaaaa caatctcaaa atgtcggctt    129000
     taattatgtc gttctatgtg atgataatag gcttggcttg ttggagtcgc ctttgcactg    129060
     gctaccagga ggtatacgct cgtgttatag actattttgt ctaatatttg aatatttaaa    129120
     gtacgtaaat aagtgcttct aggacaatac ctagtcgcag ggcaactacg ccctcataat    129180
     tgctgtcatg ttaaaagata aaggaacagt gtcgaaatac ggagagaaaa aggaacagga    129240
     atatcattaa agagaaagtt ttgaagtcat tagcaatgat accagcgaca aattactcct    129300
     tttgtagcag tgcagagcct ttgctgttgg aaacttgtct tctttggcca atagaaaccg    129360
     aagttccgcc accttctaac cttgttagct taggaggaag taaagtggca ccattattac    129420
     ctagtgaaga tacttttgct gtgccttgtt tcgtggactt gttttcatta gtatttgagg    129480
     gagacttatt cttggatggt ggtgcggtag gaatcactga gtatctcctt tcgttgttga    129540
     ctagacctgc ttctttcaca cgctttgtgt tcaaattata ttcaggaact ttaaagaaag    129600
     tatctttgtc ttcatcatat tcccataagg accatgttat accgtatggc ttggtctcta    129660
     agcaatagac acaatgaagt gggacgtcca aattagagat tatgtctaca cttaagttca    129720
     taaaatatcc caataaagca cgcgctacaa cacggtgtgt gattattaac acgttgtcct    129780
     gaatcctttc tacctcagtg atcacaggtc tcaacctatt gataacatcg aggtaggatt    129840
     caccgccaat gccagggtaa cgatagcgca atttatcccg ttgtctctcg gcaaattcgg    129900
     atgggaattt tgcttgtatt tctgggaaag tcataccttc gtaatcacct gcactaattt    129960
     catcaagcat acgcatttgc ttgattggat attcatcctc attaaagtat ttggctgttt    130020
     ctatcgacct cttcaacata ctagtccaca caaagaactc attgtaaagt tggtcgggtt    130080
     ggtttaagtc agctacagat ggtaacttat ctttatcaag atctacatca tgtatgtttc    130140
     cagactccaa tttcttgagc tgttcttgtc cagctttgtt tttttcaatt tcattaacaa    130200
     ggaattgtgc tctttgttcg tcaataaatc tagaaagcgc cttagcgtac ttgtcaccac    130260
     ggcttgttat gtgagaatcg cctcccagtt tacctaatac attatcttca ctttcaccat    130320
     ttctcgttat ccaaatctgt ctttccttta ggttaaaatt caacagataa tacaccgtct    130380
     gagaagcgag gaaaccttgt atcttatttg cgattacttt tttaccaaca tcgatcattt    130440
     taatatattg gatatcttct tcatcttcga taggttcgta ggccttaatg tagtttgata    130500
     aacgttcttt gaaatccagt aatgatttct ttgggtcttt tcctttgtaa tcaggaccaa    130560
     ataattttag tctaatatta ctttcaacaa cagccttgtt agtacagatg gattcaagaa    130620
     ataatacctt tagatgagga cttctgtttc ttattctttc taatacttgt tttctgcgcg    130680
     ctttactggt atttgtggca tcaaaaatac ctacagatcc aggcccatcc aaaagataat    130740
     ccatcagctc ttctaatgtg tcaagagccc atttatctct taatgctgtg tattcggtgt    130800
     ttgtgggatc gaaaaatgag gagtcttgtt cagacaagcc catctgctta gcatattttc    130860
     tcctagtgtt accaacatta aaaacttgac agtaatacat cgagtaattc aaataccttg    130920
     atagtttgtt tgtgatgaac gatttacctg tagcgggtaa gcctaccata acaataacta    130980
     atttagaacc tggatcctcc tttgaaatca atccatcagg cgaggtcttg gatttggtca    131040
     acccaggaac atcaattgta gtaggtctcc tctttggatg gtagaattgc gaaggcgact    131100
     ttaccaaacc ggggctggct tcatttggag agggcgattt aggggaaatt atatctgttg    131160
     gacccattgt gaatccttcc gatggcaccg ttttgtttaa gtttgcattg atcttagagt    131220
     tttgtaatgc ctggttcagt tgcaccaggc tcagagtact actttctctg gaagacgaag    131280
     gggtagcctc ggctgaaccg ctaggcgaat tccacatact agccactggc gtgtcactca    131340
     gtggccgcct cttgaaagaa ggcagtgacg acaagatatg tgcaccaagc tggtcccgag    131400
     attcctcgtc atcttcatct tcttcgtcat cgtcgtcgtc ttgtccaata ccaacgtact    131460
     tgctcttcaa atagttcttt ctcggactag caatagcttc atcctcagta tcaggaatca    131520
     tcctatcctc ttcctcgtca cagtcagaac caaatacttc cactttcctc tgaaaagata    131580
     tcgcagaatt actatggctg ctcttcttca caacattgct caaagcaccc tgactgccct    131640
     ctcgagagga cccgggactg atccccgcac cgctcccact gttcgtgggc gacagcgatt    131700
     ccatcttctc catagcttgc gttctattct actgcttcct tgcgaactgg acttcagaat    131760
     caagtaccat tagtaggtct cttatttgaa tgggattgcc ttagtgattt cccttttttc    131820
     cagctggggg acccttccca ttgtcacctc gaactttgaa aaaaatgctg gatgagcaaa    131880
     ccacgccata taagaaagcc tattggtgtg gttttgaagc agtgagttag cgtttagcaa    131940
     cacaacatgt ctacgatgct atgggttgtc gttgctgcgg tgctgctgtt tgtgctgcct    132000
     gtggtgcggg ttcctatgct tgacttgacg aggaggaaca tcatcagatg gcagcgaggc    132060
     gggatacaga agtataccac gcggtactat gggtttttcc acccatattg caatgcagga    132120
     ggtggtggtg agaaagttct gtggaaagcg gttcaggaga cgctacttta cgaccccaat    132180
     tgttccattg tgatctacac tggtgacgtg gacagcagtc ccaaagagat tattgcgaat    132240
     gtgatcaagc ggtttgacta tgagatggat ttcaataggg ttcagtttgt gtttttgaag    132300
     tacaggaagt gggtggatgg cagtacgtgg aagcatttga ctttggtcgg acaggctatg    132360
     ggatcgatgc tgctaaccat cgaagctctc cttcgttttg ttccagatat atggctggac    132420
     actatgggtt acccatttgg gtaccccgtg gttcgttggc ttgcaggctt gcctgtgatg    132480
     acttacacac attatccggt gatatcctct gatatgatac acaagatcga gatagagaat    132540
     cagaaacagc catccaagaa aggaactttg aaactaatct attggaaact atttatgaag    132600
     tggtaccagt atgtgggaaa attcgttgat gtagcaatca caaactcaac atggaccggt    132660
     aatcacataa gatcaatttg gaagagggtc aagataaaag ttatgtatcc accatgctcg    132720
     actgagaaac tggttaagaa ctcttcgcct actgcatacg agacaagaca aaaccaagca    132780
     gttttaattg cccaatttag acccgagaag agacacaagt tagtgataca agcatactct    132840
     gattttatca gcagaactgc aagcaaggac cacttcaaac tggtgctcat agggtcgact    132900
     agatctgaag aggatagggc ttatgtcgaa actttgaaaa gctgggcatt tgatacactg    132960
     aaaataccga aagaatcatt aacgtttaag acagattgta gttacgatga tattaagaaa    133020
     ttccttgctg agtcaacctt tggtatcaat gcaatgtgga acgaacattt cggtattgca    133080
     gttgtagaat acgcagcagc aggtctaatc tcgctagtgc atgcctcagc tggaccctta    133140
     ctagatataa tagttccctg ggattctgca aagaaacagc aattgcctta tagtgattct    133200
     acaaaagaca cgagaactgg tttattcttc aaggacaaga gtgatcctga ttataagcca    133260
     acagatgcac agttcaacaa ctatggctct ctggcagata tatttgaaga agccaatagc    133320
     ttaagcatag ctgagagaaa acagatatca gaaagagcca aggagtgtgc gtcaaacaaa    133380
     ttctctgata atacgtttaa ccatgcatgg gatcacgcac ttgatgagtt agaacataag    133440
     acctccagac tgggatccaa ttaaagaata ttttgaaagc agtttgccat gtgttgccat    133500
     catctacaac aactacataa tgataaatat tatttgttca gtcaataaat catattctat    133560
     atagcacttt tccaatgatt caaattgatc agtaatttct tcaaaatcca atttttcaaa    133620
     ctaagaaggc cttgaagagc cagaagaaaa agttcaaaat caaagtggaa cggtatcgac    133680
     agggatttca agagctcaag aagaggttga ccaggtttaa aattgacatt agacttgttg    133740
     aacaaggtta catctttgga taagtcattt accacataca ttaaagatcg aaacacaaat    133800
     gtctacgccg cctgctgtca gagaagctgc aaagcaagtg gtgaaatgtc tggaaaggtt    133860
     tcctgccgat aggttcaagc atttgacctc cttcaaggat attcaaatct ctaggttcaa    133920
     ccgtatagct ggtgtatctc tcaaaggaga agacgctgcg aatgagaaga agccaagtct    133980
     ttcagaagtc aaagatatga ttagcagaac ctcaggtccc ttaggtctac agaaggattt    134040
     cttgaagaaa ttacagggtg ctttacaaca ggatatggta tctgaagaag gactgacaaa    134100
     acaaaagagg tctttggaag tgttgatgag tgataaatac aagaattatt atgaagtagg    134160
     agacaagtta tacaaaccca atgggaaccc agaatattat cagagattga tggatgaatt    134220
     gacaggtaag aagaaggaaa acctattcac tggtttaaga actgtgtttt ttggtaaata    134280
     gatgctctaa agttatgtct gatctttcgg tacatttcga caccaatggt gtcgaatcta    134340
     gtctctccag attccttaac tgtaggctgg catcataaca caaactcagc tgtaaatata    134400
     tatttggtct gatccagtaa ataaccacat tgatcattga aaaggttcta atgaagctaa    134460
     tgtgatctat ctatatattc tatctgtatc ttgtttagaa acaaaaaatc atagactcaa    134520
     aacttcattg ttagtttact tctttgcgta ggtaaccttg atattattgc caagttttgt    134580
     taattttgga accatttctt ttaaggccac tgttgcagct tcaatatctt catactcgac    134640
     aaatgccaca ttccgaactg ataccagtcg aatttccttg agttccttag tcggtatgtt    134700
     gacttttatc tgatctgatg tacacccaga tggcaaatct gtcagcaata gtatagaatt    134760
     tggctctacg agtttttcat tatcttgttt aggtggtctt gtttcttgtt tcaatgctaa    134820
     tggcactggc ttcttttcat tgattgtggc cgtcactttc tgtgttaaac ctgtcacagc    134880
     agctttaatc tgctcatcat caacaccttt tgatcttaat ttcgatctca gtcttctctg    134940
     tttccttctt agctttaaag tttccagttt atgttgattg ttctctaaat cttctttcct    135000
     atatttggtc cgcaacgcct tctgcaagac acgttcgttg tctaagtaca agcctaaaaa    135060
     cgactccttc ttagcaaaac taatattgat tattcttcca gatactttca atttattgtt    135120
     ctggtagcga tccataaaac tctgagccag ttcatggctc tcgaaggtta ggaagccttg    135180
     atttcttaat cgcagtgatc ttgatagcga aattgagatt agacccagtg attcatccaa    135240
     atagagattc ttatcctgtg attcctttaa ttcattatat tcattgaagt cgattgaggc    135300
     aggtattggc tttgatgggt tcagtacata aatattgttt ctgttgatgc acttgagaag    135360
     attcctaatg aaagactcct tgttaactgg ccttctgggg agattctgta aatatagcgt    135420
     ctttatgttt tcttgcttca taaccgatag tggccttccc gttctgaagt aattgttggt    135480
     gatggctcat cgatgagctt ctcttaaaat tattgttatt acttcaaatt tagtgggctc    135540
     gtgaggacgt attatataaa atacaaaagg tgtatttcaa cgtagcttga ttgttactaa    135600
     tattattatt ttattgtaga tttaaataca caatagtaag tgcattcata ttacttatgt    135660
     tataaagcct ttaacttatt ttgacgaacc gcctgcgaat tatattattg ataaaagtgc    135720
     tagaaatgaa aaaaaataaa tgataaatac aatgatgatg gaaataaaat taaaaataaa    135780
     aatatatgaa gattgttcta ccattcacaa ctatatgaaa ggccacagaa gaaaattacc    135840
     ttccatgtgg atgaccatat gcgtagcatg gaaatgtatc atgaataaaa tattgttcct    135900
     cagtcaagca cataccggaa agacaactgc gatttaataa gagcaagaag gtgataaaac    135960
     ctactcactc aaatgcctct attgtaaagg aaaggacaac cctcattcca aaatttaaat    136020
     ttatcaatat tcttatttct tagcagcctt ttgagcggcc ttggtaacct taccagcctt    136080
     gtcagtcttg tcaacagact tgatgacacc gacagcaacg gtttgtctca tgtctctgac    136140
     agcgaatcta cccaatggtg ggtagtcgga gaaagcttcg acacacattg gcttggatgg    136200
     aacgaactta accaaagcag cgtcaccgga cttcaagaac tttggagagt cttccaactt    136260
     cttaccggat cttctgtcgt tcttttccaa caattcttcg aacttacaag caatgtgggc    136320
     ggtgtgacag tccaaaactg gagagtaacc agcagagatt tgacctgggt ggttcaagac    136380
     aatgacggta gcgttgaaag aagcagcagc ctttggtggg tcgttcttgg agtcaccaca    136440
     gacattacct cttctgattt ccttaacgga aacgttctta acgttgaaac caacgttgtc    136500
     acctggcaaa ccttcagtca attgttcgtg gtgcatttca acggacttga cttcagtggt    136560
     aacaccagct ggggcgaagg taacaaccat acctggcttg atgacaccgg tttcgactct    136620
     accgactggc accgtaccga taccaccgat cttgtagaca tcttgcaatg gcaatctcaa    136680
     tggcttgtca gttggtctgg ttggtggttc gatagcgtca atggcttcca acaaggtctt    136740
     acccttgacg acaccagcct tggtttcctt ttcccaaccc ttgtaccagg aagcgttggt    136800
     ggtggcttca atcatgttgt caccgttcca accagagatt gggacaaatg gaacagtctt    136860
     tgggttgtaa ccgaccttct tgatgaagtt ggaggtttcc ttaacgattt cagcgaatct    136920
     ggattcatcc cacttgacag agtccatctt gttgacagca acaatcaatt gtctaacacc    136980
     tagggtgaaa gccaatagag cgtgttctct ggtttgacca tccttggaga taccggcttc    137040
     gaattcaccg acaccaccag caataatcaa gatagcacag tcagcttgag aagtaccagt    137100
     aatcatgttc ttgatgaaat ctctgtgacc tggggcatcg ataacggtga cgtggtactt    137160
     tggagtttca aacttccaca aagcgatatc gatagtgata cctctttctc tttcagcctt    137220
     caacttgtcc aaaacccaag cgtacttgaa agaaccctta cccaattcag cggcttcctt    137280
     ctcgaacttt tcgatagttc tcttgtcaat accaccacac ttgtaaatca agtgaccggt    137340
     ggtagtagac ttaccggaat cgacgtgacc aataacgacg acgttaacgt gttgcttgtc    137400
     cttacccatt gctatattag ttcaagttag ttatctgtgc tgaactttct acaaaagagg    137460
     aatttaacaa gaagtggaaa gttttcaaga gaagttttaa aaacccaagc tgcttaaata    137520
     tcttattcca tcgatgaatt tttttcaaat tttttcttca aactcatcgc attgaaaaaa    137580
     aaaaattttt cagttgaaaa aagaaacaat aaaaagcaat aatagcaata agtgatggag    137640
     gaggtactct ctcaacgggt ggccaactag gaagcagcac ttacaggggt actccttaca    137700
     actactaatg ttgatgctgg ccattatgag agggtccccc atctgtattg tctgtattgt    137760
     ctgtattgta tgacgtttct tttcctggaa aagcaattca agagctggtt accagtgccg    137820
     taacgcaaac ttcatcactt ggttggtgac ctatctactt atgatgctag cgctgtagtc    137880
     atctattgta ggtttggttg aagactcttc ataaggtttg ttatgttggt atagctaaac    137940
     actcaaaaat aatatgaagg ttgggattat aggtgggatt ggtcctgagg ctaccacgca    138000
     ctactacata agcattatta agcagttcca ggatgcagtt ggttctgaca aagttctccc    138060
     cgagatggtg gttgagagca tcaatatgta ccacatgttt gagatgttgg aacagagaca    138120
     atatgatgac gttgctgaat atttagctca tgcagcatgt aatcttcaga aggctggtgc    138180
     tgatttcgga gtgatgtgcg gcaacacccc acatattgta ttcgaaaaga tccagggcaa    138240
     gacagattta ccattgttga gcatggtcca gtgttcattg gatgttgcca gtgccatggg    138300
     gcttaagaga ttggctttgt tggggacaaa attcacaatg cagaacgatt tctttaagag    138360
     gccttttgaa atggccggca ttagcatata cacaccttct ccagtagaac aagagacaat    138420
     tcaccaaaag atagtaggtg aactggaaaa cggaatagta acgcccgaca ctaaaagtac    138480
     tctcctcact atcatcaatg gaatgatcaa ggagcatgga cttgatggtg taatcctggg    138540
     ctgcacggaa ctaccgctca ttttaaatca aagggacttc tccatcgaag ttctggatat    138600
     tgccaaggaa catattaacg caattgtaaa gaaactctct tgctagtcaa tgttatatcc    138660
     agcagcaaga gcactaactg cattatcgca tacaaatggc attgagtgtc acgtgatgca    138720
     gtgctttctg acatatataa tatctggttt cgcttctgat attgttactg tagtcttgag    138780
     tattcaggag actacccaaa tatgcctcag ataatgtagc ttttgcttat tattccttga    138840
     gaaggattga tattaccatt acagtaggct aggttccttc ttttgtgtca tattcttgaa    138900
     catttctgta ttagtattat ttctataaaa tagtaactac ataatggtta caaaggagcc    138960
     tgcagttatg ctaattcgtg tccagactat ctaggatatc attctgctct tccatatctc    139020
     tataaaaggg actttgttgg tttgttgaaa ctgccgaata ttgagccctc gagttgttct    139080
     tggttaggag cccgcctaca acactgccaa caaatctaaa ggtcccacca aaaactttca    139140
     tcggtatcgt tttccataag ctacggttgt gtctattcat ttcccatctc atatcgtctc    139200
     ttgcaaaaga ggtagttgag gaggagtaat tgtcatgtag tcttacagat ttcaccgatc    139260
     catccttgaa cagccacttc ctgcaggcat attcgaccat aaagaagatg acaatgatac    139320
     tgatgaagat accataaacg ttgacttcgt tagtcttgtt tgatgtcgga caagcataga    139380
     cgcttctaat ctcgaagaag taagagcact catggaggtt tccaacgtat gaaatctgtg    139440
     cttttgagct cacagtcttg tcacatatga agtttaacaa tgttgcttta cgatctttgc    139500
     cgttgggaca cattgaccca ttttcgtact tcaatgtgag cactcttgtg tcatatatac    139560
     cagttaggcg aggttcacta ctgaagtcac cgatcgatac atatttcatg gtataaccat    139620
     gttcggtgtc gttcaccaca tagaaagcgc ctgtggtgtt ggatagttgg tctttctctt    139680
     ccttgctcac cactggggat gagcacacac tgagtgtgaa atttgtcttg ccttcccagt    139740
     ccttcactag ccaacgagtc ttgttgctct tagtcttctt gttgttcctt ctctgggtca    139800
     tctggaattc ttcattaggg ctagtagaca gctgcgagag gtcaatataa gtacccgtta    139860
     gggggttcat gactgcacaa aatggcttct cattgtcctc agcttttgct gccttgatgg    139920
     gcaggcagga tagaagcaat aataggcacg atagtagcat gcttttcact gcattaaata    139980
     ttgttgtggc tagttcttgt gaatatgtgc agatataaga attctaataa tactacattt    140040
     tatacattgc cgtttttgcc agtttcttca cgttaggcaa atcatcttgt tccttaatca    140100
     gtaggggagg acattttgaa gaccaaaacg ttaaaaacca gcaagtaata ttttatcgtc    140160
     ggcacacaat gaagaacggt ttaacaagtc taggctaaca ccaatgcctg gaacgaggat    140220
     gctctgtata cactttgtgt caagtgttca cgatgcagcg agtatattta tataaccact    140280
     agttcaaaaa aagaagaaag agctttgtgt gcagagctat agcatgtata tactagtatg    140340
     tagggagtag gacaatgcac caggactcta gcaccgagga acggatgttc cagtttgacg    140400
     aagagatggg cgatggactg gacgctcagc tcgacctgtt gtttcaacag actgcgcgcg    140460
     tagagaagat tatagagttc aatgagcggg acttggcaca gcaggaactt gactgtacta    140520
     taccggcact ggacaccaag gtcaaatggt ataggaagta tgtgaggata atgttagaca    140580
     agtggttgct gatcaaggtc cggtgctact ctcaagggca aaagcaagag caaaagcaaa    140640
     agcaagaaca agagcaagaa caagagcaag agcaagggca acacaaatct acacagtgca    140700
     ccgtaaccaa aacgctgtca tcattagtac tggatgtcca gggtccaatg agtaaccggc    140760
     acgagttcga agctggtagc tatagctatg aacacgccca tcccagttcc acggacgccg    140820
     atgcggagag catagtcaca gacgagagcg agctgcaaca cacgagggcc accaccagca    140880
     actaccgtgc actaggacag tgtcagggac agagtcaggg acagagtcag gggccgccca    140940
     acatacttca cgacagggat aaagaagcac cacgtggcag aacaagacac aggtcacggt    141000
     atacccctgt acgacacgca tcatgtggca atcggtgatc tacagattga gcgacggccc    141060
     ggagcacctg gctgatttac catatgatgt gcaacggagt gtatcacatg acacagttga    141120
     gtgacggaaa gaggaaaaac tcaaataaag atgccgtgcc agttgtcagc gaaaagacgg    141180
     ttcgcccaag cgtgtgacca gcgacagggg caaggggcag ggacagcgag agtaagccca    141240
     gcactgctcc cccgaggaga gccgtatagg ttctggaact tttttggact tctggaactt    141300
     ctggaacttc tgggaactcg ctcccacaca gaagaaatcg caccgtgcta gaccggatca    141360
     gaagggatat cagcagggat cgcagtcgcg gagtaacggc cgtacacact ctctcgtcac    141420
     aactggaaag aacaaccgac gggccggatc ggaacataaa ttgctttttt cctgcccttc    141480
     cttttttctg atgctcatac gtgctgctct gtgcttgcag cgcaatttgt agatctgttg    141540
     tacgcgtgtt tctcaagcac caacccagtc aactttgagc ttaactgcct cactattaat    141600
     aatatccgca tctcacaaat aaccaatttt gctgattctg tctagtgcca cttgtcactt    141660
     gccagtgcca gtgccagtgc tcacttgcca ggtttgctgc ttaaagaatt ccgctcttca    141720
     tacacatcct acactccctt aaggagggaa gtacaaacaa gaagtgttcg cccattctct    141780
     ctcacatgat gtgtaaagaa aagtgaaaat cagcaataat agcttctgac tatgactatc    141840
     tgtattgaca gcaataatag ctttcgggat agcatgcaaa aaaaaattta tatataaaca    141900
     gaggtctttt tgaaatgtta gatcaatttc taattaaaca ttttgtagat cctacataac    141960
     tcatacaaca aacaacaaac acatacaaaa acaaacacaa tggctaacga ttgcaaatgt    142020
     cctaacggtt gctcctgtcc aaactgcgcc aacggtggct gccagtgcgg tgacaagtgc    142080
     gagtgcaaga agcagagctg tcacggctgc ggtgaacaat gcaagtgcgg ttcccacggt    142140
     tccagctgtc acggttcttg tggatgcggt gacaagtgtg agtgcaagta attgcattaa    142200
     caactaaagc aaaatactag ataaataata taaaaaaacg acaagaaaac acaacaaaac    142260
     agcacaagtt gcggttttct ataacgatta gattctatgc attcacgatc gctaatttag    142320
     caacatatta tacataactt tcacatacat ttaccctcta ataaaatttc acttaatata    142380
     atatcctacc caaaagctat atttagaaac aggtcgctca cgatccacgc ttccacgacg    142440
     aaagggccct tctctttctc tcacgcgtga cttgtacggg tgatttacta ggccccccca    142500
     tgcagcatta aaaaaaaaat gcaatagata attatatata agaatcaaca gctcatcgca    142560
     tgctattcgg tgatcctgga gttcgcattg aagcagagga gtctacagat ataagtcatg    142620
     agttctgtat cgcagtccgt gtctataccg cagccttcac agacgtacag ccggggtgct    142680
     gacggttgtg tggtgtgccc cacttccgtg gcgtgtccta cttgcgcaga ggacgagaac    142740
     tgtgtgctca cggcgctgac ctgtgacaca tgcccttaca catactgtgc gaagaagtcc    142800
     agtctcgcga tcgggagtct ctccggcgtg gacgccaacg gtaacgccct gaatgcgacg    142860
     aacagctctg ggagctcgac gaactcccac aagggccgtg tgaatatacc ggggatcgtg    142920
     tccggtagtg ttgtcgggtt ccttgtgctg gtgctggtgc tggtgatagt gtacttctgg    142980
     aagagaagga agcggttcgc cagggagggc aagctgcgtg cgtacaagct gagcaggggc    143040
     cgcaggggcc ccaacagggt cggtggtaag aacagcgggg atggcgaaga cggcgaagat    143100
     ggtgctggag gtgatgggat caaatgggac tccgacattg agaacgagct ggatgatgat    143160
     gacctagacc tggatataga cgacgatgac gatgacgaag atgacgacga cgacgaagac    143220
     gacgaagacg atatcgatga cggggcggga ccaagacacc tgtatgctgc ccagcctcat    143280
     atgcgacaac ggctgaaaga catagtggag gaaggagatg acatgaatgt gagcggtccc    143340
     gtgggtctag atgcgctgcg gaatggtcaa acagtggagc agttcaggct gaggcccatg    143400
     cgtccgttga aggcagcgag cgacgcacag agtatataca gtaacaacac agtgcacacg    143460
     aaggcgtcgt cgaatgtgtt gccgattgct tatattccgg gtgttaccat caaccagatg    143520
     caaccgcatg tgaagcctgg atataggccg cacagtcgtg ctgtgagggg ccggctgaac    143580
     cacgacgacg tgcgctcaca catcacattg gggtcgtcta tactgggtag cgaggacaac    143640
     tttgacctcg agtttgacca tagtgtcact ccggttccag tgaagccgga gatggagaaa    143700
     gcggagaagc ctgccacgaa cctgaccact gcgatacgtg ccaagcctcg gctaataaca    143760
     atcgatggca aggacccaca agacgccagt gaaggtatgc cagaagagac gcaagatgtg    143820
     caagtgccag agcagcacga tgatgtgcat agcagtgggt ccagcacgga gagtttcacc    143880
     atagacctgg acatatcact gccggaagac gagtcgccct ttggagacca gcaccagata    143940
     gttaactaaa agctgacacc tagagatctc acagattctc gacccatata aaatacatat    144000
     tctcgattat aacaatggtt tacgtaattc tttcctggaa cagtacagga acataatggg    144060
     ggggggatag tgaagcaaga tataacaccg ctctgtaaca gggcggtgtt atatcttaac    144120
     aaattgtaag cccgcctcct cagtcaacta cgcacaataa taaaaatagt tgcacagaaa    144180
     tgaacgcacc gcacagaaaa taaaacgcta atagcgcggt gttttatccc cagagaccgt    144240
     gcggccgttc accggggaaa accttgcggt gttttcagag cctttgggag acaaaacgcg    144300
     gtcggtgtgt cagacagaat cggtgctatg cctacagacg tacgaactct cgtacatcag    144360
     aaccacagaa aatcctgcta cttgcgcacc cccccccctc cccctatacc acctgcacaa    144420
     gagtgcacag taacagcaga gtgagagaca cgaaaagcaa tacttagaaa cacctgcagc    144480
     cacccgtacc cacaacacta atgacccccc cctgtacagt accccttaca tcaccacccc    144540
     tgataagtcc cctataaccc ctattagcag caaatcccaa acccaaaacc caaatcccaa    144600
     acccaaatca atcgaactac aagcactaac aagctactag caagctacta gcaaactgct    144660
     ttctctgcta agcaaactct aagcaaactg ctatagatgg caagacacag atggcatccc    144720
     ctatagtatg gatatcactt tgtacagtat gacacatcag gtcttctggg ccctgcttaa    144780
     tgaaaaccgg gttcgaggat gcgagcaagt gtgtacctcc tatgcattct aatcaactgc    144840
     aatcgattga attgattcca gtggccaatt gggaaaatct tttgaggggg atcacagaga    144900
     taaaaaaaat tttgaaatca tatatattgg gtggttttcc ccttgggtaa tcattttaat    144960
     tccttttcaa ggtttgggaa gtagaagaaa aaaagacaag caaaacaaaa tcacacaaca    145020
     cataatcaaa atgtctttcg gtgaaattga taagctagct gtttccacta tcagattgct    145080
     atctgttgac caagtctcca aggctaactc tggtcaccct ggtgccccat tgggtatggc    145140
     tcctgctgcc cacgtcgtct ggtcccagat gagaaccaac ccaaagaacc cagactggat    145200
     cgccagagac agatttgtgt tgtctaacgg tcacgcctgt gctttgctgt actccatgtt    145260
     gcacttgact ggcttcgact tctccatcga cgacttgaag aacttcagac aattgaactc    145320
     cagatgtcca ggtcaccctg aattcgagtt gccaggtgtc gaagtcacca ccggtccatt    145380
     gggtcaaggt atctccaacg ctgtcggtat ggccatcgcc caagccaact tcgccgctac    145440
     ttacaacaag ccagacttca ccttgtctga ctcttacgtc tacactttct tgggtgacgg    145500
     ttgtctgcaa gaaggtgtct cttccgaagc ctgctctttg gccggtcact tgaagctagg    145560
     taacatcatt gccatctacg acgacaacaa gatcaccatc gatggtaaca ccaccgtctc    145620
     cttcgatgaa gacgtctgca agagatacga agcctacggc tgggaagtcc tacacgtcga    145680
     gaacggtaac gaggacctaa acgccatcgc tcaagccgtc aacaaggcta agcaatccaa    145740
     ggacaagcca accttgatca agatgaccac caccatcggt tacggttccc taaacgctgg    145800
     ctctcactcc gtccacggtt ccccattgaa ggaagacgac ttgaagcaac taagaaagaa    145860
     gttcggtttc gacccagaga agtccttcgt cgtcccacaa gaagtctacg actactacca    145920
     agccaagatc gccaccccag gtgccaaggc taaccaagaa tgggacgcca agttcgccaa    145980
     gtaccaacaa aagtacccag aacagggtaa ggaattggct agaagattgg ccggtgaatt    146040
     gccagctggc tggtgctcta agttgccaac ttacactcca gctgactccg ccgtcgctac    146100
     cagaaagttg tccgaaatcg tcttccaaag catctacgat gaattgccag aaatgatcgg    146160
     tggttccgct gacttgaccc catccaactt gaccagatgg aaggaggccg tcgacttcca    146220
     accaccatcc tccggcttgg gtgactactc cggtagatac atcagatacg gtatcagaga    146280
     acacggtatg gccgctatca tgaacggtat ctccgccttc ggtgccaact acaaggctta    146340
     cggtggtact ttcttgaact tcgtttccta cgccgccggt gccgtcagat tgtccgctct    146400
     atccggccac ccagtcatct acgttgccac ccacgactcc atcggtgtcg gtgaggatgg    146460
     tccaacccat caacctatcg aaaccttggc tcacttcaga gctttgccaa acttgcacgt    146520
     ctggagacca gctgacggta acgaaacctc cgctgcttac aaggtcgctt tggaatccaa    146580
     gcacacccca tccgtcattg ccctatccag acaaaacttg ccacaattgg aaggttcctc    146640
     tgttgaaaag gctctaaagg gtggttacgt cttgaaggaa gccaacaacg ccgacatcac    146700
     tttggtctct accggttccg aagtttactt gaccgttgac gctgtcaagg tcttggctgc    146760
     taagggtatc accgcccgtg ttgtctcctt gccagacttc ctagccttcg accaacaacc    146820
     agaagattac aagttgtccg tcctaccaga cggtgctcca gtcatgtctg tcgaagtctt    146880
     gtccaccaag agttggggta agtacgctca cgaatctttc ggtatcgaca gattcggtgc    146940
     ttccggtaag gcaccagaag tttacgacta cttcggcttc actccagaag gtatcgctga    147000
     aagagctgaa aaggtcgtta agttctacca cggccaaaag ctatcttctc cattgaagaa    147060
     ggctctataa atttgacatg ttctttttta agttttcaat atgaatttga cgcgattccc    147120
     tagccgaata attcaatatt tcatgatcag agtgttcgct gggtagaggt gacttaacgg    147180
     ttgtaatatt tcgatgatac agcgatctat ttctcaggtt ttaaatgcaa tttcaaattt    147240
     tttttttgag attctttaaa acagtcttct tttcactcaa atttacttta tgtgcttcga    147300
     tactggctta tcaaacactg taatttggtt tgatgtgttg tttgaattat tcaaaatgtt    147360
     gaaatagagc tgttcatagt agtttataaa agttagtttc ctttacgcaa tcaaatttca    147420
     atctatttag tactgataac aaaaacattt tcaaatttat atatatcgtc cttttatagt    147480
     ttgtattttc tactcttttt tcatcatacg gttttatagc agtaatttcc acaagaacaa    147540
     atatacaatg tattaagtgc tacagttgtg tttttataca aatgccttct attcactatc    147600
     gcaatgcaaa aaaacatgca ttacatgtaa atgggggatt attaactttg ggtacactga    147660
     aatctgccag atcctaaatc gatcactgcc attgagaaat gacagcaaca taaaaagacg    147720
     aattgcaaag tgaacgcgaa tttgatgata tacagaaaca acaaccaaaa attatctctt    147780
     aagactaacc gaatcttaag catgaccaga gctaaatata taatgattaa aatttatacc    147840
     taaaatgtcc tcaaattcag gaaccaataa aaagtcatga acagtttatc cacaaaacct    147900
     gacaatgaaa tcgtcaattg cgaagaaaga aaatgtcctg ccccaccccc cccagcccca    147960
     ctaagattac tctggcctta tctctactgt acatcaaatc aagcagcatt tcctgggcta    148020
     gtttgagcta acatttgctg tcccttgccc ctcgagacat ttctatattt ctgcaataaa    148080
     ttgttgtctt aatatccagc aattgctttc attagtaggg cacaccggat ttaatggata    148140
     tacaaaaaat atgtgggtca tgaatactgg taaaagaaga tcagtgcacg gctaaaacaa    148200
     gtacatacaa gacagttctg tgcattgtaa ttcccattga actgaagaac aataggagct    148260
     gctcttgctg tgataatcgt tctcctttta gtatgccatc gatgaggtca aacaatgctg    148320
     aaagaaaaaa ccgtgcgtta atccctagtc ttcctcgaga aagtaatacc tccagataat    148380
     agagcctttc ttgaagtctg gggaagccaa accctggcac attcgtatat atatcggttg    148440
     tagaagtcga tgcccatttg atggcctctt tgtagcactc gatgacataa taagcgtttc    148500
     tttcaatttt caatttgcaa actgaaaaat acttataagt agagcttaaa tttaagagtc    148560
     acccatcttt tcattgagaa caagacaact atagtgtata caccacaaca gacacaatca    148620
     tgacaacaga taaaaagctt tcagttgcat tcgtttgcct cggaaatatc tgtagatcgc    148680
     ccatggcaga agctgtattc aaacatactg ttaaggagaa caatttggaa agtcgatttg    148740
     aaaagattga ctcgtttggc actgctggtt accacgtagg agaatctcca gactctagat    148800
     cttcttctac atgcaggtct catggcgtgc ctgttaatca cagggctcaa cagatcagag    148860
     cgcaccattt caatgagttt gactacatca tttgcatgga tgagtccaac tacaagagtc    148920
     tagagaggat aaaacccaag ggttccagag cacagatatt tttgtttggc aattggaaca    148980
     ctgactcaaa gttcaagaag atcgtggatg atccatacta tgggggtaaa gaaggatttg    149040
     aatataactt tcaacaagta acttatttca gtaatgagtt tttgaaacag gaattggttt    149100
     aaatagagga attgagatcg agtacttttt ttcctcagtg ctagacttac atttttatta    149160
     ctatatcctg aatgttatgt tttcattata gaacttgatg ccctttggcc aatagtaaaa    149220
     caaactgaca ggattaaaaa ggtacgcctt aaagaaatag gctccatacg cacatacacg    149280
     tatatgactg ggtttagtgt atatacatat gatagctttt gtcggtcata taaaagtacg    149340
     ctcaccattg ttcccatcac taaattatta atactcatag agaagaaaga ttagagcatc    149400
     ttttaaatac cgctataagt tagttgagaa atacaaataa tttatattta taaactatat    149460
     tggatatgat taatagttac aagctttgga aagattatgc aggtgttcta aaataaaact    149520
     atattaagta atgcctttac aagtgtaatg ctgttgcagt atcaaagctt ttcaaagtct    149580
     gcttcgttat agacaaaatc gcttccgcaa cgtcttgata gccaactctt tttaaaatcg    149640
     aaatatctcc atgattcctc ttcagattta gtcattccgg gtggtagttt ttctatctcc    149700
     ttatagtacc aacacctgtc tttcttattg aattgccagt ttctaatttt tgctaactct    149760
     cttgcagcta aaaattgctc atatgtacct tgataatgat agaaaataaa gaataaagta    149820
     tccaggtcaa acatgttgaa gatcttagcg agcgatgtcc tggaatatat atcttcatgc    149880
     ttgttgtttc tgccctcgga accattctga tgattaggtt gagtttgttc gtaaaacgga    149940
     tatacaaacc ttataggctc gtttgggaaa aaaattgagg taggatgatg ctgagagagt    150000
     ggctttcgat ataagcttgg agagtctgca tccaaagaat ctgggcaatt caacaatgag    150060
     gactccagtt gctgtatcat tgcaggggtc atatcttcga tcggttgaag taagtttctc    150120
     tttgattcca gccagtattg gatctcatct ttaaacagcg ggttgttcat agctgtagag    150180
     tttagttgga tatcctgttg aagaatttca ttaatttctg ctgttctgtc tactggttcc    150240
     acgtaatcat cttccttatc atcatcttca tcctcattat catcaccttc gttattcgat    150300
     tgctcgtctt ctgcttgttt agttggctta tcttcggatt taataatttc ttcaggcttg    150360
     ctcttatccg cttttgtttc ttgagtatca atggtctttg tcttgtcaga agattcattt    150420
     ttgttagcat tggctgttcc agccaatgga gtaggtgatc tcttggcagc agaacctgag    150480
     atctttgagc tctttttcgt gggagatttt tttggggtgc tcttgatgct ttcctcttgc    150540
     tgtgcagcga tggcggcttt gttcaactcg catcctatat cttcgtatat tgtctcgtac    150600
     tcaatgaaat ctgggtcgtc gttgttttcg acatagtatt tgatatcgtc atggaactca    150660
     ttgagcttat ctgggtctag ttcgttgttt tgcaacagct tcaagatgtt ttccaagttc    150720
     gctatgtgga attcgtgtct ctctatctgg tgctcattgt cttcctgtgc ttccagactc    150780
     tccagttgct tcgtcaattc gtcgatacac tcgtggataa agagggactc gtctctcttg    150840
     cgcagctcgc gcgggtcctt gatgatatcc gggttggtca gcgcctcctt cgagaactgc    150900
     ttcgtcttca tcagcttctc tatctgcttg aacttctcca tatcgttctc gatcagcttc    150960
     cgcgtctcca tcagcaccgt gtccttgtcc ttcacatcct ctttgctcaa ccacgtcttc    151020
     acctggtccc gctgcttctg cagcttcttg atctcccgct tcaagtcccc ttccagcttc    151080
     tcacggtagc tgatgttcga ggactcagtg ccttgaaact tctcatatat agagtcgaac    151140
     tcctccagcc cttccttcac tttcttcaaa agcttgtcaa tctcctgctg taacttcctc    151200
     tgcgacatcg ctatttttcg attactttac ttttaaccac cacccttgca ctgagaaatc    151260
     cctacgtaaa gagcttcact acttgtgcgt ttaatatctg tatctatgga ccagtgttgc    151320
     tcagcgcaat accgattgag ttttgagttt tgagttttga gctttgagtt ttgagattgg    151380
     gattgggatt gggatgtgag tgcgagttag agttagagag agcttcgaag cgattttttg    151440
     gcaaaagata caggaatgag cgtctcacac ggcaccaatc aggtgtatgt gccgtgtaga    151500
     gtgtctagat gcaattatat actactatac ggccaatcat ctgatgtgcc gtatagtctg    151560
     atgtacgtat atacggatag agcacatgat gtacgtacgt actgataaac aaacctgtct    151620
     cttttacgtc cataatgatc tcagtagtgt ctctctctct tctgcaaatt cgcaattcgc    151680
     agctttgctg ggtttctttt cagttgtctg tctatcagtt gtctgtctat cagtggtgtt    151740
     gccaatgttt ctctggctgt tgctttgctg ttgggttgaa tgtcatttgc tttctgtaag    151800
     aaagcttcgg attgcttttc ctatctgttt atcattcgca cttgtcaaca atcccacaat    151860
     caatcttttc ttcgcttcct tctcgccctc tctcgctctc tctcttttat agccctttta    151920
     gcattttaaa ctatttcaat tgcatattac ttctccctct ctctttgcga aaactagata    151980
     accacgctta agaataatgg agaacagtac cactaacact gatacctccg ttatggctac    152040
     cactcctagt gcagtagcag ctgcagcagc agctgctaca actggcaatg ctagtgctaa    152100
     tgctactaca actacaacta caactgctaa tgccacaaac gaacagcaac tggatccgct    152160
     cacacagtct actgctgaga cttggctgtc tatagcctcg ctcgctgaga cgctcggcga    152220
     cgcagacagg gctgccatgg cctacgatgc gactttgcag cacaatgcgt cctctacgaa    152280
     gggactcacc tcgctggcac acttgtacag gtcccgggac atgttccaga aggccgcgga    152340
     gctgtacgag tgcgcactgc aggtcaaccc cgagctgagc gacgtgtggg ctacgctcgg    152400
     ccactgctac ctgatgctcg acgacttgca gcgggcctac aacgcctacc agcaagccct    152460
     gtaccacctg agcaacccta acgtgccgaa gttgtggcac ggaatcggta tcctctacga    152520
     cagatacggc tccctcgact acgctgaaga agcgttcgca aaagtcctcg aactcgaccc    152580
     acacttcgaa aaggccaacg agatctactt cagactcggc atcatctaca agcaccaggg    152640
     caagtggtcg caggccctcg agtgcttcag gtacatcctc gcccagcccc ctaccccgct    152700
     gcaggagtgg gacatctggt tccaattggg tagcgtcctc gagagcatgg gcgaatggca    152760
     aggcgcccgt gaggcctacg aacacgtcct cttgcagaac gaccaccacg caaaggtctt    152820
     ccagcaactg ggttgcctgt acggtatgaa caacgtccag ttctacgacc cgcaaaaggc    152880
     cctgagctac ctgttgaagt ctctagaggt tgacccatcc gacgccacta cctggtacca    152940
     cctgggcaga gtccacatga taagatcgga ctacacagcc gcatacgacg ccttccaaca    153000
     ggctgtcaac agagactcca gaaaccctat cttctggtgc tccatcggtg tgctgtacta    153060
     ccaaatttct cagtacagag acgccctgga cgcttacaca agagcaatca gactaaaccc    153120
     ttacatcagc gaagtctggt atgacctggg tacattatac gaaacttgca acaaccagct    153180
     ctctgacgcc ttggacgctt acaaacaagc agcaagattg gacccagaaa acatccacat    153240
     cagaaagagg ctagagactt tgactgccca attggaaaac ccacaagagg ccgccgcact    153300
     acagcagcag caacaacagc aacagctctc cacaccatca aacggtaacg tgatactatc    153360
     gaataactct caacaacaag aattcaacca aggcagcgta cagatgatga taaacaacaa    153420
     cgctaatgct agcccaccgg taatgttaca accaacttta caagttactg accaagtgaa    153480
     cccgctaaat gtaaggccag catacccagc agaccaacaa cctcagcaac cacaacaact    153540
     atactccggt gcacctctac aacagccacc acaaacacaa cagccacctc atactgagac    153600
     acaacctcta caacaacctg tggcacctcc atctctacct cctactcaaa ttccaaatac    153660
     tcttccacaa caaccattgc catcacaaca acaggcaaac ttacttccaa aagctaatcc    153720
     tatggatatc agtaatgcta ataaccagat cccacccagg aatccagata tccccagtgc    153780
     agaacaagcg gaaccagcat atactgctgg agctcatcaa caatcagtgg gtgcagctca    153840
     accagaggct cctgagtcag tgggtgctgc tccaaagccc gatattttga accaaccaga    153900
     ggctccaaag accgaagata accaattacc acaagctaat attcctgaaa tcaagccaat    153960
     ggaagtacaa aatcctacta ctcaagaaac cgaaactcat caactaccaa gaattcaacc    154020
     aaatgcagca ccacagacac taccagaaaa cggaagtatc aatgccctag ttaatgctgc    154080
     tgtttcaagt gctccagccc caacaaacaa gaatgaaaga gaaccagatg ctaatgaagt    154140
     agagccagca cagaagagac agaaactgga tgatagccct gaagctcctc aggctacgga    154200
     atcagcacca gaatcagtac cagaatcagc accagaatca gcaccagaat caaacattga    154260
     gccaactaat caagaaaagg aggatctagc aaaagaaact acacctaccg agaataccga    154320
     aagtgccaaa tcggtcaaac aagaacaaca aacacaacaa gaagtatcag aaccacctgt    154380
     tgaaaatggt caagaagaaa ccacaacctc cttgccagtt cctgcaactg aggaaacgaa    154440
     ccacaacaac gaaactgttg gaactgccga agacttgaag gatgaagcca tgcatgatgc    154500
     tacacaagat ggagaaaagc accaagcagt cgaggaatct gtcacaactg atctaccatc    154560
     cactgaacaa gaaaaacatt tagacgaacc agcacaaaag tctgaagtag aagaaaatac    154620
     tagagcagag actgctggat atgaagaacc atctgacctt ccagatgcac aaaaatcttc    154680
     cgaaacaact ggaacaaccg aaacagctga agctgaacac acggaagtta ctaatgtgcc    154740
     aagtgaagtt gaaacatctg aaacggctaa gcctgcagaa acaactgcag atcagctaac    154800
     gggtgaaata aaccaggaga aacaaataga acaaccttct gaggcgtcag aatctgttcc    154860
     tgaagaaaag actgaagtag aacaaccaaa gccagctgaa gaagattcca aaggaaatga    154920
     tacgccacaa gaagaagtat ccatttcaaa tactgaaacg acaatggcgg atgaatcatc    154980
     cacccaacct gttaaggact caactgagac taaccaaaac gaccctgcag ataacatgac    155040
     tgaagagtct cacggccagg actcaacaat cgatgaagcc gacaaaggca gtatcgagga    155100
     gaacaaagat acaccaaatg aggactttca aaagttacaa gaaggaacat caacagatga    155160
     aaaaattaac aatgacgaag agatgaaaga agaaaatgat gagccaaaaa ttactactac    155220
     aaatgaaaat actgagcaga atgattctgt caatggcgaa gttcaaacaa atggcacaac    155280
     tgaggttgaa gaggctgctg atgaaactgt gatcaaacca actgcagaag ccttggagaa    155340
     attagaagaa gaagcaaagt tgagagaaga ggaagagaaa gagcgtctaa acaatgagaa    155400
     caacgaagat aacaaaacag aagttactaa agatgctgtg gtaagagagg ttgaggaaga    155460
     tgaaaattac gatgattaga tccgcagatt cacaatcatg atgtaatcat ttatttgcat    155520
     gttccctttg tttttggagc gttatgttga catgaatttc tttgagtgct gtctatttgt    155580
     gaatacttaa agaccattat tgaagtttaa aatggctgaa ttagagaatt cggcattatc    155640
     agactataaa tacttattga tttcctgaaa tcgttgtttt attattataa atatatctat    155700
     gtattataag gtagtaacca aatgcagaag ttttttttta tatttattaa tacaaactaa    155760
     actaactgaa aacattaaaa agatcctcga caaatttagc ccatttatct ttatcatcat    155820
     aaaaactgca agaacccagt cctttgaatg aaacatgatc ctcgtttacc aataaaacag    155880
     gtatattacc ttcttcacca gattgtgagt cactatcgtc gtcattaata gcctcttcat    155940
     caatatccat tttgtcatca ttgattatat tgcttccctc catcaactcc tgttgcccaa    156000
     taaaggactc tgaattattt gaaatattta agttgtctgg tttttgatcc ggttcagtcg    156060
     tggtatcagc cataatttca tgaagactga actgctgcaa accttcatcc ttgaaaacta    156120
     ctgcctcaga catacttggt ctcttagctt tgtttgaaga tctccttctt ctctgcaaag    156180
     acatggaatt tctttgcatg aatgatgcgt tcttatttgt aggccctttc attatttctg    156240
     gattagtgtt ttcgactgtg aattcatcct ttgtgtttgc tatatctgct ctaatatgct    156300
     gatcatcatc atcagaaatc gaactcacca atttcaaata tattggtcgt agaactgtcc    156360
     tgtaccaaat agtccaattg agtatatctg caattaggtc gaggttatcg ttgtttatat    156420
     tgaatcgtct gatttgtatg agatcagtgg taaaatcatt cattaattca atagtttgtt    156480
     ttttagagga gcctaattca taaaaggcat gacataatac atcagatact tttctgctcg    156540
     ttagctggtc tttctcatca atgaacagat ctgttggcac aaactcttta ggaaaccaga    156600
     aaacatcttc atctgtgtca tcgaaattta cctcaagaat gaggttaaca cccaccgagt    156660
     agttttctga gttctcatta atccaagatc cagtctctga agaatagatg tactcataaa    156720
     atctttgttg tgggactttt gctctctcaa agtatacttt ggctaacggt ctcgagcgca    156780
     tagaatatcc gtgtgtttca tatatatata atccaaacct attgtccaca tttgctacaa    156840
     ctttaaatct gttatcacaa ctctctttaa aaaatgtatt aatgtatttc ttcagctctc    156900
     taaaatactt gaagaggttt agttttcctt cattgagttt agagtccaag ccattgccag    156960
     aggatacaga tttcttatct gttttgttgg ttagagatga tccgtttgtt ccattcccag    157020
     atcccaagtt gtttccagaa gatatctggt tgtcagactc tacgcttgag tatgtgtcta    157080
     ataagtacag gaattccaag ttatggtgga attgcttcaa cgagtcataa ttggtcaacg    157140
     aattgagcaa aatattcgac tgtttgtccc ctgcttcttc caattgctca ttggaatagt    157200
     caaagttatc aaaattcgat gcgagcacca gtttcacatc ctgcaccgtg ctctgtgtct    157260
     tattgtaatc aatgtcaata acaataatct tagaggcagt agagagtcgc gatatatcgt    157320
     tatccagctc atcaataaac gactctaacc ccatagactg acatagcttc gtgatattct    157380
     cgatggtaat agtccccggc ttgtaatcct tcaacaaccc tatcagatcc cccaaaactt    157440
     ccacgtactg atcagccatc ctgtctccac accttgttgg tcttgaactg gtcccgctca    157500
     ctcaaattct gatctcaaaa gggctaaata accactaaaa tgactacatt tgagtttgaa    157560
     gtgtcaagct tattactcga gactcgaatt ttagcactgt taactatgtc gttacaaggg    157620
     atatatcttt ccaatgagcc ttgcccaaaa tttgcgatga gcttcaactt cccagcaaac    157680
     tttcagcata tttcagtata cttcaggaag ttatgttggc attggggggt tctgtagcca    157740
     ttatttagtc ccaaacagat caatcggcga gaatatacag atatgagcga gattacacac    157800
     cctactattg ttgatggatg gttcagagag atctctgaca ccatgtggcc tggtcaagcc    157860
     atgactttga aagtcgagaa ggtcttgcac catgagaagt ccaagtacca ggacgtcttg    157920
     atcttcaagt ccaccaacta cggtaacgtt cttgttttgg acaatgttat ccaggccact    157980
     gagcgtgacg agttctccta ccaggagatg atcacccatt tggccatgaa ctctcaccca    158040
     aacccaaaga aggttcttgt cattggtggt ggtgatggtg gtgttcttag agaagttgtc    158100
     aagcatgagt gtgttgaaga agcttggctg tgtgacattg acgaagctgt tatcagattg    158160
     tccaaggaat acttgccaga catggccggt gtttactctc atccaaaggt caagacccac    158220
     atcggtgatg gtttccaatt cttgagagac tatcaaaaca cattcgatgt tatcatcact    158280
     gactccagtg atccagaagg tccagctgag actttgtttc aacaatctta cttcgagttg    158340
     ttgagaagtg ctttgacaga caagggtgtt attaccactc aagccgaaag tatgtggttg    158400
     cacttgccaa tcatcaagga cttgaagaag gcctgctccc aagtgttccc agttgctgag    158460
     tacgcttaca ccaccatccc aacttaccca tctggtacca tcggtttcat ggtctgctct    158520
     aaggacgcct ccgctaacgt caagaaacca ctgcgtgaaa tgactgaaga acaagagaag    158580
     aagttgctaa gatactacaa caagagaatc cacgagtcct ctttcgttct accaacctgg    158640
     gttgccaagg aattggaact ttaatgtcat taaatagtca ataaggtgat ttcccaactg    158700
     cccaaaaatt gatatataaa agagggagaa tcatgtgaat tcatctctat acgctatagt    158760
     acctacttaa aatatgtaaa tgtaattaag aattcaaaag acatggccct ttctagatga    158820
     ttttgaagtt ttatgatgac ttaaatggtc ggacttacaa gccaatttat catcaatttc    158880
     ctacaatatt gaacaaactg caatagaagt aactttcgag tcaaaaacta tgagtagcaa    158940
     cttaatttgt ctaaagaaag tattttagaa ctatactgat ttaaaaagta tggttcagct    159000
     agtgatcagt gcatctcagt tccaatcaca agtggtcgac ctgctgccat gtaataagag    159060
     acagaaatca caattgatct actcaatgtt ggagagctat ggacttttag aatgctttga    159120
     ccatataatt gatgtgccta gttgtcaaag gaaggatcta gagaagtttc actcaaaaga    159180
     ctacctcaac gtgatactcg atgagcaatt gaattggaac cctcaaatcg atggaaatga    159240
     agatcagtta atggagcttc ggaaagcttg gaacgatata accaccagca atgaagcgtc    159300
     aaaaccagat ttcaaaactt attccgagtt attgcattat tatagggatc atattgaagt    159360
     ttctgaacat aataagaaga ggacagctct cgaggctgag ctgtccgatg ttgaaagcgg    159420
     agatgaagtt acaaggcgat ccacgttggc caaattcaac ttgttggatg attgtcctat    159480
     attcccatat ttgccattgt actgctatgt gtcaacgggc gcaacattat cgctagcaca    159540
     atacatactg gaaggcagtg aaaggaccat tgccattaac tgggatggcg gcaggcatca    159600
     cagtatgaag acgaaagcca gtggattttg ctacatcaac gacatagctc tgttaattat    159660
     gacattgaga cgtggcggtg tagatcgcat ttcttatgtt gactttgatc ttcaccatgg    159720
     tgatggagtt gagaaagcgt tcaagtacag taagcaagtg cagacaatct cattgcacat    159780
     gtatgagact gggttcttcc cttgtagtgg atctctcgag gataattcta gcggtaagag    159840
     catcgtcaac atcccactct tacacggtct agatgattca actttacaag atatagcgaa    159900
     gaggattatt gtaccgagta tatccaaaca tcaacccaat gtaattgtaa tccaatgtgg    159960
     tggcgatggc ctgaaaggcg acaagtatag tgagtggcaa ctatccataa agggcctgac    160020
     atctacaatt acctctttaa tagagcagtt caattgccat attgtattgc ttggtggagg    160080
     tgggtacaac aacttgctaa tgagcaggtt ctacacatac ttgacctgga gcatatgcca    160140
     ccaatatgcc tctgaataca gtacacccat cgatgatctg atacaggacc actgttatag    160200
     cgacctgtac agtccagagc agtttaaatt ctggtattac gaccaagaaa cttcaggagg    160260
     ctcgctcaaa aactacaata caactgcata cattgaagac ctaataaaaa atataccact    160320
     gacatgagat gtatccaacg tagtatagat agtagtataa acttagtcaa caatacataa    160380
     actaactata gaagcatcta accgtatttt catcacctta cacgttaaaa tgatcttcga    160440
     agccatttcc ttgaatttct ggcagaattc ccgtttctca ccatgaaatg ataataataa    160500
     acgcaaagtt tgggattagc aggccatatt tggcagcagt tacagttttt agcgtcattt    160560
     gggcggtact tgaatcagga taccactatt tgtgacaacc atagcgtttt ggaaaatttc    160620
     tagctagacc tttcttttga tagaatcaga tcgatattga aaaggggagt aacaaatagc    160680
     aaagcaacac ggcccaggag tactgacatt tcacaataca agagagccac ctttttgcga    160740
     tacttaattt ttcttttgag ctatccattg aattacgcca gtcaaatact atatttttaa    160800
     cacattagga tgtcttctaa cttaactgag gaacaaattg ctgagtttaa ggaagctttt    160860
     gctttgtttg acaaggataa caatggatcc atttcttcta gtgaattggc cactgttatg    160920
     agatccttag ggctttctcc aagtgaagct gaagtcaccg atctaatgaa cgaaatcgat    160980
     gttgatggta accaccaaat tgaatttagc gagttcttgg cactaatgtc acgccaacta    161040
     aagtctaatg actctgaaca agaactatta gaagctttca aagtctttga caagaatggt    161100
     gacggtctaa tctctgctgc tgaattgaag catgtgttga cctctattgg tgaaaagctt    161160
     actgacgctg aagtggatga aatgttgcgt gaagtcagtg atggctctgg tgaaattaac    161220
     atccaacaat ttgctgcact attatctaaa taaggaatca aaaataaaat aaaaatacct    161280
     aaaaaaaaaa gctccccctc atcacattaa ttattagtta ctgagattat tatttttttt    161340
     ttctataatt attctaataa atactgtcta ttctattcta ttctatatta aagagtccaa    161400
     aatttcttca gagaaagaag aaatgtttat tgcaaacaag aaatttgatt tcaaggctat    161460
     ggaagtattt gaacagtaaa taaaagcact tagctcagct atgtacaaat gaagttaacg    161520
     taggcttttt ctttggaacc ggtggaggag ctttaccttt taaggaatcc ttctttttgg    161580
     gtaccgttgg tggctttttc tttaatggct tattgtgaac cacttcagta gcagcttcac    161640
     catgaatctc tctttcataa gagtttccga cagattttag cttaatatgt tgcaattctg    161700
     aagtaatatc tccaattcca atgttagata ctgacatttg actatttact tcttggttaa    161760
     cttgtttaga ttcgatgtta ttttcctgga tattatcttt tctaattggc gggtcgggca    161820
     ttggcctgtt actggattga attgaggaaa ctgtacttcg tctttgcaaa tccatattgg    161880
     tatccctaga tggtgaaatt ggagtttgag ggtttggttg tgtattcatt ttagtagaag    161940
     tactgcgtct agggagtggt ggagtgcctc ttttcaaagt attcgtaatt ggtggccttt    162000
     cattagcgga atgaccagca tatgtgccat catagtaatt gtttatctgt tctattgagt    162060
     ttatccctgg ggaagtctca accactgaat ttgtactcat agattggctg gtggttcttc    162120
     taggtggtgg aggcgggact gctctggttg ctgcgcctgg tggacctact gcaggagcag    162180
     gtatgtttcg aattgaatta ttattaatat ctgctgatgc tacggaactg ctatcaatag    162240
     tagaattgtt agtctgcata ttttcatcaa ttgtctcatt ttctacagaa gcacgccccc    162300
     tgtctctatg ggttggcgga ggcggtaatg atgataagtc cacattattc atcggtattc    162360
     ggttttgcaa tgcctcattg gcagaattgg ttgaagtgat cgcagtttgg ttaacatctg    162420
     gtggaatcga cggcatgggt ctgtatgcat tggcttgaac agggggcgtt attccttgac    162480
     cgtatactgg ctgttctggt gatcgtgtct gctgcggggg tgcattttgt gtataagagg    162540
     tttgttgtgt ttgtgaaaca tactgtggtt gtgtgttatt agaatatatc tgctgttgct    162600
     ggccataggc ttgctggtta tgtaattgct gattctgctg taattgtgta ttgtattctg    162660
     gttgttgttg ctgctgttgt tgctgttgag gtaatggatt gtaagctgct tgtgcttgta    162720
     cttggtaggg tgcattactg tatgtatttt gttgtgagtt ttgttgtaat tgttgctgtt    162780
     gagaattgta agctacttgt gctgagttcg tatatgtgtt attagccgcc atttggttaa    162840
     agttattatt tgtagattgt gtaggtgctg caacattgag ttgttggtta ggtaaattac    162900
     tttgaaatgt attattggca ttgtactgat gattcggtgt aatactgtta acaattggcg    162960
     cttgacctgc tggatgctgt tgatttccgt aagaatagtt ggcattagtg ccagccggtt    163020
     gttgtggttg ttgtattgcg tagttttgag tgggattgta ctgactattc tgaacaggtg    163080
     gttgtggact tacaggttgc tgttgtgccg gactgctata gggggtattt tgtgcctgtg    163140
     cattgtaact tattgtgtta tttgctgctg cagtaggttg tgagtaacca ctgtagttac    163200
     cagcaatact accagcagta tttccagcta catgtccagc ttgccctgat ctagtaggag    163260
     gaggtgggaa cgatgaagga tccctcagcg tattgacact tctaggggta tggtaatctt    163320
     ccgagtactc atcttcttca tggtgatcgg tatgatgtgt atctttgtct ttcttatgca    163380
     tatgcttctt gctagtgttg taaccagcct tggcaactgt cttggtaccc ttataggtaa    163440
     acttccctgc ggtagctaac cctgatttca gcgaatccat cctggaaatt gttattgtgt    163500
     tgtgctgctg acttgcaatg ttcgactatg aagaataaag agatcaatgg caacgtttat    163560
     ataccacttg ccaggatagt tgttatggcg aagtctggtg ggcttaaggc acttgtcgta    163620
     aaatgattta cgtatggtga gtgatataag ctcccctata agtgccggaa tgtacaaaaa    163680
     gcctacttct gtatcgttta gtccagggtt gttacgtgta actgtataga catgatggta    163740
     atatttgtat aaatagttta tatagatgct tacaatagac agactagtga ataatatctg    163800
     gtcatttttc gatatcaaaa ctcgaaccac acccacaact gctcttcaag ttaccatctg    163860
     tgatcttgaa agtcgaaccg attagctcag tggtatagtt cagagtagtg ttgttcagta    163920
     tcccgagcga agtctcgtct attgcaactt tcccgccttc ttccgagact atatatatga    163980
     cgtctttact agacgagtca gcaccttctg caaactcatc tactacttct tcctgcgttt    164040
     tgctttcgga attgccagtt tcctccaagg aaagcgtcga ctccggcact agcttcatgt    164100
     tgtattgaaa cccgtgacag ccaccgctct ccacaagcac acgcaacacc tcttgggatt    164160
     ccttgtatat ctcatttaat ctctttgcag ccctctccgc tatcttcaag cccttgtcct    164220
     cctgcttgtt taaaaccttg taaggttcca ccagcggaac ctcaccttca gatgcctcaa    164280
     cttttatccc ataccaacgg gtattctgca ttgtattcat catgggcttc gccataggct    164340
     tggccatcgc cttagccatc ggaatcacct tcggcataga aaccacacgc gcatatcccc    164400
     tcacagaaat cctcgatacc gtcacgctcc tgatcccgat catcttaacc gccgtcttgt    164460
     cgagtgttac actatcccgc atccaccatc tccctgcccc cagtcccgtt tatatacatg    164520
     tgtcagtcca ttactaatgg ctttccctgt tccaggaaag gcccgaattc tggtccgaga    164580
     ctatttgaca catttcgcac ggagttttct aagcaactct cctgcttcga tattcccccg    164640
     atgcattccg gacccacacg gagtatatcg cactgaggaa gtatagtctt cagttcatct    164700
     acaagtccgc attaactgaa cttgtaacta ctttttggta tattcttgtt tatagcatcg    164760
     agcagacggt acactctggg tttctctggt actggaaact gaagatgtac atgccttctg    164820
     ccccgttgat cgtagtgaaa tttggcgatg actctggatc ccataagtcg cggtatatgc    164880
     agttgagttg ctcgcagcac atagctgcta ctatgctgtt tgtagtcgat actgtaggaa    164940
     taactctctt ggctatccca gccattttgc tcagagtgag ctctgagcaa tcaataccgt    165000
     attgcgatgc tcgctgtctg cattgatcta gtaattgtgt gcatactgct aggtcgtcca    165060
     gatctgcgtc tgggttcgat atgagcacca cgtactcgac aatgtgctcg agggaccgcg    165120
     ggttgttagc cactgtgcac atcgggttgt tcatcgctga ctcgtgcggt aatgtgtcta    165180
     tggagcactc ccagcaggca ttgatccctg gtataatagt cttgatgtgg cccttgagac    165240
     cctccactcc gccgtctata aacggtatgc aaatctcaaa cgcagaggct ctagtgatgt    165300
     ccacgagcac ttggttcaca tagcgtcttg gggctatggc gtccagtcca gatatcacaa    165360
     actggaactg gctatagaat gtggcgtcaa gcgtggttaa gtcagtaaca tgtgggacaa    165420
     taactttgtc tgtaacccgc ttgccaatgg cgtgggcagc tacttcagcc ttgtatttac    165480
     caatgtcctg ctcccgaaac aagaactgtc tgttcaggtt gctcagctca atagtgtcaa    165540
     ggtccaccac atggatctca gatacatagt cgtacctagc caagttcttc aatagctcac    165600
     aaccaagacc gcctgcacct agtaccaaca ctttcatggc catttcagct catagcggta    165660
     tgggggttgt caagttagcg taaatttcaa tttgctctta aatatatatg cgctggatag    165720
     gataagttga gtagcgataa acttatgacc acacagtata acacacacaa gactatgcta    165780
     cagtattgca aaacacagat gataaagaga atggcatcgg ttctgttaat cagggtctta    165840
     cagcctacac tcacaagaaa atacaatagc gttcacgata taccgcgctg tttgagccaa    165900
     tctagctaga gaatagagta catgattact gacactagca agtcatgaca gttatgtata    165960
     aaatctaata aaaccagctg ttccaaccgt atgattcttg tatgctacac tgattatggg    166020
     cttatactca tcacggcgca cgcctccagc gagctttttg acttcctgaa agtttggcaa    166080
     cgcagataat ggcaagtccc attgaagagt aggtatcaat gtgaatttat tgcaagcgat    166140
     tggcagtcaa gagttgtgct agttgttcca ttcacatttc aggttcgtcg aggcattaag    166200
     gaacttggtt atagtagaaa gaacggggga aaatggcttt gaataacgtg agaagacagg    166260
     acttatgtgt gcaatacaag aagagtgagc caccaagggg tatttacagt gagagtcaat    166320
     ctctgagcgg tattgtgaat cagactatgc caatggctgc gatctttcta aagaacaagt    166380
     ttatagcgtg gttttcgttg atacagagtg tgcactccta cttgaacact gatgaggaga    166440
     ccttggaaaa gaataagagc aagactggta actcagcact cgatcagcca ccattggtta    166500
     aagtggccat gagtcttgtt ggtatattgg tatgttacat gaacttggtg ttcccaaccc    166560
     cagatgcccc accaccatcc tcagagaaga agattttgga tgaagagaag aagtgagttc    166620
     gggtactatt ttagcaagct tgtccactaa aaatgtattt tatatgaaga tcgacaagac    166680
     ctgatagatg aggtgagttt gcctattttt taatgttaac gatatcgaaa atattagatt    166740
     ctgcaggtcg ttattttatt ccatagcgta ttacttagaa caatgcataa attatataaa    166800
     gaaataggaa ttgttcctat ccgtattttc ttcgtcactt atacgttaat catagactgg    166860
     tttgagatcg gttcttggtt gacacgcggt attacgatta ctcaccaatg tcttcgaacc    166920
     aatcctgagg tctggtgtcg atgaacttct tcatgatggc cttgcatggc tcgtcattca    166980
     tttgtacaac ttcgacacct ctgctcttca aatattcctc acctggactc ttgaagttgt    167040
     cgctctcacc gatgacacat cttggaatac catatagcaa gatggcacca gtgcacatat    167100
     cacagggaga caatgtagtg tacaaagtgg tgtccttgta aactttaccc tctagtctac    167160
     cacagttctc caaagtagag atctcaccgt gtagggtagg agaacccttt tggaatctca    167220
     tgttgtggcc gcggcccaga acagtaccat ctttgttgtt gatcaaacaa ccaccaattg    167280
     gcacaccacc ttcttcaaag cctttggcag cctcctcata ggctattttc ataccaagag    167340
     catcccattg tgcagcgtta gacattgttc aagatattct gattgtttcg gttaatatgt    167400
     atccgactag ggtcttgata actagcatta ttgcaagctc atcgcatccc gatttatata    167460
     gcgttcgcta ataaattttc atgaaaattt actgaaaaat tattacaaat tagaacttgc    167520
     gatgacttct tcaagacagc taatacactt gaataccagg agtcagtgcc atctaaattc    167580
     aacatctcat aagttcattc gtaatacatc cccataaagc cagtgtcggc tggtataata    167640
     ttggtcagct tgtcatttct gagtatacgc actagggccg ttaaaactca ccttgctgaa    167700
     agtttaattc tgcccaccag cactaagttc acccccagaa tctattcttg tagtcagcac    167760
     caatcggatt tatcatctcg agtggtgtaa gatcatattt atacttgacg tcttttgcca    167820
     acgctaaagt tccatatcga attagatggt aaagcaccgg tagaaggttg agggcacgat    167880
     gttagtgaaa gggtcaacca aatttctgat ggctcatcgc cacgactcta tgcttctgaa    167940
     caagataaga tgctatgcga caacagatga taataacctt gtctctgcag ggaaaggaag    168000
     tcaagtgtta catgatagcc tttggcccga taagcacaat cctactcctt atgaaatatt    168060
     tgggtttggt gtcggtacgc atgtggattt gaagaagttg aagatggagt atcacaaata    168120
     tgtgaagatg taccaccctg atttgagttc ccatattcag ataagaaagt ccagcctagt    168180
     gaaatctcat catgccatgg aaatcgctaa cacagcacaa tatctgaccc aggcagagaa    168240
     gatacagcgg ttcaaacttg tcacacaggc atacgagatt ctaaaggatc ctagaaagaa    168300
     aaacctatac gactgtacac gttctggttg ggatatggct ggaagtgcag gtcctactgg    168360
     agcccagtca gcctattatg cctctagtgc agcatataac aacttctctg atcaatcgta    168420
     tgcgtattgg aatgccggta attgggagga tgtccataat tatcaaaata acagtggaca    168480
     gaagcttgat ccctggactt tgctgatgtg gtttggaggg ctattactat gcttagaggg    168540
     aagctcgttg ctagcccgaa ttgaggatac acttacagat aagagtatca cagaggataa    168600
     tattgaagta gagttggggc agtgttatat caattacggc cttgatactg acaaatggtc    168660
     acggcttaga cggttcttgt ggttcagaac atttaacatg tatcgttcca aggttgactt    168720
     agatagggaa gccgagaaga acgaggatct gatcaagact ttacaggaaa aggttaaatg    168780
     aaactgaaaa atctttaatc ttttggcaac atacccttgg cattctttaa tttccaagtc    168840
     tggcatacat ttctattaac aatgcacata tttttttttt tgttggttaa tattcttttt    168900
     ggaaaagagt acatttttta atattcctga tgcattttat tattattttc tgaagtagtc    168960
     ttatataatt ggataaaagt ttttgaatat gattaaattt tcacatttat ataaatacat    169020
     tagttgatgc actatcctat ggtagcagag aacttgaaaa tcaaattaac ccaagagtct    169080
     cattgccaat tcaaaagtag caaaggtacc accgttagct ggagcggctc tcagcattgt    169140
     tggaccaaat cctttgaaga aggccttcaa tccctctctg gcataaagat ttctggctac    169200
     ctggatcata ttcttaccgt tttgaggttt atttaggtta tctgtctgca tgaccgattt    169260
     cacaacatca attggataaa ccattaacca caaagctgta cctgaaagtg caccatataa    169320
     gcataatttc catggtggaa tttcagttct cttcaaacct tggttaattt gctttgatac    169380
     taaggcctcg tatacaagga aatatgtacc acagccatga ccttctctta gcattgtagg    169440
     gattagaccc ctcattaacc ctttttgact tctcagtttt ttgatacaat cgattgggcc    169500
     tttgaattct gcctgtgcac cagaacccgt ctgtgtttga agtcgtattc ttacatgctc    169560
     gatgggagaa gctagaaagg aattggtcat accaccagtg agaccacaaa gatagtactg    169620
     cgatagagaa agagtcgcgt tgtggtctac atttctggca tggaaaaatc ttttcattgc    169680
     ttcattaaca ccaaactgaa ttgagacaca tgcaccaaca ccaaccaatg gagtcaatgt    169740
     acctttataa aaaccttttg gaccttcatt cttaagcaaa tttttaacaa cctctgcagc    169800
     agacgtgggt acctttgaag tttgaagtct cactttagtt gtgtcaaaag gttgccctat    169860
     taaaacctga gcaatcccac cagccgtacc agctagcagg tccttgacaa ctcttccatt    169920
     atcttgtccg ggatgatcct ccaagtcatc gatcaattgt ggtgtaggaa attcttcaga    169980
     catctatagc ttgaatattg attattgttg ctaccagaca aaatgaacct gttgtgtaaa    170040
     tatttattcg aagtatatgt ttaaaatgat tgattatatg tcagctatca ctagctttta    170100
     tatagtcaaa cccatcttgt gggcttttca ccttattact aagtgatgtg atgagctact    170160
     tgctgtgata cgatgcggac tttacttttt ttttaactga ttctgttgct agactctgtc    170220
     aaaatttgaa agactttcac actaccaata ttctcaatag caacccccgg atgagctgtg    170280
     caggatcagc tattgtgaaa gctcttgtta ttttaactct ttcttcaaaa caggttcatt    170340
     tcttctaata ccattgggtc tatatagtta aatgtgaagt ttttcaatta gcttatcggc    170400
     acttaagtat tacttattta ggaaattgat aagaaccggt tccttatcaa aatgaacata    170460
     atagatgctc ttcgatatgg ctaatggtgg aatatggata tctttaggta ctttgctaat    170520
     ctgtgtcacg attttcaatc tctatttaaa actccaaaat atcgtgttga ccatattttc    170580
     ttgtcacaac ggctaaaatt aacgatgcaa tatccaaatt tggcgggcaa ggagggcaat    170640
     tgtgctcgtg tagttcatct ggaataacaa tatttgtagt tccaaatata ttactattca    170700
     ctcttctgtt caaaatctct cttgcttgtt tagctaatga tcggatattg ctcatctgct    170760
     ccgcagttaa tctagttgga atatgcaata ggatgtataa aagccattgg gataacattt    170820
     tctttctctc aagattcttc ccgaaagtat agatctcttt taaccaaatt tgggtcatgt    170880
     acataacaag tgtccacaaa tttgaactat ctatcatatt aataaatgca gtatgggtag    170940
     gttgatttga agtaacgtat tttgcccatg gttttaaacc atgaggtgcc ctcttgtaat    171000
     ctgttcttat acaatatttc acggtgttca aatccttgat cttgctattt ctcattgttt    171060
     ttaacagatt ctcagcccag tcctcgtcta tttctaaagt tccgttcact ggatcgggat    171120
     cactacattt aagctgatct cgaaatatat tcaccaaatg gcggtcaaag ctagatgccc    171180
     tattctcgtc aatctttttt tgtaagtaga atcgcaaaag ctgtgttaag tgggatatag    171240
     attcatcatc ataaccttca aaaacatagc acccatgcca aataatatca ctgatgtttt    171300
     caaaccattt ataccagttt tctatgctgt acaagtactc agttatttga tcacttttaa    171360
     ccttggtgtc agaaggaatg ctagttgaat catcttcatc atcatagata ttagcgtcaa    171420
     aagtattttt agaaacttgg ccgatctggt ggcttatagc atttgtgtga agagcttcgt    171480
     ttcttacttc cgaaagatag ctcttgacta atggattgac ttctggatca tttatattaa    171540
     aggctttagc ttgaccaaaa accggatcaa ttgcacttga caacgcttcc ttattttgat    171600
     cttttgaatt tctgtttctc ccggccattg tttagttgac tctagtttgc agctagatat    171660
     atgaactcct taatatactg aatcaagtgt ttgttgtgtc tgtaatgtgg catggctcta    171720
     aatcattcac ctctaaatta acatcacctc acatttccga tgccctgctc ttattttttt    171780
     ttaatttttt aagtattaat tactgctata aagaaatatt aatcaattgg atttattgtt    171840
     aaaatacttg gagtcgatgc aatattaagt cgttcatact acaaataaga tgtttaaata    171900
     gtgcagatta tatttatttg tagttattag cttagaagct tttttttcta taggtcgctt    171960
     gttgatacgg catcatgatt tgaattctat aacagccctg ctatcataaa accatgcgta    172020
     agcgtttcta aaaatcacac tttcttttta accttcttta atgtactctt tggaacaacc    172080
     ggtttcttct taagctttgc aataactctt tcatcaaatt gtgagtcgca tgcagggcat    172140
     ttgttgcctg gtgggatgat agataaaaca caaagacaaa cagaacatat atagcctatg    172200
     gcaacaactt taccggtaag atagcatgat gttctgaaat ccactgaacc ttgtgtaggt    172260
     ctcactataa tttgccttag ggagggatca atcgacattg ctgtggataa gtactgtatg    172320
     ataccattag tcgattctaa gtggatgtat acaccatttg tggcatctgt ggtctgttgc    172380
     aaaaaggtac tctgtttatt accaccaatc ttgataacat caatagggca tttcagcttg    172440
     gtggcagaaa agatacaatt cattatcggt atgtattgaa agatttcatc cttctctctg    172500
     ctgctaccac acgtaatgac aagtaatcgt gatcttaaac taatgctttc aaattctttc    172560
     gttagtctat ttgtataggt cagagcagct gccatcgcac ctgataatgt actcttttga    172620
     actggtttat ctattaggct ttcctctctc tgatacaatt tataaaactc ttcgattaat    172680
     gtctcgtcaa cattcctgaa ccttctgtac atatgagagc tgattatgga cagatctttt    172740
     gagtttcctg cattttgctc tgatgtatcg ctactccttg ggtacaaata ttgtatacct    172800
     tgagaaaatg cggcaatgac ggcaacttga ttagcactat taaatgctaa atgactgttt    172860
     aagaacacaa tcaaagactt taatacagta gtaacgctct gtttctcacc gcttctgtga    172920
     tcaaattctg cccataatcg tggggatata tctaaaacca ctgtgagaag tgaaggaatg    172980
     tcttcggtag ctgttgacct aagtttggtc tgctgaaaat tggggtcggc tatagcatcc    173040
     atgatattat tactgtggga tgagttgaca acgttacagt ttcttcttta tttgaagagt    173100
     agtgaataga atttatagtt tgcctttttg ttcacttaag tgcactttgt caattttgaa    173160
     ctttttgatc cgagaagctt cttctataaa aaaattctaa agttgaacaa gtagcaagca    173220
     agtgaagtat acttaaaaag ctatgcataa tgccctgatt aatgcgaaga aatttaaagc    173280
     gtcaaaaaca ttacattata gattatataa taataataat tagtcgatat gcaaaaatta    173340
     tgcggcagta cttacaccca aattattaag tttctccata gcatctagat atctcttatt    173400
     agttggtttg gaatgagtac ttgtagacat tcttgctgat ctcatctgtt gtctatacaa    173460
     ctcctcactg aattgtagtt ttaagatagt cttgtggagc tctacaggca aatttgcaag    173520
     ggatccctta ttcaattctt caaataaggt cgactcgtca gcatcacaaa gtgaataaaa    173580
     taataaaggc tcgctcatgt caatatttga tggatcagga gagaaattcc tgaaagtgtg    173640
     ttgtagcatt tgaatgttac gtgataattt tttgacacca ttgctgttta aaaccttaat    173700
     cgtttgagag cccttaatga acgcaatgtt acataatttg tcaacgccaa tgaaaataat    173760
     ctttaactcg acatcagata actgttgttt tagcttgttc tctgatagcc ttaatcttga    173820
     tatcaacgaa gcaatgcttt gatctatttc attactgcta tcttctggat tccacatggt    173880
     cgtattctga aatagctcac caatatttga gatgcacaga gatctcatat caaatctcaa    173940
     taatgatacc aactttgttt tcagctgcat aaaggcattg atagtttgat caaatttctc    174000
     ttcagattct ttgtcaagcg agaacttcaa ggtttttatt tgtttgacat cagaatcagt    174060
     agtctcgaag aaggaccact gcttcctcaa aatatcaatt tcagactttg tttcaacatt    174120
     attttcttct tcaacccttt ttttcattgt tggtagccaa tctaatatcc acatgatagt    174180
     tgataaaaag tagattatgt tatcaaatga ggttggactc aatgaatcat atgttgtcaa    174240
     acccctgctc ttgacgcaaa aattaggaac gtacctaaat aattcgttgg tttcttgagt    174300
     tattacactt tcatcaccat tataaatttt agattcaaga tgacttaact tttcatcatt    174360
     gagccaagtg attaaaatgt tgttgctgat gtcattgtgg ctattgacga tagtattgaa    174420
     gaggtcttca tagtatgctt ggagtcttat aattacttcc aatatagaag tcgatacatt    174480
     cttccggaat gtgttcgttg tattcattaa tagcataatc cttgcaagta gattttggaa    174540
     atcaacagct gccttaaaaa ttgttttgtt ctcatcgttt atttcaagcg cataaggatt    174600
     attattttca acatggtttt caaacagtga attaaatgtc acctcaatat ttgggaagaa    174660
     ttgattctcc atataatctt taaaaaattt caatggagaa attgtgtttg tttttatttg    174720
     ttccggtagt atgttctcac aagcactgac atatactaag taaggctcaa gtaatacttt    174780
     gatattgaaa atagaaccag gaattagtga atcatctctc tcaaacgatt catcctgtat    174840
     ataaatagag cccagttcca tatttgaaga aactgtaaac cccgggaaaa tatccttcaa    174900
     aagtgttttc aattctgctg catgtttctt agcagatgcc tcgccttcaa tattatcttc    174960
     taagctaaaa tgctcaattc tattgtttgc gattgaagaa gctctagatc tttttgtttt    175020
     caaaagttta ttactattta atagttggtc atttcttagg tatcttgtta ataaaaattc    175080
     aatctcatct ataacctttc tccacacttt atcaagcgga taaatagtgc tcttagaggt    175140
     tggagatctt aaagagttga cagactctgc aacaactcta tgaccttgtg ttgcaactag    175200
     aaatttgatg aaaatctccc aaaagcattc cctcattatc aatgatagaa tgtcctttat    175260
     ggataaacca aaattcaatt ctttttcaaa cccttgagac atttttagca gggatgggtg    175320
     ttttaatctt accttttctg tactttttag tacgatatta tgaaactctt cctttgttct    175380
     gtcataaatg atattcaaag caggtgatag ctttttcata tctttcaaga ggctcaaata    175440
     tataaagagt ttgtcaaaaa cagtttgctt acttcgtacc ataacttttt ttgagtatga    175500
     ctttgagtct tcaatgtctt tcataaagat ggagaattta tcgttaataa ttcgtgattg    175560
     ctcttttatg tcaatattca ctacattgta aacatagttt tccaatgtgg agaaattagt    175620
     ctgagctgta ccgaccattc tgccaatctc atttgtaaca aaagaatcgt cattcttgct    175680
     gtagagaata ttgtgtatct cttcgatgat ggtattgaat agcacatgct cctgtaattc    175740
     tagttgctgc actaatggtt ttatagcact tacatcctta agtgtttgac tacctgctag    175800
     taagaatccc ttttctaata agatccttgc atctctatag ttcttgcctc taatatgttc    175860
     ctctataata tctgggtact gaattaattt ttcaatagaa tttaagtctt caatcacctg    175920
     gttatacttt aggctttgat tattcaaatc ttctaaatct gacttgtcga gaacaaattt    175980
     atggtttgct tccctgacag aatccttaag ttctaaaatc ttttgttgcg atttagttat    176040
     tgcattaaca gcttgagtat atgatgccac attggaattg aatgcttgac tgtgttgatt    176100
     gacaacttct tgtaaatggg agccgatttg ctctttcaac tggttgaact ctatatatct    176160
     gtgcccaaga ccaaccgaag tgtcatccaa aaaagctaag gctaattcta aaggattaga    176220
     atcctctgtt aaaaccctat tccattgact cttaacaagg cttaagtcat ctcgaaggtt    176280
     gtctagcgca ttttccattg catgttgctg atcttctgaa taactgttaa cagaaagagc    176340
     tcttcggcgc ccacgacctt gattaactgc taaatggctc atgatgttgt ttatatactt    176400
     tctgttcttt gaatttcaaa aatactaaag tatgttctct ctaacagtgt ttttgggcgt    176460
     tgtttattct aatcctattt ttgactgcca atttagcctt atttagtctc aattcaagga    176520
     caatcagcaa attgtccaat taaatagtaa ttttgtgatg cgtttttaat ggtaaactag    176580
     agatgtaatc aaaaatagta ccataattat gactatttcg atagctttat cctgcattcc    176640
     agattcgatt tgatatccca cttcattgtg tttcccctat gaaatgcatt gtaattatat    176700
     tttttaaaac gacataatca catgatatat aattcttgca attgtaatta gccaatgtgt    176760
     caattagtcc atttatggat gaatttatta cattcaaaca atgctatact gtgttatcca    176820
     tatccgcatt tttcataatc aatgttatta tttgggtctt aataaatttt attattttgt    176880
     ctgaatagga gctgctattc tgatattaaa tatataaaaa gcattaataa gtatagtaat    176940
     gccttcttta aaatgtatat ttgtcgccgc atctttgcta ttactcttct atatatttag    177000
     agtactcttc gccaagctgc ctctctatgt aaaattgcgc tacttcttcg tttaagcatt    177060
     gtcttagatc gtccatagag ttcaagttat attcatatga gaaattaaat ggtccttttg    177120
     agcaaatagg ttcatcattg ggctttcgga ctgattgaac aaactggtgt tcaagagact    177180
     gtagaacatt caatctgctt tctggttccc attgtaataa tttatcaatg agatccagtg    177240
     cagtggctga ggccatgggg tacacagtcg accaaggcat tccgcttttt aggttatcaa    177300
     gattatgatt actgttatga ccgaataaat tccatgcctt cagtgtccca tatttgacca    177360
     gcaaggatct agaaggagtt cctaatattt ttttaatttc atatacttga tgtatggaat    177420
     ccttccccat aaatataggc cttcttccgt aaaattctgc aagtatacaa ccaacagacc    177480
     acatatcaac agatttagtg tattcgttgt tagataaaat tagttcaggg gctctatacc    177540
     atcttgttgc tacataattt gtgatttcgt tgggctttga gtttttgttg acaaactgtt    177600
     ttgcaacacc tcttgccaaa ccaaaatcac atatctttaa gcagccattc acagtgcata    177660
     atatattacc tggtttcaaa tctctatgaa taacatccgc gctatggatg tatttcacac    177720
     cacaaagtat ttgatatatg aaatgttgaa tgtgaaactc tgaaagctga actgaagagt    177780
     gaataactct cgcgaggtca taatctatca attcttggta gcagtacaag ccatcatatg    177840
     gtttgtcctg gacaatctct atgtcaataa gatttacaat atgtttatga cccttgaaat    177900
     aattcatgaa ttttatctct cttatagcgc gcttcagcag aatttttcgg tagaatatgt    177960
     ttgtaatctt cttgatggct actgtaaact gttcttggtc ttcattatct aacttgtgtt    178020
     tggcagaaca gacaacacca tatgatcctt tccccaatac ctgaataatt tcatatttcc    178080
     cagatattga aaagttcgca ttcttgtata tggtccgtgg agctttgata cttgtgaaat    178140
     caggcactat gcccgcggca tctgtattcc tttttgagtt caacgagaag aacgaagact    178200
     ttttacttcc tccagtgtta ctggaaccat tcttgttgac aatattgtcg ttggagccaa    178260
     gaattttgct taagcccatt atttgcgttg cagtaatata tttacgctga tctatagcga    178320
     tgttaataaa caagactgtg taattgtatt aaatttagtg gctgataata taggcaagaa    178380
     attattcttc tctctgtcgg ttataaaatt tgccgatatg aagcatccgt ttcaaatagt    178440
     tttgtggcat aaattgaaac aaaacaacaa gacgctacaa catgcagtca cttgtcatga    178500
     cacatagtac tcacaatatt tgccattgtt aagaaatata atttgagttt caatataacc    178560
     tgttccatta acacatttga taaacttctc aaattggttg gtaacagcat gaacttatga    178620
     cataaaaaag acgactctca agaatgcgat acaagaaata tgaacactgt catcagggaa    178680
     catcctttag atattcaaat agaaacgaaa caatacgatc ttaaaactca taactcaata    178740
     agcaaataat agattttcaa gcgattattt ggatggatta cttattgaag gttcaacaag    178800
     aacaagttag agtagtaata gacaccagac gattcgcgac ttggaaagaa cctttccccc    178860
     aatgaatcta ccacttacat atccatttgt agttacaaaa gaccaaggtg gtgcaataag    178920
     agagggtgac gcgtgagcaa gtgctacaat atttaccttt ttcttgcttt catattagta    178980
     gcgtgcgacg cgtaaagatg ttgcaatttt tttttgactt tctactgagt tatttagtag    179040
     catcttgaac aattggtggt cattttgcat agtgacgata tgttacaaag ctgcaaaaac    179100
     tatcgtgaca cttatttaaa tagagtactt actctcttcc agccaattca ttactttaaa    179160
     tacaattatt ttgtgcttaa cgattgtgaa ctcaagacaa cctaactcaa taagtgaata    179220
     ttcgctctat aaaaaaaaat catatacaat gttggaagct aaatttgaag aagcatctct    179280
     tttcaagaga attattgatg gtttcaagga ctgtgtccaa ttggtcaact ttcaatgtaa    179340
     agaagatggt atcattgctc aggcagttga tgattcccgt gttttattgg tttctttgga    179400
     aattggtatt gaagcattcc aagaatacag atgtgatcat ccagttactc taggtattga    179460
     ccttacatct ttgagtaaga ttctaagatg tggtaacaac tctgacacgc tgacattgat    179520
     tgcagatgac accccagatt ctgtcctatt gttgtttgag gacaccaaga gagagagaat    179580
     cgctgaatac tctttgaagc tgatggatat cgatgctgat ttcttgaaga tcgaagaact    179640
     acaatacgat actacattga tgatgccatc ttatgagttt tctaaggtcg ttcgtgactt    179700
     gagtcaattg agtgattctt tgaacatcat ggtcacaaag gaaaccatta agtttgttgc    179760
     cgatggtgac attggttctg gttcggttat cttgaagcct tttgtcgata tggaaaagcc    179820
     agaagactcc gtcaagttgg aaatggaaca accagtggat ctaacatttg gttccaagta    179880
     tttgctagac attgtcaagg gttctgctct atcagaaaag atcggtataa ggctttccag    179940
     tgaagctcca gctttattcc aatttgactt gaagagtgga ttcttacaat tcttcttagc    180000
     accaaagttt aacgacgaag aataagccac tggcccagga tcataaactg taacaaaaat    180060
     aaattaatct ctcatatata taacctatac actgtacatt agtcaaaata acataaattt    180120
     attatcaatt ataaaaatgc acttaaatat tacaaattaa tcatggccaa gcgtttaata    180180
     tttgcaaagt tagtaactcc acctataaaa gctacttatc taaagtacac ataacctttg    180240
     ctataaaacc ttcaagatgg aagatagctt tgttacccaa gcatagacgc tcatcaaaaa    180300
     cactagcatg gtcaataatc tctacacggg aggaatctgg agttgtttta tcagagatca    180360
     atgcaaatgc taattcctgt agtatcactt tagccggtat acagtgagcg agcaagtcat    180420
     ataggacagc acgacactcc actaatgaac ttaccgatct ctctttcttt atcttgttgg    180480
     ccagtttcaa tattactacc atccagtccg gtttgattac gggagtgttt tcctttaatt    180540
     gcatttcgtt gctgagactc attgactcca acattaaaag agcaagtctc atattaccat    180600
     ttgactcatt ggctacctta tctagaatta cctggtctac gatattgacg ttctcttcac    180660
     ttgcaacatc tttcaatgtt ttcgttatat ctttcatttg tggtgctggt gacctgatca    180720
     tcaaacaacg cgaccttatt ggggagatga tagatgacat agagtcacac agcatgatca    180780
     aacgtatgtt ttttgagtac ttctccatgg tacgtcttag cgcagcctgt gcatccctag    180840
     tcaatgaatt ggcctcattg attatcacac acttaaacct attggcaata ccagagctcc    180900
     cgtcctggaa atcgacctgt tccatctgtg caacttcctt cagaagctcc tggatcacaa    180960
     cacgatcgtt attacccatg tcactgggag tgatctccaa atggtacgga gaactaacca    181020
     catttagctc cagcttcctg ttcgaaggcg tcacgaaccg cctgacatct atctttagcc    181080
     tatacacctg gctaccaaag atagactcca acagagccat acaccttgtc ttcttaccag    181140
     atccattggg gccatatatc agcagatgtg gaagatccct cggattcata gccaaggaag    181200
     agagaaaccg cgttagatca tcgttgtaag acagagtctt caacgtttta ggcctgtgct    181260
     tatcaaccca aagagacatt attaaaagag cagctgttga tcgaggttgg tctcgctgta    181320
     gaggtaatta ttcgtggata gtctccccac taatatgccc ggtaattatg tatagtatgc    181380
     cagtatttta ttcaatcgtt acgctcatcg cgaattctta ggaaagcaag agcacgctca    181440
     cttctaacgt cacagtattt tacatgtgat gtattggtct aacctatacg tcaaattcct    181500
     ctagtaacaa gtatttgcaa tgatgcttgg tgaatggtta ctagcgttgt tatctagttt    181560
     gttttgttat cctgatcagt gattggcgta gctgtatttg tgacgtttgg gataggagcc    181620
     cttgtacaag tcactattaa cagaaagtgg gagcacatag ttcacgattt ctgcccgaag    181680
     ttgcatttca attgccaaag gggatagcat ttaagaagaa agtgcctgca gacttaaact    181740
     tgcagtgata ttcagagatc aaacagaaat aggtagacac caattgagaa aatggctaca    181800
     gatgatcagt ttatagagcc tgattttata gagcctgacg ttcccgttcg agatggcagc    181860
     aatggaaact caagtgccgc tggaagtcga ggtatagctg gtttgtctgg caatatggag    181920
     accagtagtg gtgattggaa cagaggtacg ttggacgaga gtgtcttggc aactttcaag    181980
     cgagatatct atgatatcaa ctcgaagtta aaacaagttg tgtacccgca cttaccttcg    182040
     cataggtaca tggccaccac gagtggtgac caggactctg ctcagggagc caacgaggac    182100
     atattcaaca gctctgactt ctgggcaccg ctgaccttta tcatactgta ctcagtatgt    182160
     gtatcgcacg caaagggcct attctcgtct gtgtttgtgt cctgctggtt cgtgcttgtg    182220
     gtgatggcct tgcatttgaa actgacgaaa ccttaccaaa acgccacatt gctctcatac    182280
     gtgtctctgt ccgggtactg tatgttccct ctagtgatat gcggacttct ggtacaaata    182340
     gtgatacccg cagtgtccca cacactggga accagccctt ggaaggtcag agtctccact    182400
     ctgctcagac tcacggtgtt cgggttctgc tttatttggt ccttcacatg ctcagcaatc    182460
     gtcaccaggt cgaagggctt cgtccagtta tacccgctcg cactctgtct cttcggcctt    182520
     gcatggctat cgatgattct gtaatttact cacatccaat atatcgtgac acgcacaaca    182580
     gttgtacata taatctaaat atatttgtaa cacgcccaaa tgattgtaca tatactcgca    182640
     tacatatagc gtaacaacaa tggttgtaag cacttgtgtg ttacatagag atctcctagt    182700
     acagaaccaa aacttgggat aactccgggc gttcaaaata ccttgcaata acagcgggat    182760
     gcagaatgag aagccccaaa cagatgagaa cagtgtatat taagtagatt tataacaccg    182820
     accggtgtta tggcgactta tctttttttt aattagagac gcagcaagag ttgatttgct    182880
     acagcagttt ctgtgcaagg aaccggtgac ttcctctttc accccactcc cccacacttc    182940
     tgcccgtacg gatcgttgaa gaagttgggt tttctctctt gctgcgtgga attactggct    183000
     gccacttttc aacggaatga gggaccaaca aacacatctc accccctgct gtagacgtca    183060
     aagcgtaatc tgtcaaaact ataatagaat attaagcttg aatttgttta aaaggcgggg    183120
     aaggcggcaa aggtaagtca ggagtagctg agagtatgtc gctgttacaa ccatttacgt    183180
     gtacgtgcta tcctttgagg ctgcccgctg cgcaggccgg gtctggggat gagtatgtgc    183240
     ggaggaagca gagtctggac tgtaggactg gtgctgcagt tacgttgacg cggagtaata    183300
     tatttgtgca tggagggctg actatacctt tgaacttgga gaaagtgaca tgtgctgaga    183360
     ttcagaacca ggtggtgttg tattttgcga aggagaagga ctgcagtgca gggtttaagg    183420
     atttaaagca atggttgagt cccgagatat tctttctgga tctgatatcg cggacatgga    183480
     atagggtgga taccactgtg gagagtgaga ctatgttggg cgcaggtgcg ggcgctggcg    183540
     ctggcactgc caccgggact ggcatggaga ctgaccctgc tcgggaagct gcggatgttg    183600
     atgtgtttgc caacgagcag tctttgtcct cttctgtaac attatcagtg atagagcagg    183660
     agagtttcag agagaggctg ttccactcta tgtgctatgt tgatggcaat atattcgtgt    183720
     ttgggggatt agtgatgtcg ccgcagaacg gctacgagtt tacggcgtcc aatgagttgt    183780
     ggagactgga ccttaggacg aagcagtggt cactggtgag tagaaaccca ttgatacaaa    183840
     gaaggtttaa tcactccatg cacgtcaaaa acgaacatag tgacactaga gatacgaaaa    183900
     ttgtcattgt gggtggtcta aacaacttgg atgagccagt gcataaagtc gatatttaca    183960
     acctcacgag aggctactgg cagtctgtgc cagattctga gttcccaata gagctagaaa    184020
     ccaatatcga aggaaagcca gtggaccttg ctacggactc ttgtttttct attcttgttg    184080
     agaacaatga ggccaagatc ccagcgttag cattttacaa accattaagt tgtcgagatc    184140
     actcggtgat aacatcaaga tcaaaaaaag cgaaacaagt gtctggtaga tcatcagtag    184200
     atacggaaat ggcggtatgt gattctgata caggtaccaa agagcaagac gaacaggatc    184260
     ctaatagtca atctcctata gtggccttac ccattgtttc ggggtcgaaa ggtataagga    184320
     tggcctccca tcctttacaa ccaaacgatc tattagaagc tcccttaaat ttactaaatc    184380
     caactggaga ctacttcggt tacaatattg taattggtgg tttctgccct acattactac    184440
     cttctgattt tcattgttat atttacgata ttccttctgg aaaatggact cggattggta    184500
     tcacttgtcc ggattgtgaa attaatacgc ataggttctg gaaactgttt gtgtgggatt    184560
     ctcatcatca ggctttggtt ttagggacca aaaatgatga tggatatttg ccaagtgtcc    184620
     agaaatttga tcatctatta agttttggtc ttcctataat aaatatattc aacaaaggta    184680
     ttcactcagt tccatctaac aaggatgcag tcatgtcggt accagattct aaatttggat    184740
     ctagtggtgt ttctgatctt gaaagtgatt tgaatagaat gagctttgca tcttctcaga    184800
     catctcaatt tgaaagttat ataagataca ttgcaccacc atatgagatg acatctatta    184860
     gatctgtgtt tcctgcatat gcaatggttt taggtaagga tgcattggaa atatatggta    184920
     aaccgctttc agattttgag cttgtcagta gtgaaggtga agcaattgga gtaccattat    184980
     atttactacg gaaaaggtgg ggcagatatt ttgatctttt gctatcccaa ggttactcta    185040
     aagcttgtac agaatacgag gcgtctggta acctttctac gttaatcaag ttgacaccgt    185100
     tttcttcgag gactggatcg agagatatcc atagttctag gttatcatca tctagctcgt    185160
     tagataatta ttttgtaaaa ggaattggag cacagcatca tcattactca gtatcagggc    185220
     cagccggtag aaaacctccc ggatctgaaa atattgtaga tagaacatca aggtcttcag    185280
     tagatgggca tttaatgggt tcatccccaa atccaatgag cgaaagtgta tatctcacgc    185340
     atattgatga tgttgatgat gatgatgatg attgcgttgg tccaacatcg caagcaaaaa    185400
     atacaaataa aatgaaatct gtatcccgaa caattacttc atctacaaca agttccactg    185460
     gtggtatggt gtttagggtt ccatttcaag aaaagaagcc atcgtcatct gttcaagata    185520
     tcgcgccaga ttcccagttt tttcagacag gatcgagtag tagaaggtcc tccttattga    185580
     gctcgcaaac gatgggaata cagagatcac ccaaaattga aggtaaaagg agagcttcac    185640
     atcctatcat atcctctata atggacaaag gacaaccagt atctacacgt agtgtgggaa    185700
     gtactaggag ttccctttcc tatgttagtt cttcgtctga aagacaaagc aaatctcatc    185760
     tgcctgggag tcgaaacagc agtgtaaccg gttctccaat tttgggagtc ttaaatgtgc    185820
     ccttaccacc accttgccag accccaacag aaccggtgcc accgcctcct gttacaaagt    185880
     accccaatat cacttcaaaa cctagaacga actcaatgtc agaggtgttt aataccatta    185940
     aaggaagtcc tctttcatct agaagatcgt catatagcag aaagacgagt acgtctgaag    186000
     tgaattcagc gattgacagg caattaatgg aagatagatt caaagaagct gatatggcct    186060
     ttgctaaaca gacaccaact aaaccagtcg caggtagtaa gatgcctgaa aatattaggt    186120
     cttcaacaag aaactcagta aataacgatt ggagtaggca ttcttttgca tctgtatcag    186180
     atagttcgga aagtgctaca gtaaatggta acatagaaat ggaaccaatg ttgattccgc    186240
     gaactctata tttaccatgg tcaactgcaa cggtgcacgc atttgcagaa ttcttttata    186300
     caggtcaggt caatggtaaa tggatgttgt ctccagtcgt tctcgactta ttggttattt    186360
     ctaaactata tgagttacct ctcctattca atttgatatc agaggttctt tactctattg    186420
     ttgggaaaaa ggaagaaggc atgtacatta cctgtaaatc gttaattgat tcgttttcaa    186480
     gaaaagtttc gacatatttt ggtaatgata aagaaaagga agtggcatat ttggagtcat    186540
     gtgaagctta caagattctg aaaaaaatca agctttgcct tgaaagaatt gataacggat    186600
     tctttgatct tgatttgatg agaagacatt ctatgtctag atcatcatat aatagcagta    186660
     atggaagtac ggtggagaag aagaattcac tggatttgag tccaagaggc tcaagtaatt    186720
     tgccaactat gatgggaaat ggaccaagag atagtcatgt ctcgattgaa tcgctaaatt    186780
     atcctatgca catgaatata ccatcatcta gacggtcgac aggaacattt gcacacagga    186840
     ctacaaagaa atccagttta agcaaagaga tagatccgtc tttctttaat gatacaagtt    186900
     ccaccttaag cctgcatgac actgctatag taaaagattt caatgagaag attgcaaaag    186960
     ctgatactat cacggaaaag gattactcta gtaccagtag cagtagcagt tgtgatctag    187020
     atgatgaatc tgatcaagaa aaactaagac atctttctga aactgatttt gctactattc    187080
     ttgatacaag agactcaaaa tcacatcaat tgaatactaa agaggacatt aacaatttcg    187140
     acttcagttt ggggttgttg tcatccttca atgatgaaaa aaacaagctc aggaaggtag    187200
     acgttgatga gccaattgat ccattggcaa agatcagtca taatttggac agtccaaata    187260
     ggttatactc gaagtatagc caaggttttg ggaaaatgcc taaaagcggt agtcaagcaa    187320
     gtaatatggg tttattgact ctagagaatt tagcctcgcc taatgctctg cctccggatg    187380
     atgcagtgat caaagcaatc catcagacta cagtcctagc aaacgaggtt aggttaatga    187440
     ttagatgtgg tgactgtttg caaatatcaa aagatttgag acgctgtaaa aaaattatga    187500
     actctgaact cactaaactt gaaaagacac ataatgtatc agaatctagg actagtattt    187560
     ctgcgtcttc atcgcaaact agactctccg actaccaaag cagcaccaat tctggaaaga    187620
     ttacaccaac tgctggtggt tctgtaacaa ccatggatcc gttggtgaaa agcaaactaa    187680
     agcaaaactt gacaggtcaa gaactgcatc caggtattca tttcgtagaa actctgcatt    187740
     caccaaaatc agttgctgat ttcgagagca aagaaacctc tagccaacca ggcgttctta    187800
     atgggttgca cacaggactt cactcaggat ttcatgctgg acttcatacc tctccccacg    187860
     caggtcttca ctccaaacct caacatagtc atagtgctac taagattcca aaagtttctc    187920
     acaaactggg gaaagcgaca acctcgacta gtttgaaatc cgagagcaag tcacccagta    187980
     gtactaatct aggaaagaaa gaacataatt cttctttggg tcctttatcc ttttttggta    188040
     ttagaaacaa atagttacaa atattatgta gttttaagtt tttgtataat tctgaacaca    188100
     ttcttataat ttccattatc attgttggca gtcacctaag tcatttgatg aggggtttcc    188160
     gatattttat gtcttgttcc aattttggtg agtaactgtc aaatagcgaa ggtgtataca    188220
     aaactgatgt taaggtaaaa agttgtgatg ttatagaatc tggaacagct ttaaacttag    188280
     ataactaggg aaacatgaag gagtatcctg aagaatatct aggacagcat atctcaacat    188340
     tacctacacc atgtatggtc attgatgaaa agaaattcaa ctcaaattgt gagaatatgc    188400
     tcaaacatgt cggcgagtta ggttctttaa ctgaacatcc tatattgttt agagctcatg    188460
     taaaaacgca taagacaaca gaaggtactc tgcgccaatt aggatttgaa gggacttcag    188520
     cgccatttag atcaaaggct atcctagttt ccacaattaa ggaagctgaa ggtttactag    188580
     aataccagga ttctatcaac ggggtgtttg tcgatgacat tgcttttagt ttgcctgcat    188640
     gtgtaccaga agtattggaa agactatcat cgatctctac aagggtaagt aatcttaggg    188700
     tttttgtcga taatatcgat catttggaaa atctgaagca atttggtaga ccaaaaagtg    188760
     gcaaaaaatg gtcaatattt ctaaagattg atatgggaac atcgagagct ggattggaag    188820
     ttagatctga agagttcaaa gagttagttg agaaattatg tgatgagtca gtgaaagaag    188880
     ttacccaaat attcggtttg tatgcccatg ctggtcacag ctatagctcc catgacatta    188940
     acgaagctaa tggatacttg attgatgaga tcacagctgt taatgaagct gccaagctag    189000
     ttggtagtgt cacagaaatc gagcctagac ttttaacatt gtccgttggg gcaactccaa    189060
     cagcaaattc gttgagtaca aaggaaaaca aaaaactcat tgatattata agaaatgatt    189120
     tagttgcacc tttagagatt cattgtggca actatccatg ttatgatctc caacaatata    189180
     gcacaaaatg tattaaatta aacaaaatct ctgccttcgt cttagcatcg atagtttcga    189240
     agtatgagaa gagaaacgag gcattaataa atgcaggagt attagcatta gctagggaga    189300
     actcctctat cccaggtatg ggattgtgta tcaacacgga caaatattta catgctccaa    189360
     gagatttcga agtgagctcc tttgtgaacc gtgtttctca ggaacatggt atcttacagc    189420
     cttacaatag agataaatgc gaagattgga aactaggtga gaagttacta gtgattccac    189480
     aacatgcttg tataacgatg gctcaatttc catactactt tgtattcaat gatagtggta    189540
     aagtaattga tgtttggaag ccgcatcaaa agtggtaaaa ggataagaca aaaatggttg    189600
     tgagtagttg caatacagta tttattatat agaaatagta tacctcaaag atagaacaag    189660
     ataactaata attatttgtg tttgcataat atccgaacat cacagtattt caacattaca    189720
     tatttatacg tatcgacgaa ctgtaatagc ccatttaatt ttcatgtcta tgtgcgatga    189780
     gaaagaaaaa tttttgggca gaagtataat gaaaacgttt taaaacgcca gtagtgtagc    189840
     atcgaattgc ttaggtttaa gatcaattgc ttatcttaaa ggtcaggaat agtcaccata    189900
     tctccacaca gtttgaggat tcattttaag cgatgagcaa tcctagatct tgggaggttt    189960
     tggaacctga attgggtaaa ctatgttacg attcgaagat ctcgaataga ataccaattt    190020
     tgactgaact aaaagagatt gtgaagacca ataatttgtc cagggaacaa ttgctcaatt    190080
     tagccagcgt tcttttgaac acttacacaa tttacaagga ccatgaatca aagaaagctg    190140
     tttgcgatat ttatgatgag atgatcacaa tcgatgggtc cttcattgcg atctttttgg    190200
     atcacattgt tgagacttta ggtgataaga ttggtactaa ggctttatcg gattatctaa    190260
     atttgttaga caatatcaat cattttcttc aggtgatttt agtcgattcg aatttaacta    190320
     gccaatacct accgaaagtg ttgcaatgcc acacaattac tactgctagt atcgaaacat    190380
     cactggacat atctgaaaaa tccatggaat tggttagcga gaagcaaaat cagcacagaa    190440
     gaagaatgag aaagacaatt attcagaatt caacaaaata tttaaacaag ggtttaaaga    190500
     acactgagaa tatccaagat gtattggaga ctataaggca tcagctacta gaggaatatg    190560
     tgaagttgaa actaccagtt gcgggtatct tggtcttttc ggctgcttta accaaggctg    190620
     ctcttcaatt acatgtacag acaccaattg tgctggaatt tttaaggaca acatactcaa    190680
     aagattttgt tgtctttttt ggtaaagagg tactattagg taaaacacca ccttcatcat    190740
     tatgtgtcgc aactagtatc gatactatat ctcaagaatt attcacagaa gatatgataa    190800
     agaatgatat tataccagtc ttggaaaagt ctaatctgag atcccccgaa tccagctttc    190860
     aatatgccag agctcttttt ggtagcatta acgccaaaac aatcaatatg gctgaacttt    190920
     acgcatctac gaaactaatg tctcaggcat tctcttcatt taagagttcc agagagggta    190980
     ccaaaaccgc tgcaatttct tttactgttt cagtactgag atcattgtgt gttgagacaa    191040
     ctgaagaaag tgctcttttg aaaattgttg aaaacatatt caccaatttg aagactaata    191100
     tgaatgctga ttacaaagcc attgtttcca cattactaca agctatacca accttccatg    191160
     aaaatgtttc tttagatatt gctgagaaac tgtctccatt gctggtgaaa gaatcgaatg    191220
     aacaagcact tgttaactta ttaaatcctt tttatcagca ctattttgca actggcactt    191280
     caattgataa atttaatacc acaattatat ctggacttca agaaaagaag gctcctctta    191340
     aaagatgttg gttttctagt ctatttatga acatcgatac tgttacagag tcaatagcaa    191400
     agactattgg gaaactttgc accacatata tcaaagaaaa cttagtccac gctcaaagaa    191460
     cagagcatag cgtagctttt agtatcttat ctggctttgt gttcttttca gagaatgttt    191520
     atgcagaaat tgagcatgat ataattgata ttcaaaaaga tgcaatgcta ggtgaggcat    191580
     ttttgagagt atgtacatct attgaattgg atgcagtaac acgtcaacgt tctgtaaccc    191640
     tattggaaaa ggccgtttca ttgcaaggtg aaactatatc agaaaatgtg ataaattcta    191700
     ttgcaaacct catgaaacaa gactcctttg aattggatga aaaatgctca atagtatact    191760
     ttataccaat tttcaatgca ttagttacat caaatgagga caaaactact caaggtaata    191820
     tcttgagatt tctattggtc atctcacagt atgataaatt caggattaaa aatggttggg    191880
     ccggtttggc tctcaaatgt ggcatagatc cttctcagat tattgcagaa aacacgagca    191940
     caattataaa cactattata agtgagtctt caaaacccga actgttgaac acgatttatg    192000
     gaagctgtgt tatcaaggca gcctcataca tagcatttat caatcctgtt gctgttgctg    192060
     ggccaatagc caagcttttc agtgaggatc tttctgttgc tgatcttgat aagttaacag    192120
     aagaagatgt aagtatatgg aaaggtaatg aaggcgaaat ggttatcaat gtgttggaaa    192180
     agcgcaatga tagaaaatta gctgacaaga attctaagga ttatgaaact ctgaaatggg    192240
     aagaatcgat cagaaaagag caggctaaga aagctaattt gaaactttcc aaagaagatc    192300
     agatgttagt taaggaacaa cttgaaaaag aatccaaaat tagaactcat gttaatggca    192360
     tttatttgag actatacaga agtctttctc taatcaagca gttatcaaag gaggctaagc    192420
     ttgttgacaa tggtatttta gtatggtatc caaccgctgt gaactcgttg atgagcctga    192480
     tcagaacgga gaactcatat aatcttcttg agtcattatt agttgaatca tttttatctt    192540
     tatctgaaaa cactgccgaa aagctagaac actacagact attttgtggg ttggctatat    192600
     taagagttta caaggctaaa tttataccat ccaattacct tgaagaaaat ctagaagaac    192660
     tattatcaag ggtattgttt agattgaaga ttgtgacaag taacactgaa ctcgattcaa    192720
     ttactttgac atatttgctt cctctgatta cttatgttct agaagaaggt aaaaaggctg    192780
     cacttaaaaa tgcggacaag cctgttaaca gaactgaatt tgttgaagaa gattcggaag    192840
     aagaaaattt gcttcttgcc atggacatca tttcagctca agctccatta tttgagaatt    192900
     catccattcc aagggcctca attttacaag tgctactatc gctactttct cttccatcta    192960
     aagctaaaat tgccaaggac tgcttaaata cattaagtca aagtatctca gtacatccca    193020
     cagaaaatga tctgaaaatc atcatttcca gtttgttatc ggggcactca tttgtacgta    193080
     ctactatttt ggaagttttg gacaatgagt atgaattaca agaattcatg aaattctctc    193140
     ctgaaatatt catgtgtaga tttgattcgg atgataataa tagggaatta gcaaacttca    193200
     tctgggagtt taacaaattc gaaattgttc cggaattact agacggtcta ttgtctctat    193260
     tttatcaaca agatagtggt ctccgtttgt ttttggcccg tggttttgca tacgctactt    193320
     ataatgttaa gggagaagaa tatttggagc agtctctgaa aatgttaatg aacttttata    193380
     atgagaaggc ccaaccttta actgctattc ttgatgagtt tggtttagtg gtcgtccctg    193440
     cctcacaaag aaaagatctg tgggaagaaa gaagcacagc cgctattgca ctaaaagagc    193500
     tttcgcctgg cttgccaagt gacggtgata ctgtggtttc tgtaattgaa ttcttgattg    193560
     ctggcccact aggtgacaga gaaccaattg tgcgtcaaga aatgaaagaa gcaggtattg    193620
     aaatcattaa tcagcatggt gctcaaaagt catcacagtt agttccccta tttgaaagct    193680
     ctctagaaac cattaaagat gttaatacaa aggaaaacgt aattattttg tatggtaccc    193740
     ttgcacagca tttggataag tccgacaaaa gaattggatc tattattgat caattgttac    193800
     aaacgttaga caccccctct ttagatgttc agcaggctgt ttcttcctgt attgcagcct    193860
     tggtgtttca attcaaggaa aattgtggat catacattac acagttgcta gccaagcttt    193920
     tagattctac cattgctaag cctgtaagaa aaggtgctgc ttggggtatt gcaggtatag    193980
     ttaaagggta tggtatctcg gctttatcag agtttgatat tatacgtagt ttaatggaag    194040
     cttcagaaga taaaaaggat gctattaaaa gagaatcggt tgcttatgct tttgaatatc    194100
     tatcacaatc cttgggtaaa ttatttgaac cttatgtgat agaagttcta ccaaatattt    194160
     tgaagaatct tggtgattct gtgcctgaag tcagagatgc tactgcagct gcaaccaagt    194220
     cgattatggc taacacgact ggttatggtg tgaagaagat gatcccagtc actgttgcaa    194280
     atcttgatga aattgcatgg agaacaaaaa gagggtctgt tcaattgttg ggtaatatgg    194340
     catatcttga tcctactcaa ctgtcgaact cgttgtcaac aattgtaccc caaattgttg    194400
     gtgttttgaa tgattcacac aaggaagtac gcaaagctgc tgatgaatct ttaaagcgtt    194460
     tcggtgaagt cattagaaat cctgagatac agagattagt tccaatcttg ttaaaggcta    194520
     tcggtgatcc gacgaaatat actgaagagg cgctagatgc attgatacaa actcaattcg    194580
     tccattatat tgatggtcct tctcttgcat taatcattca tattatacac cgtggtatgc    194640
     atgaccgttc tgctaataca aaacgtaaag catgtaagat tgttggtaat atggctattt    194700
     tggtagaaac caaagacttg attccgtact tgcaacaatt aatcgatgaa gttgaaatag    194760
     caatggttga tcctgtacca aacaccagag ctactgccgc tagagctctt ggtgctttag    194820
     ttgaacgttt aggtgaagat caattcccag atttgattcc aagattatta gatacattga    194880
     atgatgagac aaaatctggt gatcgtttgg gatctgctca agccttagca gaggtcatca    194940
     gtggcctagg tttatccaaa ttagatgaat tactacctac tgttcttgca ggtgctacta    195000
     attacagatc atttgttagg gaaggtttta tgccgctgtt attatttttg cctatttgtt    195060
     ttggtgccca gtttgcacca tatatcaacc aaatcattca gcctattcta gctggtttgg    195120
     ccgatataga tgaaaacatt agagacactt cattgaaggc aggtaaattg attgtgaaaa    195180
     attatgcaac aaaagccatt gatctattat tgcctgaatt ggaaagaggt gtatttgacg    195240
     aaaatgaacg tattcgtctt tcatctgttc aactatctgg tgaattatta ttccaggtta    195300
     ctggtatttc atctagaaat gaattctcag aagagggtga aatcggatca gagttttctg    195360
     gtaaaatggt tgatgttctt ggtcaagagc ggagagacag agtgttgtct tctttgtttg    195420
     tttgtagaaa tgatacttct ggtattgttc gtgcaagcac tgttgatatt tggaaggcat    195480
     tggttccaaa caccccacgt actgttaagg aaattctgcc tgttcttact gatatgattg    195540
     ttacaaattt ggcatcctca tcaaataccc taagaaatat tgctgctcaa actcttggtg    195600
     atgtggttcg tagagttggt ggtaacgcta tggcacagct attggaggct ctcgaagtga    195660
     cattggaaaa gacttctaac ccagattcaa gagagggtgt gtgtattgcc ttgaatgagt    195720
     tagttatgtc tgccagcatg gatactctaa cccaatatca agatacagtt gcaaacatat    195780
     tgagaagaac cttaattgat tctaatgaat ctgtcagaca ggcagcagcc ctgtcttttg    195840
     attcctatca agaggcagtt ggtaaggttg ctgtggatga agttatccca tacttattga    195900
     atgctctgaa atccaacgaa aactcagaat atgcattgct aggtttacag gatattatgg    195960
     caacaaaatc ggatgttatt ttcccaattc taatgccaac tttgcttgca tcacctatag    196020
     attcgttcag agcatctgct ttaggttcat tggcggaggt tgctggtcca gctctatata    196080
     aacgtctttc ggttattatc aattcgttag tcgacacttt gatatctgat gatattgatg    196140
     acacaactaa ggagggtgtc aagcaagcgc tagatcgtgt gtttttatct gttaaggacg    196200
     atgaaggctt gcacccattg ctgcaacaaa ttctagctct tgttaagaat gatgacatga    196260
     agaagcgtat tgttacattg cagtgcctac caaacttctt tgagcagacc tccctagatt    196320
     tggatgtcta tgtcccagac tttgtttcca attcaatcat gtcattggat gacgagaatg    196380
     ctgttttcgt gaaggcaaca tttgaggcat tgtctgcgct tgtgaagaag cagcctaagg    196440
     atatgctaga aaaattggtt cagccagcaa aacaagcatt gcaaagaact ggtaaacaag    196500
     gtgaagattt atcagccttt gcacttccaa gaggtcctaa ctgtgttctt ccaatctttt    196560
     tacatggtct aatgtatggt tccgctgagg agagagaagt ttccgctttg gctattgccg    196620
     atgtagtttc aaagactccg gctgataacc taaaaccatt cgttagtgct attaccggtc    196680
     ctctaattcg tgttgttggt gaaagattca agagtgatgt caaggctgct attttgctag    196740
     cattgaatat actgttcaag aaaattccac agtttttgag accatttatt ccacaattac    196800
     aaaggacttt cgttaagtcc ttgtcagatc caactaatga gactttgaga ttgcgtgcag    196860
     ctaaggctat tggtacttta attgaattcc agccacgtgt tgatccattg gtgattgagc    196920
     ttgttactag cgctaagcaa actgaagaag agggtgtaaa gaccgctatg ctaaatgcac    196980
     tgttggaagt tgttggtaag gctggttcaa aactgaacga agcttccaag aagaacattg    197040
     taaagttggt cgaggaagag atgctctcca gtaatgataa actagctgtt gcttatgcta    197100
     aattgatagg ttctctatct gaaatcttat cagaagatga agctaagaat attcttcaag    197160
     aaaaggtgtt agatgccgat atggaaggta gcgccggtaa gtttgcggta ttgattttga    197220
     actcgttttt gaaagatgca ccttctcata ttttcagttc aggtgagatt cataagtttg    197280
     ttaaatttat tactgatgct atgacatcaa ctaatgttca ctttgttgaa aatgctacat    197340
     tagcggctgg taaattattg cttctacata atgagacgaa gtctccttac acaaatatga    197400
     agaacgacgt aactttcatt gtccctgagg aggatatcaa gtctttagtc gaggaattag    197460
     ctaagagtgc attagtacca tctagtaaca ccacagatca aagaagactt tcattagttg    197520
     ttctgagaac cattgcaaga ttaaagaacg aggagactgt gaagccatac ttggatgttc    197580
     ttgcccctgc tgtgttttca tgtgtcagag atgttgttat tccaataaag ttagctgctg    197640
     aaaaggcctt cttggctttg ttcggtttaa ttgaggaaga agacatggct acattcaaca    197700
     actggtttga aagcgtgagc agcaatggtg ctactataga taacatagtg ggaaccacta    197760
     tacaactgag gtcgattggg gattacacga agagagttgc caagaggctg gctgcagttg    197820
     aaagagaaag aaccgcggcc ggtggtgatg atgagatgat gttcagtgat aggtatgagg    197880
     atgaaagaga aatatgggcc gtcggtggtg ttgagttgcc aacggatata tagtcaaaaa    197940
     gaagaaagaa agaacgctca taactaccat ctttattttg ggacctaact tgttgcattg    198000
     tatattagca tgtacaatat atagatattt tattgttttt taattaattc ataaacaatt    198060
     tattatacaa aattgattct ctccatcacg cacaaaaaag tgttgtgaaa agttatagcc    198120
     tctacttatt ttcaaggtaa tcagccatgg accacatcat tctctctatt aaaggcagtt    198180
     gctgccacca agttagagat tctccaccgg actcataaat ccagtccacc aatggttgtt    198240
     tcccgtagta tttaaacaat ttaaaggaaa tgttaacaat tagtagatag aggagtgctt    198300
     tagccaagta tcggagaggc acagtttgta aacgctcttc tttttctgaa ctcatacaga    198360
     attgagtata gaaaagagat ataactgttc tctgacgaga gcctacatac tttgtctata    198420
     taaacaccct gaacaacaat ctgctagtat ctggtagaga agagaagctc cttatatgag    198480
     caacagccac acagtaggtg ccacaaggta gacacgtgac ttttatagcc agtagtttca    198540
     aaaaataaaa gttaaaaaaa tttaatggtt gctaagagat tcgaactctt gcatcttacg    198600
     atacctgagt gctcctgagt ttgttaaccc agtaagtaat gtttcaactt gaatcaggcg    198660
     ccttagaccg ctcggccaaa caaccatact gtatttgttg gatgggagag aataccagat    198720
     gactatgata agtagtgtag tatttttttg ttgtgaatat taattttgag agagtagtat    198780
     tgtccacggt cccatgtaat atagacatac caaaactact aatccgctgt aattgttttc    198840
     ccgtgctgag agctggtggt agccatatat tgtttctaac tgaatctgtc atgtacaagg    198900
     gcatgaatga aagtctgtca tcgcattgtg tctgagtcat ttagctcctc cgtgtcgcag    198960
     tattgctctt tcttccaatc cccgatttgc gatgcccatt ccgagcattc agttggttct    199020
     tagtaggcct tattaaagag catcacatcc agcacagcca taccgttggt atataagcta    199080
     ttgccatcct ttttttttta tcttttacaa aaatactgtc tattgctaag ctagttcaag    199140
     gtaaagcacc accgaaataa atgtctgcca ccatatttaa caacatcgaa gaacttcctg    199200
     ctgatgccct tttcggtatc aagcaaaggt acaatcaaga taccagagcc accagagttg    199260
     acttgggtat tggtgcgtac cgtgatgacc aaggcaaacc atgggtgttg ccttcggtta    199320
     gaatggctga aagggcaatc caagaggatc caagctacaa tcatgaatac ttgggtatca    199380
     atggtcttcc aagtttgtct tccgctgctg ctaatgttat atttggtgaa gactccccag    199440
     ctttgaaaga aggcagaacc atctcagttc aatctttgtc tggtacaggt gctttgcaca    199500
     ttgctgccaa gtttatctct aagttcgctg ctgacaagaa gatttatttg tctcagccaa    199560
     cttgggctaa ccacaacgcc atcttcaagg cacaaggttt agagactgct tcttatccat    199620
     actggaagag ttctaccaag tcccttgact tggaaggttt catctcagcc atcgaaagtg    199680
     cgccaaaggg ttctatattc ctgctgcatg catgtgcaca caacccaact ggtttggacc    199740
     catctgagaa gcaatggccc gttatcctgg atgctctggt caagggcgat cacttggcct    199800
     tattcgactc cgcttaccaa ggttttgcct ccggtgactt ggacaaggac gcctttgctg    199860
     tgcgtttggg tgtcgaaaag ttggcctcca cttcaccaat ctttgtatgc cagtctttcg    199920
     ccaagaacgt cggtatgtat ggtgaaagag tcggttgttt ccacttgatc ctacctaagc    199980
     agaatgccaa tctcgcacca atcaagtctg ctatcacatc tcaaatatct agtattatca    200040
     gaagtgaagt gtccaactcc ccagcttatg gtgccaagat cgtttctaag attttgaaca    200100
     caccagagct tactaagcaa tggcacgaag acatggttac catgtcatct agaatcaagg    200160
     agatgagaat cgcattgaga gaccatctag ttaagttggg aactccaggt acttgggacc    200220
     acatcgtcga gcaatgcggt atgttctctt tcacaggctt gaccccagag atggttaaga    200280
     gactggaggt ccagcacgct gtctacttgg tctccagtgg tagagcctct attgccggcc    200340
     taaactccgg caacgttgag tacaccgcaa aggccatcga cgaagtagtc cgtcactact    200400
     caacttccaa gttgtgaagt tccggaacca ctcctctcta cctcttacaa aagacatttt    200460
     acctacatag ttcataacac acatttgtta atatctcagt aactcctttt cagttcaaat    200520
     ataatatgaa gaacccaaat atatctagtt tattagcctg aataccaaat tatcggtata    200580
     ttccttccta attaggaaat gagttgccta attaggcaac tagctgttct agcacacagt    200640
     cccaaaacgg caattttctg gttttccgtt gtggacatgg gctttgaagg tcaagccgat    200700
     ttctcactgc agactaaagc gatagcaaaa ttagaacttt tggcaaaatg cgaagtgtaa    200760
     tagcattagc agggattgac acgttaaaga ctgggcgtga atacctggcg tatactaggc    200820
     tggagacacc ctgtagagag tccagcaact gtggttagca attataagaa gtggcttttt    200880
     ggtttgctat taccttccct cctggcaagc tcagcatcga agaaatttgt ttgagaatag    200940
     tttaattttg aactccgatc ggaatatata ttattgaata ctcttatttg aagggaatct    201000
     agctatgaat ataaagaacc gtacgtttga gtttcagcag agtgttgcga catataagaa    201060
     gcgagtgaag aagaacgatg ccacttccaa tggtaagcct caagctggtg tttcagagtt    201120
     ccaaaagaaa gcatctgcta tagcgcgtga aatctcttct agtgcgcagc tgctttccaa    201180
     actggcgctc ttggctaagc ggaagccaat gttgaatgac aacccggtgg agattgctga    201240
     gctctcattt ctgataaaac gaaagatata cgccattgag caaagtttaa tagatttgag    201300
     taaacttcag aaggtacaga ggaatggtgg taacagtagt gctggttcta ctacggacgt    201360
     tacaactcaa cactcaaaga atgtagtaaa tttactgaat acaaagatga gaaacatatc    201420
     tggtggtttc aaggatgttc tcgaagaaag acagcgtatg gagatggcta atagggatag    201480
     gtgggagaag ataaactcga catcaaattc cacttcgaga gcaatgtcta acactcagga    201540
     ttcagagaat aaaaacttaa acgataacgc catggttaat gaggttgcca catacaatca    201600
     ttccaatcca ttcatgagct catctctaat tgatgaagaa tctcatgcca atgctaataa    201660
     aggatcagag ctagccctgc cacagagtga ctcccagatg ttgttaatga tggaggaagg    201720
     gcaaatggca aataacgtat atttacaaga gcgtaataga gctgtggaga ccattgagtc    201780
     taccatccaa gaggttggta atttattcca acagttagct tccatggttc aggaacaagg    201840
     tgaagttata caaagaattg atgccaacgt cgatgaagtt gacctaaata taacaggggc    201900
     gcaaagagaa ttgttaaagt attttgatag agttaaaagc aatcgttggc ttgttgccaa    201960
     gatcttcttt atagtgttcg tgtttttcct tgtctgggtg ttggtcaatt gaggataagg    202020
     tatcgggtta ctagaacaaa atgacattat tctgtatatg tataattact tggaattatg    202080
     atagatcctg gcccagctgt aaacttattt gcatggaata ttttgagcag tttatatatg    202140
     tgtaatgttt tattatttca ttcagagact cccaaaagtt ttcacttttt tttatatttt    202200
     ggtgttgctg ttcgcatata atgcagaggc gtagtcatag ttgattcacg tcaaaggtaa    202260
     cataatacca taaaaataga taagccatat atatgaaacc acaattaata tatagaacaa    202320
     aaaatatgaa gtgtatgaga tattacaaat gtgaattaat gataaagatt ggacaatttg    202380
     atctaggaat tgttcaaaag gatcaggtaa aacatgcaga aatacatagt aaaaaaaatg    202440
     acagataaca aaaggaagac gtatatttct attgacaatc atctaggctt ttttgtgtat    202500
     ttttttgttt attgccttaa cttttagtat gctttttttt taatttgaat gctgaagaat    202560
     aggcaaagag attgaaatga gctgaaaact gtccaggtta agaaccacgt tgtcacacga    202620
     ccttcaattt tataagttta ggggttcgcg caaaagatac agtattcaaa tttcatgaaa    202680
     atggatgtat atgaatgttt ccatctttcc ttcataggcc catctcagct tgtagttccc    202740
     gtagtgctct ttcatcctcg tcctcttctt cttcttcgat tttggtcttc gattcgtcta    202800
     tcttagtgtt gggtatattt ggcatggaga gggcctgttt gctctcgggc agtgcctgtt    202860
     cctttgtagc tacctgtggt tctgtttcct gtgctagcat gtccagttct tcgtccagct    202920
     cgtcctcgtc tatctcgttg gcgccggtgt acagtggtct tgatatggcg tcgctgatct    202980
     cttctccgag ctcgacttgc tcgcgtatct cgtccatggt ctcgtcgacc ctgtcgatgt    203040
     ccagtcccga gtgtatcgac ttcatagcct tcgcaccttg tttcatggcc cgcatggtct    203100
     ccaggttcaa gttcgcactc tctatcgaga acagctgctg ctccagcgag tccatctgcg    203160
     actccagctt caccagctgg ccctcgtaca ctttcttctt cttcagcgca ttcttcgcca    203220
     tagtcttgtt gcccctcgtc aggaacttgc gtgcctcgtt ctcctgcgca gtgatctgcc    203280
     cttgcagatg cgcctgcttc ttcgacagca ggttgatgtg ctcccgcagc tcaatgatcg    203340
     ccttcttcgg caactccttg ttcgtgttcc ccttacctcc aaatatagac gcccacatcc    203400
     ttgtgcttgt tgttgttgtg cttgttgtgc ttgttgtgtt gtacttgtag tgttatcccc    203460
     cccttcacat ttatagccct ttttgaagtt tcttccaaag tcagcgaaga gaagagaagt    203520
     gccactttcg cagctaggaa ggtataaggg aaactgtact ggtgtacgta cagcatatga    203580
     tgatacgtgg tggggtatat agaatataca ctattacgtg atgatcatat gactacccgt    203640
     ggtaaagtag aatatatacg tatacacggg atatcatatg atggccacat atacagatac    203700
     tccaagtaat gtataacggc aatcatatga tatacgtgca actgtactgt cccttccccc    203760
     ccccacttca cctccattca tccgaggacc taatacccac ttcactaccc actacccaca    203820
     gtgagagtgc aatgcagtac gttcgtgtga caagatgggg cagtttgccg tcttttctac    203880
     aaagaagggc ggacttctcc gagtctgaac gagtctgaac agagtctgga caggagaagg    203940
     tgtgcagtgc tgcgggggtt tatgtgtgtg ttgtaagctt gttaccttcg gaatggcctt    204000
     ctcacgtctg attggttccc ttctgcgaat tgaataacat cgaatagact ctgcttctca    204060
     ctctagtata aatgaaacaa acctttgctt tacctggaat aagatggata gaggggagaa    204120
     aaggcaggta ataccataca ctaaagagga ataaatacca aagaaaacaa aaacatgctg    204180
     tctctgggat tgatgaacag aagtgctgga tgcactagaa gagcggtcct tcttatccgt    204240
     ggtgcagctc agaggaggct gttgagcagt tctgtgcgca gactaaacac gatgaagtcg    204300
     tctatgaacg ctgaggaaga agcgctactg aacaagcagc gtgctctgag acctatctcc    204360
     ccacacttga ccatatacca gccacagctg acatggtaca tgtcctccgt gcacagaatc    204420
     tcacacctga tcctcggcgg tactttctac gtgctcacta tcctgttcgg gcttgggtac    204480
     ttcgtctccg gcataaacac cgagtccgtc tcgcagtggt accacaagca cgtctcgcca    204540
     atgaccgagc agatcgtcaa ggcagggttc gccttcactt tcgccttcca ctacttctcc    204600
     accatcagac actacatctg ggacttcgca aaggaactga ccttgaaagg tgtctacaga    204660
     acaggctact ccgtgctggc tttgaccgcc atcgcaggta catacatctg gaacatgtaa    204720
     tacacctgca cccccaaaac tatttattta tataccatgt atattcaaca tgaaatctca    204780
     tgaacaattt ttgcaaacga taatgtggtc ctcgtgcata tgctagtaag acgtgcttgt    204840
     aagacgtgct tgcaaactat gcctgtacac aagactatgc tgcgcaacct gttgcttatg    204900
     ctggtggaac attgagatcg ttatgtacgc cataacaaaa aaaaggtagc cccttatgta    204960
     aaaagttgac taagcgatga gcaacgttag tcatacccac aactcccccc ccacacacat    205020
     ataagaagac taaagacaca cgctacaaca gaccttgcat cacactccga cataacagca    205080
     taacctacta gtattgcaga tatgatattc aacagcttca cgatcacgga ctatgtgatc    205140
     gttctgctcg tttacctcga gtccatggtg gctttcttcc tgaagctggt gcctcagccc    205200
     ataatatcgc tgctggagtg gttcatcgac tactcgttca gcgaggacaa cacctcgttc    205260
     gaggagcgtc tccgcaccgc ggttaccatc catgacatgt gccgcttgtt cgggatagag    205320
     gtcgaggacc acctggtgcg taccgaggac gactacatcc tgaccctgca ccgcatcccg    205380
     ccaagagaag gtaccgctaa cggcaagaca gtctacctgc accacggcct gctgatgtgc    205440
     tccgatgtct gggtctgcca cgtcgagaga cacaagaact tgccctttgt gcttcacgac    205500
     ctgggcttcg acgtctggat gggcaacaac agaggtaaca agtactccac agcacatttg    205560
     tacaaacagc ctaagtccaa ggagttctgg gacttctcca tcgacgagtt cgcattcttc    205620
     gacattccaa actccatcca gttcgtcctc gacagatgca agattgacca gctgatatgt    205680
     atcgggttct ctcagggctc cgcccagatg tttgccgcgc taagtatcag cgaggacctg    205740
     aacaagaaag tgtcccattt catcgccatc gccccagcca tgactccaaa gggtctgcac    205800
     aacagaatcg tggacactct cgccaagtcc tctccgactc tgatgtactt gttcttcgga    205860
     cgcaacatca tcttgccctc ggctgtggtc tggcagaaga ctatacaccc taagcttttc    205920
     aacttcttca tcgatttcgg taacagaatc ctgttcaact ggaaagctct gaacatcact    205980
     cagaagcaaa agatggctgc ttactcgaaa ctttactcta caaccagcgt gaagtccatc    206040
     gtgcattggt tccaaatcct tagagcacag aaattccaaa tgtttgaaga acaggacgac    206100
     atgtttaact ccttgactag accatacaag atcccaaggt tcccaacaaa gactaacatc    206160
     aagaccccta tcttgctaat atacggcggt gtcgactcgt tggttgacat caatgtcatg    206220
     aggaataacc tgcccttaac aaatgtcttt gacataaaag tggacctaca tgaacatctt    206280
     gacctgatct ggggcaaaga taccgatacg ctcgtgattg ccaaagtatt gagattcata    206340
     gagttcttca gcggcgagaa actactacag tccactacac tttctcttgg cgagccagaa    206400
     agactcatgc ctgttaagac gccaatcagc caacacacta gcagaagaaa cagcaacagt    206460
     agcgttggca cagaaaatgc gactccttca acgtttaacg ttcgtaagac tacgacgccc    206520
     tctaactaca ggtacgaaca aacggaaagc ccaaccgccc aatacggttt agagaagttg    206580
     aactctctgt actccaacgt tggaaggggg ctagaagata ttgacgagaa ggaggccttc    206640
     ctggactaca ataccggcga caagatggac gaaatccaaa agacgaactc aatcaaccaa    206700
     cgcagactga gcgagtacct ggactcatcc acagacttga aacaaatgga cagcaatgct    206760
     accaccaccg tcaacactcc caactaatca aaagacagtt ctgtccgttt ctttttctaa    206820
     gtacgtttac gtttattagt tattatctga actttttaat tctatttcca agcacagtca    206880
     gtaaatgatc ttccacctcc cctttatata tattacataa caatatacca aataaaaaaa    206940
     ccaatactaa tgcaaggata taatcctgac attgcctata ttcacaacaa tcgataatat    207000
     actacctgct gatagctata cttttttttt caagatgctc atcgattttt ttctcacagc    207060
     gaggaaaaaa tgttagaatg ctaacacata aagaggattc acaacaaata ctactttcac    207120
     cagctgtcat agccggaatc aacgtacttg acacatctca taggacaaca gtattaggtg    207180
     aacattggta gacgcgattc atattaattt cccccacaac ttatcctggc agttttgaat    207240
     tacggacatt gtcataattt tagtgacagc gaagttgaac ttcagtttgg aaagatttat    207300
     ttagacttat tgcgaaagag ctttggatta tcgaagtagt gcatatttgg tcaatattat    207360
     cttggagcaa ttttcatttt gcgaaccctc acatactcaa gagctctcag gtaccaagat    207420
     gtcatttgct gggtactctg gtaattccaa ttcgaactcc catttcaaga ggcggaacac    207480
     cacgcagacc gatagagatg gtgccaatac acataataag aggtcaaggc cgaataatta    207540
     tagtaaaaat gctgattttg cgaagagtaa cgatatgaat gataggaaca atagcaaacc    207600
     agagtttaca ggctcgaggt accaaggtgg gaaagccagc aggtttccga agaaggatta    207660
     tgaagagagt tcgaacaaga acaggaatag aaatcaaaat acgaagaggt tccaaagcac    207720
     aaaaccaaac agaaagctga atgttaatga gagtcgattt agagaagact acaacaataa    207780
     acatggcaga atctctacac gttacaacaa tttcacaaca ggcaatacaa gcgatatacg    207840
     gactaatggt aacaacacgc ctttacgaca ggatgacaga aatactataa ccaggccatc    207900
     taacaatgcc aataataacc aggattcagg caggaaaata tttgaacttc ccaagggacc    207960
     aaaatcaaca atatctagat ataacactgg agaaccatac aaaggtacaa aacctcaatc    208020
     tataccaact cctactctac ctactacttt cctatcgaga cccatgaacg actccgtgta    208080
     tgaacgatta ttacaagttg gtgaaggtac atatggtaag gtctacaaag ctagaaatac    208140
     agttacgaaa gaacttgttg cactcaagaa gttaagacta caaggggaaa gggaaggatt    208200
     tccaatcact tcaattagag aaatcaagtt attacaaagt tttaaccacg agaacgtgtc    208260
     aacaataaag gaaattatgg tggaaagcca gaagatcata tacatgatct ttgagtatgc    208320
     cgacaatgat cttggggggt tgttactaaa taaacagatc aatattaatg cggcacaatc    208380
     gaaacacata ttcaaacaaa ttcttcacgg tatcgaatac ctacacgata acaacatact    208440
     acatcgtgac ataaagggct ctaatattct tatagacaat caaggctcac ttaagctcac    208500
     ggatttcggt ttagctagaa aaatagattg taacagagat gccatccgag attatacaaa    208560
     tagggtcata acgatatggt ataggccgcc cgagttgttg ctaggtacaa caaattatgg    208620
     acctgaggta gatatgtggg gttgtgggtg tatacttgtc gagttgttca acaagatggc    208680
     aatctttcaa ggtacaaacg agctggagca acttgaggct attttcaaag tcatgggctc    208740
     tccaagtata gaacaatggc cgaatatttt tgatatgccc tggttcttca tgattatgcc    208800
     tcaacaagct accaaatatc caaacgtttt tgaggaaaag tttagggcag tgctagagac    208860
     agacaattgc ttcaagttgg cacagggtct actacgttat gatcaagaaa agaggctaac    208920
     agccagcgaa gcgctacaaa gcgaatattt caaagaagat cctcaaccgc agcctctaat    208980
     attgaatgac gctataagtt gccacgagtt tgaagtaaag ctggccagaa aacaacaaaa    209040
     aaagaaagaa cagagcaagt ctaccacctc ttctgcttaa atgtgtcttc tgcatttttt    209100
     caacctgaat agtatatgtt tgcgttgcat cttttgcata cctatatatt tcattttaca    209160
     actagcacca ataccgcaaa ctataccgtt tctccgcagg catagcacag attcatggat    209220
     tttcccatta ggtcgaaaca tattttatta attgcatcac agttaattat gtgtcatata    209280
     taaataacga atatagaact agttttatat taataataca gcacgtcctt cccccatcat    209340
     cggtccattt tggccacaaa tagtatcaaa aagcatggga gaaacgccaa acaagaattg    209400
     aaattgtaga aacgtcacca cccccagttt catttttcac ctccaccaag catttggtcc    209460
     tcaaaacacc gactactacc gataagccaa ctgctgttca ccttccccaa ttgcccgacc    209520
     aggttctcat tgcattgttt agacatggta tcgagatgtc tcgttgtctc cttcaagttc    209580
     tggttcagct cttccaattg ctgagctaaa tgcgcatact gtctctgttt agtattgttc    209640
     ataccgaatt cttacttaac ttcacgggtt tgtagcactg tttagcatcc cagttgatat    209700
     gcttcttgat ctatcaaaga caaagatcat cgcaaaaagt ctttaaaaag tgcaaaaatt    209760
     gaaaacattg ctttaaattg tagtagtgct ggcaaaatag gtctaataca atggaattat    209820
     aatgtgttat atatatacat gaatgcattt gatttgtaat tagcttagat acagatattt    209880
     gaattattag cttttgtagc ggttctcgag ctcggttttt gacctgaatt tggacaatga    209940
     ggtcgcaccc taaggtttta ctaaaagaat tgagggttgc gcctagctga aatcttagtc    210000
     cactttggca ccttgtgtat acctttcctg tagcctctgc tcttcttgtc aaacactgtg    210060
     tatttgtcct ttgctgacat ctggtactcc ttagggaaga acgacgcttt gttcagcaga    210120
     cgcataatgg cacttctggg cttgtacttg cgttcttcca gtgcttgttc aaactgcaac    210180
     cctttctcct gacagcgctg tacgtgcaat ccaagtgtta ggttcttcac tacatcatca    210240
     acagccttta gcctctgtct ttgacggaac ttctggggac cggacatcct ccatggaact    210300
     ttccacaaca acccgccttg caggaactga gtacctctga atggaccaaa catcttaatt    210360
     acggttgctt ggagggttct tgtaatgcct agactactat ccaacagtaa cttctttaat    210420
     aaattctcca ggaaatcctc cttccaagtg tctcaagagt gactaagaac gaggaaccgg    210480
     cagaggacaa agcactggag gagacaatta aaagtgcttg agtacagctt atattgaaac    210540
     caactcagct tgaaacgttg ctatttgaat caattagaat agtactgaga gaatagttgc    210600
     aacaatgtct gagcaagcag ctagcgaaag cgggcgtaga gtgcccttgt gggttttgaa    210660
     tgctagggag gagaaggagg ccaggacgaa cttgaagaac atggcttaca agaactgtga    210720
     tgagtatgtg aaggctatgg ctgattgtgc aaagcagaat ggtctcaaat gttttccggc    210780
     ttgtgatcaa cagagagcag acatgaggca gtgcctgctg ttctaccaga cagatcatta    210840
     cttggatgtt gagagggaca agattgttca gaagagaatc gccaggctgg aagagatggt    210900
     aaataagcag aaatcgtgat atgctggcta tcgacactaa catatattca ggttcctctc    210960
     tttttaaaag gtacaacgtt tgttatgaaa tgcaatacaa taactttcac tgtaaataaa    211020
     tttaatgacc attaccccca tacaatagac ttttcttctc cagtacattc caataaatat    211080
     ttaaatcaaa taccagattt cagaacgtat tatgcaatat ttttcactat actaatctat    211140
     gtatatcgat gttatataaa ctatgaataa aatcttaaaa atgataattt ctcataggaa    211200
     ttaagaaagt gtcaaatcct tttctggcgc caaattgata cagttccatt aaaacagatc    211260
     aagtaaatct tgcgtcgtcg tgctcttttt ctcattaatg tttagattct caactttctg    211320
     tgaaacgcta cccacagtag catttgtaga actaaaacca aacaagtcat cgagctcaga    211380
     aagtgccgac ggttgcggtg tactgttgtt attgttactt gtagacatca tatcatcatc    211440
     ttcgtcaccg aaatccaaca aaacatcatc gttagcttta ttttctaatt cattcttagc    211500
     tatgtcttgc aactcttcta gctgtttgtt gttaacaata ttttgcacgt acttcactct    211560
     tttgttgccc gagtctagtt tgaaatttat ggagctgata ttgcccagct gtcttagcaa    211620
     cttttctaat agctcaggag agaattggtc tatagtagaa tttatctgag gtacttgact    211680
     ggagcacaaa gaatttatta gttcatcaac atttggtaga gaaagggttc tccagtacac    211740
     catggccata tctctaacat ccaattcctt tgtttcttta gtagatgtat ctaaaacaga    211800
     ttgaagtaag tcactcggca acatattatg taatctgacc gttgtaatta atattgacat    211860
     ttgtgtggac gtgttctcat tgacaaaatt atctacaaaa cccttcattt tactttccag    211920
     tgatgagaac agcctaggat actgacccat gatccaaata tatttacatt tagctgcatc    211980
     tgttgtcagt tctatttcag gagactccca actattaagc actgagcaaa gttgctttgc    212040
     gagctcggca ttgttattcg tgtgtcttaa cagatcaatt gctgcagaac agcaatcatc    212100
     cttggacttt tcccgtactt ctagtagttc cactagaata tccattactt tctgaataaa    212160
     cggcaaatct gaatacttga ttgctaattg agacaaagct aggataactc tgctaacgaa    212220
     ttctggttca aaatccatag catactcctt cagttcggcc aatagtagat tacattgttt    212280
     caagttagat ggatcaacca gtctaactag aatatcaatc ttctcaactt taacatataa    212340
     tgggtcattg aacttaatat agaatattct caattccttg gtcaatagtt ctgggtattt    212400
     ttccaataca atcctaatat tcttcaatgc tacatattgc atctctggag gagtagacat    212460
     tagagaaaca agtgcagagg agagtttctt cattattgat gccctcttgc tactgttatc    212520
     ggcaatgatt agtggcaggt tctgaatgat aactttaatt gtggccagca caacagctgg    212580
     atttacgtgt tgtaaatgtg cagtaactct atcaataata tcctgtgctt caacaccatc    212640
     tcttgcgctg tactctgcca atgctgtcag tattgtgatt ctggcccact cagtacattc    212700
     atttagtgct aacaaaaact gagagacatg gctttgaatt agttgaggta atttcacggc    212760
     cgttgggtcc atattgttta tttccactag tgcggcggtg gcattggcca ccaccattgg    212820
     gttggaatca tctagggcac tctgaagatc ttctaacacg cccagttcga cacatagttg    212880
     tttgttcaat tggaacagct tggcaacaca gatgactgca gtctttctaa cgtacgggtt    212940
     atcatcctgc aacgtcttcc tcagtggtgt ctcgatatac tctaggattt tttccactct    213000
     aatcagggac atggtcctga tcgccataca acggatcaat gggttagggt cttgggcatc    213060
     ctggataaac gtattgacag ccaggataca aagctctggg tgcgtctctg cgtagttcat    213120
     cacgtataag tacaccagct tcttttgttc cacatcattg gtagcaatgt tctttagcac    213180
     atccgggaac aacgaggaga catccttacc cagagtcatc tgctgtatgg tcttcttgat    213240
     agcatccttt ctggtctgcg agtatggtga caccagtccg gccctcaatt cagccagttc    213300
     acctttgctg gatattttag gtgcaactcg taccgagtcc ttcaggaact ttttaatcct    213360
     cttgtccaat ggtggcatga tatgtgcaag cgactatttc caacgtgatt attgtgtgga    213420
     gttcaattgc cttgtgtatt attccaagtg aacaaagccc tttttgattt ctatttaaaa    213480
     tggtattgct ggcaatttga gggctatgaa ttgttctaaa aacctgagat tacgatcaca    213540
     caagaaaccg tggtagaaga taccaccaac aatgcaataa tagcaaaaac tagactcgat    213600
     gtggatgtga acaagactac ataaacttta ccttacgctt aatctactaa agacaccatc    213660
     ctgcattcca gctaactcga acctatcaga agaataaaag acaacgccac ggaattgcaa    213720
     ctagcatcta cagatacaga acaattaatt cccaagtagt ttggaacaac aatggctata    213780
     acctctatag caacttaata tttgaatggc acttatgcca atagtgttca aagagtgcct    213840
     ggcagctata cacagagagc ccaacagcga aagaaaccga cagcactgcg aacgtcaact    213900
     aggcacatga tgacataccg tatagtgaga taactcgtga cttttgtatt gagttccaga    213960
     atatacgcag agaaatggcc atctccaagc gtatagcatg gaacgtttgg tgaagatgct    214020
     ctcaaagccc aattttcatg aaaaattttc aagtttgacc caaattctgt tttgcaaagc    214080
     tttgaagcat tgcggaatga aaaaaaaaaa ttcgatgagg tggttgagtt gtctgtgcag    214140
     atgttttact gggttaattc agttttcttg catttgccaa ttggaaatta tttttttctt    214200
     tggtgtaaaa attttttctc tctacttttt gcaacttttt tttaatatat aagagcttag    214260
     aataattctt tttttatttc tttgtatttc tcttactagt tcatatttct tctttatata    214320
     tttgaaagtc agacatccag gtataatata atagaaatgg catctaacga agttctagtt    214380
     ttgagaggta ccctagaagg tcacaacggt tgggttacat ccttggccac ttctgctggt    214440
     caaccaaact tgttgttgtc cgcttcccgt gacaagactt tgatctcttg gaagttgact    214500
     ggtgacgacc aaaagttcgg tgtcccagtt aagtccttca agggtcactc ccacattgtc    214560
     caagactgta ccttgaccga aaacggtgct tacgctcttt ccggttcttg ggataagact    214620
     ttgagactat gggatgttgc caccggtgaa actttccaaa ctttcgtcgg ccacaagggt    214680
     gatgtcatgt ccgttgccat cgacaagaag gcttccatga tcatctctgg ttcccgtgac    214740
     aagtccatca aggtctggtc tatcaagggt gactgtttgg ccactttgat cggtcacaac    214800
     gactgggtct cccaagttag aatcgccaac tcctctgacg acgatgacaa ggttaccgtt    214860
     atctctgccg gtaacgacaa gatggttaag gtatgttaaa ttttattttc ttcactaaac    214920
     taaccgatat tgaatttttt cctttgatta cactacggct cctattattg gaaatttgtg    214980
     cgacatttgg gttatcaaac tgattaccga tcatctaact gacacataca tgggtatcaa    215040
     atgctgaaac aattaacact attcaaatga tgtattacaa atatttgcta cttcggacgt    215100
     tgccttccac ggcttcgaat gagacatact aattatcacc aagatctctg atgaattaat    215160
     aaaaaattgt ttctagcctt tgaaatcctg atatgccagg gaaatgaata ctatggtatt    215220
     tcgatacact ttgacaacat tatggaacac aatccaaagt aatggtgaat gtaattaggc    215280
     aatatcggat ggtacatgat aaatttatga accattttta ctaacaattt atgatacaaa    215340
     ttctctttgt ttaacaacta catttcaagt agagtcatat gacttttttt gaaaacgtat    215400
     gttatttgca atattgaata tgtaacaatt gcaacagtcc tggaacttga accaattcaa    215460
     gattgaagct gacttcgtcg gtcacaactc taacgtcaac actgtcactg cttccccaga    215520
     tggttctttg attgcctctg ccggtaagga cggtgaaatt atgttgtgga actctgctgc    215580
     caaggtccca atgtacacct tgtctgctgg tgacgaagtt tacgctttgt ccttctctcc    215640
     aaacagatac tggttgtgtg ctgccactgc ctctggtatc aagatcttct ccttggaccc    215700
     acaatgtcta ttggatgact tgaagccaga attcgctggt tacactcaat ccgctgaacc    215760
     acatgctgtt tccttggctt ggtcttctga cggtcaaact ttgttcgctg gttacactga    215820
     caacgtcatc agagtttggc aagtcatgac ctctaactaa gtttgaatag aagataagag    215880
     ttatttaatc tcatcttttt atttagatat ttagttactg gtcaatcacc ataagaattt    215940
     ttacttctta aacatgttta gcatctataa aatgggccca ttaatggctc cttttgatag    216000
     attagttttt cggactacat aatgtataat aatgaaataa tattaatcgg atacgtacaa    216060
     acttttttgt gattattgtt tcacgaatta atcattgata aactatattt gtattatcaa    216120
     aatcttttag aatatatatg ggtagtaatc aatatataca gtcggaaatt caaaaagagg    216180
     tcatactggg agaagatagc tttctataaa tcttcagagt caccaatata tgtcatagcc    216240
     tcagcgccac ctttggctaa atcaggcttt tcaagtacat ctgcaataca actccaaggg    216300
     tttttcagtc caccccattt taataccctt tctttgaatt tctcacctcc agttctgttg    216360
     aatggatcgt ctttaaaaag actgtcccaa acttttgagg ctatggctct atcaaataaa    216420
     taactatagt aagtcgcacc atatccaaac aagtgaccaa agcgaccaca ccagttgctc    216480
     tcatcatcag caagaacttg tagtctcgtt tctagtttct gataaatctt tgcactatca    216540
     atgcgttcaa tatctgaaag agaaaaagaa ccgtgcaatt tttgatcaag catagccatc    216600
     ttggcttgtg aatatgtttc acagtgttgc aaaaattgag ttttatcaag atagtcgttc    216660
     aataatgcct ccggagcagg ttctgatgtt tcgtaatgac ttccaatggt tcttagaact    216720
     ctgatatcac gagcaaagtg ctccatcaat atgctaggca attcaacaaa atctgtagcg    216780
     caacgtgtcc cactaatatt ttgcaacctt gttctaccaa gcattgaatg catagcatgc    216840
     cccatttcat gaaatagtgt ctcaatttca ttcatatgta gaaaacatgt tctattacca    216900
     tttggcaaag cgactgtact aaagttgcat actaatgaaa tcacaggtag ctgaaataca    216960
     gtaccatcgg aattttgccc tgtctgtatg gtcgtaaagt cattttcatc cgggtacact    217020
     tgtcttgaac agcataccgt gaaatgagca ggatttgata tctttccaac gcgttcaaac    217080
     agatcacaat aaataacacc aaccaatccc tcttcctcgc ttatgacatc gagtctacga    217140
     acatctggtg accatgtttc cccgttttca gttcttgatg gttgtaaggt gataccatat    217200
     atcctcttaa acaattcaga gagaccgttg attacattcc ctaatgagaa ataatagcgc    217260
     agttgttcat cacgtatcat agccatctca ttatcggaat catacttgga tgaaaaataa    217320
     tttttgtccc atggtttaac aattgacaag atttcattat ctgacatatg ccttgaatca    217380
     ggtgcattca acttatctct tgcaataaac tccagctctc ttgcagccaa aggcttagtg    217440
     acattcatta aagttttgat aaaacccttt acattttctg gtgaaccagc cattttattg    217500
     tccaactggt aatccgaata gctctgcttc cccaataaat tcgataatat tactcttaat    217560
     ctcactaatt ggttcaaacg ttgaatttga gctttagggc aattatgtaa ggctgcccaa    217620
     acttcttttc tgatgtcttc atcaggacaa gattttaaaa tctgtaatgg tatttgacca    217680
     tatgttggga tcttatagta ttttcccgtt aaatctctat tcaatcttgc agtcagtaga    217740
     ggactaatac cactcttgtc catttcatct cttttaactt taataaactc tttagccaca    217800
     taatcggtgt tatttataaa ctcttgccca ataacactga tctgttgaga aagctcgata    217860
     aattgctctc taataccagc tttcatatat ataccagact tttcgaaatc atctagaaga    217920
     atttcaccaa ctttcctttc ttcctcagat aaaactttca atatctcggg gtcttcaagg    217980
     acttccttca atttattaca aaggacaaca tctgtattca gaacattcat aaattcaaac    218040
     atctcctcgt gacacatctg agctgcttcc acatagcttt gatcaggatg ggcagatctt    218100
     aagaactcac acaaatcaat aacacggcac aatgtatcac ttaattgatc caaattcata    218160
     atataatgta ctttctcttc cttactgacg ctatttctta gaatctcagc aagtttgtgg    218220
     gctttatgca aagaatcgtg actgaactgt ctcaaaccat cagtagaagt cagatacgga    218280
     ttcttgaata aacctgtttc ttttgtatat tgagtagtat tttcgcttag ggattgccaa    218340
     tattttgagt catcgaatat tcgttggagc tctgtagtat ttctcccaga tgaaccggac    218400
     agccatctca gccctgtata gtttaatata ctgaggattc tcggtagtct cgagatttct    218460
     ttgtttaaca gtatcttttg gattaacatc tctcgttaac tctgtgctga aatcggtatt    218520
     tgtaagtcaa atggtgtacc taacgttaca gcttgatgaa acaagcaaaa taaaacgaaa    218580
     atattcaaag tatgttaaaa tcagctgaaa atcgactatc tgtgttcttt actatcctac    218640
     taaaagacca tgtttcattg attttagctt ataaattgta tatgcataca tttttttcac    218700
     tttcgaaact ttcaatcggc tcttagaaaa gggccggatc aggcagtctc ttttagtaat    218760
     agaacatgtg taattataag gcaagaccag gcgttgtgcg attattatat attttactga    218820
     catttggttt gtatagatat caggtataat aaattaattt tcttgagctt gctaaataga    218880
     atgtgtataa tacatacaat aattataatt ggttgaaaat aacgaatgtg atcaaataaa    218940
     gtaatggcat gagcaagatg gccattctat aaaatataca tatccctaac cgattgaata    219000
     ttagtaatag tgacaataat gataataatg aaaatttgat actgaagtaa atggaatctc    219060
     tctttcatcc aactttctct tgctttatca tctttctgac ttttctcagt tccttttctg    219120
     cctcctttaa caatgaatca aatgaagtct cttttgcaaa cttagctgat tctttcagaa    219180
     gtttcctagc tttctttaaa tttccttcat gtatattcca taccccaata ccgtatacgg    219240
     ccaatgctgc tgccttcatc gatagtggat ctaacatttc ttcaaaatta tcagtaattt    219300
     cagcactgtt cagaacacct tggaagcatt gtaaagaaag cttcacgtat ctgtcatgat    219360
     tgctatgaag taaattcaaa taataatttt cttcattatc cttcgatgta tcagtagcta    219420
     cttcattctc taatgaactt ttctctttct ctagtttata cagtacacct tcaatcttct    219480
     cagcttgcaa atacaggata gaacctaaat tggcctgcga aaacaagatc tgggattttt    219540
     tgacatttgc caacgacatt aactgcactg tcatcaattg atttctcagc gctgcaggta    219600
     catcgttgga ttgtagacaa tactgtgtga ataaatcaag agcagtaaac aattcatctt    219660
     tgaacaaccc cacaacatca tctaacatct ctccgctaag cttcttaccg atggcagttt    219720
     gtgaaccgtc agccaagtct ataaattcaa agggtctatg ttcagatgtg ggtttcacaa    219780
     ccgtgtccag cacagcctgt tgttcttgta gaaattcgct tatctcagga tatcgagtat    219840
     atatgacatt ttgcaagaca cgtaagtgat gaagcaacat cgtcttacct aagtacttgt    219900
     catccctatg ttgtaagtat tttatcagga cgctgaggtc cctcttaata tatcgcccta    219960
     ctttgtcaag gtcggaaaca ctagttgtga gcaggtagtc taggtacttc tgcattatgt    220020
     gatcgtatat ctcacaagca ttctccaaat catccaaccg ttcgtgcatt tcggcgatct    220080
     tgatctctat cccagtatat tcgtcagaca aggggtctac gcccagcttg tcacactcct    220140
     tcagagcatc gcgatagtat tgcaaaccac ggtggtagtt cttaccaaac ttttcagtct    220200
     cttgccacag accttttctc agtatcgtgg ccacgctgct cgggaaagtg tgatgaggcc    220260
     agtaaaacca ccacaacccg acgccaatca cagcagcacc caccactcgc atagctagcc    220320
     gactgtacct cccgctctta tcactctgtg gtgcctcatc gatgccattc tcaaccgagt    220380
     acgcacggtt agcactcgca ctgatctgcc tccagcgact cgattgcccg aaactacgca    220440
     caccgaaacg gctcacaaga attactctcc gtagcatccc tgatagatcg tttgctttgg    220500
     agttttgata tatagaccaa aacgttacta atagcacata cacccttata tataaagcta    220560
     acaaattgac actttttgat gtaacattcc cccacttctt tccccttcgt cacacccaag    220620
     aggaatgaac tccaaaaaaa aaagattaat tagaaccaag aagtggagca aagagtcata    220680
     cacatatgta tccttggaac atgttggaga atagcctttt ttttttgaga ccgcacaaca    220740
     atcgaaccaa ttggtaaccc ttcctccaac ctgcccctgc ccattgtatt gttatacaac    220800
     agattcccaa tactgggcct gtaagataca tcctatctca tcgcatcgca catcaactac    220860
     aagataagga ggttacagcc aagaccaaga aaaagcaata aaaaggaaaa ggtgggaata    220920
     atgcattgtg cggctacttc tgtaggattt acgccaatta cttcaatttc tgtaactcac    220980
     ttccaattaa ttattttttt ggaaggattc tcaaaatgac gtcataatca aaataataag    221040
     acacaataac tatcactcta aactgtgtgt gtgtgggtag ttgcacacgt aaccgtcatg    221100
     tgactcttct ataatttcct tgaatttctc aaatttcact tctcaatctc atcgctccct    221160
     cttccagtaa ctactgaatg gaaggcagta tagcatcgag gtgtgtgtgt gtgtatgtgt    221220
     atgtatccgt ttgtgcgtta tcttacagat ggtggctatt acaagccatg gccttatagg    221280
     ttgtattgaa tatacgttta tataccaagt agaaactgta ctaagttaga cactaaaagc    221340
     acaataagat ggtttccaca cctgaactga agaagtacgt tgataaaaag atcctcttac    221400
     aactgaatgg gtcccgccag gttgctggtg ttctgcgagg atacgatctg tttttgaacg    221460
     ttgtgctgga tgacgctata gagttgctga aagacggtga gaaacaaaaa ctgggctccc    221520
     agacagtggt acgaggtagc tcgattctat cattggaagc actagatact attgtatgac    221580
     aaaagcaaag aactttatat gtatgtaaaa ataaaataat gacctactca tcttttatct    221640
     ctttatttat gcgaatcaat aaatataatt aaatacatca gactattagc tctataatct    221700
     gcattgcatc tctacacctg ctctcttata accacacttc tcatagaaag ccacattctt    221760
     ctcgtcacag tcgaggataa ctttgtaaca gccagcgtca aagccaatct cagtcaatct    221820
     cttgatcaga tgcttaccca ggcgtttccc ttggtggtgc ttcgagacag cgatgtcttc    221880
     tatatgccca cacataccgg tgccatgtat gatctttctc tcaattatta tattaccaca    221940
     cgcagcaacc gatttggtct cagtgtcgta gattaccgtg gggttataca tcctgtactg    222000
     ttttttgcct tcgtcctcgg gaaacaacaa actgctgtcc cagtactgga gcaacttgtc    222060
     aaactgctcc ttagatactt cacccactgc agtaagcact tgcaacgcgc caactacacc    222120
     ttcgtagtcc tcagaagtca tacgcctgat aacataacgt ggatccaacg ccatcttcac    222180
     accattcaac ttgcttggtg gacctcatct gttgcactag tattgtccaa tggtctctgg    222240
     ctactcactt taaagctcta attggccatt gttacaccca aaccggcctg ccccctgcag    222300
     cattctctac gcagaaatta tgggtcattc attgccaaaa aaaaatttaa attaaacgtc    222360
     gaaatgctca atcatagcaa cggtcgggct catcgacaac taaactagtt gaataaccat    222420
     tgatatagtg tattaacagg ctctatctaa gactcaacat ttatcagaat ttaaccagtc    222480
     cagtgtcaga ataagtatag tggctaaact ggtgcaagat caaatcaaaa aaagctttta    222540
     taattttgtt ttgaataata gcattactat aatctacttg gtccgaggga agaacaatgt    222600
     cgaccaagga gtttaaggag gagatccata cttctacctc tgagtttacc aaatatgact    222660
     ctcaaaagcc gtattatagt tccggcgagt ctccggaacc agtcgttacc aagagaaata    222720
     tattccaaag atgtgtcgat tctttcaagc caccagtgga tggttccttc gatactagta    222780
     acttaaagag aacactgaag tctaggcacc tgattatgat cgccatcggt ggtagtatag    222840
     gtactggttt gttcattggt agtggtcaag cgttggccac aggtggccca ctagcagtta    222900
     tcatcggttg gactattgcg ggatctcaga ttgtcggtac catacatggt cttggtgaaa    222960
     taactgtgcg attccctgtt gttggtgcat ttgcagacta cagtaccaga ttccttgatc    223020
     caagtatcag ttttgtggtt tctacgattt atgtgataca atggttcttt gtcttaccct    223080
     tggaaattat tgcctcagct attaccatac aatattggaa ctcttctatt gatcccgtgg    223140
     tctgggtcgc aattttttat ggtgtcattg ttagtatcaa tcttttcggt gccagagggt    223200
     ttggtgaagc cgaatttgtc ttctctacca ttaaggctat cacaatctgt ggattcatta    223260
     ttctatgtat tgtgctaatt tgtggtggtg gtccagacca tgaattcatt ggtgccaagt    223320
     actggcatga tccaggtgct ttggcacatg gattccctgg tgtcttgtct gtgcttgttg    223380
     ttgcatctta ctccctaggt ggtacggaga tgacttgcct agcttcgggt gagactgatc    223440
     caaaggaatt gccaagtgcc atcaaacaag tgttctggcg tatattattt ttctttctag    223500
     cttcattaac cctagtcgga tttttagtcc catacacaaa tgaaaatctt ttaggtggtt    223560
     cttccgttga taactctcca tttgttatcg ctatcaagct acatcacatc aaagctctac    223620
     catcgatagt taatgctgtt attttgatca gcatcctaag tgtcggtaat tcatgtattt    223680
     ttgcttctag tagaactctt tgttccatgg cacaccaagg attgattcct agattttttg    223740
     gttacattga cagagccggg agacctctag ctggtattgt taccaactct ctattcggtc    223800
     tactggcatt tttggtcaag tcaagctctg tcagtgaggt gtttgactgg ttaatggcaa    223860
     ttgccggtct agcgacttgt attgtctggc taagtatcaa tctatcacac atcaggttca    223920
     gactggcaat gaaagcacaa aataaaactc ttgatgaact tgagtttgtc agcgccgttg    223980
     gtatttgggg ttcagcttac tccgcactta tcaatgtcct gattttaatc gcacaatttt    224040
     acatttcctt gtggccaatt ggagggtgga ctgatagtag tcaaagagca aagaaatttt    224100
     ttcaaagtta tttatgtgct ttgattatgc ttctaatctt ctgtattcac aaagtatatt    224160
     atagagtaag ctttggtaaa tggtgggacg taaaaccatt aaaagatatc gatttagaaa    224220
     ctggtcgtaa gaatgttgat atcgacgtta taaaagctga gatcgccgaa agaaagatgt    224280
     acttgaagaa gaaaccatgg attgttagat ggtaccattt ctggtgctga gttattgtac    224340
     aatcacctgt tttttccttt aaacaaagct acttattttg cattacctct ttagtactaa    224400
     tattaattaa aagtgaattc tttacacatt tggcataaat gaacgaatta atgattccga    224460
     gtatgatagt aatgaaatct aaaatgttct aattttagaa caatgaacac taatatatca    224520
     cgtcgtaata gttgcattga ctaatatcta aaaaacatat caagcatttg acataaatta    224580
     acactcattt tcaatcagaa ctcataacgc aaattttttt tatatttgac ctgtttctat    224640
     ttttatatgc tagctagttt aaatatttta ataaaattat acgctttatt tcatatttaa    224700
     gtatttttat attactatag aggtctctca cagattatgt atattcctgc attgcaaatg    224760
     actttgaaat ccaagttgct actctaaact aaagtgtcgc taaaaagcat caaatcaaga    224820
     ggccgatcaa agaaaataaa actgaaaaaa cgcagtagtt gatgactagc aatcacataa    224880
     gcaaaaggat gcttgataag ctgcataaag atggttaatg tgtatggaac aaataattag    224940
     atggaaggca tatcaataga gacttcactt ctggatatta aggatggcat tgacaaaata    225000
     attgcatctg gtgaaccttg cgatgttaat gaggtgatag ataaaattga tctctttcaa    225060
     caggatcctg aagtgctcga tagagagtta aatggactga ttaagaagct cacaactggg    225120
     ttctttcaat tggaaagtga tgataagaaa attcatattg caagcgtatt ctatactttg    225180
     tcaaaggtat gcaatgtgaa gaaaacgtac attcatcttg atgctaacgt ttatttgctt    225240
     gagcatattg agaatgcggt gcgtacatat gatagtatgg aattgtccac cccggtaagc    225300
     tccaaaatac ttaaatggca ttatctctat cttgcctttt gttggctctg tgtaattgtt    225360
     aaggcgccat tgaaattgtc caatgattct catcttctac aatttattga tgacagtatt    225420
     acaaaacatg aaaaggtaac ggtattgcaa cctttatttg cagagattaa agcagaactg    225480
     ttggtcaaga atcggatact tctacataaa ttttgtgaac tactgcatga gacgacaaat    225540
     gatgaaaatg ttattgatta ctttgagatg cttttaattt ataggatctt aaaagccatt    225600
     gtgaaaagtc ctaagcaatt tagtatctat cgtgatgatg taggactcat agaactgctt    225660
     tcttggatat gtttgtatca atctgatcgc ttattatcat tggagagggg agcaatcttg    225720
     atgacaaaaa tattccccaa actattacca ttctttatat accatcacaa tatcgaaatg    225780
     attgaagata taataagttg gtatctcaat aacatgaact caaaattttc cgaatttagg    225840
     tttgcaattg ccaattccta caaaaaagtg gtagaacagc taacaaatac atatgaagat    225900
     aaggatatac ttcctccact tatattagaa agattaacag atacttctaa tatactgaac    225960
     aacagttcct gggatacagt agactctgat agactccata ctttgctttt gatctcggcg    226020
     ttcagtattg atatgattta taaaagactc cctaaccaaa tagaggaaat aattgttaaa    226080
     ttaattcctc ttgcctctag atttcaacaa cgtagcatat ctgttattag aggtaaccaa    226140
     gtaagagatg cggctaattt tatatgttgg tcattggcaa gatgttcatt agagaataaa    226200
     agtacaattg agaacatcat tttctttcta ctaacaagat ctattatgga tagtgattat    226260
     ttgattagaa aatctgccaa tgctgcctta caagaggtct tgggtaggca tggttacaaa    226320
     attttcgata ataacacgat cttggagttc atacaacttc caagttttaa ccttgagaaa    226380
     catttattta gtaatttaga aagcatattt gagattacca atctaaacta tccttccttt    226440
     ttgtccaggc ttttattttg gctagttgat tttggtattt tggacaatgt cgactgcgaa    226500
     acaacattgt tatgtattta tggactgagc catctcgcat ataaatctgc agaaaaaata    226560
     ttaaaagact ttggtattac cacaaaactc aaacaattac tcagcattgc ctctacttta    226620
     agcacggaaa aacagaccag actgataaat ctatgtctcc atttaccttc agccattaat    226680
     ttgattgaag tactaccgat tttaggtagt atatcagaaa aagtattatc ttcacaacat    226740
     aagtcgttat cgcaggagga tatttttctt caccttacaa tcctaaaatt ttggtctgtt    226800
     gcgattaatg agagcaaacc agtcttgctt acacaccaag atatccagtt attttttagc    226860
     atcgttagag gcgcgcaagc tacaatttcg aatttctcta agttccaaga gtattccaac    226920
     attattgtta gtcaaatttc aaatctggga tcaagcatat tctgtactga tgatatatca    226980
     cgattatttt ggacagaata taagaaattt attcgttttg ataatatttt agcttgtggg    227040
     tctttaccat atgtacatgg agagatgttt attaacattt tatctgaagt tttacctttg    227100
     ttgttctctc aagcaaaagc ttgtatcata aaatctatag atgataatac tcagctgctc    227160
     aaacccttca tacaaaccaa ggacttcatg tacatcatgt cagatttttt agatgactat    227220
     actgtcaccg atcaaggtga cattggtcgt catgttagaa tgcaagctgt tcaattctat    227280
     atgaacaata ttacaatgtt tcatcacata gacaatgtca ttcttcaaaa agttgaaaca    227340
     tcattggtca ggctcatggc tgagccttcc ttctctatta gagaaatgtc ttatcagctg    227400
     ttatgcaaga tatacagcta taatgaagtt cttgaatcta acaagtcata tgaatatagt    227460
     attcttattt tccagaagaa tatttttaag aacgacaata tcgatttctg gaaaggatat    227520
     tgcctaaacg gcggtgccat ttactctact gacttacaaa ttgctacagc aattgatgaa    227580
     ttcataaaat tctatacaaa cgaaggaatt gatgagaaga tcaagctatg taattatctg    227640
     gcgaaaataa tcccagcagc tcaaaagatc ttggatgaaa ggatcaaaaa caagaaaaaa    227700
     agcataacag gtggtaagga gtatgatata gttaagttca caatatcagc tactatattt    227760
     tggagaagac taatagaatc tcaattggaa gttccatcac atttcaattt caatggtctt    227820
     tttgccaggg tatacaatat acacttactc aatatcaata aagtgatgaa aactaattgc    227880
     ataaaattgt ttcctctaat agctattgct gcttctagat cgcaagcaga taatgagaaa    227940
     catctagcaa acagtatttt gaaaaaaatg attatcttga tgaaacggct acctaccacc    228000
     aacaaccaac agcctctgta taagaaagca tacttggagg gaataataca aatacttcta    228060
     tactacaaag cggattctca agttgaatta ttacaagcta caggtgatac agattatgaa    228120
     cttaccaaac tgaaagatga agatatatta ctcagttgac tttttttagg acacagacct    228180
     atgtcaaatt atgtatttta gataacttca atacctcact ttgttcaatt atgagatttt    228240
     taatgcaaca gaaaataaga gtagaaagta tgcattgctg gtattcaaac cattattttg    228300
     ttagacaaga gcttataacg ttccttgtca tctgcggtca atatatcttc ccatttagta    228360
     aaaatatgag ctaactgtcg tataccatca ggattattgc acgtaataaa ctccgctaaa    228420
     gacttgataa gtattggtat gaatattgcc ttttctgcat tattgaggat aacatcatca    228480
     ttaccaattg aagaaactaa agtctgaatt gtaagtttca attcaatgtt ttgtttggta    228540
     tgcagatacc acgcaatctg gaaccagatc ttaagtaact tatattcctc tgagttaagt    228600
     tctttaatga cttcattgta taactgcttc gaatcagctt tacttatcaa ctgtaagcag    228660
     tctctgtaaa atacaagacc tctttcattc tgtttgaaat ttcctatatc tcccgattcc    228720
     attctcttat atgattttat catgccaata cccaattttg cgaatgtcac tttagaagct    228780
     tcatcgtcta tgcgattatt aatattcttt agcattttta tgcattcatg gtataattcc    228840
     tttggaatcc taccttttaa tgttttccca gagtttgcta tccaatcaat gttggatgta    228900
     tttaagagag taagaactct aaaatatatt tttcttctat tctcatttct tagttgttgt    228960
     agttttttga taatcatcga cagatctaac gcgctatggt ctttacgatc gtctttttct    229020
     tttaatttgg aaaaatctat gtactttgtt atccacgccc ttgtatcgta ctgaactttt    229080
     agaaacttag atcttttagg ttgtggaaag acatcagtga ccaattttga tattgaatta    229140
     tctgactggt acctttttga tgtgtaacaa agtaattgat aatttcttat atttaagcca    229200
     ggtgtgtatc tttttagcat catatcacag atagttccat tattatacag gacaatctta    229260
     ggagcattaa aacggacaat gaaattagga taacaaaatt tatgagctgc agtgcttctt    229320
     ttcgactaat cttttatgaa tttagttacc atatgcactt tttttaaatc tcggatttct    229380
     cttattttcg agcaatgtgt gacaagaagc gtaataaatc acaagaactt tcacagccga    229440
     aaacctaatg aactagttat aagtgttcgc tagtaagcta aaatatcact aagaaattca    229500
     gaactatgcc acaattcctt tatggtttat tttttcttct atcagatact tagtttcaag    229560
     ttctgttttt ggctgaccca tttgattttt ctccgagaat cgcaatagca ctttcttttc    229620
     gtagatttct tttagacttt tttggtgttt agatatccat agatggttaa agcactgttc    229680
     gcaatctaaa cgcttatcca catttacttc aagaagtttg ctaacaaaat tttgtgccat    229740
     gatatctatt gtactccatt ggcttacatt aaagttcaat atacccgctt ttgcgttttc    229800
     tacaatgctt tgctcagtcc catcgccgta aaatggtgat attccagtaa gcattatatg    229860
     tgttattaca cctaaagacc atagatcgca tttgctgtca taaccttgtt gctcaagcgt    229920
     cgcggcccgg aaaaatgaat ggtaagcctt tctgtttgct ttgaagccaa cttctggtgc    229980
     acaatattcg ggcgtcccca ctacagtaaa cattctagat ttcattgtgg taactgttct    230040
     tgcgattcca aaatcagcta aaacaatttt tgtaaatggc tcaggtgtgc atagtaaaat    230100
     attatctaac tttaggtctc tgtgtactat tcctttggtg tgtaaatatt taagggcgtg    230160
     caatatctga taaacaaaca ctagggcctc agtttgtgaa ataggcatta gacaatcacc    230220
     tttagctaaa tacgagaaaa ggtcaccccc tggtataagt tcctgaaaaa tgtaaaggtt    230280
     attgctctta tcagtatgtg tcttgaacac tttaataata tttggatggt tcaattgcat    230340
     aagaatctta gcctctttat ctagttttga gagcttcatc ttaacaattt taactgcata    230400
     acatttggga gttatcttct gggagctttt tcccgaatgt gcgccaatgc ccatatacgc    230460
     aatcaagaca tatccaaatg ttccatttcc aacaacaatg tttgatatat tccaattgtc    230520
     cacattttct gtataattga tagttatttt tttgggcaaa gaaggagttg acggctgaca    230580
     agaaaatttt agaaacttgc caccattttc acatagttct atcaagtcac cgtcgtttaa    230640
     tattgctaca ttttccttta atagtttcgt tccgtttatg taagtgccat tcaatgaaca    230700
     gtctctcaag tagtacatgg gtatacttgt ctcatcgaaa agaatcatcc ataccataca    230760
     atgaatcgcg gaaatagccg ggttggatat acacatgcaa ttttccttcg gacttctgcc    230820
     tattttaatg ggattatgta gctcaatgta tactctcggt ctaggtgtac ctgctaagtt    230880
     atgaccgacc actctgtgtc cccactggcc actcaacagc acttccccgg gcttaaaatc    230940
     accaatgact tctagatacg aatccatcag tacagtgtag cagtttattt ttattctttt    231000
     tttttttctt tattgagcac catgatacac taaaccggta gaagaaggac agctagtgga    231060
     aagaaccggc aatcttagcc gccttttata ctttttttgt tctttgaatt ttaaaggggg    231120
     agaaaaacca ttcccccctt tttctttcac ctcccttgaa attttagccg ccgaaatata    231180
     ctttttcgtc ctaccttttc ttagaagaaa aacttccttt tatttcacac aaacccaaat    231240
     tacccatcgg cggctagcac tgcactacat tcacacccgt tgtacacgca cttcaataga    231300
     aacagcacca aaaccaccag atctaagtat caactgctat aaatagtatt atgtcatcat    231360
     attcagtgct gggagtgggg ggactgggta cccaaagaag tcgaacgtca gagtacaaaa    231420
     acaacttctc agaactgtcc gtacaaattt gggaaaatct cctttagaca atggcagctt    231480
     ctagccgccg agccttctaa tcatgatatt tttagtggac acttgagtaa aggtcgtaga    231540
     aaggattcca gaagagacat gtgcttgttt cgctcaagcc cttcccctcc gctgcgttgc    231600
     tgacaagaat acgcacggct gtagcaaaga gaaatgccaa aacgcatgct agcttctgcg    231660
     ggggggggaa ggggggataa tatagtgagc aaagacgcta cggggaaata ctaaggccag    231720
     agcaacttgc agacaaaata gaacaaggaa aaccaatgag cgttaccttg caagagaaac    231780
     tgccgtacaa gcactctacg tgcatggtcc cgtacagcta attctctggt caagctgtaa    231840
     gaaaatggaa gggatggtga aggaggaagg ggttgaggtg gcgagaggga tgagtgggat    231900
     gagtgggaga gcacacacac atgagggaca atttgggatt ttccccggaa tataaataac    231960
     gattggtgct tccctttgcg tctcacgagg ggaaaatttg gaaattgaag aacccataca    232020
     ccatcgtagg agacggaatt tgttatataa tacgaacatc acacatttac acgtgataca    232080
     gagctagagc tacaaagaat acacaaacta accctttaaa ataaggtatt tagaaaggta    232140
     aacaggacag acaggacacc gattgctgaa tagcagacgg gaaaggatta ttagtgcacg    232200
     tacaagacag tgtaataagc catttaaaat gtcagaacca cctacgccag tgcatgctgg    232260
     gcccaacgag cagctggata ttgatgacat caaggagctg agcgatgagg atatcgaaga    232320
     gctggatttg aagccggaca tggacactga ttcgttatct gaaaagcatc aaggggagta    232380
     tgtacaagag aatggggctg tgaagcgaga gcatagcata ttgtcgaatg aggagctgta    232440
     tggggaggac gagcgctcag attttcagcc tcgagttaac atcaattcac cattttcttc    232500
     ctatgccaat ctgcgagccc ttgacgatag agctagacct aagccgcaga gacgactgtc    232560
     tatgtcccag cagtcgaagt ttattgcata ttgtgatcaa aaactcatgg acattcaacg    232620
     aaaatttgtc caatctcgtg ggcttaacac acagaatggg taccaaggcc tggagccctt    232680
     gttacaggac gttaaatgcc tggtggactt catatggtac tcattagatg gatcccccaa    232740
     tactgatgta ctattaacag aggagcttca atccgatgac tctatgggaa tgaagatgaa    232800
     caataacaat atggctaaag acacttactt cggccagtcc tcttatctca tcaagatagc    232860
     agatgatttg ctagactaca tagaaaaatt tgacttaaag tttttatctg gtgaggaatt    232920
     acaccaaacg ttatcgaaac tgttcaaact actgtttatt ctggatagaa tattctccaa    232980
     actgatcgac ggtgacatac ccggtgggaa aaggttaaat ggtacagaat ccgtaagagt    233040
     taatggtatt gctgagagga ctaggatgaa attacctgtc atttttgaaa gtcaggattt    233100
     acacggctac cattttgaag tgagtaaagt gtacgaaaat acattagaga gatgttccag    233160
     ataacgcaca gtaaatatca aaaaaacttc tcgataagac tggacttaat caagaccata    233220
     caatttccta gcatcgcttt catgccacta tattttctaa tgaattcctt aatttgtaac    233280
     tatactaata agacggtttt ttactagcaa attcttgcta acgataacga tattataatc    233340
     gcactttatg atattttcct atatataacg ctctataaaa gaatgcattt gttgaatatg    233400
     aaattggcat tgtgttgaca gcaacaagaa tcagaaacta atggggccat atttgtttac    233460
     agatcgtata ctttttgctt accttattac tgttggtcga atggatccct catataagca    233520
     ctagcagcct gtggtgtaaa cagtggaaca ttggcgatgt ctgtatgact gtgatcacca    233580
     cttatagccg attcgtttac tggcgatttg gaatctccag attttgtttc agagttgtta    233640
     ttgttatgct gtagagcttc ttgatttgct gctgcaacag aaactgcttt atatgaactc    233700
     aaatctaaaa tcaccgtaac atctttggtt atcttggcta acgaagcaag ttgtggcctt    233760
     acttcattta gacttggcaa atcagccatt aaagtctttg cattggcaag aattgaaata    233820
     attgctttga ggaaggcatt gatactttcc catgttttta gcttttcaga ggtcgttgaa    233880
     tacttttcag cagttattcc atcaccagtc agaagccgta acctttcacc tagtacctgt    233940
     gataattgca ataattgcct acaggtatct gttaaatctt ttattttggt agctagtgta    234000
     tcggtcaata cctgatgtcc tgttgaacta gccaaagcaa ctttagatat ttcagatgta    234060
     agttgattat acaccattgt caccatctta actactgttc ccaatgtttc gtgaagttgc    234120
     tgatcaatat ctacatccgt tccagtcggt gttgagattc cacccttctc agttaatggg    234180
     ggttgctgta cttgctttag ttttggtgct gtaagagaca catttccatt ttgaagttca    234240
     ttgttaatct gtttctcatc aggtggattc ttgaaattac cacctctatt atctgctgtc    234300
     ttagctaaat tagaaatatt cattttatgt ttgtccgaag aaccttgctc ttgagtactg    234360
     tttgtagtag caactgcatg agtaggtagt tgtccttgag ttcgtaactg actaacacca    234420
     ttaggagatg ttattatatt agacttagat ccattaacat tcaaaagact acctgttcct    234480
     ctaccttgta tggtattact tcttgacctg gctacttttg gaatgcctga ttcattgtgt    234540
     tctactgagc tttcttgatc agatacggca tcatgatatc tagttttttc ttcatttgac    234600
     aatcgtactc cagcaatatc tggttttgaa acattagtta gcgttggttt tctgcttaat    234660
     ccgacatggt ctgtcctact gttcgcttcg cttttacttc ttattatagc cggatgacca    234720
     tcactctcag gttgaatttt attgctattg ttactggcac ttttcttatg tagtaaaagt    234780
     gtctcctgtg gtgtaataaa gctccatgca ttgtacattt cagtatatga acacactagt    234840
     gacatgaaaa acattcttat gaaacataaa tcatcttcct caaaaaaagc tttaaaattt    234900
     ttctgtaaca gcgcaataat ttgtttaaat attgagatga tagtcataca aagtgtgatc    234960
     aaaggttggt cgttcgagat ttcttgattg tcagactgtt ctaaaatttc cacaagatta    235020
     tcaatgtgtg atctaaccga atatagaaga gataccacat tcacagcaat ggacttttct    235080
     ttacaaagtg aagtgatctt tcgtattgcc tgttgacact ctgtaaaact aaacaataat    235140
     ttgcgacaag caacaaccaa atcagtgtgt gatactttat gctgttcctg gttaacctct    235200
     tctggaagaa ttgatagtct tttgaaataa tcgttgtatt tagtatggtt gtagaggtca    235260
     tttgaagaca gaacattagg tgtattcata ttcgtatctg tgaaattctc tttggcaata    235320
     gtaacattat tgatatgttc tgatatagtg gcagatgaga tgctagaatc attcaattgt    235380
     tcatcagtta ctggtatggt attaacaaac cccatccgct ttgccgctct actcaatttt    235440
     gactctagcg actgtacttt catttttggg tgattgttaa gaaagcgagg aatggcaatt    235500
     gcccaatact catctttagg taagttttgt tgatttggaa cataagatag tacttgatca    235560
     agttcttctt tcggtatagg gtttccttca atttctagaa cttttatatg atttagttga    235620
     agaataggag atagtttcca aattgaggta agtctgttgt tcttcagaga tataaccttt    235680
     aatctagtag agaatacgct tggaaattcc tctggaagct gagagatttt attggatgat    235740
     atatccaaaa tttccaactt ctggcaattc agaagttcaa ccgggatctc tcgaagccca    235800
     ttactatgca gatcgaggta gcgcaggttt tttaactcac taaagttttc tggtaagtat    235860
     gttatgttgt ttttccttag tgagagtctt tctgcatttg caagtagttt aatatcttcc    235920
     ggtggtattg ttttaaggtt cagtcctata agtttaacag tggagctatt ttttgattcc    235980
     tgttgtgtta actcatgatc tattacttct ctcatttcat ctatacttaa ctcattcata    236040
     gcttgagacc cctttgaact atcgtcattg tatttttcat ttgctagtgg catattctca    236100
     tgccctattt ttatctgatg ttccattgat gcagaaactt gacacctttt caattctaat    236160
     cagtatctga cgcaacttta atattaaata aggaatccag agctggacaa gataaaattt    236220
     gtcttctttg gatacacaaa gtatatttgg attgagattt gttgagatat tgctcaaccc    236280
     tagttgcaga attgtatttc taatgctaaa aaaaattaca gatgagaaat actcttcctc    236340
     atcaacttgc tgagttagta actctaataa ctaggaattc ggtgaagttc agccaatgga    236400
     tattgaagtg tgaatgctta tcgttaaaga atcagctata ggctttttgt aatacttgga    236460
     attgctatat tctttgtatt ttatcttcca atttctaaat cattgaattt ttcaagaaat    236520
     tgtaatcgga tttatttttt ttttgttttg atttaagaag ctccaattaa gcgaaattct    236580
     ggagaaaaat cagtatcgcc catatataag atgttaatca atagttgtgc atcactcttc    236640
     actgtatttt ctgataaaat ttgtcggata acaaatataa tgatactctt agattgtaat    236700
     atcctgtatt gattgattga tgatatgtga cctgatattc tatgtattta tctcactata    236760
     aatcagtctg agcaagatca tcatggataa aaagagatat aatattgata aaaaatataa    236820
     ttatttacat tatttacaaa tgatagattg aaggagtaaa atccggtgta attaaaaata    236880
     atactctgat atttacatga aattttattt tcaagtactg cttttctact tcatgataat    236940
     tgtgaaaaca tttgttttga tagttcttgg aagtatcaat ggttgcaagc tctctttcat    237000
     aaactcgaat atatttgcat tatttttatt tttcattttt ttcattttta gattctctgt    237060
     ggtgagactc ataaaagtaa tgttcatgtc gaagtggatt ttagctttga gaatgatttt    237120
     gcaccaattt ttttgaacat agctatgtca tcatttctaa actggtaatt gaaatcggga    237180
     tctattgcag gcaacttttc gataatgaat tcagagaatt ccagtagttc ttttgggata    237240
     gttttagtac taccacttct aaagaccatc cttattgttc tcagaacctg ttccatccaa    237300
     ttaatagaca tatgaacttc taaaccagga agcatttcta ggtacttgga taattctgga    237360
     tatagtgaca cgtcgtgtgt tctaccaata acctgacaaa gaccctttat cattgtaccc    237420
     attaattgag gtgagttgat tctcatgggt tgcgatactt tgttgttgtc agtcttcatt    237480
     aattcctcaa atattttctc cgcattctga acatcaccat ccggtttacg gaattcactg    237540
     aacaaaatct ttttttgtaa ggtgaaattc aattggtaaa tccctctttg ctcaaataac    237600
     acacggacag gaataatcga aggtgcaata tcgatgaact tttctaaaat caagttgacc    237660
     tcttgcttcc acgattgagt agaaatttga ggctttagtt ttagtacttt gcttctaaca    237720
     tcattagcga taacatatgt ctcatcgtcc gtcttggttt tgtatatgta gtcaccatat    237780
     gttttcaacg ccaaaatgga ggtattagac ccaaatgaat ccaagctgtt ctgttggtaa    237840
     aaatcatcaa atactttgct atcatttgga ttctcattaa aaatttttaa cgctattgct    237900
     tcagctagat caacagattt tagtttccca aatttcgtag catctattct gttttgaatt    237960
     tgtgaatatg tgatctttgt tcttctgata attgctagta aaaaggcctc aaagacaact    238020
     tggttattct tatactctgt aggtatctct ttttcccata tattctgtaa ttcttcaata    238080
     tttccagatg tatttaaagc tttgatcaaa gaagcatatg ctagagaggc atcgattccc    238140
     actttaccaa attctggttt caaatatgaa ttccaaacag ccaatagtct ttgcagtttt    238200
     tgtatttttg agggagctgg atattttgaa acaatgtcga gtaatcctaa ttttaattta    238260
     aaaccatccg cgtcgctaag tttatcctta tactcgttga atacttgcat tggaaaagag    238320
     gagttcgcat tcagtttatt gaattgctcc ataaactttg taataatttc aatatcgcag    238380
     ttattgatat ccctttgtgc agaatagata ttataaaagc ttcttagtct agattctgtg    238440
     taacagatat caagttgatt tatgaaccac gtcttgtttt gtgttgcata taaatttaag    238500
     agatatgcaa atctgttgga taattcttgg tcccttttca acacttcatt ctgttcaaca    238560
     atggaaatta ttcttccgaa tggaatgtcg gtatgaaatc tttctgtctg taaaatctgt    238620
     tgtaacatgc tgcaatctgg ttcgttcata tcaggaagtt tcaagtatgc tattgtggta    238680
     tatgccatta agttttcatt tgatgttgtg aattgctcca aatatttaac ccacagggag    238740
     ataacatctt taggagcgtc cttcacaagc aggtagtatc tcaatatcat ctcatattga    238800
     gcaggaccta tcaaattata cttcgatagt tgttcaagca caacatatgg gtctaagcta    238860
     gaagtattct tcgcatttgt aatgctttga aaaagacggt taataaaaga caatgatctg    238920
     ctcctgccat attttggtgc cattccttgt cttccgtttg aaaattcaga tatcttatct    238980
     aagtcatttt tgaactcatt gtataaagat tcaatatttg ccttcccatc aggttgtgcc    239040
     aatttgcctg tatactcttt gttcaactca aataaccttc ctgatcttct tggtgttgtc    239100
     tcaacatttg actgtgtgct agacgataaa aatcttaaag ccgtactttt aaggtattgg    239160
     tactgggcat ctcttaagga acgtactagt agtctctggt ttatccttaa cattgtggta    239220
     gaattctcaa tttattagtt tacaggtcct ttatacgctt cccatgaaat caattaatag    239280
     gacaggagtc aattactatg ctatgatcca gcgggaaagt atagggatac agattcaaac    239340
     tagagccact caaaacaggg attcgattac aaaattagtt gtgctctcct atttctataa    239400
     tactcattaa gaatatttat ttgatgtttc gagaaatatc ttttaacttg gttgtaaatg    239460
     ccgttacttt ctctgtttcc aacccttccg agactgaaaa aaaactgagc tgtgaaaaat    239520
     cattgaagtg acttcgaaat gaacaataca cattttatgg acagtatcct cataccgagg    239580
     gaggtctcct atagttttgg tgattaagct gtttttagag tagcgaatat actacgtcag    239640
     agacaattga aggttagttg taaaaagtcc agtatatttt gaagcaaatt attagggtgt    239700
     tagcaatcaa tgacgtatag tttcaaatgc tgtgatgacg gttctggtat agcaagtggg    239760
     tctatactta gatttgacaa tgttacaatt ttattagacc ctggttggag ctcatataaa    239820
     gtctcttacg aggatagtgt ggcattttgg tcgaacatta ttgctgaggt tgacataatt    239880
     ctgatctcgc aaccgactac agaatgtttg ggtgcctata ccttcctgta ttacaatttt    239940
     atatcgcatt ttatttcaca tattcaggtg tatgctacac tgcctgtagc caatctagga    240000
     agagtatcaa caattgaatt ttacgttaca aagggtatca taggtcctta ccaaacaaac    240060
     caacttgata tagatgatgt tgagaaagcg tttgatttca tagatgtgct taaatactct    240120
     caactcgttg atttaagatc caaatacgat ggtttatcat tatttgcata taattcaggc    240180
     tacgcaccgg gtggtgctat atggtgtata actacttact cagagaaatt aatttatgcc    240240
     ccaagatgga atcatactag agatacgatc ttgaatgctg ctaatctatt agataataca    240300
     ggaaaaccat tatcatcact aatgagaccg tctgcaatag ttacaaactt cgatcatttt    240360
     ggctcctcac aaccttttag aaagcgtgca aaatctttca aggatatact taagactaaa    240420
     ctaagcaata atggtaatat tttgattcca gtagatattg gtggtaaatt cttagatctt    240480
     tttgttttgg ttcacgattt cctttatgag aatggcagga ataataagtt agcaaatatt    240540
     ccaattgtac tcctgtccta cacaaaggca agatcactaa catatgcaaa atctatgacg    240600
     gaatggtttt ctagtatctc agctaaaact tgggaaaata gaaaccaaaa aacagctttt    240660
     gatctggata cgccattttc tgttgtggac tcaaatgaat tggcaaattt gaagggtcct    240720
     aaaatatgct ttgtttctaa tgtagagaca ttggttaacg atgcattgtc gattttaggg    240780
     tcagataata atacattgtt agttttgact acagataaca gacaggaagt tccagcactt    240840
     catacaatat atgactactg gaaggagaat aatactgaaa gttcaattga aagtgcaaat    240900
     gttctaaaac tgaaccaaaa aattaccata aataccacaa cattcaagga attgcagaac    240960
     gaagaacttg atgcttatct aagtaaatta gaacaaagga aacggaaaca gttgataaca    241020
     gaaattacga ccaggaaggg gctcaaaaag ggggccgccg ttgcccttcc tactaattta    241080
     gcatctgatg aaggtcagaa aacagaagtt gatctggttg atgacattac aaacaccgaa    241140
     gatctggaaa aactattaga agaagaggag gaggacgaag acgaagataa tgaagataat    241200
     cttattaata ttttagaaga tgaagataga gccgacggaa ttgaggagtc tattccagta    241260
     gatataataa ttacgcctgg tgttaacaac aagcacaaaa tatttccatt tcagcctctt    241320
     agacaaaaaa aagatgatta tggtattgta gtgaagtttg atcaatttgt tccagctgaa    241380
     gacaaagatg atattacgcc atcaaagaga catataaatg gagataatga ggaggatatg    241440
     gatgacgatt atgttataaa ggaagcttct aataagaaga tcaaatcaga tagtgttaac    241500
     cagcccacaa aagagactaa attttcggat gatattaatc acttgcggaa tagcaacaga    241560
     cctggtatac gagagtttaa agcaactgag gttaacttaa atatgagttt aacgtttatc    241620
     aacatggaaa gtttggtgga tagaaggtca tgtggtgtga tatggccact ttttaaaagc    241680
     cgcaaattaa ttttgatggg accttcaaat gttcaagaca agcatgtaac tggcatcatc    241740
     actagtaaaa ccatggaagt aaccagcctg gcatataatc aatcaattga ttttgatact    241800
     accatcaagg cattggatat aacgatatct ccagaattgg atgcacttct caaatggcag    241860
     aggatcagta acgactacac acttgcgcac gtaaccggta gactagtcaa ggaaagtgcc    241920
     catcagtcct cggctgtacc agtaacagat aacaccactt ctagtggaag agagaaatat    241980
     gtgctaaaac cattaaatgg caatgtcggt gtacagacca atggctcact agctattggt    242040
     gatgtcagat taatcaaact gaaacaaaac ttaaacgcga ctaatcatac tgcagagttc    242100
     aagggtgaag gtatattggt agtggatgat aaagtaatta ttagaaagat aagtgatagt    242160
     gaaactataa ttgatggtcc cccatcggca ctgttctatt ctgtgaaaaa gctagtgatg    242220
     gatatgctag ctaagatata aacgacctaa ctccttacac gcaagtaatt atcttaagta    242280
     caaatggttt catatcacga ccaatgagta tatattctgt atggatacgc gctactgtta    242340
     atttacatta aaacagaact gaatgaaaac ttaattgata aaggatgatt actatcatga    242400
     tactattgtc tttatacaac aatttttcat acgtaatcac gaaaccggta tcgcctactt    242460
     acttgaactg taatttttca gtgttctagc ttgcgatgag gtgaaaaaaa tactgcatat    242520
     aactatgact acagcaatag cttaagtttt gtagatttga aagagttgat ttggtttcta    242580
     tctggtggat acaagcgaag ctatatatta cttaacattc aatatttaat tacaatttag    242640
     ctgggcgtta aatcaggatt cacaagagca atagaagttg ataaaatatt tccagatatt    242700
     caattatgag tgagcgaaga gaagaagaaa gaggtagaac tggcttttct atgaaaaaga    242760
     atcacaactc caattttaat cgaaggaatc aagaacaaat acaccagaag ttgccaacga    242820
     aaataagcgg tccattaact ttagagcagc tttgtgcata tcagcatatg ttcaggatac    242880
     aagaaatatc ttcaattata aaatcccata gctttgaagt tccaaacgct agaaatcgtt    242940
     ctccatcacc tcctccagtt tatgatgcag aaggtaaaag aataaataca agagaacaac    243000
     tttataaaaa gaaattgatg aatgaaagat tcaaactagt ggaggtcgtc tctaagttaa    243060
     ttccaggata ttcagctcct aaggattata agagacctac cacttttcaa gagaaatatt    243120
     atataccagt ttctcaatat ccacaaataa acttcgttgg actattatta ggacccagag    243180
     ggaaaacact aagaaaaatg caagaagatt ctggatgtaa gattgctatc agaggtagag    243240
     gttcagttaa ggaaggtaag acctcatcag atctgccacc aggagccatg gacttttctg    243300
     acccattgca ttgtttaata atcgctgata atgaagagaa gatagaaaat ggtatcaaag    243360
     cctgtcgaaa tattgtaata aaggcagtca catctccaga aggacagaat gagttgaaga    243420
     gaggacaact acgtgaacta gcggaattga atggtacttt aagagaagat aataggcctt    243480
     gtgctacttg tggtcaacag ggtcataaga aatacgaatg tccacatagg gagacatttg    243540
     caatgaagat tatttgtagg cgatgtaatc aaccaggtca tacaataaga gactgtactt    243600
     cagattctaa ctatggaaaa cagatacact cttcgagata taataatgaa atgccttacc    243660
     atagaaccag cacagctgtc gatcaaccga gtgcgtactc gagatatgga tatacaccaa    243720
     gaaatcataa tggaagtagt agattcaacg ataattccaa atatctgaac aatggtaaca    243780
     aaagggctac tccacaaccc gagcttgaat tagaaactag tcataagagg caacaaatta    243840
     atcctacctc aagttctcag gataccttaa gtcaccagac taatcatatg actatgacaa    243900
     cgatagaaga ttctggaatt gataagttac aacttcctgc tggtatgtct aatgaaaatc    243960
     ctataccaca gcctgttaat ttcaacgaga ttcaaataaa tgacgtctct ggaccaaatg    244020
     gcactttaga agcgccaccg ggccttgact tgggaaataa tgattctaac ataaccctgc    244080
     aaggaccacc aggtctaaac tagaatgcat acttttgtat tgataattta tatagttatt    244140
     tagtatagct atcggtaatg aattatccat aaattctaat tcatattcta ttttccattt    244200
     catcacattg agatatgaat acgaatctca acaagaatgg ttatctggat ttagcttctt    244260
     ggctctcctt ccatttatgg gcaagcgcta atatattcga tgtgtcaatg ttgcttttat    244320
     tttcatcatc tggaaaggta tatgtaatat tctgagtctt taatccgtcg atatctttga    244380
     tgccatttac aatagagggt aatctctttt caattctttg tctactggat atatcaccat    244440
     actgtccttc aaagtcgaca taagattgta aaattcttgc tctatcttcg tctctcttaa    244500
     tttctttgaa ataattgaga gctctttcaa aaacatctct tgcattatct ttattattat    244560
     cagtaatctc aaattcaaat tcgatctctt gttcatctaa agcactacta tccttcaacc    244620
     tttcttcttt catgatttgg aagttttgaa cttgttcctc tgtaggaact gttaatttct    244680
     tcattgcata atcagtccaa gcttctacgg taaagttaga cagctctact tgttttttta    244740
     ataatggttc aatattatca aaattctgat attccatttc atagtcaatt aagatttcaa    244800
     gcagatgtaa ctggaatgac tttgaaaaca gcccaatgtt gttttgaatc ggaatcatgc    244860
     aaacactgcg taccctgact tcatctccca gactgtcttc aaattctaca taggctctcc    244920
     atgtatcgag atttagcgga tcgaatttta aaaagttttc atataatatt ctaacgcgat    244980
     caaattccct aagtttggtc tccagatcaa tgtaatactt aaaagtcttc cgttttggac    245040
     atagtcctaa cgaacgaccc aaaatagatc tagctttctc caggttatct tgtcgaattt    245100
     caaactcagc gtataatatc catatttttg aaaaagtaaa atcatcatta gggataatat    245160
     tatggatcag ttcttcaaat ttctgtccac ataagggaat atcattaatt gttagctcaa    245220
     gaaatgttaa gtatttaatc catatcagga tatactgctt ccaatatttg tctttagtcc    245280
     tactagtagg aatggccgca tttagcacat tactaaacgc ctccataact aatttaggat    245340
     aattattttc aagtaattgc aaatacaaca gccatgtgtc gtaatcatat actttttcat    245400
     tcagaatatc ttcatagtgt tttttacgat taagtatgat ggtattctct aaagtttcgg    245460
     ccgttccatg ttctctttca aattgaagaa gtgcattatt taaagtatta gatttaggcc    245520
     atttttgaat agcgatctct aataaggatt ttgatcttat atactccttc tgaagtgcct    245580
     cccatttaga aaattccacg attaaattaa tacagtcgtc aactaattca tttcgacttt    245640
     ctgaatatgc aatcaatgca tccaatgcca gagaatatac cgatctgaca gttttggttg    245700
     aaccatacct tacctcgaaa ttaatccatt ttctccatgt tgaaaattga ggatgtataa    245760
     gaacatattt tgagtaaata ttacgcacat cttcatacct ttcttgtcta acctcgaaat    245820
     cggtaaatga atcccatacg tgagctgccg gttctaaaga gcaccatttc tgaaataaat    245880
     tgcgcactat gtcaaagtgt gctaaggatt cttctacaat taaatacttg taccatagtt    245940
     tgtcaacacg tggaagttta gtaatagccc tttctaatat gtttctcgca tgattgatat    246000
     atcctagctt caactcggat tctatatacc ttatccataa gggaacatag ctgatatgta    246060
     ccctaagtgc acgttcaaaa atagaccttg ctcttctcat atcatgctgt tcaatttcga    246120
     acactgcata acgcatccat tgcttgacat ccagtctatt ccttttcaaa tagccttcaa    246180
     actctgtcct tttcctgcgt tgtacatctt ttagttcttc gagatcaaga atatcaatgg    246240
     catctatgga aaattgctta ttttgagatt tatagacatc cttcagtata tcattatctg    246300
     taatctgttt tgcaggtatc tcagtcattc ccactacgct agaaatagat cttatctaat    246360
     gttgctctag ctgacttctt cttttcgaag tatccttttc actctgtaat gaatgcaaca    246420
     gtctagagtt cactagatct caaacactaa gaaatttgat ttaaataaaa tgtttggtga    246480
     tgattttagg tgatacctta ttttagttga taatataagt aagtgtagct catcgagcat    246540
     taaatattag agttttcata tgagagaata ttctcaagtt tgtacagtca cgtgatatat    246600
     ttcataatac atgaaaggtg ttatattaat tgggatctat tagttgattt gaaagctata    246660
     tgctactcat gtatgtttgg ttttctatat ctctatgacg tgttttacac cacattatac    246720
     attccggttt ataactagct ctttgcccaa agaaatggtt gattgcgaga tgaatactgt    246780
     agccatttat gcatcttttg agtaaacatt tgactttaag aactcagcta aatcgttcaa    246840
     ttctgcaggg tcagctgagt ggccaagacc tctatagctc ttaaaagtgt agttctcaag    246900
     ttcaccagcg gatttgaaga actccgctgt ttgtacacca attgggaaag gaacaacgtc    246960
     atcgctttca ccgtgaccat ggaacacagg agtgtttggg tttaagttct ttctggtctc    247020
     ttgaagttca tttctaaggt aggcaaaccc agaaagaccg ataaatgcac ctatcttatt    247080
     atttagagta actgctgatg ctaatgctaa tgcagcacct tgggagaacc caccaactat    247140
     tatattttga ggttctatcc catcgctaat actactatca acatatttct gtacttcctt    247200
     taatgattgc tggaatccga cggtatcgac attagaagtt gtccagtccc acactttaat    247260
     atcaaaccaa gaaggcattg gcataccacc attggcagta actggcttta tgggtgcatt    247320
     aggaaatata aagttagtgc tctcaaaaca tggatggtat tgctgcaggt attgagctaa    247380
     aaatgaccaa ccttgacctg tgtcacctaa accatgcagg aatattagtg catatttagc    247440
     gggtttctta gtactggcaa ttcgaacagc agtagacatt gatgtagact agtcttattt    247500
     gtgttatcag ttaagatact tgattatata tcttctcttt acctcgaagt tgaactaata    247560
     ccacagtatt cctttgtctt gaatcatctt caacttttaa gaaggtggaa atatccgatg    247620
     cgatgatatg aaattgattg ttaacctatt tagcagtgga taatatattg agcccgaata    247680
     acaaagttct aatatctgaa gtaaagaact accatatcgt tttgatagat agctcaatca    247740
     tacctcgata acaatttata atggataaac cacctattct tccgcccaga gaagacgcag    247800
     ttgctctaga gccagctaat gatcagccaa aactggatgt caaattacct gtaaatatta    247860
     atctgctctc atataatgaa ttactagagc ttataaatca gcacagagat aagctgcatt    247920
     ggttttgtgc tagcatggat tcttttgaac cgattacaga ggaggttaag agactgaaga    247980
     accagtttaa ggagctggag gagaaattct cgaaattgga ggacggtaaa gttgttattc    248040
     aagaccaaat tgctgaattg gtcatcttag aaagcgaata tacgaagaaa tatcagaatc    248100
     tacaacaatt aatccgctcg aattactcta aagatgtagc aaaacggacg atgctcaata    248160
     aaataaagga aaacgaacaa aagtgcgatg agttagagat aaacgccaaa ggcagtttag    248220
     atctggatgt gtttcttaaa tcgtatatgg attttaagct agattatcac atgcaaaagc    248280
     aaaagctgaa tgtgttgtcc gctcagaata atttctaagg atgcaactga atagtattga    248340
     aaatctataa ggataaccgc aatcagtatc actgaatagg tatataggat atcaaattat    248400
     atgcaggcat atagtaactc tatagcgttg atctcactcc aattgaatgt ttattattta    248460
     agtagcgtgg ctaataatat atgggtgaag taaaacatcg atactcataa ttgcaaaaaa    248520
     ataatatgcc ttagttgtca ccatatataa gttagaaacg atgttatagc tagtgtctac    248580
     aaaaaaataa tttacaaata ataggaagaa atgaaaagaa taaaggcaaa acagagtaat    248640
     agttgcataa attggaaaat aaaagaaaaa atgaactgaa gaaatgcttg ttttcaccag    248700
     gctaacttaa tcagatttaa agaagttaaa ctactttaat ctgaaggaat catccttatt    248760
     ccatgataat gcagttgggt cagcaatttt tctgccaccc ataacccacg ccaatgcaag    248820
     aacaatggcc atggcagcac atatacagcc accaatcaaa taaacttcac ctaggaatgg    248880
     gtttctgcca ccaatagagg agccgtgtgt gatgaagaca cctttcttac cgttatactc    248940
     agtaacaggc cagtgtagac cgatgtcaat ttgccattcg cccgctggca aggtatcgtt    249000
     agtgtttttt ctaatcagtt ttgtttgctt gtcgaaagcg gctggtctca tccagttttg    249060
     aaactcttcc cattcattta tgtttggcat gttggtctcg ttgtaaccat ttgggaaagc    249120
     ctttgcccag tatggaggtg ggacgacttc tgtgtggttg tacttggtct tcttatatct    249180
     tttcttatca gagtgccaat ttattctctt gttggtcaaa gggtaattct tagtggagtc    249240
     ctggacgttc tgtaattcaa atggataaga gtcattgaac atcgagttcg caatcagccc    249300
     acaggggtaa atcaatttac cttcgctgtc atggcccagt actttacagt tgataccggt    249360
     gtttgaacga acatcgtgca gcgaaggtct cttacctctt atttggtcct cactgaaaga    249420
     aagcacatat cttctgtggt ttgcggcaaa tttctcgagc acataattca catagactgt    249480
     tttcttcaag tcagcagggg tggtgaacct gatctggcag gtaccacgtt cattagagtc    249540
     atccgatgga tcgtccacaa atctccactg tggctttgta ttgaaatcct tatggttgtg    249600
     gaagatgtag ttgaaatgat catcgggcat gtcctggaag ttatcctttg gcgcggcagt    249660
     gacacagtcc tggtaaaaca tagtgatctc gtcaactcta gaggattgcg ccaagagaca    249720
     gccacctaca atgacaaaca ccgcggcgac aagcaagtat ataggcaaaa cactctttgg    249780
     cgtgaacaca gggttgatgg acgcgagacg ctgctgcgtg aagttatcct ctttaggcct    249840
     cctgttcttc gtcttcaccg gtacatagtc atcatcctca aactccgaag catcaacatc    249900
     ctcttcttcg ggcacatctt cttggtactc gtgttctttc tttcgaaaca cattattcac    249960
     ttgcgtcaaa tccaacttca ccattttttt tccctatctt gctctccttt ctatgtcaaa    250020
     ctccagaaca aaaaacggct atacctttag attactatct tctcaatggt aatgtagaaa    250080
     ctggtgcttt ttggaaacgg cctcgatgtc ttatgtaaag actattcctg attactgggc    250140
     acttttggtg ttattcgact gttatttttt cttcaaactg cggaaagagc gattttcaaa    250200
     gcccatcacc gagaaaaata gggattgtca caggaatgcc gggtaagtga taaatttggt    250260
     gggtttccag agtgatcttg caccataggc tctatatcag tagcggcttc tggcatgtga    250320
     agcatagtgg gtgtatgttc gacctgggga cgtggactat tagaggtttt atagagctgt    250380
     tcttgaggca ttgggtaatt tgtgatggct ggtggatatg agtcctacag cgatgctggc    250440
     gagaatttgg ccgatgtgcg ggaggacagt ccgatgaagg atgttgacga tgttacagtg    250500
     gctcaaaaac ctcggtctag taagtttgtt ttgagtaagt ttaccatata tgaggcgaag    250560
     gataggatgt atgtggttgg gagtaacaag cgggagagta tgttccggat catggagatt    250620
     gatctcactg taccatgcga agagctgagt ctcttagaag ataatgtttt cttcactcgt    250680
     aatgaggtta tggatgtgct ctctagattg gaggatgcta gcagtgatgg tctcacgaaa    250740
     atactgacgt gcgatgcttt gctcggtttt ataaggttta catcttgcta ttacttagtc    250800
     gtggtgacta agataagtca ggtcgcggtc atcggaggac attccattta tcacatcgat    250860
     ggaacagaac tgataccgat aatgagtaag aaaacattta aaacaccgga gagaagctca    250920
     ccagaagcta gactaatgaa tatttttaaa gatttagact tgaccaagac tttctatttc    250980
     agtttcacat atgacataac aaacacattg cagacaaatt tattaaggga aaaattgaaa    251040
     gcaattggca ggaccgacat cagtatacct tacgacatat ttggttacaa tgacatgttt    251100
     atgtggaaca ataacctgct tgaaccagtt ttgtcatgcc ttgagagcgt ttatgactgg    251160
     ttccagccaa taatacatgg cttcatcgat caggtcaacg tatctgttct ggggaaatcc    251220
     gtgtacatca ctcttattgc aaggaggtcg agattcttcg cgggcgctag attcttgaaa    251280
     agaggtgtaa ataataatgg ctatgtggcc aacgaagtgg aaaccgaaca aatagtggca    251340
     gatatggtac taactgcgtt tcacaagtca ggtatgggtt attttgatag taatagatat    251400
     acctcatttg tgcaacatag aggatctatt cctttgtttt ggacacagga agcctcaaat    251460
     ttaactgcca aacctccaat tgaaattact gtgagagatc ctttttttag tgctgccgcc    251520
     atacattttg ataatctatt tcaacgttac ggcggtggac ggattgacgt tctcaacctg    251580
     attaagacga aggaaaaagt gccaagagaa actaaactgt taaaagagta tgaggaatgt    251640
     ataaaatatc tgaactcact gatatatgat aataatatga tatcatatac ctcttgggat    251700
     atgagtagag aatccaaaca agatggtcaa ggtgtcattg aatttttaga aagctacgct    251760
     attgatacca taacatccac tggcatattt cacaatagca aagacttcaa aggtacgaag    251820
     atccaacaag gtgtatgcag gacaaattgt attgattgtc tagatagaac aaatgcagca    251880
     cagtttgtca taggcaagag ggcattagga gttcaattga agtctctggg aataattgat    251940
     gattcttttc tagaatacga ttctgatata gtaaacattc taacagaact atttcatgac    252000
     ctgggtgata ccattgcttt acaatatggt ggatcgcatc tagtgaatac aatggaaaca    252060
     tatagaaaga ttaatcagtg gaagtcccat tcaagggata tgattgagag tattaaaaga    252120
     ttctatagta actcattcat ggatgcacaa agacaagatg ctgttaatct ttttcttggc    252180
     aattatgtat ggaaggaaga tcaaccgtcg ctttgggaaa tgaacacaga tcattatctt    252240
     cataacgatt ttggtcttga ggagacgaaa agaagttata ctcattggtg gaataatcac    252300
     catgtcatta aactaggaga tctgatacgt aatgaggtaa ccgaaaagaa taatgatatt    252360
     tcaagagcaa atttgatagc aaatataaga ggttatccag ctgcttttga taattattgg    252420
     aatgaatact acacgaccaa ggtagttact tggctccatg aactttttgc atacaacatg    252480
     aattctacta ggcgatatca tcagcttaag aaatattcag gaaaggattc ttcgccattc    252540
     aaatctcgaa aacagagttg gattaacaaa aaggtgaaag gcagtgttat tgatagcccc    252600
     atagatctta attcacctga agatcgaaag cttgatgtga ttaaagatga gaaatgttta    252660
     aggataacat ctactgatga actgctcttt ggtaactatc aactgactag cttagtcaat    252720
     aaaagaaatc acattgcaaa tttactacat gcagatgaaa tatcattaga aagagctact    252780
     tctaccggct acgaggatga gcattgttgc tcaactattg aagacaggtt tgaaattgaa    252840
     agatatggta ataatgacaa cctttattca gttattgata tcaccacctc catcggatat    252900
     tataaagaaa ttagagtaga ttttgattat tatacacgtc taggacaagt tgatagatac    252960
     aaggagcttg agaactacga aacatatttt gataatcata gctgggagcc tattatgtaa    253020
     gtggttccag ttatagtttt gaatgttttt tatagagcat atattagttt aatattcaac    253080
     atttgcagtc cgtttttaga acatttgttt gcggctcata aattaagtct ttttaatata    253140
     tatataactt cgaaaatagt tgatgttact gtgaaatatc aatagagtga ccattagttg    253200
     atatctcatt tcggttttcc cgcattatta cgtggtatgt cgctcaaatg ccggtcttaa    253260
     aataggccat ttgaaagaga agtgatgcct gaaaaactga caaaaaattg agatgagtac    253320
     ctgaaaatat aacttcatgt aaagtggcaa atcagtttaa gaaatacaat tatgatattt    253380
     ctagtattgc gcaaatgtta ttcagccagt caagctagct actaagtcgc tttttataat    253440
     tttagttgct tcttctgtcc tggtttgatt atacctatag ggaacaaaat ataaaatgca    253500
     atcgaaaaat ggagtcaaga ggccgagacc ttcacatgtg tgtgacaact gtaagcgtag    253560
     gaaacagaaa tgtgataaga atagacctag ctgccgaaga tgcttgaaac tgaatcaaac    253620
     atgtgtctat cctgactcaa atggatcaaa cgtgtcaaac atatcgccag tatctgatag    253680
     ttcgataata gatgatatta aaaatagcaa tgatggtaac agcagtttga tacatgcagt    253740
     gaataatcag gagggtaaaa taatgtacga taagaatagg cattttagca ttaattccat    253800
     gctcgaccat agatcaaatc actcacaata tcttggaaac aacattagga ctacagatag    253860
     cggaaccagt gagaatccat caacagaaaa taaagaaaga acaaaggaat tggaattttc    253920
     cagcacaatg aacacaacag aaaagaatta ctccgagaat attgctaata tgttaacaaa    253980
     ctcaagtgca tatcagccaa ttaatgagat tacgccagag agtctttcag caagtggaag    254040
     aaaatcgcta gaatgtaatg gagagactgc atatgatagc atattggctg aaaacgatct    254100
     ggatgatatg atattagagc tattcaaccc caacaacatg atagttgtat atggtaatat    254160
     gacatacatt gattcaccat ttgcccttca tactctagca caactagatg catttgcaag    254220
     agctttatgt ggagcacttc atggtaatac aatgatagaa ctacatagca agctcttgtt    254280
     gtgcccacaa gctaataact atgccgagat gttatcacaa ttacaacctc catctcctgt    254340
     tgcagagttg aattcagaac tgagtacgct gccttatatt aaacaatcta ttataaagtg    254400
     ggttgaatca tctgagaaaa atcaatattg tgctatagcc attggactgt ctcataaaac    254460
     ggttagtttg gatgaaacca tgtctcctca attgtatgca ggtctacaat tactagtcta    254520
     tgacattgaa aataaattca ctacagtggt tgaaactgag tatatcttaa aaaatttctt    254580
     tgagaatatt tacccttttt atccattcat ggagctttgc agctttaaaa gtaacctgaa    254640
     taaaatatgt gagacgagtg agaacggtag atataaattc aatatcatat caaaaaataa    254700
     cacacaatca gactttgaga cattttgctt gttcaatgtt gtgctagcaa tatcttttag    254760
     gcagctaatg gttgagtcag atgttacttt tctaaaatct aaggatgtag agagtgtcat    254820
     taaaaacctt tattccaatt ctcaaaagct gttaataatg ttagacacat ataaaaatac    254880
     gaatgaatcg agtttctgtt gcgaattgta cgccttccta ttgagctacc ttgagccaaa    254940
     tgcagaattg acatgtctga cgcatgaaaa aataggccga ctaaaaagtt taaatgagat    255000
     tgctctgact ttgggtttgc atcataaccc atcgaaatac acaagatatt tcaacgaatt    255060
     agaacctgac ccaaaaattt tgaagtttag gaggaagttg tggcttggtt taaacacgct    255120
     aaaaatggaa atattaatac caaatggggt ggccaataga cttgacatag actatatgaa    255180
     tgcattcata tcacctgaaa gaagcttggc aaaaatttta caaaatgatt ttcactctat    255240
     tggggaaatt gatgccagca tactacagcg ctatgataat aaatatcaac tgcaattaat    255300
     tttaaatgaa ttggttatta gttgtacacc agttagtaat aatgtccatt tcggggaagt    255360
     tgtacaaaat ctgaaaagag ctaagaattt tttaattgct aatttttcaa taacagactg    255420
     tgaaatgtta gaagaccaaa cactattata caaagtagat cctaacatag aaattaatct    255480
     caagtcgaca aaaaatgtag agttgattat taattatatc aatggctata cgtgcatcat    255540
     gtgtgtttat tttgtcttag ctacgaaatt tgaggaattg agtagacaag actggagaaa    255600
     gtatgaaaag tactatcaca aatttttaat agaggcgatt gaatccaatg tcaaactgga    255660
     taccctagta atgggttatc ttgaaggcaa atatgctaag ttcattgaca ctaagcatag    255720
     atacgtgcta gatagaattg tatcaaattt agtgattaag ttatggactt tgaaaagttg    255780
     ttttttgaca agattttctt acaaacgtta tgtcactgaa cgcttagagc gcaaatatag    255840
     agcagaaaaa atggcatatc ctgaagcaaa tctattgcca gtactcatta gaataatcaa    255900
     tttattaaat gtccaaatgt acagatcagt tgaactactc aggtctaata tatctgcaga    255960
     atattataca cgttcttatt gttctcccat gtttcaatac atcgtcaata taattgagaa    256020
     aggaaaacta gttgaagtgg tgaataagtt ttgggataga actttcgaag ctgcaaatgt    256080
     gccttcatta cttttaaaaa gtgtgaatat gaagtggggc cttgacatga agaatccaca    256140
     aataataaag taccatttaa taagccctga agggctacag tgtatgaata agaaacttct    256200
     agaaggtatt gaaaatgtat taaatgtaca tttagtggat tgtcgtgact gtgaggccat    256260
     atgggattcc aatgaagttg cagatacagc ctccaccgaa agtggaaact ttgatcagtt    256320
     ttttgaaacc aactttgatt tattcttggg tgcttttaac aactccctgg gggattttcc    256380
     aaaaataaca tttgactaaa aaatgctaac aacctctaca aactatatta attaaattat    256440
     actaagtatc tgccaatatt tattttttat aattcaatgt gaatgaattt tatgactact    256500
     ctaaagttgt tgtgcactat agtagttggt aatccatcct gttttaattt tgaataatgc    256560
     actcttttgt gcgtgctcat ctcaaaaggt ctgaaaatca ccaaaatggg aagatgtcaa    256620
     attaatgtga tgagaaaatc aacattgcat cgaataaagg attacatgca gataaagatt    256680
     cagaattaca ttattgtaac gtcccaaact taaatagcaa atattacaga ttgttggcac    256740
     caatgatgaa tactcaatga tgaatttggt taataacttt agtaaactgt ttccaagatg    256800
     tctcacgact gggttatatt tatggtcatt atatgcaatt gtggtttgta tacacgtcat    256860
     tagggcaaga gtggtacttc cattggtttt cacgattgca atggttgctt tgtatactta    256920
     tgcaaagctc atatatgttg gacctggtac gacaaaggag tattcgatat tgagagtata    256980
     tgacttgaac gcagcagaga gtggatttga gttaccacca gaaatgctgg tgaaaagaag    257040
     ttatacacaa aagagaaatg gtagatttag ggtttgtaag agctgtagta gttggaaacc    257100
     ggatagatgc catcactgtt caacttgtaa tgtatgtgtt ctaaaaatgg atcaccattg    257160
     tccgtggttt gcgggatgcg ttggttatag aaatcaaaag ttttttatcc aattcttgat    257220
     atattgtact gtttacagta tattagtgct gatattaagt tctatggaaa tttatacatg    257280
     gtttaaagga gagttctttg aggtagaact cataaacttt actttactat ctctatggtt    257340
     actggctctt gttgtttcga tatctataac aatattcaca gtattcagta ttagtcaagt    257400
     gtgccaaaat cagaccacaa ttgaattata cagtttgagg agatacaacg aagaggtcgc    257460
     atttttaaat gaattttcta atgaaccgat aaagggaaca atcaatatat ttgatcttgg    257520
     gaagaagctg ataaactggg aagaagttat ggggtattct ctcattgagt gggccttgcc    257580
     aatttcacgg agaccttctt cactcgatct tgagggatct catagtcatg gattgttctt    257640
     caatgtcaat aaaaacgtta gtaaaactat gaatgagagt gtagatttgc aggataggtt    257700
     actccgtcga ctgactccga gatcttcgct tgatgtagat agatcaaatt ttgtctaact    257760
     ggttttttta tttctcgcct tcatattata tgcattttct tggcatgatt aaataacatt    257820
     ctttcacaac aattatctta tcagtacagt tttattgggt tgatttctaa atacaacgca    257880
     ataaatgaaa tttgtctatt attatttgat atatctatga agcaataact aatatttaac    257940
     tgatttggct aataatacaa tgataatgaa tgtcttacta ttagaaattt aaagtaagaa    258000
     tgcagagagt aggcctattc cttgaaactt cgcgagttgg aaaggtatgc aataacggga    258060
     gtactttacc aatcatagca ggagagcgat gaagccaatg attatagttg agaactgaat    258120
     agtcaagctt gatgatccgc cttggtagat acttacaaca tgagaagtcg ttgtattgcc    258180
     tggatgtact gttgataacg ttgatgcttg aacagaagtg tatagggaaa ttatggctgg    258240
     tgcagtggag gttgtttcta ctttaccaga cacaatattg ttcgttggtt taggtgagga    258300
     gctggatttc aaagtagaaa ctggctccag aacaccaata tcagttacaa cagcagattt    258360
     agtactcaaa gatttgctag ctgatacttc aacagaatgg gcaacagaat ttgaagattt    258420
     tgaggataat gtgctcacag cttcaagatc accatacacc gatttagatg ccggcttggt    258480
     actatagtat acttgctcag aaacactcag ttctgttgat tttaccttag aggatgtaga    258540
     tgcttttgtg ctagaagtct gctttgtgga ttgaatagtt gaagcagctt ccaagaattc    258600
     gtattcgctc aattgctcag aaatggtgct ttgataaaca cttgcaattg ttgaaagttg    258660
     tgtttcgtta tctgcttttt cgcaagtagg gcacacagtt ttggttactg tttgtttcaa    258720
     ggattgtgtg gttgtagtgt ttgtaaattt ggaagtactg ctagagatag aggaggatgt    258780
     ggctgcgctg gaatagtccg tttgactgct tgaaatagtc gtaattgttg agttgtggta    258840
     cattatagat gatgatgatg atgttgagtt tgtaaattca tccggtctag aagttggcgt    258900
     agcagttgga gttgaggtgg tggtatcatt tctaacaatc ttcgattgta tcatcatctt    258960
     tgagctcgtt gtaccattta gagttgaaac tggaatccat acaccatact cactaacaat    259020
     agctgaaaca gtagaatggt ctagactgta tgttgggata acttcaagtg atttagtaac    259080
     attggatgct gtaccattag tgtatgctgg caatggtgtc atggttgagt tcttagaaac    259140
     atcaggattt ggagtcgaaa cattgatgtg agaaagattg tctaatggag ctgcgtataa    259200
     gtttgtattg atgttaattt ccgatgggtc aacaacatct ctcttagata ggtcatttgc    259260
     tggataacta atattcaggt tgttggaaat agtctttgaa tatagttgag aagaatagta    259320
     agtgattctc acatactctc caccactgaa actagagtta aataggacgt cgattttaga    259380
     gttggtggag tagtcgtgta cagcagtcaa tggcacagtt gccaaaggtt ggttaaattt    259440
     gttcagtttg gtaacaactt tgaaggtggt ctttgaagca tcgaattgat aagcgttggg    259500
     aacagagggc gtagattgaa ttctgatagg tcttttaaac tgagagattg gaatatcaag    259560
     agtaaaccaa gcagtgttgt tagtttggta aatgccacca tttgtgttaa ttttggttgg    259620
     atctgttgct aagtagttga tgttacgaac aaactcgaca ttgtcgccat tggtaaaagt    259680
     gtaagataca gaaccgggac ttcttatttc tgacaaaccc tttgaagaaa gcttacataa    259740
     gaaattgaaa gtggtactaa cattttgcaa aatgttgctg tcaaccaatt gaatgtcaaa    259800
     attgttggag tcgtcggctt tgttaatgga accaattatc ttggagttat aagacaatgg    259860
     aaaatcacca gaaggaaaag aatcaaactc atcaggaact gtgaatggaa tggaattttt    259920
     agcatcttga gggacaaaca cttgaccttg aatcaaaaac caatgactag ggtctgtgct    259980
     gttgtttgag ccggagtgtg tatcgaatac ttgtatatcg gttagaaagc ctttttgcgc    260040
     attggcaaat atagatgtac taatgctcat aaaagtgagc agaaatgtag ttgtaaattt    260100
     cattgtgtta ttgaaatatg atcaatagat gtgtgttgtc tgctttggta gctttgaatt    260160
     ggtaaggttt ggagtgatat ttatttaatt gtaatgtttt ttgttgtgta ttatttgaat    260220
     aggttagata aggcaaactg gaaaagaaag tatttcttat gaccttctga attgagataa    260280
     aatcaggttc tttatatatg actacaataa aataaatctt ttgccaaact tggttaattt    260340
     ctcaatgcca gtatatgctt cagatggtat tcattcctac ttaggaatac cgtaccagtt    260400
     ttctgataac caatgcaaca ttccttgtaa aagcacgggc actttctcga taaatgcaca    260460
     tagctcttac cagcaaattc caaagaaagg tagaaaaaag aggaggtctt aatcagcgat    260520
     ctcgaggacc tgttctcatt aatgggcacg cattaacgaa caccgatatg tattgcaggt    260580
     acagtgtaaa aaaacggtat ttaactacca gtctgaatag ttactgtttg ttaccgtact    260640
     ttaaactatc attgtacgtc gatttctagg gtagatctaa cttcacgcaa caatgctggt    260700
     aaagatttac gctatttgac tcaatttaga gaatgtgaga ccagcagatc tacaaaaaat    260760
     cgggttctga taaatctggc acagcaggtt ctgaggaaat gccctcttcc ttgaaagttt    260820
     agggacacca gaataacact gcataaagga ctgtgcacta ttcgctgtgg actaaactaa    260880
     tttgtgcagg atttgtttgg agcagagcaa ctaacctaga aaatgctgta cataatgatt    260940
     tgtaactttt ttatttttct ctgggagctc ccagaaaaca ttgcacgatt aagtccaaac    261000
     tgaatgtata gaaaaaataa gatggctgga agttgctggc tagtgataat tgagaatctt    261060
     aaaatcattg ctgggttact gatttcgatg ggtttttttg caagccagat atctatcaat    261120
     acaagaagaa ctaatttgta ggcggtgtta tgttctcctt caaacctctt cgccatttaa    261180
     attgtctatt cttgaatggc tgactcttag catgtattct ggtcgagtga attggtatga    261240
     atgaatacgt tctggtgaaa agtctggtgc gtaatttctg ttgaatcaat tgagtttgtt    261300
     gagccacaag cgtaattggt agttagtagg agataaaatt caggaggctg tgcttggcct    261360
     tgtctattag cagaagcaat tttacttgta gaaatgctgt cgataccatc agcagtatga    261420
     caggtcaacc ttgttcagca taggcctatt attgccctga accaaaaatc aacggctgga    261480
     tcatcaaaat gtgtagatat atggaagata aaaagacgac attgattttg tgggtagaat    261540
     tacaatattg agagaggagt ctagattgga taagtctata agcgtttctt gttcaaatct    261600
     tgcagttgta tatgcctgtt catctttcta ggtatattac acaattacaa atagcagaat    261660
     aagtagtctt tatgtctagt cgagctggta caacaacttt tcttttggat agtggccata    261720
     tgtcataatt ccttcttcga atacctaaaa aagtttaatt ttcggataat tatgaaggat    261780
     ccgaagctag ttgacaaaaa gctcgaacca atcattattc atctgtatag ttgaccacca    261840
     atatccggtt ttagtaggca ctaataaaaa agaacttaag attacatgta taagtgatta    261900
     ttattcattt gcccagctca taacatttga attgtgcata caaaggaatc gaggattgag    261960
     gatactacat accgagagta gtgttgtttg atggttctcc cgataataat tggagttggt    262020
     gtaacgctgg tagcatggac cacccaatcg gctctccgag cttggcagat ctatagaact    262080
     cttactccag gcatgatagc agctatgaat gggatcaaac taacaaattt tcgctcgaaa    262140
     tacgcatcaa aatttcacag tgacaggtta aacccggggc tgaaaatgca actaaacaaa    262200
     tgggaaggag gattttatca tccaatgtca gaatcagagg ctttaatgat actaaatatt    262260
     actcaaaaag aaattatgag tttgaatgct ccattactaa agaaaaagca taggctagca    262320
     atgcttaaaa atcacccaga taaaggtgga agtccatatt tatcagcaaa aatcaatgaa    262380
     gcaaaggaat tattagaaaa aagtgtacta actaggaaat aatcaacggt agatcgtctg    262440
     catgaatggg tcgcatgccg gtattctact attagaataa ttgcacaaag tttcatattt    262500
     tctagaaggc aactagcctt acaaaggtaa cgaaaaggct atgtcatgaa tttagagctc    262560
     ttgattcttt ttttcatagc attacaaatt ggtaaaggta tatgtaaacc gtccaaggat    262620
     atgcaaaaga aatactcata cacaacaacc ttcaagacac tattcaatgt agtaatgtta    262680
     aatatttttt aattgaaact atgattgtat tttgagtgga actaattctt tattcgagtt    262740
     catcggtttc gttaatggat aatgttttaa ttgttagtta tcttacctta actcgccatc    262800
     actaaatacg ttgtgtggtg catcgattaa tgtttgagtc ggcatatcat ttttaactcc    262860
     gaatgtttgt tcaaaggatg gaccagtggt ttctgaatca tctcggcact ataagattga    262920
     agtatgtatt ttatgtaata ggtttcgtta atataacgaa cagattcttg aaaatattta    262980
     tctgatagtt agcctttatc agtaagtgca gtgcaagcca gagttgatat tcctgggtga    263040
     gaccaatata ggtcaagact ttatgatgat tacagcggat ctaatatggg atgagaatct    263100
     tgataatgat tgtgaagtgt caaaagacat atgggaagac gatacattca tagataagag    263160
     ttatttgaaa gttgtattgc ctagctatga tggggttgat actccgatag tatatcattt    263220
     taagttgaat gatgatttga aaataaattc aatcaagata cccacaaatt ccatcggtaa    263280
     ccttggtaag ttcggtcgat tgaatacttg ttccttagaa gctgtatcag gagaaccacc    263340
     tgttcttaaa gagattatta ttaagattga tgaaagattg tatgacaaac tagcacttct    263400
     acctaaagct aatgaaaaaa aacaatactt tcaaattaag tataatctgg tgaacaagca    263460
     gtctgtgata cacgaaggta atatatgggg gcatgtttgt gaagtagtgg agactaaacc    263520
     atttagtcaa ggtgttatcg attttagtgt tactgacatt gtattaatta ggagtaaaat    263580
     actgtcagta gaaaataaac atgatagaag tttagttaat ttacaagcat ttcacgattt    263640
     atcaaggata cctttaaagt gtcttcatta ccctgttgaa cgctctcttc ttcttcctga    263700
     acctcctttt gatgatgatg actctattta tgtatttttt ccttttgact tgttatcaaa    263760
     attgaaaata tcaagcggct cgtttgtacg tctatcaaac tctaaaaatt ctgtattagt    263820
     acgagccttc cttttacagt cccctaatca ttatgctgtt gatggcatat atacaacacc    263880
     atttgtgttg gcccaatttg atgaattacc acttgttgaa gttgaaccag tatataataa    263940
     tgaattagcc tttcccacag catcagaggt agtcatctca aaagttggaa atgtattgca    264000
     cacacaaaag agatatcagg agcttatttt acaaaagctt agatattact ttttaacagc    264060
     aagaagaata ctcagtaatg gtagtttaat accaatcact attgattcat catttgatga    264120
     aataatctta gaagatatcg atttggatgt caacactata aaatcagatg atgattgtat    264180
     tgtttggttt gttgtaagta acagaaaatt tgagaacatt tcaaactatg atccgaaagc    264240
     tgaatttttt gttgatccga aacatacaaa attaattacg tcagcgatgg agaatagaag    264300
     tttaagctca aacactttta attctgcttt gaaatactat ggtcttccag gtgtatttca    264360
     ctaccgtcct gatatatttc ctgttgtgaa tgatattaaa aatgtaatca atacacatgc    264420
     ggaagctaat aaaaaagtac ctaatctgcc aatgatatta aacctatctt caaatgtgcc    264480
     aaaagtgggt aaagcaagta tcctaagaag catagctatc gatctttcat atcagtttgt    264540
     tgatattgat actttatcag tagtattttc gtcagggtca tcagatattg ctacaacttt    264600
     tttgggatat cttaaaggca aactcgaaaa tctgctaccc ttcactggaa atacgattat    264660
     actaatcaaa catattgatc acatattgaa aaaagttgat caaaatcagg atatacaaca    264720
     atccagacaa gttaaagcac tagaaggtga cctaatatct ttcattaaat cttactcaag    264780
     gatatatcca ggtgttgtat ttgcgtttac atcagctagt attgataacc tacctgaggg    264840
     cttccgatca gaaattaagt tcgattatgt tgttcatccg cccaatgaaa aacagcggcg    264900
     aagtataatt gatgagcttt tgtcaacatc agatctcttt caaaagtatg gtaacaggaa    264960
     attacgtatt cagtgttcta atgagataga aatttctaca ttatctttgc attcggcggg    265020
     gttgtcgccc tatgatatac aatatattat tagtttggct gtggcagatt cgttgagaaa    265080
     atgtaacaac tatctgttgt ggagacaaaa taaaataaag gtggatatga tatctataca    265140
     aaatgcacta gaaaaggtga gaagtgatta ttccgcttca attggtgcac caagtatacc    265200
     gaatgtaacc tgggatgatg ttggtgggtt gagttctgtc aaggatgcta taatggaaac    265260
     gattgactta ccattgaaac atccagaatt atttgggtca ggtctgaaga aacgaagtgg    265320
     tattttattt tatggtccac caggaaccgg taaaacactt cttgcaaaag caattgcaac    265380
     aaatttctcg ctgaattttt ttagtgtgaa aggtccagag ctgttaaata tgtacatagg    265440
     tgaatctgaa gcaaatgtga gaagagtatt ccagaaggcg agagatgcca aaccgtgtgt    265500
     aatattcttt gatgaagttg actctgttgc accaaaaagg ggaaaccaag gagattccgg    265560
     gggtgttatg gatagaatag tctctcaact attagcagaa ttggacggaa tgagctctga    265620
     cggtgatggt gtttttatta taggtgcaac gaataggcct gatttattgg atgaagcact    265680
     tttaaggccg ggtcgttttg ataaactaat ctatttaggt attgcagata ccagagaaaa    265740
     gcaggctaat ataatgaggg ctttgacaag aaaattcaaa gtgagctctg acattaactt    265800
     tgatgaactt gtgtctgatt ttccatttag ttatacaggt gccgactttt atgctctttg    265860
     ctcagatgca atgttgaagg ccatgactag aatatcgaag gaaattgatg agaaagttga    265920
     caaatataat caagacaatg gtactagtat atcaatacga tactggtttg accatgtatg    265980
     ctctgatgaa gatactgatg ttatagttaa gaaggaagat tttttaaatg ctaataaaga    266040
     gctgatacca agtgtttccc agcaagagtt ggaacattat aaacaaatca gggctaattt    266100
     tgaggatagt aagtagtttt ttttactaca tcagatattt catacaacac ttgtataaag    266160
     caacaaaaga aatagctcat attcataaag aagatatgtt gaaagatatc atatatccaa    266220
     caagataaaa attcattgtt ggttttgtag tgccaaaact tgtaatgtat tgtttttatt    266280
     tattcggtta cgaaatgaat gacaagtgaa tacaatgcta ctatgatcgt agctcaaaaa    266340
     attgaggtca ctaaagataa tggaatcaag ttaagcgagt ttacctacag tatacgaaat    266400
     ggcatgggat atgcatcata atatgtctat attgttgaaa tttgaacttg atcaacaaat    266460
     taatgtttta ttaaaagata tatgtatatt atatgttatt ggttacattt ctatatgtga    266520
     aagtagcgct ctcttactaa atgtgaaggt tactataatg cacattgata gagtaaaatt    266580
     agaatgcaat atctgttaca gtagttgaaa aatgcaatgc agtagtggag ttttcgttaa    266640
     ttatttggat acccatttct ttgtatctct gtaagaatcg tgagtgtcct tgtatagttg    266700
     tctttcaaat tcgtccagtt tgagtaagaa tctagtagaa gctgccaagt tagtagcctg    266760
     gctagtacca acagatgaac caattcctga attgttggca gatctagttg ttaaagaaga    266820
     agtaccgtta atggacgcca ggggtcctga tctatcctcg tttgcactat tctgctgaag    266880
     tcttaatgca tcaagcaagg cacttctgta tttgttcccg tactcggtat ctatcgacac    266940
     actgctggca tagttgttta tctgctgtgc tctttcaagc agcagctcat acactatttc    267000
     acctaggtct ttgtcactat agagcgctat ccatttaaga gccatgtcca agaagtaagg    267060
     gtttatcgcg tgtaaatcca gcgacttggg atctgtctta atcgcattta ttactttgtt    267120
     cgagaacata tcaggcgtaa gcagctctac gaaggcatca ccgccatcct cttcctctgc    267180
     attagggtcc atgtcctcct gttcctggct atccgcacct acaatggcca acacccgcgc    267240
     caaccacagt ggcaaagaaa gctttgtatt cttccgtatc ggtttccctg ggttattctc    267300
     caagtaccct agccccggaa tctcatagtt aaacttacaa ggaacttcag tagagtccac    267360
     tagtatgtca tctatatcat agtagcccat cagtcgactg tctgtcgtac ttagtccccg    267420
     tatgtatttc gatacaatcc cgttgaaata gaaatgtatt gccgccactg gcacgattcg    267480
     cagttactac tgtataaccg aaatgaaact ataagagtgt ggatgacgcg tcagccgtta    267540
     tacttatcag aattaaaatg aacgcgtaaa agtccgtaca ccactatatt acacatgtag    267600
     tttccgtgca cagctatgac atattagccc ttaattgaag tcgaagggtg aacaggcttt    267660
     catataacga ataaaatagt actctctgaa gtaaatacaa tgaggacaga gctgctttgt    267720
     ggtggtacta caacgtataa gtcataatcg atggattttg tcttgtttat ttgtggccct    267780
     caaaccgcca tcgaagtgtg agcgttctcg gtgtttgttc catccgtccg gtccccgatg    267840
     actcgtagat gaagtgctca tcattctcca ggcctcttgt atatcaatga gaacctcacc    267900
     tattgctgtc aaagcaaaaa aagatgagca tccctttctc ttgaaatgtg tgatcttttg    267960
     ggtttgtaga aaggtacagt gtttgtggct tttaggatta aaccccgaat acccagatgt    268020
     cctgttctaa agaatgggca cacgactctc cacctctaat tctctttgac gttggagtaa    268080
     tgtgatgagg ggacttgaca aggaacttgt gtatgtttag gaggaatata tattgtgtaa    268140
     cagattcttg gaaagtccga cttttcccac ctcgtcttgc taccgaagca gcttgtctgt    268200
     ctcactcttt ctcgccttca tttaggaaat ctaaaaagtg aaggacaacc tattacaata    268260
     caaataagca atatcctggg actacaggta taaaagagtt catcatcgag gaaaaacgag    268320
     gataagatgg tttgcgacac gttggtttac caccctacga ttactaggtt aatcaagttt    268380
     ttggatacca ccgcaggcag ggagaaagca ctgcgtttat tacagtatct atgcaggttt    268440
     ttggctgtgc agcagagttc cgcgttggcg aagggcctgc aggtgcagtt caccatggtt    268500
     cgtaagattt tgcgtttctt gaagccattg aaccacttgc aagctgcctc gaagttttac    268560
     gataacaagc tcaatggtga tgatattcta cgtgtcggta atgtcataaa gaaccttgcc    268620
     tacgccgggt acttgacttt tgatcaaata aacttgttgc ggatcttgaa gcttgtgcca    268680
     gtgactcagt tcaccggcaa gaaagtgcca aagctggcta attggttctg gttcgtcggt    268740
     ttgatatcgg ggctggtaat ggatgtccgt aatatacaca catctcaaac taagattttg    268800
     accattgcat ctaaggctag tagtgtttct ccagatggct cagatgtcga aaagccatct    268860
     gatgctcaat tcgccgaaga aaccaaggcc gcatacgtca cagcatgtaa gcaaagatac    268920
     gctgcgatta gaagattagt ctgggactcg ttcgatacct ttattgtgtt gaacaacttg    268980
     ggctacttgt ccagcagtga ggattctatt ggtctggccg gtgttgtcac ctctctacta    269040
     ggcttagagg acttatggaa aggtacgaaa taaggatagg gaacattatg gacaatataa    269100
     tttggttgta tatatgtaaa tggcttcgag ctcaacattt cttcttaatt tgtataaatt    269160
     gatttagttc cttggtttag cagttatgat gaaactcaaa caacaataat tgcttaatgc    269220
     gcaaaataat attcaacaaa taaaatgaac aatatttcta gatattgccg tcgcaatcat    269280
     atataaacaa tcaatgccat aaatcgtact ggtgccaaat agtgggttat gtaatttttg    269340
     tagtatatgt tttggttgac tttgttaacc atggaatggt tttgagaaag ataactacga    269400
     caggaaagcg tagacaataa caacactgag cagagcatgg aactgagtta acattacaat    269460
     aaaatcagca tataaaagtt gcagtggttc ctctaatgac atagtgaatt ccaagtgata    269520
     aataatgaga ctaattattt gctgttaatt agggatatat cacgacaatt gaggatcaaa    269580
     aacacaaaat agaatactac tacttagatt aaagatgtac ttactataca aatagtacac    269640
     acactaaagc tacgcttcaa taattagtaa aactagtaaa ataaaacaaa gtgaaagtac    269700
     atacataata gtacatgaca tgcaaatatt aatcctggag tagaaagtgt cgatagagca    269760
     gaagtgaatt gatctatatt aaccttgcat ttctcttgag ttgaaaacag ctgaagatgg    269820
     cattgattcg aacgatttgt gaaagcgact agaaagaatg gtttttattt cagttatatc    269880
     aaatatgtgt cttattaatc caaaaaatac tctaaaataa ttattgagtt tttgacttat    269940
     tatagattat gcggcataaa tttattaaat atctatcgag aaaattggac atgcattata    270000
     atcgggatgg agagataaaa tttttgaata acactgagtt ctcctcgatc atagtgctca    270060
     tcatgaaata gcttattaat agtttacaaa tatgagagta agtgtggact actattccag    270120
     atgctccgat cggtttgtca cactgtataa acaatccaaa tcagtgtgta aatacttatg    270180
     aaagttattt aggtctacta gtgtattagt tcaaatttta attgcactgc tttagtgcag    270240
     cttgggtttg agtatataca ttcgaagttt acctaaacac aatatataat attattattc    270300
     tttattccat cgggtgctct gtaatcctca tgaaataaaa tatactatat cagccagaaa    270360
     acatagttgg ttcgatagct ttatattcac ataatagcca aattatgact atttaaccta    270420
     tgtgtccaca atttgaaact cactgaatat ggtttactat gtagatttga caatcatttc    270480
     atgattaaca tatccacttc tacacagttg gaatactaca atattaatct tgcccaacat    270540
     ctggctttat atttgatcct aaatttgaaa gactagtttt aattttgcta tgttgactgg    270600
     tttttctcta tatgtaacat acacggttaa tttaaccttg aaaatttaac caaataatta    270660
     taatgttgta gctgttataa gaatacatta gttttggaaa gtgtgctcct attaagtcaa    270720
     atggttatta agttatatgc ttggtaaaaa aaaataataa tagggtagta cttaaaaggc    270780
     aatcaatgag tgcagcagtt ttttagcggc atttttgtta ttactcgata gctcttttgt    270840
     tttggttttt tgaattcata ttcgatatac ctattactgg aatatggtac aaatctgata    270900
     aggctctcct caagataata cctttgaaac aaggcatccg taattgttga ttattttagc    270960
     ccacttttct aacacaggac tgaatactat cataaatcat ccagattctc tgaaagaatt    271020
     ctggcattta gagttactag taattatttt tatattatct ttgatactaa tctgcgaagc    271080
     gaatttacca tttatccttt attgaagtac aacgacggaa gcataacaag gaatatattg    271140
     tagtttcaaa ttaatggaat tctaatatca atagcggaaa ttaacaattt tattattttc    271200
     agtagttcta cgaatttgat gacatgtatt aacctatttg aactcttcac accaaaatta    271260
     ataaccgtat ttgtaagcag ctacccaaat tatacaaaat acagtcggtt ccataacatt    271320
     gcccttttat ttgtaattaa tacaaactaa acacaccaaa ctaattcgta gcaatatcat    271380
     acatacgata agaagtaaag agccagtagc aatgtaatat tggttgctta aagaatttgc    271440
     tatcattcga aaaagttggc cttaaagcac tagactactg taaaagagat aaggatatat    271500
     gttaatatat ccagcctgaa taccgtgagg ccattaaata agtcacgaaa atctatgtta    271560
     atggtgtaac atataatact aatatcggta tttatttgaa gaccggcact ttcttaatta    271620
     aacaactgtc cctttaagaa tcgaaataca ggagtttgag acaaattata gctaattaat    271680
     tatctggact tgcaaattct tgattctaga ctacttttct ccattcaaca tattctaaga    271740
     aagatatgtt tgagagccta ataactgctt agcataatac tagaaagata taaccatgta    271800
     ttgcaatttt ctttgatact gccgccaatt tacagtagaa tatccggttt gtgattcaaa    271860
     atctttgatt ttatttattc gctttctgga agagattcaa aatagtcctg cactggtcgt    271920
     gtgatggttt aatcatcttc aagtttgtgt agtagccatt tatatcttga agtgtaaaaa    271980
     gataaacact tagtcaagtt tcactgaata acagtgcgat ataattaatt agtgtgctgg    272040
     acattactgc taggagtgat cctgtggctg ccatcttgcc ctttatgttg attcgtggtg    272100
     tctacattgg tagtgtgaga gctgataagg agacagcgag aaggtgagaa gcagaagatg    272160
     catgtgcaga tagtttagag ttgctgtagc atatattgcc aacactcaca gtagacaaca    272220
     aaggatagcg ttgacctctc ttctcaaatt agaaaggact gcaggtctgg caagaaggca    272280
     tgcccaacgc catgctccta ctactggcta gtaagacgga acaggcatac ggcactaaac    272340
     ctaaggaatt gtttgggctt gccactttta ttgttgttcc tggatgcccc acctaaccca    272400
     cttaaacatg gtgggggtga gagtccaagc gagtttgcaa ttgcctacta gaaggggttt    272460
     tcccagatgc taagaagata aaattagacg aggggaagga cagcttctac acttgttgga    272520
     ttaagaagtt ccacttgatg taagaaggcc cacgtaagga tcttattgta agctctcttg    272580
     agaaaggact gtacccaatt gatccacgct gaaagaggcc ttgaagtggg gagggttgca    272640
     aacaaattac tactgattta tccggtacgt ttttctgaga ccccttcatg tatttctgct    272700
     ttcaagagaa acggtgtagt ttagctgggc ttattgtgct gtaaattttt ccgagatttg    272760
     ggcacagagt agcgaaaggc gcaaaatgta gtgccggaag acaatgtgcc ccacttttgc    272820
     gtctctcttg gatttatgtg gagtttttcc ggattcttga tgcatactgg gggagggcta    272880
     taaggtgagc agcagagaaa tgggtagaac caagttgcag taaatggtcg tagctaggtg    272940
     gttcagatgg tttttccgag tgattgacgt aaaaatttgg ctcccattcc aatttagggt    273000
     gcccacatac aacttactgt cttccctttt ttcgtcttag agttgttcct ctaactagca    273060
     ctgcagggcc aatctgggaa aaaaggaaaa agggcactga aaattagcct ttcctggact    273120
     gcaacgtaat actaccaaat aacgagggtc cccagggctc cccacctgag tcaaacagga    273180
     aataggtatt agaacatgag tgaaatgaag gcctacagag agctggagag ggaggggaga    273240
     ggaggataat agctatttga gggtagtaag tgaggaggag ttttcattct gtatggcaac    273300
     gaataacacg cacaagagca accaagaact gaatgcacac aatgatgttg ttgggtacta    273360
     gtccatggac agtaaaagac ggcagccatg agaacaatac agactcattt cgaggaagtc    273420
     aaaaacttta tctcagttgc taaatttttg tgctagtact attgcctacc aatactgata    273480
     atcatagcgt agattgcttc tttgtgcccc tcagtagtac tctaagctgg atgtgttatt    273540
     gggtacttgg aactctgcat tgttctctgc caggaaagta ttcttttcaa tttacatgtc    273600
     aaactgttaa atgacgtaga ccacatttta gaggggacgt ttgtgggacc ctgacaaact    273660
     ttttggaact ccagaaaatc cacacatttt ccgcagagag ccaaggcaaa gaattaattt    273720
     cttatgtgca aagtccagta aaatgataac gaagggctct gatccatgca ttgagaatat    273780
     aataaaaata gcatttacaa tatcaagtgt gtggggccgg tgcacaaatt aatcgcgggg    273840
     taataagaac gttcaaacaa tcgccaatct ctacgagcaa ttagttagtt tcctttcttg    273900
     aactagttta ccaccttgta tatcccaaaa gagggttgct gttctaagac aaactacaaa    273960
     ccaatttgca aatgtagtgt agacgcaagc agaattgatg tgaattctat acttgtcaaa    274020
     taatgtgggg atgcagtaac agaacaagaa tatttagcaa tagcttcaaa aaaaaaaagt    274080
     atataaggac ctcaaagttc ttattgagag agtttcaatt tcctattctt atttctcatt    274140
     attgtttctt aacttataaa taaaacatca acaataatct ctagtgagaa taaccaaata    274200
     aaaaatcaat atattttcac tattactatt cctttattgt gataataata gtgacccaca    274260
     cctactaact gaatttattt aagaatgtca caagctcaaa gtttgtcacc ttctgaaagc    274320
     gccgaaaact ccccagtcag ggaagtcaat gttgctaaca gcttcaaaga tgatgacttc    274380
     attttggagc agaagcaaac cgctgatgtt tctgcgatgt ccccagaagc agaagcacca    274440
     cctaaaccaa tctcagccta ctttactgtg atctgtctat gtttgatgat cgcattcggt    274500
     ggttttgtct ttggctggga tactggtact atttctggtt ttgttgctca gaccgatttc    274560
     aagagaagat ttggacaaca agctgctgat ggttcttact acttatctga tgtgagaact    274620
     ggtttgattg ttgctatttt caatattggt tgtgccattg gtggtttgac cttgggtcgt    274680
     cttggtgata tgtatggtcg tcgtcttggt ttgatggctg ttattactgt ctacgttgtt    274740
     ggtattgtaa ttcaaatctc ttctaccact acctggtacc aatattttgt tggtagaatt    274800
     gtctccggtc ttggtgttgg tggtattgct gtgctatccc caaccttaat ttctgaaact    274860
     gctccaaagc atttgagagg tacttgtgtg tcattctacc agttgatgat tactttgggt    274920
     atcttcttgg gttactgtac aaactatggt accaagactc acaccaattc tattcaatgg    274980
     agagttcctc taggtctatg ttttgcctgg gctttgttca tgcttgttgg tatgtccatg    275040
     gttcctgaat caccaagatt cttggttgag aagggtagat ttgaagaggc cagacgctct    275100
     cttgcccgtt ctaacaaggt ttccatggat gacccaattg tcacagctga aattgaaaac    275160
     atcagcgctg gtgttgaagc tgagaaatct gcaggtaatg cctcttgggg tgaattgttt    275220
     tccaccaagg gtaagatctt gcaacgtgtt gtcatgggta tcatgatcca atctttgcaa    275280
     caattgactg gttgtaacta cttcttctac tacggtacta ctattttcaa ggctgttggt    275340
     ttagaagatt ctttccaaac ttctattatc ttgggtattg tcaactttgc ttccaccttt    275400
     gtcgctttgt atgttgttga ccgctttggt cgccgtaagt gtttgctatg gggttcctct    275460
     acaatggctg tctgcatggt catctttgct tcagttggtg tcaagagtct atatcctaac    275520
     ggtaaggacc aaccatcctc cactactgct ggtaacgtta tgattgtttt cacctgtcta    275580
     tacatcttct gttttgcaac tacttgggct ccaactgctt acgttattgt tgccgaaacc    275640
     tacccactac gtgttaaaaa ccgtgctatg gccattgctg ttggtttcaa ctggatctgg    275700
     ggtttcttga ttggtttctt cacaccattt attactactg ccattaactt ctactacggt    275760
     tacgtcttca tgggctgtct agtcttctcc ttcttctacg tcttcttctt tgtttgcgaa    275820
     actaaaggtt tgactttgga agaagtcaat gaaatgtacg aagaaggcgt cttgccatgg    275880
     aagtccgctc aatggctacc aactaccaag agaaccagtg gctacgatgt ggacgctgct    275940
     ttgcacgatg acaagccatg gtacaagaga tttgcttaga gtcttgaatt tctttctgga    276000
     tagctgagcc atccaacatt aatcctaaca aaaaataaga actctttatt ttacaactct    276060
     attttctctc tttgtttcac cgtctttggc gccatcgtgc atgcatctcc atgtacagaa    276120
     ctatatgatc ttttgaacgc aggcgtcgaa ggatattctc tgtgctcttt cttattaata    276180
     ttattttctt tctgtacttt tgagctacat atatactctc tacgagtgag ataaaaaatc    276240
     tttatatact atattctaat gattttatga aataaattcc aattttgcta attgctattc    276300
     ctcaattctt tcataatttt aatttaaaag gaaaatcaaa tccagtcctt tgctattttc    276360
     agagattgct tactagttct ttgtgacttg tactttagga tatgtactaa ttgacttaag    276420
     aattgtatga gttacttacg ataaaatatt attaagtatt atctttatat ttttttctat    276480
     aaatgtgctc gttgttttta ttgcaaagga aattatggta aaattaaaac agatgctatc    276540
     caaaaggaat gccattacca gatgttgata tttttcttga ccaattaaat cttttggtaa    276600
     tattttattg agtatttagc tacagattgc aactacggaa atatgtgatc agataaaaat    276660
     gaaatgaaaa ataaatgcct tagataagca atcaaatgac tcacaacttt ttaacaggtc    276720
     tgaattgttt gactaaaaat tgatttcggt taaaatcata tttttgtgcc ccttaaatca    276780
     tattatttta gatagtaata tttttgaaat gttcattcct ttaatctttg gtgatgaata    276840
     ttaacttaat acaagcaatt aggctatgtt tcttttgttt taggtctttc gtaatattta    276900
     ctcataatgc caatataatt attctcagga gaatatcttg ttaatttctc ttatgtgaca    276960
     gactctcaca aaagaaaaaa aaataagaat ttttgttcga atgcatatga ataccacttt    277020
     aaatatttta ctttcaaaat ttttgaggct gcacagcatt attcttatct taatcttgct    277080
     tttatgaatt ttataatgat tgatattgga ttcaagagaa ctcatagcac aggtatataa    277140
     actcttcttt tcataccact ttataaatat tacattacca tacaaaattt actaagagta    277200
     gtaagtatga taattattca atattgtata gtcttttgta tattaatata cctattctca    277260
     aaactctcaa aatagtacat gaatagttat aattactgac taaagaattc gaagtatttg    277320
     tgagatatac atatggtcaa catcaaagaa agaatatata ttaagtatga atagtaatat    277380
     atccctattt aaaatttgtt aagaatttat agaaaatatc gtgacaggtt tggtggatgt    277440
     aatgatagta tcacatgctc atttcatact gtgacaatac acaattcata tatctcgaaa    277500
     gaattaacta cacagtaaca ttatctaaaa tggaccacat tcatttactt taacggaaca    277560
     aaattcgtga acattcatat tttatatttt cagatattga aactttaaaa tatgctaaaa    277620
     gaaattctat gttccattgc aatgtagcgc gaaattcaat attataaatt caaaatgtgg    277680
     taagctgcat tagaaaaaaa ataagtcaat tcttagaaag ttttaatcat ctctagtaag    277740
     tatgaaaatc tatgtttaaa attatgaaag aattgaggaa tagcaattag caaaattgga    277800
     atttatttca taaaatcatt agaatatagt atataaagat tttttatctc actcgtagag    277860
     agtatatatg tagctcaaaa gtacagaaag aaaataatat taataagaaa gagcacagag    277920
     aatatccttc gacgcctgcg ttcaaaagat catatagttc tgtacatgga gatgcatgca    277980
     cgatggcgcc aaagacggtg aaacaaagag agaaaataga gttgtaaaat aaagagttct    278040
     tattttttgt taggattaat gttggatggc tcagctatcc agaaagaaat tcaagactct    278100
     aagcaaatct cttgtaccat ggcttgtcat cgtgcaaagc agcgtccaca tcgtagccac    278160
     tggttctctt ggtagttggt agccattgag cggacttcca tggcaagacg ccttcttcgt    278220
     acatttcatt gacttcttcc aaagtcaaac ctttagtttc gcaaacaaag aagaagacgt    278280
     agaagaagga gaagactaga cagcccatga agacgtaacc gtagtagaag ttaatggcag    278340
     tagtaataaa tggtgtgaag aaaccaatca agaaacccca gatccagttg aaaccaacag    278400
     caatggccat agcacggttt ttaacacgta gtgggtaggt ttcggcaaca ataacgtaag    278460
     cagttggagc ccaagtagtt gcaaaacaga agatgtatag acaggtgaaa acaatcataa    278520
     cgttaccagc agtagtggag gatggttggt ccttaccgtt aggatataga ctcttgacac    278580
     caactgaagc aaagatgacc atgcagacag ccattgtaga ggaaccccat agcaaacact    278640
     tacggcgacc aaagcggtca acaacataca aagcgacaaa ggtggaagca aagttgacaa    278700
     tacccaagat aatagaagtt tggaaagaat cttctaaacc aacagccttg aaaatagtag    278760
     taccgtagta gaagaagtag ttacaaccag tcaattgttg caaagattgg atcatgatac    278820
     ccatgacaac acgttgcaag atcttaccct tggtggaaaa caattcaccc caagaggcat    278880
     tacctgcaga tttctcagct tcaacaccag cgctgatgtt ttcaatttca gctgtgacaa    278940
     ttgggtcatc catggaaacc ttgttagaac gggcaagaga gcgtctggcc tcttcaaatc    279000
     tacccttctc aaccaagaat cttggtgatt caggaaccat ggacatacca acaagcatga    279060
     acaaagccca ggcaaaacat agacctagag gaactctcca ttgaatagaa ttggtgtgag    279120
     tcttggtacc atagtttgta cagtaaccca agaagatacc caaagtaatc atcaactggt    279180
     agaatgacac acaagtacct ctcaaatgct ttggagcagt ttcagaaatt aaggttgggg    279240
     atagcacagc aataccacca acaccaagac cggagacaat tctaccaaca aaatattggt    279300
     accaggtagt ggtagaagag atttgaatta caataccaac aacgtagaca gtaataacag    279360
     ccatcaaacc aagacgacga ccatacatat caccaagacg acccaaggtc aaaccaccaa    279420
     tggcacaacc aatattgaaa atagcaacaa tcaaaccagt tctcacatca gataagtagt    279480
     aagaaccatc agcagcttgt tgtccaaatc ttctcttgaa atcggtctga gcaacaaaac    279540
     cagaaatagt accagtatcc cagccaaaga caaaaccacc gaatgcgatc atcaaacata    279600
     gacagatcac agtaaagtag gctgagattg gtttaggtgg tgcttctgct tctggggaca    279660
     tcgcagaaac atcagcggtt tgcttctgct ccaaaatgaa gtcatcatct ttgaagctgt    279720
     tagcaacatt gacttccctg actggggagt tttcggcgct ttcagaaggt gacaaacttt    279780
     gagcttgtga cattcttaaa taaattcagt tagtaggtgt gggtcactat tattatcaca    279840
     ataaaggaat agtaatagtg aaaatatatt gattttttat ttggttattc tcactagaga    279900
     ttattgttga tgttttattt ataagttaag aaacaataat gagaaataag aataggaaat    279960
     tgaaactctc tcaataagaa ctttgaggtc cttatatact tttttttttt gaagctattg    280020
     ctaaatattc ttgttctgtt actgcatccc cacattattt gacaagtata gaattcacat    280080
     caattctgct tgcgtctaca ctacatttgc aaattggttt gtagtttgtc ttagaacagc    280140
     aaccctcttt tgggatatac aaggtggtaa actagttcaa gaaaggaaac taactaattg    280200
     ctcgtagaga ttggcgattg tttgaacgtt cttattaccc cgcgattaat ttgtgcaccg    280260
     gccccacaca cttgatattg taaatgctat ttttattata ttctcaatgc atggatcaga    280320
     gcccttcgtt atcattttac tggactttgc acataagaaa ttaattcttt gccttggctc    280380
     tctgcggaaa atgtgtggat tttctggagt tccaaaaagt ttgtcagggt cccacaaacg    280440
     tcccctctaa aatgtggtct acgtcattta acagtttgac atgtaaattg aaaagaatac    280500
     tttcctggca gagaacaatg cagagttcca agtacccaat aacacatcca gcttagagta    280560
     ctactgaggg gcacaaagaa gcaatctacg ctatgattat cagtattggt aggcaatagt    280620
     actagcacaa aaatttagca actgagataa agtttttgac ttcctcgaaa tgagtctgta    280680
     ttgttctcat ggctgccgtc ttttactgtc catggactag tacccaacaa catcattgtg    280740
     tgcattcagt tcttggttgc tcttgtgcgt gttattcgtt gccatacaga atgaaaactc    280800
     ctcctcactt actaccctca aatagctatt atcctcctct cccctccctc tccagctctc    280860
     tgtaggcctt catttcactc atgttctaat acctatttcc tgtttgactc aggtggggag    280920
     ccctggggac cctcgttatt tggtagtatt acgttgcagt ccaggaaagg ctaattttca    280980
     gtgccctttt tccttttttt cccagattgg ccctgcagtg ctagttagag gaacaacttt    281040
     aagacgaaaa aagggaagac agtaagttgt atgtgggcac cctaaattgg aatgggagaa    281100
     acaaattttt acgtcaatca ctcggaaaaa ccatctgaac cgcctagcta cgaccattta    281160
     ctgcaacttg gttctaccca tttctctgct gctcacctta tagccctccc ccagtatgca    281220
     tcaagaatcc ggaaaaactc cacataaatc caagagagac gcaaaagtgg ggcacattgt    281280
     cttccggcac tacattttgc gcctttcgct actctgtgcc caaatctcgg aaaaatttac    281340
     agcacaataa gcccagctaa actacaccgt ttctcttgaa agcagaaata catgaagggg    281400
     tctcagaaaa acgtaccgga taaatcagta gtaatttgtt tgcaaccctc cccacttcaa    281460
     ggcctctttc agcgtggatc aattgggtac agtcctttct caagagagct tacaataaga    281520
     tccttacgtg ggccttctta catcaagtgg aacttcttaa tccaacaagt gtagaagctg    281580
     tccttcccct cgtctaattt tatcttctta gcatctggga aaaccccttc tagtaggcaa    281640
     ttgcaaactc gcttggactc tcacccccac catgtttaag tgggttaggt ggggcatcca    281700
     ggaacaacaa taaaagtggc aagcccaaac aattccttag gtttagtgcc gtatgcctgt    281760
     tccgtcttac cagccagtag taggagcatg gcgttgggca tgccttcttg ccagacctgc    281820
     agtcctttct aatttgagaa gagaggtcaa cgctatcctt tgttgtctac tgtgagtgtt    281880
     ggcaatatat gctacagcaa ctctaaacta tctgcacatg catcttctgc ttctcacctt    281940
     ctcgctgtct ccttatcagc tctcacacta ccaatgtaga caccacgaat caacataaag    282000
     ggcaagatgg cagccacagg atcactccta gcagtaatgt ccagcacact aattaattac    282060
     attgatctcg gtagtgggct aggccaacat taagtcgaaa gccgctattt gataaatatc    282120
     aaaatattta ggataaatag gtcaaattac tgttcgttcg atcatagaaa ataatgcgat    282180
     atagaataag aatgaatatt acatatttta attgaaagaa atcgtagagg atatataatt    282240
     tccacatact aatcatcagt ctcactactt tctgtaaaaa tgagctcgtt taatctgttt    282300
     gtcgaatcct tcacggcaaa tcttaaacta tgggcttcct taatcagttt ctggattttt    282360
     aaattcaaat cacttttaaa cttagaatgc tcattgtaga gaacctcttt ttcattgaga    282420
     agttccgtta caatacgctc ggcattggca attttctgct ctatgttttt atttccctca    282480
     gttatttgtc gctccagctt ttcaatctcc aagctctgtg ccaaaatttc ggcacggttc    282540
     tcctgcctaa catttttcag atttaggttt aaatcagata gtttcaattc tagggattca    282600
     ttggtagaac ctctggaatt aatttcttca gttaacatgc ctatttcacg ttctagttct    282660
     tggttatccg ttttaagtgt ctcaattctc ttcattatgt cagaattaat agacaatagc    282720
     atattttgat agtactcagg cattggatga tctgtgggga agagtttatc catagtcaat    282780
     gcattttctg agtttggaac aacaacctca tttggaagtg taatcttcag tggttcaatt    282840
     tctatatcat gacctagctt tcttcttgaa gttaaaaact ctaataatag gtcattgtat    282900
     tgtctgatac tgtcttgaaa tgtaacgaag actttttcat tatcaacctt agttgatttt    282960
     attaggctta caaattcatc agctttttca gcaatttgat caatttcttt ttctaactgt    283020
     aacttttgct catttttatt ttcaatttgt tcaactgata agccttttct ttgtaaactg    283080
     tcttgtatct gactaatctc ttctgttatc agtttaatgt tttctttttt ctcattcagt    283140
     tcatcctcta ttttgcttaa ttttattggc cattcttcac tttttgcttt cattgaatca    283200
     acatattttt ggaattttac cagatctcca tttaatgccg ttgattttcc tcttgccact    283260
     ttcaacttct caaccctatt cctactaatc tcaaattttt caaacatatt ttcatttttt    283320
     gattgtatat tattgacatc caactttatt atatgtaagt acctttcaaa accagccttt    283380
     aattcattca tatgatcgga ataatcgtct ttcaaattca gaaaagtttt gtatgagtca    283440
     gtaatataat ctataaataa cctttctgcc atcagttcat acttttcctg tcgtacttcc    283500
     tggtcctcta tattttcgac cggttttgat aaagtagtca gatcttgagt ttgttgattc    283560
     aaaaggtttt gatccagtgt attcagacat ttgtctagtc tcaaatttat agtcaccaac    283620
     caatgcagca tgccaaggaa tttaggccag cctgaacctc ctactgctga aatttgtgac    283680
     ttattaatag actctaggta tggatattgc aaaattttca gaagttgata cacttcgtat    283740
     tctattgatt tggtgaaagt ataaccggga tctaaacgca gataaagcca cttgaatatt    283800
     gtcacgaatg atttttgcgt tggttgcttt agagtcttta atgagattgg atagttggta    283860
     tcaatctcaa aggtattttg gattagataa tcaaatattt cttgctgaat agcactttga    283920
     aagtttttat ctcgtaaagg tctaggatct cgagaaccag agtaaggttg tgaaaagctg    283980
     gaaaatccta taggattatt gttcgcactc ttaaaattat tcgcatttag gtcgcgctct    284040
     aggactggaa gacttgccct catattattg tcatcaagat tcttgttttg tgaaaaggac    284100
     atagatttat tgtaggttgg taagattcca gaagcgccag ctactgttga tcgcatgtat    284160
     ttcttgttat tcttctgaat gccgttgcta ttacttacag ctcttgctga actctgtttt    284220
     agactattga tagaatcact tgcagcacta cttacactat tccgtcttct ttgcatgttt    284280
     tgcgatagcg ggtgctgcgg tatttgagtt gtaaatctat ggggattcag tctactcaac    284340
     acagatgcct cagactgttc gtttggcatt gcggaaaaaa atatatgtct ctgggtgact    284400
     cgataataat tgtctgacta tcacttctgg atattgtgga aaatctcttt attacggtat    284460
     tcttcttgta gcttcaaagc ttttttggtt tcttcacact gttcttttcc taccgtgacc    284520
     aaaacaagag agacctcaat gctaatttat aggattgtag attgtaaaac taaccgctga    284580
     cttaagtttc ttcaataaca ttctaagatc acacttgcag aagatgaagc tactactgtt    284640
     tggtgtaaca ctgctatggt gttttgtttt cttaggagcc agatcaaaat gtaaacacaa    284700
     aaggaaacga aatgcgagaa aaaccatttt gtattacgtt atgagtgata tgaaaaactt    284760
     ctcggtattc ggatgctcat cgcagagctc atctcatcgc tatattatcg agtcagtgga    284820
     agtggagcat atatggtgat tgatacttat tcttcccttg ctggaactgt ttattggcca    284880
     tctaggttga gtttctttac ttgttatacc gtataattaa gagatacaca aatctgaaac    284940
     aatgaacaag gctattccgg tttcagtgtt ggctgatcaa cttgctgagt cgaatgggtt    285000
     tcagtttcac aatatacttt atcatttgaa gtcatcggac tatgtcgatg agaagttatt    285060
     gaaatcagaa ctttcagtat tagtcgtgaa aatacagaaa ttgctgaact caaatagtaa    285120
     ctacagcatt tggaaaggtt gtcatgctgc tgttgtaatt tgcacttata acccattggt    285180
     actaatggca tatggtggta agttattgga cattgtgtac cagaagttag agattaaggt    285240
     gctgcaaaga tctaccaatt ctttggatgc tcaaggtaag caagtgctga actctttggt    285300
     caacgctatc tctgttctca tgaatttaat gagaaataag actggtctat caagagaatt    285360
     tttagttcca aaaattaaag ccataattcc aacattgata acattgtccc agtatgaacc    285420
     tgaattggtg ttgcctattc ttagatctct gatttttaag catacgacta cattcaagcc    285480
     attcaatgct aagtttaagg ttatcttaac tcaattctta acagaaggat ttgatacttt    285540
     gaatgagcat actcagaaat tagtatgtga ttgttatgca tatttgcaca tggtgaagac    285600
     acaaacgtac cagcaacaag atgagcactc gagtcatcat aaaacattcc aagatgagaa    285660
     ttggatgaat ggaatgaatg ctgttcttgc agaattcaag ccacttatcg agttatgtgg    285720
     tgaaatttta gatttcagtc aagatgaaga gttgactaaa ttgattggaa aaatggttcc    285780
     acttgccgct gaaagtacta gcattttccg cagtttgact atggatatga ataaatcaac    285840
     tactttatat gatataccta agaggattga tgttttgtcg aagatgctga tgagctttat    285900
     ttccgtacca acgacataca caataagaat tccattagat aagctgaatg ttacttgctc    285960
     tgccttgtta agtattactt ctaagcatat tcctatcaaa cgtgagttac gtcgtgatat    286020
     tgaacttaat gccacaatta atgatgtatt cactaaaatc caatttgctg gtattagact    286080
     atactcaaca atggtctcaa aattcggaaa cgtatgtttt tcctacttat cagacatatt    286140
     ctatgcccta agtttattca ttcctttcaa ggagaagtca ttaaatattg actttgaaaa    286200
     atgttttgcc ttgaagagag aatttttggt agtttttgat ttggtatcaa aaattattgc    286260
     taatgtcggt catcaattaa cagacattga tttcctactt caattaattg agattggttt    286320
     ggatcttact gaagagagat cattaatcca aaatgtcttc cagcaaacca acgccaaaaa    286380
     agagcaagag ctttcgaaga ctaagaataa aaataaaaag gataataaga gaggttccct    286440
     agctgattta tatgttagtg gttctcaatt tacgctagca tgtgacctta aaacctttga    286500
     tactttgaac aaatttttta tcagtattat tgcaaatcag aaacttgcta cagcgcagat    286560
     gacaaaattg agtagatatg ctatatttac agctcagact tataagcaaa accttggtga    286620
     ggtcccaaca acttttgtgg aacttctaag aactttggtt atccaaccag gaaatgaaag    286680
     agtaaccatc ttacctatgg cggtgaacat catcaaagaa tcatctgatg acgtatttga    286740
     tatcctatca cacccaagac ttccgatgag tattttacat tctattgaaa agtctacctt    286800
     tgacaatggt gaagatgatg aggatgataa tcctgacttg catgcgaacg aaaaacagca    286860
     agaatataat gatcaaccag ttgaacgttc tgaacagaaa gtagttgatt tcgttttgga    286920
     agaacctgtt gctgttgatg taaaaacaaa agaaactgta caattcaaag acggtatcac    286980
     tacttcagag gaccaagttg atactaagag acctagggat gaggaattta ttattgaaaa    287040
     atctagcagt gccaaaaagt ttaggacgga aaatcaacca gaaactattc caattggcgt    287100
     aagtgatgaa acagtttacc aagaaaccga gaaggttaca gttaacgttg acacctcctc    287160
     taatgacaat gaggatgatg aggatgattc agacttcgag atcccagcaa ttgaattgtc    287220
     agatgatgac gatgaagatg aataatcacc tggacgttat ggtatataac agactagtca    287280
     tttgaccatt ataaaatttg tagcatagaa taaatttact attagaaaga ataaaaaatg    287340
     gtacgaataa taaactatca ttgattaaaa tcattacatt aaactagtga agctagtgtt    287400
     tcggcacatt ggtccttagt tcctggtgaa actgggttag aaccacttaa atactgagca    287460
     aacaaatact tgccgactaa tggttggtgt acagtaccaa gctcgttgac aatatctttt    287520
     cttctgttgt aataactgaa ctttagtgat ccgtccgcca gtagttccat tagaaaatca    287580
     tcgtcctttg gaacagggcc cttgatttta attgcttctt caacttcttt tatgcccatt    287640
     gccaaagttt ctttattttt ggacgcatca gggtgcattt gtacattttt gataatacct    287700
     tcctttaaca actttgcaga ggcgttcttt attggagtta gtttagccac cattctgatg    287760
     ttgctgtcta ataggttatc tattagaata cgtgactttt ctggatcatc aagagcaatt    287820
     ttgacattct cagcgtggct cttgttttca tccatatcga taaagttctt ggacatgaaa    287880
     gtggaatcaa acacttgagc cacctttggc ttatcctgtc tagcaatgta aatacctaga    287940
     gcataagcct taaaggtcaa taccgagaca gatctgattc ctgaaccaag aatgtcatac    288000
     ttagtggata atggataggt tggacgtgag ataacaacag ggaagggagt aacagcatca    288060
     tcaaccaaga cactcttacc atctctttct ttttgcaatt cttccctttc ccaggtacat    288120
     acataggtac caccagcgaa agcagcacta actagaccaa caatccacca agctttttta    288180
     tcagactttt cagttgcagg ttttggtgca gatgattgta gtctcttggt aacagctgat    288240
     aatctcgtag ctctggtagc caaaccagtg ttctttataa gcgatcttct aaccaaagtt    288300
     ctcaacatct cttggatatt attttctata gatcacaagt tagggttagt gaataatgaa    288360
     atacagtgaa ttattagagg aaaaccttaa cgagagtcaa gaagagccaa tacgatataa    288420
     ttgggccttt aaataaaaaa taaatgaatg gcaaatcttc aaattctatg atacagttga    288480
     gaacatggac aatggttcag ctgtggtgct tcgtcagtat tcttttttca agatagatca    288540
     ttgactataa atccacaggg ggatatcata gtatttacaa ctcgagaaat tattctgtga    288600
     atatttcaac tggagttcaa cttttcaatg atgtcaaagg agaacaatgg ggcacggtgg    288660
     acttgctaca aagtacctga gcaaatttac agttactcac agtctccttt ggaaaaatgt    288720
     ctataaaatt gttacgtgga ttactatggt tctcagtcgt tactcgtatg agctaagtga    288780
     tagtatcaca gaccattcga tgataaagga caaaaacaga aacttaatga ttactaatca    288840
     atttcaaaac aattatgccg tgggaaccct ttcgtcattt gtaatttttg atgtcaatgg    288900
     atttgaatat tatgttatta atgtatatag acaattcact attcactatt gtagaaggaa    288960
     taacactcgc aaattaagtt ggacattagg tgtgagatat accttgtctc tccagttcta    289020
     atgcttcttt aagagtgagg tcgcatttag atcttgtctt tgctacacta tccaattctg    289080
     tgaatgtgtc aattaaaacc ttgttgcaag ccttttctgc ctcttcatct atatatgtgc    289140
     atatttcgag tgcatgatta ttgatatatt atacatcgag attaatagtt agtatgatga    289200
     ttcactgttt tcattagcaa atagattgga gttgttgttc ttgtactgta tatacataca    289260
     cttcttatca agtgcctcgt taatcttttt ctttaaagca tctctttcgg tctcagagag    289320
     aggcatgagt gttaggcaaa aactttcgtt tgagtatctc taagtaaaga ctccaattaa    289380
     atgtctcata tattgttcaa tcaactatat cacaacagtc acagacacgt tttaatgtat    289440
     ttactaacat ttatggtgat tgttgtcttg ggtacctagt acgcttgttg gaacgtatct    289500
     tgcgataaac gtaacaagct tatggcgcat ttcccagact aaatattaaa tattatggat    289560
     ggtatttcgc tctcttgtaa attattttga aatcattaac ttagtcatat actcatgtca    289620
     attttaccta ttgttacaaa tatgcattaa atatgattgc gactctctca ttcactattt    289680
     taagtcaaaa gtcaggaggt tgtcatcgct atataaaagt ataaaactag tatcttcatg    289740
     agacaataac cacatggatt tggcagagtt gaatgagcta ttatctccca gcacaacttc    289800
     tctggtttga acagccttcc atgaatttgc agttttgtca tattgatgaa attggaattc    289860
     aattctgttt gagtccaacg acttgttcag caataaaaac cttcccgtta tatcaaagtc    289920
     ccaacaacca ccatttatag gcaatggatt ggaagacaat gtcggtggcg actttcgaag    289980
     atcaaatgtg tacagtacat ccccatctaa ttctacaata aagtagaacc cattaggaca    290040
     gaattttacg ttggttatgg cttttgcatc attgggcagt tctgatccaa tctcaaactt    290100
     gatgggagga tcatcaggct ggcaaaggtt taaaatttca acacaactac ttctagcaag    290160
     tgcgatcaga ataccatctt tgtgtagatc aaccttgtca taatgcatat catctgagtt    290220
     ttctgtttgc ctcactctga catcagtttt cccatctttt gatacatacc ctatattacc    290280
     tttatcatcc gcccacacac agtattctgg cttaacgttc tcgtgactat ataggtataa    290340
     taagtttcca agttcagaac caccaagctc aatttgctga gcttgctttg ttttagtatt    290400
     aagaaccata attctgttat ttgttgtctt aacaagtata