(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_6

ID   CAGLA1_6; SV 2; linear; genomic DNA; GRV; FUN; 687738 BP.
XX
AC   CR380951_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 21)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome E, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380951.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..687738
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome E"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        complement(12511..13227)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435506"
FT                   /locus_tag="CAGL0E00187g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58615.1"
FT                   /db_xref="HOGENOM:HBG124532"
FT                   /db_xref="UniParc:UPI00003B61C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP5"
FT                   /transl_table=1
FT                   /translation="MSTPNSSPTSISSSYSAASSGSSSTSGSSSSLYVSALSSVSASSS
FT                   PYSHTSSVVASNSSSFPTLMSTVSSTESVTSHQEASLSSSVTISSSSVALTSKQTSSQN
FT                   SAFANKTVSIPSPSTSIFTDTVGKTITKVITYCSETDNQGNVGTRTSSYTIDASNANLD
FT                   ATGSLVVSRETTTKSRRQDASEAITGKSHSLTSSVSVVELHSSAVISQYAGSAANLSCL
FT                   SRIGALATLLALLLLS"
FT   CDS_pept        complement(15452..21046)
FT                   /pseudo
FT                   /gene_family="HOG000142341" [ FAMILY / ALN / TREE ]
FT                   /protein_id="CAG58617.4"
FT   CDS_pept        25881..28523
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348410"
FT                   /locus_tag="CAGL0E00275g"
FT                   /product="Similarities with uniprot|P36170 Saccharomyces
FT                   cerevisiae YKR102w FLO10"
FT                   /protein_id="CAG58619.1"
FT                   /db_xref="HOGENOM:HBG124541"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00003B61C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP4"
FT                   /transl_table=1
FT                   /translation="MSWALIYAILHSLAVVCEGFISTEGDISIVRDSNIPNNYPLGCSN
FT                   KYSGHLPGLKMELYSYNYVNPRHPDPQNPGKLDQLYDPNLLGTYECFDSSYKDINYPRV
FT                   GYKSKTLIGRSDGVSGILNFNFVPPWGCMPQKGQLPPAYNFKSNITLSNFTMILFGYFK
FT                   PKISGNHIFSLHGDDLIYLNFGAGNAFDCCRQESSADNFGNYQAFSLWGINWEKKTLTV
FT                   YLDMNTYYPIRIFYNNRDYQAIFNFSFKTEFDSSPVIDFQDYFFFLRDIDGGCPGEVSF
FT                   QTTCGNFPRTITKTVDYEVVSSHPVQLPYTKTIYHVLVPCTSSVGATICTDGYYDPISN
FT                   ICHSYSSMIIKKLSSVLPSSSISSGLRLSSSSTFSSIPMPSVTTSKIMSSRFEAPFGPR
FT                   IGTWDLEDKPEPASKQLGDFIVDINGMSRSHLAQFSVNLPSNDTQRPYSKRNSSFFPSN
FT                   LSDREPATPTSWIYMETTVDPLVTSLSPQQENKTHQKQLSSPYFFASSVDRSLNSSYKS
FT                   SSLYLDHILRSSFSSSMKLHQSRDYASEKQKLSFSEQQSSTSSKVLASKLKDMSDRSST
FT                   NYSIVRHATPHPNFSQIQRSQPKSKYSYLNSTESIDGIPTAHKFMSKLPELRSQFTNSP
FT                   LFTKMGAIGNHSPQFVSEYSHYSSSMDNLSIGSDTLESSNLSRSSIASNPVNSSYFTND
FT                   VFEITQLNNKTDSRSILYGDDTSTQTAISESTPASGISVPTLINITRNLVHVINVTAEE
FT                   LNWNTPPAVDKNDGSSNLITIKWFSDVSTLFSYVIGMADDQDNIYTTNCCGSCHHHYHI
FT                   HSINLPTFTDFYSRVDTNNENSNLGIQTLNDTFNLISSLTHNGGSTFLKASISYLSLTE
FT                   LIIGVILLC"
FT   tRNA            28878..28951
FT                   /gene_name="tRNA-Asn (GTT)"
FT   CDS_pept        join(29668..29775,29840..30076,30143..30190)
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500586"
FT                   /gene_name="MTL2A1"
FT                   /locus_tag="CAGL0E00341g"
FT                   /product="Mating-type-like protein A1 "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58621.1"
FT                   /db_xref="EMBL:CAE84398.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124470"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI00003B61CA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q708A7"
FT                   /transl_table=1
FT                   /translation="MMTVDPIQDLRNICLQILQSVNSNTLLEEETWDYNTLINNIDLPK
FT                   QTREALRRSASQYLLYCQRKNKTYTTRKPLPAKAKLQLVETFSKKRYLTRCEKHQLAVQ
FT                   CGITTNQVQIWFANRRKRSKDLNNRD"
FT   CDS_pept        complement(30336..30527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435507"
FT                   /locus_tag="CAGL0E00363g"
FT                   /product="Similar to uniprot|Q06287 Saccharomyces
FT                   cerevisiae YLR186w"
FT                   /protein_id="CAG58622.1"
FT                   /db_xref="HOGENOM:HBG124303"
FT                   /db_xref="HOGENOM:HBG398777"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="UniParc:UPI00003B61CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP1"
FT                   /transl_table=1
FT                   /translation="MRPQEYLGDKQSVCVFVGAMARGHDSFADEYVDDKIAISNYPLSA
FT                   SVACSKFCHGAEDAWAII"
FT   CDS_pept        31960..33786
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18500587"
FT                   /locus_tag="CAGL0E00385g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58623.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B61CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVP0"
FT                   /transl_table=1
FT                   /translation="MFARGSRLFLYRPVIHRNSSTKTDLKKTQTWTQVKQLLRLAKPER
FT                   KYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTPDAPIYGLTRNQFLLALGSVFVVGAI
FT                   ANSGRIIILKITGEKLVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSV
FT                   TSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQD
FT                   KVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGL
FT                   IGNIAMIGLLLVGTADSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVL
FT                   ELQNMKTKISPTKGISPPKTLKGLPITFNNVSFAYSNGKSVLSEMNFQIHPGEHVCFVG
FT                   GSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILD
FT                   NITYGLHDKSLTDLNMALKAANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVF
FT                   LQNPDILILDEATSALDTKSEDIINKELQRRQEAGMTTISIAHRLSTIRHSSRVIVIED
FT                   GRVVESGSFDQLRSTRDSELNKLLKEGLEHHK"
FT   CDS_pept        34344..35459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500588"
FT                   /locus_tag="CAGL0E00407g"
FT                   /product="Similar to uniprot|P25366 Saccharomyces
FT                   cerevisiae YCR095c"
FT                   /protein_id="CAG58624.1"
FT                   /db_xref="HOGENOM:HBG058226"
FT                   /db_xref="HOGENOM:HBG323791"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="UniParc:UPI00003B61CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN9"
FT                   /transl_table=1
FT                   /translation="MLVPPASFGIAEEGIYRCSKVETLNLSFLEGLNLKTVIFVGGTEP
FT                   SKFFKEFFTRSSIEWTAIRTADFSTVGSPLKNDLSLVSPHSYQKMHSDEDTQSRESLGE
FT                   DGESIHSGTSLTIGMNKVISPQKMAYHFSDSDDLMLIKSKSLQRIFEKLLDRKNYNTLL
FT                   VDKTSLVIGILRKIQKWNISSIINEYRLFAGKNRGYFAETFLEMIQIKIEQTIEERSLD
FT                   EQQIDTIVSEEQQLPCVEHKSNPVELVDEDLLCDEPEVPERQLHIVEEAERKNRIKDIP
FT                   RVNNILISDTSTSSSDLGIFGHRYRLAFTQKEQGQYEYYKSQDGNDDIETVCLKIPKEN
FT                   DLPGWFKFQRDLWEQENIPQIHHFYKEQIYI"
FT   CDS_pept        complement(35604..36770)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435508"
FT                   /locus_tag="CAGL0E00429g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58625.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG356600"
FT                   /db_xref="HOGENOM:HBG525157"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniParc:UPI00003B61CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN8"
FT                   /transl_table=1
FT                   /translation="MWFFKKAAEPEDSLMGTEHKSNKPPNTAFRQQRLKSWQPILSPQS
FT                   VLPLLIFYACIFTPIGVGLILSAKGVQDLTIDYSHCSTKANTGDFTDIPKKYVHHNFKH
FT                   KVASKARWKLENEDDESKCILEFEIPDDIKDSVYIYYKLTNFYQNHRRYVESFDYKQLL
FT                   GKALSKDELTTACRPLRAEGDKIVYPCGMIANSMFNDTFDQQLKAVGDSNSDYELTNKK
FT                   ISWSIDRKRFKKTTYNASQIIPPPNWRERFPDGYTEDNIPNIHEWEEFQVWMRTAALPK
FT                   FYKLALKNETAPLPKGTYSMAIGLHYPISYFGGSKSFVLTTNSVIGGRNMSLGVVYLIV
FT                   SCLSGLLALIFIIKLFFQPRAMGDHAFLKFDEETDSRDNNDLALREIL"
FT   CDS_pept        complement(37236..43508)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435509"
FT                   /locus_tag="CAGL0E00451g"
FT                   /product="Similar to uniprot|P25655 Saccharomyces
FT                   cerevisiae YCR093w CDC39"
FT                   /protein_id="CAG58626.1"
FT                   /db_xref="HOGENOM:HBG058224"
FT                   /db_xref="HOGENOM:HBG204068"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="UniParc:UPI00003B61CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN7"
FT                   /transl_table=1
FT                   /translation="MPSGPTDESKLGTKKDSSDIINSGNNRSKHRTAITRVVQILVNLS
FT                   EINFEISKRDIFEILEYSAAEVEIEYLKRLLVQAENIDGNPKELYNLLYHSIKRLSKKD
FT                   ESYVSLIRKAVFENTEFIQDYKIKKLDHYLQDHLNTEPDLLDCIDIEKYIKSLTINIEE
FT                   MNYQESLQSVLSADNPPDNYIEQIRDIVFSLEGESLNDCVALLLSEILSPGSQNLQNAS
FT                   KTDIESGNASPWFTPYAVDAATHIGHQLHETLYAMKKDATNWNRIFNLMSTKYFLSTPV
FT                   HASLASLSSLFAILDSGSIIDEFFSCDWHVSVKLQLVVLLHKWSVSEGCFDILNSQNIR
FT                   KVSNKIENTKMSMLYLMCVSSLDLELFLQRDELVDNPMLPVFQECFFQDFNAAPEYLAL
FT                   ALINNMKHFSLLIENTTTVDEILIALVVQTFEKSFQSVTDIIRALGNDNKLLLEVCTAI
FT                   INTNKFRLIEFAKVLKDEGKLEFVIDHTPFEDIFKFLPRAIRVGWNGFEDYIHKHLDSN
FT                   NSHSAISYLDAQIKIPDNDMPLKKSQSFDLKSLHTLINFLRTIPLNANDQLMFEKLQFA
FT                   LLIAVPRLLNFGYDHDNVILASEDTGPVESDIEKEMQMQLQKMYSGEIAIKDVIDLLIK
FT                   LRDSNSSHDQDLFACITHAVLSESNFYKDYPLDALATTSVLFGSMILFQLLRGFVLDVA
FT                   FKIIMNFAKEGVESKMFKFAVQAIYAFRIRLPDFPQYCKDLLQEVPDLKTQPQVYQSLS
FT                   EAAHGIDVAKNQSTPITKQPLELYPMKFFVIDELKYQFQQDTPPKDVTEKVLFILNNIS
FT                   TENLKNKVLDLKSVLTSNYYAWFSNYLVNQRAKTEPNYQNLYKDVLVNVESESLHQYVI
FT                   NMTLKQLFLLMSIKDVKAIDKKHLKNLAAWLGCITIGVDKPIKHRNIAFRELLLDAHKE
FT                   NRLEIVVPFTTKIIQHAANSKIFKPPNPWTIGILRTLKELNEKANWKLSLTFEVEVLFK
FT                   ALDIPMDSLDSTNYLDSTDIIENLSGNIGSVTLEQQQVEHQRQMLMMQQHQQQLLIYQQ
FT                   RQQHILNNNPSSKEQGNYMEAQNQTNDGPFVSLSGSTLFTTRPEIKRVFQIALAKAVRE
FT                   VLGPVVEKSANIAVITTTKIVSKDFATEPDENKLKAAAITMVRQLAKSLSRATAYDPLK
FT                   ESLRSTTQSLLPNMMGLSSNPLEELDTAINDNIGLALNLVELAAVDKAVQELREQLIQA
FT                   IAIRRYHKERRSDQPFITPNTNPYSLALPDPLGIKNNGVTPQQFKLYEEFGNFFPDNHA
FT                   MTIANQNQSVNTPQSIPAEPVQNIPQNIQTTANRQPLGPAQAQMPIRNPHLVNNVQSEL
FT                   EQNHRILVHLMDSLVALIKENADKNSLKELGEKNQIDGIIFQILTFIAKSVQKDQLALK
FT                   VSQAVVNSLFATSESPLCREVLSLLLEKLCSLSLVARKDVVWWLVYALDSRKFNLAVIK
FT                   SLIEVNLIDPYELDNVLVKAMASGMENSVDFTIKLIEESILSEDPILMRMDLINSVIYL
FT                   SKLNSKDSQEFISKYENKAILPIKEDIEITKKEHYFLIFTEWVKLLQRVESDDAITLAF
FT                   ISQMMDAGILSESDNVIVFFKSALELSIYSFKKSDPTGDVFVSIDALSKMIIKLLIHQN
FT                   WNDCSRGDYFNMILSVILLVFAKDHGETNTTFNERPYFRLLSNLLYEWSQIRTHKFVNV
FT                   KNSDNRKDLQQFDAEFYNTFALYLHSLQPFAFTGFSFAWVTLLSHRMFLPEMLRLSDKK
FT                   GWKNLMILMMDLFLFLDKYTKKNSVSDAVSVIYKGALRIMLAISNDYPEFLIENHYELM
FT                   NALPQTYFQLKNVILSAIPRGISIPNPFDQNVHMKDMPECQTVPNVYYDPVADLRNLKK
FT                   PVDNYLRIPSSSLLRTVVNGLYSDEKHRKNCLGYEAVSVNQKLIRAIVLHTGIEAGLEN
FT                   EKTSSNAIFNTKSSYYTLLFEIIKEGKAEIKYQMIQSIIEQLRYPNIHTYWFSFVIKEM
FT                   FISKEWDDQLDIVRELILRVLLERLIVNKPHTWGVTMMMHTLITNKDVEILELECVKSQ
FT                   SEVQLIFKQLIKHANAMSVATPLNDVDLNSQTQPQPINA"
FT   CDS_pept        44238..47315
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348411"
FT                   /gene_name="MSH3"
FT                   /locus_tag="CAGL0E00473g"
FT                   /product="DNA mismatch repair protein MSH3 "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58627.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG377949"
FT                   /db_xref="HOGENOM:HBG735169"
FT                   /db_xref="HSSP:1EWR"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniParc:UPI00003B61D0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVN6"
FT                   /transl_table=1
FT                   /translation="MKQASISRFFKKVSAVNKEKVDQVKEVEKEAEVDEVLDLTLDSEN
FT                   DEEQQQETPVLEPIDGEEHPTVSKVPDLNDSRLLQKQKILNASKDITNSVDVSAFNEKL
FT                   KDIMNKRKLGRIKGSLIDESDEIAEQSEADEHNIKKKRKKSDQLTPLDRQVKDLKLGNM
FT                   DKVLVIRVGYKYKIFAQDAIIASTILHLQLIPGKVTIDDSNPNDSKYKQFAYCSFPDVR
FT                   LKVHLERLVRSGLKVAVVEQSETATTKKFDNSKAKTSVFERKITGTYSKATYATNCEFE
FT                   VNHENILGTNNSIWALDIEVSDSIYKYYLWSIQLSNGEVIYDSFEESKDNFSKVETRMK
FT                   YLNPSEIVSPVVDSFPIKLKKRFLDLQLCQKNYDILAEDLNIPKKELLNNRLIELWHIL
FT                   YRYLKEYSNEKLLNIGSNYRHFSQKISIQLQAQTINNLDLISNDDSKGTLFWILDHTRT
FT                   PFGKRLLKEWLLRPLLSKDAIVDRLNAIDCILESANSIFFESLNQMMKGIPDLLRTINR
FT                   VSFGKTSQREVYFLLKQLTGVIKHFEAHKDYIEVEINSNSGAIKTKSTKLASIMTQMFE
FT                   FSLSSVIPQLLLMINVSAVMEKDQKKQLLGFFHLNNYDNSENIIKMQRDIDSVKAQLHD
FT                   ELQNIKKILKRPHLAYKDEVDFLIEVRNTQVKGIPSDWVKVNNTKMISRFLTPRTKELV
FT                   ELLEYQNDLLYNEISKEYDQFLNRIASYYNEVKTFIMNLAEYDCLLSLAAVSCNVGYTR
FT                   PVFTDSNEQLIIAKQARNPIIESLGVDYVPNDIEMEKDSGRVLVITGPNMGGKSSYIRQ
FT                   IALMVIMAQIGSYVPAESLKLSVFDNVLTRIGSQDNILQGQSTFKVELSETVEIINSCT
FT                   SKTLLLLDEVGRGTSTRDGNAIAWALIKYFVEEEQCPFILFTTHFTIVTTVKSPLLKSY
FT                   HMNYVQHKNENENWTTVVFLYQLKAGVTDSSYGLNVAKLAGIDTHIINRAHDVAISYKN
FT                   DTEFDTNMILFQKVRNILANRTTARETLKVLLELDV"
FT   CDS_pept        47583..48134
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435510"
FT                   /locus_tag="CAGL0E00495g"
FT                   /product="Similar to uniprot|P25654 Saccharomyces
FT                   cerevisiae YCR090c"
FT                   /protein_id="CAG58628.1"
FT                   /db_xref="HOGENOM:HBG177042"
FT                   /db_xref="HOGENOM:HBG590687"
FT                   /db_xref="InterPro:IPR008584"
FT                   /db_xref="UniParc:UPI00003B61D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN5"
FT                   /transl_table=1
FT                   /translation="MLYLSMSGTLSENIVRVYPRDTEQSIAEYSFDITCTHCREAHGSP
FT                   VFINAYEKHEMAGSRGETSFTMKCKFCGNEMSINLSHFEEALWNSEAESYDSGSITTSR
FT                   KKHGIKNVSGNAGLLLQLDCRGCDISKFNPQNITFVVELQQGKMECIIEEGEDEWYDYD
FT                   DNQGEEVSITEIKFDIIKGK"
FT   CDS_pept        48402..48845
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246865" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500589"
FT                   /locus_tag="CAGL0E00517g"
FT                   /product="Similar to uniprot|P37263 Saccharomyces
FT                   cerevisiae YCR087ca"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58629.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189832"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR014898"
FT                   /db_xref="UniParc:UPI00003B61D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN4"
FT                   /transl_table=1
FT                   /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPNAYYTCIDCSKTFDDGVSY
FT                   KQHTQCISEDEKYQKALYKGKKNQNQNQNQNQNQKKQKQTTVTEEKKPAEKETKKEVKK
FT                   SLPNFKKGDNLYKILKSYKDKDDKKKLLKSLVVDSEGRIVLKN"
FT   CDS_pept        complement(49029..49574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435511"
FT                   /locus_tag="CAGL0E00539g"
FT                   /product="Similar to uniprot|P25651 Saccharomyces
FT                   cerevisiae YCR086w YCX6"
FT                   /protein_id="CAG58630.1"
FT                   /db_xref="HOGENOM:HBG059759"
FT                   /db_xref="HOGENOM:HBG204066"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="UniParc:UPI00003B61D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN3"
FT                   /transl_table=1
FT                   /translation="MDPLSEYKKSVQKRLDAADLLVERVVQENTLLRQKLDSRDVELES
FT                   VKEQLAVLRSKRDELDERSQKDKETIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGS
FT                   KNGIMDYKLGFVKSQAENTTEVDTEVIYVPLLKQRTAEELQELQKKLPDYLFETLSFPL
FT                   RSLNQFYIKMSKSLNKKV"
FT   CDS_pept        49987..52497
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195164"
FT                   /locus_tag="CAGL0E00561g"
FT                   /product="Similarities with uniprot|P16649 Saccharomyces
FT                   cerevisiae YCR084c TUP1"
FT                   /protein_id="CAG58631.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG395537"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B61D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN2"
FT                   /transl_table=1
FT                   /translation="MTANASLGKLNDLLEGIRQEFAQLSHEANSYRLHQKDYDYKIKQQ
FT                   LAEMQQIRNTVYELEMSHRKMKDAYDEEIERLKIELDTRDRQLATLSAQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLHQQQLQASPTGQGHVQVDQNGAYQLY
FT                   RPVQAATIETNGGLPAGGQSTLPQPYNAIAASQADHVQQRHRMAPAVGNLTSTPTVNSQ
FT                   HSTHPPTPALASSSKMQPTALATQPVTMPATQLPTFQQPQVETPQIKHEAPQSATQITQ
FT                   TPTLQSATVAANTPKVQTPSVATPGIQATPSSANQVEVATAPTIAKSPANKQPAILNQT
FT                   SPVNTAANAAPILSEKIKSPLQESQAPGTTVSEVTTSNADATQSPGQTSSALDSNRPEI
FT                   NEKVDEKATQTVQETAGKKQDTADKSDESNNYLVPLEQRADHVKPIPPFLLDLDASSVP
FT                   ENMKKQTNDYYVLFNPALPRSIDLDLHKTLEHTSVVCCVKFSNDGEFLATGCNKTTQIY
FT                   RVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSPDGKFLATGAED
FT                   KLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTL
FT                   SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSV
FT                   VFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTED
FT                   DEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDC
FT                   KARIWKYIKTTTEVNSNGKIQPIS"
FT   CDS_pept        complement(52982..53407)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435512"
FT                   /locus_tag="CAGL0E00583g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG58632.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00003B61D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN1"
FT                   /transl_table=1
FT                   /translation="MLLFRTARCQVPTLGRFATHPRIAPSIAMRFQSSGGYASIKQVKT
FT                   LEEVQKLMKDSNLSVIDFYATWCGPCKAMVPFLSKFVDQYKDVKFYKVDVDESPDVAEY
FT                   YGVSAMPTFVFTKDDDILHKIRGANPKGLAKAIEEFK"
FT   CDS_pept        complement(54221..54580)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435513"
FT                   /locus_tag="CAGL0E00605g"
FT                   /product="Similar to uniprot|P25649 Saccharomyces
FT                   cerevisiae YCR082w"
FT                   /protein_id="CAG58633.1"
FT                   /db_xref="HOGENOM:HBG124508"
FT                   /db_xref="HOGENOM:HBG204065"
FT                   /db_xref="UniParc:UPI00003B61D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVN0"
FT                   /transl_table=1
FT                   /translation="MSVDEFQERRVEESADYEVLAQRRRFLERKLVEQQYLQKQLQVLY
FT                   NLLDKTRNYQEFTDTLMNNQNLLREVFTLEGHLRRSVAQVDGQPDIDWSKYGVDLAEYI
FT                   ASDSRLLALYTDGCL"
FT   CDS_pept        complement(55009..59085)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435514"
FT                   /gene_name="SRB8"
FT                   /gene_synonym="MED12"
FT                   /locus_tag="CAGL0E00627g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 12"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58634.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059763"
FT                   /db_xref="HOGENOM:HBG204064"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniParc:UPI00003B61D7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVM9"
FT                   /transl_table=1
FT                   /translation="MIPSKYKLAPPDDLHPYSESERAKHKIYPDFDPWKHTKEEDEILL
FT                   NFVSKGYYSTSKVNFESISARSSLQDSLPKLSSTLSEKFSEVVRIREREINTIKGNSKD
FT                   GMAASKFTDLCGPDFKLPSRLTLTDHRKELWLQELSSPYTPLHKITSFIPHGLKRRQVL
FT                   EQCYIKQIPLKRAVWLIKCCYSIEWKTGIAKYANSPQEKDKFNAHLLKEWTDNFVHILE
FT                   KLIFEMTQHYNDSVKLEAWKTEVSYFLKLVGNCYTLELIDKNTFHFWILQFVSKVENFE
FT                   YLPLPLHILELFWSGICNTNSTKVNESESNPLYMVTKLTDILLNQYYIILHSKSMINDD
FT                   KYIINDIKKNNSIKESLLASIQKLICILFKQQSLEVFLFPPTSWEKYKPCLIQITSALY
FT                   RKSDEVAEIKRKLELISYRNETLKYTPPISENKVKDDLILTTFTENSGSITVVELSQVD
FT                   TGLTGALDDNATDFDWTSYSDQEISTKIQIIQIILWAIHPSRHSHYEAGQLAAKLLLLK
FT                   INTMDGFPEYEIEDEIWSLVFKLAKLSDKSKALPAVLEALYSLLNTLIVYGLIKVSTYI
FT                   RKLISSGILYLTESNDKYIHCRLLINLKMSPLMKSQYNMVLKNVMDQDPEYYNNYNFDQ
FT                   IVSIVEDLKVKLPNGDAIEYSNYPMSVKISLGEWYLTYLCNGKLVNETRESLTEKYVLF
FT                   AHQLNTNHLYFKWIEFIVYHQLIEDIETLEYLMEVLLRYKKLFSQYINDHVLFIKTFIF
FT                   IIRRILKERDSIAYSLTSFMDFWKFIMKSYSLEIRADTDLRSEMSAVYEEEKAKKEITE
FT                   GEKDSWMGLYQNIHPDSTSLDQNHTGFSELFLTNLKTFLSSKQDKQAKKKARYNLLLLM
FT                   QAKNRDYSKFISIYLKRKDFKTSDLVNLLSSKLLTLDQIKNTYGLKYVLELFDIESESN
FT                   CVFYEYQKRCYIELNYKSVLSEYNVVSHHEMNRFIFKIVNHSTSAKLKETASALLTKNL
FT                   EANKDKAIQLFYQLVYYQNNLEFLSSEELQEFAVNNSPQKLYSYLDFTNLWLFQSFTKF
FT                   YIHETFQNTNEDKVKVGDVIFSIIETTKYNVLCAKIFEDIRDHRVTDLVIELFEQDFFK
FT                   KIISGEEFKAEFLQMLIEIINHLSMHKGKTNDRSGEQSHTSYELCVQVMAHFQQLSDSE
FT                   LSAKEIELDVFMKIFTVHQNSVFQEILRDTESSSAMIESLFALFERVNFSLRLKLMFYE
FT                   VLSSLKSYCTYEAGISDEQSRTKLMHKLMCLPPFQVSSFFPEEDDTDCTRDPALSLGLD
FT                   LGTASANSTSSTTPSEGTHKKRCAIWDKRLHKYTGELQRKPYYCIKNYQDTEDINNCSL
FT                   NLSLFDARYERNNPR"
FT   CDS_pept        complement(59884..61359)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000910" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044041"
FT                   /locus_tag="CAGL0E00649g"
FT                   /product="Similar to uniprot|P25646 Saccharomyces
FT                   cerevisiae YCR079w"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG58635.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG059764"
FT                   /db_xref="HOGENOM:HBG398156"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI00003B61D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM8"
FT                   /transl_table=1
FT                   /translation="MSCAQSYIHLIPSNVKEAAAKSLRAAGRAGGAGRVGSAGSGSGTG
FT                   VQKSVSLKIHLEKFPSSIGHATSRVNRLHNEDSYSINMLRMPSRTEQLLAYKNKDLLSK
FT                   NSRSVLNVSIFDGHGGEGRVSKLLAREFYKDIVAGYPSEQDFFHLLDRYRKLIGGKYWN
FT                   DLYQSREQFYDKFIKNCNTKQELVLFGADQKGSRMIFDKWGNIIDKTSLLTDLERLRLY
FT                   YSFLKFDLEKCCGFDDMESLPENFSAEEHLKRYSGGSTASSIFLSSYNNNLKTDDSFFI
FT                   YPNGLFKLVVTQVGDTKIIICDKNGIAHPLTRLHHPTSSRESKRLNMDVKKEEEEADSF
FT                   GEKRFLNKFANTRSFGDLVGKKEGLSSEPDIYSYLVGNTEQLPHSERSKLQFGGDECFI
FT                   CMVTDGVSDILSDQEIVDLITSTVNMRGLKTANPQYLAEEVVKFIEAVGDRHADNATCI
FT                   ILRLPNWGSWPTIDRTGAEREEKLMGSSKGERA"
FT   CDS_pept        complement(61697..62338)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044042"
FT                   /locus_tag="CAGL0E00671g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG58636.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015368"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B61D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM7"
FT                   /transl_table=1
FT                   /translation="MSRAKRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGT
FT                   PYEGGKFIVDIEVPMEYPFKPPKMKFDSKVYHPNISSVTGAICLDILKNAWSPVITLKS
FT                   ALISLQALLQSPEPNDPQDAEVAQHYLRDRQSFDKTAALWTKLYASAEGSGDSVDEAQL
FT                   YGIDPEIVKEFESQGFEKNKIVEALRRLGVKSLDPNDNATVNKIIEELLK"
FT   CDS_pept        complement(62802..65291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435515"
FT                   /locus_tag="CAGL0E00693g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58637.1"
FT                   /db_xref="HOGENOM:HBG192662"
FT                   /db_xref="HOGENOM:HBG395380"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniParc:UPI00003B61DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM6"
FT                   /transl_table=1
FT                   /translation="MPRSSRRGKKREPPAWKKAAGGKAPEGGKGGKGGKGGKGAPRVAM
FT                   GKGVDVGRDREEERRVLALSSTPSTVLNRILSVLDLTFERDIGMLNGNCVRKVPDYGTL
FT                   VKLRDELQKLHHLFEHISQSDQASIDLVRQIREKRKQVRIKEEEEQEQQQKHKLKLKLK
FT                   LKDVTKKDASATDDKPELTEESAKAESPEAKEGPVEAEEDTLSRPKPDDVETVEINTQV
FT                   EETKVESGKDEVEPSEEKDAEVKDPEATDETKAEEQIDETEKPDTVLKRTHSEISSDVE
FT                   NVGELKVEDGQEEPVEGEAPPKKIKLNLTEETNDAQFGKPEENEGTEVSKDVDIDKMEN
FT                   DPTVKNPKSEFVVSQTLPLAAKALGLFNEEGLECTGEEFLKKKYSVASYPTTDLSDKLP
FT                   GELPDMDFSCPKPTNQIQFNTFLASVEKFYREFSDNDIGFLEGKYILPQNLQVDSTYDP
FT                   EVTPYIIPKLGQLYTEIWAKEDQEKNIGNTSPPSVTDPSSILPKKGAANINDTILETED
FT                   VSCGPLVSRLISAIMKESTQNIDSNMESGTPGHGLDEIKSEPDHGLPADDKDISKDNDN
FT                   AYSVEGNSSLAANADSVMTNGDTVDNDDHNSWDVNPLSRSTTSTLPAGNGWKIENVNID
FT                   YPTFEERLKRELKYVGIYMNLPKDENNPNGEDPDWLNGREDDEVSAELRQLQATLKQVT
FT                   KRNQLRKKNLIPLVERQLAWQEYSSILDDLNKQLDQAYIKRIRVPKKRRKHHGSATSGS
FT                   ASQLAQQKAANSSLKALLDKRQRWITKIGPLFDSPDLMLRIPKDSVFPNLDAQDDDDDD
FT                   IDVFAQNNMNKEEGLED"
FT   CDS_pept        65540..66469
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435516"
FT                   /locus_tag="CAGL0E00715g"
FT                   /product="Similar to uniprot|Q03976 Saccharomyces
FT                   cerevisiae YDR175c RSM24"
FT                   /protein_id="CAG58638.1"
FT                   /db_xref="HOGENOM:HBG059814"
FT                   /db_xref="HOGENOM:HBG395381"
FT                   /db_xref="InterPro:IPR017081"
FT                   /db_xref="InterPro:IPR019349"
FT                   /db_xref="UniParc:UPI00003B61DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM5"
FT                   /transl_table=1
FT                   /translation="MLRIIRSIGTAAGAAGSGAAGAAGAVAGLYREPAKWKGLKPETVI
FT                   SLYWERVAKMGKEYKQSPEELEALLGTSEYTGVPEAHIRKLYKYGEKGAMEIGAGAGPG
FT                   AGAKARDVVGGFSRFQFDELPSQALDLVDQHREQRFYNRLAAYELPLLAKYRQEYKPPS
FT                   ASDVVTYKYFTYVGEEHPNSRKVVLSLKTESLGLEPRALHKFRVLARTRYDHETDLFKM
FT                   SSDKFPEAQQNAKYLGDILKRLLQEAKDLSKDDFSDIPLDTRHTIAKNLRKKHSRRLRT
FT                   IEFPEEWKRPEDAPVKKVNITEELMKLL"
FT   CDS_pept        complement(66978..67802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435517"
FT                   /locus_tag="CAGL0E00737g"
FT                   /product="Similar to uniprot|Q03973 Saccharomyces
FT                   cerevisiae YDR174w HMO1"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58639.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059813"
FT                   /db_xref="HOGENOM:HBG398058"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI00003B61DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM4"
FT                   /transl_table=1
FT                   /translation="MDAAGLKLKSAKDSLVSALFELSKSANNTASAIVDFYNTIGEDDE
FT                   ERLEAFTTLTESLQTLTSASNQLHGISSDLVNPMDEDASSLLMGKGKKSKSGDDDADGA
FT                   DDQPPQKKKPVRDPNAPKKPLTVFFAYSAYVRQELRDARAQAGLPPLSSTEITQEISKK
FT                   WKNLSDEEKEKWKQAYNVELENYQVEKQKYLEAKKNGTLPEFMDPSTNHAPVPLPANLQ
FT                   KRSIDEIYGGSDGHKVSSSGNGENTGSSEKKKKKKKKDKKKDKNRDANRDNN"
FT   CDS_pept        68404..69453
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348412"
FT                   /locus_tag="CAGL0E00759g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="CAG58640.1"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG059811"
FT                   /db_xref="HOGENOM:HBG396454"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI00003B61DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM3"
FT                   /transl_table=1
FT                   /translation="MRAFQHRAAGHDGLLTEGEGALVFKPYHAKEAAFYMEVQRRRVDE
FT                   PGAAQDVPLHLWMPCFMGVLEQGDVRKPGASGNTPAGSKYIVLNNLLHGYSRPNVMDIK
FT                   LGSVLYDEDAPLEKRQRLQEVSRTTTSGSLAFRICGMKIERGKASCTALDEAHYDVETH
FT                   HGVEYLSVNKFYGRTRTKDDISEAIELFFNNERLSKPRKKQLYDTFWQRLQLFYNTLLD
FT                   TKARFISSSLLFVYESDPAAWEELDDVDELVHDYEVELIDTDEEDDELAGGFVQQTTQA
FT                   SMVIDTRDDDELPNPTIMNEKVEPRNKKLSSMTFIDFAHSQFTDTDDYDENVILGVENL
FT                   IDIFNELRI"
FT   CDS_pept        complement(69744..71810)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435518"
FT                   /locus_tag="CAGL0E00781g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation release factor activity "
FT                   /protein_id="CAG58641.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003285"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI00003B61DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM2"
FT                   /transl_table=1
FT                   /translation="MSDPNQQQQQQQQQQQQQQGNYQQYYQNYGQQNFQPQQGYQQYQQ
FT                   FQNYQPQQGYQQYQNYQQGGYQNYQQGGYQNYQQGGYQGGRGGYQGGRGRGGYKNYNNR
FT                   NNYNNQNSGYQNYQQQQQPAQGMTLDSFQQQQEQKSEPAPKPKKTLKLVSSSGIKLANA
FT                   TKKEEPKTEEPKKEENKQEEPAKEAKKDEETKKEETTSTESKPEATEDVSKKMEKLDVK
FT                   DTKEKEATPSQEVSSADALIKEQEDEVDEEIVNDMFGGKDHVSIIFMGHVDAGKSTMGG
FT                   NLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEK
FT                   RRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEKGGQTREHALLAKTQ
FT                   GVNKMIVVINKMDDPTVNWSQERYDQCVSNLSNYLKAIGYNVKQDVVFMPVSGYSGAGL
FT                   KERVKKEECPWYDGPALLEYLDEMKHVDRHVNAPFMLPIASKMKDLGTVVEGKIESGHI
FT                   KKGQSTLLMPNKIPVEIQNIYNETENEVDMAVCGEQVKLRIKGIEEEDISAGFVLTSPK
FT                   NPIKNVTRFVAQIAIVELKSIMSAGFSCVMHVHTAIEEVHITRLLHKLERGTNRKSKKP
FT                   PAFAKKGMKIIALLETEAPVCVETYDDYPQLGRFTLRDQGTTIAIGKIVKILE"
FT   CDS_pept        complement(72228..73367)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044043"
FT                   /locus_tag="CAGL0E00803g"
FT                   /product="Similar to uniprot|Q12329 Saccharomyces
FT                   cerevisiae YDR171w"
FT                   /protein_id="CAG58642.1"
FT                   /db_xref="HOGENOM:HBG124526"
FT                   /db_xref="HOGENOM:HBG203186"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI00003B61DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM1"
FT                   /transl_table=1
FT                   /translation="MSFYQPSLSLYDVLDALQAPRQRQPRAYGSYGSYAPYGTYGTHGT
FT                   HGSSYPYGQRHPLHHVRSTPYYRFGNPYYYSPEYYEDEDEDEGDDVQDGDEDVEMGEKP
FT                   SYYHDNSGKAARNAQEHEQQYQADNGLVDILNALLGGYPPMGSTVQLGPQGQQQRQQQQ
FT                   QQQEEPEVEEPQEPKQKPAAVQQPEPQAQETPQESKPHSESKPAQQPKLKKRASSSAFV
FT                   HQQAPSPVPDPLQISKPETRLDLPFSPEVNLYDTEDTYHVVLALPGACSKAFRIDYHPS
FT                   SHELLIKGNIEDKIGIDEKYLKITELKYGAFERTVKFPVLPRIKDESIKASYSNGLLHI
FT                   KVPKILDGTEKPAPKKRITIEDVPDEELEFEENPNPVQA"
FT   tRNA            73771..73842
FT                   /gene_name="tRNA-Gln (TTG)"
FT   CDS_pept        74016..79481
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348413"
FT                   /locus_tag="CAGL0E00847g"
FT                   /product="Similar to uniprot|P11075 Saccharomyces
FT                   cerevisiae YDR170c SEC7"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58643.2"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG059810"
FT                   /db_xref="HOGENOM:HBG355338"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00017BD7B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVM0"
FT                   /transl_table=1
FT                   /translation="MADIEDPVVAPGVSAEPDVVAADANGDGEVQEQEQQQEQEQVHEE
FT                   IQEEQDGDVSRLGTGKMHSRNPSSVSAGSVNVQSSSPLSKTILETILQERDIKKYPNVQ
FT                   KSIERALDKLKETGATNPIDSILVFEALRSTCRTGSSRIQSKALDGLSKLFSFHALDET
FT                   VLVNPPDSNASNDQTTAQQEGVTPPPKQKLIDAAIDTIADCFQGESTDERVELQIVRAL
FT                   SGCILVEDAHSNCHGASLLKAIRTIYNIFIFSLNPSNQGIAQATLTQLVGAVFDKIEVK
FT                   HIDPSSSALNVSNWDDSKSPAPPLTLANLENIDKETDKKLVSGENNGDDNDKEVNETVG
FT                   EEAQTNQELNIKDAFLVFRTMAKICAKPLDAELDMRSHAVRSKLLSLQLIYSMLRDHID
FT                   VFLSHHIYLPGKEKVTLLDSIRQYLCLSLSRNAASPLSAVFETTLEIMWLMIANLRADF
FT                   KREIPVFLTEIYFPITELKTSTAQQKRYFLHIIQRLCTDPRALIEFYLNYDCDPGMPNI
FT                   TEMLVDYLSKLALTRVEISQTQRSYYEDQLSKPLATYNFDQFPLLTTSTLSSGPDSSQT
FT                   PLPFPLEYALKMTSLNCVVAVLRSLSLWAHKALNSNSGLQGQISSFSDMNRSESNTSLS
FT                   NAGRSSMTRIDESVGEDSEAQSLNKQLEADDPTQFENLKIRKTKLSNCVNAFNLKPKRA
FT                   IPLLLQNGFINDESPESIAKWLLETDGLDLAMVGDYLGEGDEKNIAVMHAFVDQFDFTG
FT                   QSIVDALRDFLQKFRLPGEGQKIDRFMLKFAERFVDQNPGVFSKADTAYVLSYSLIMLN
FT                   TDLHSSQIKNKMTLQEFLENNEGIDNGNDLPKEFMVNLFNEIANNEIKLLSEQHQAMLN
FT                   DETTMTAPPTPSAFNFFSSRDLAREAYMQVSKEISSKTELVFKNLNKTKGKNGDVFYAA
FT                   SHVEHVKSIFVTLWMSFLAALTPPFKDYDDLETTEKCLEGIKTSIKIASIFGIDDARTS
FT                   FIGALVQFCNLQNLEEIKIKNVNAMIVLLEVALSDGNFFKKSWKDVLLVVSQIERLQLI
FT                   SKGIDRNTVPDVAQARVANPRPSYESTRSANTSYIFDIWSKKATPMELAQEKHHNQQLS
FT                   PEISKFISSSQLVVLMDNIFTKSAELSGNAIIDFIKALTEVSLEEIESSQYASTPRMFS
FT                   LQKMVDVCYYNMDRIKLEWSPVWAVMGNAFNRIATNPNLAVVFFAVDSLRQLSMRFLDI
FT                   EELSGFEFQHDFLKPFEYTIQNSGNVEVQEMIIACFRNFILTKSSKIKSGWKTILESLQ
FT                   YTAQSGNESLVVKTQSLISDDIVDAHFESIFVQEDSFAELVGVFREITKNKKFQKQALH
FT                   ALESLRKITQRIAKICFDENGESKEKNLLQGKDIFQDIWFPLLYCFNTTIMTAEDLEVR
FT                   SRALNYMFDSLVAYGNQFDEQFWENICKKLLFPIFGVLSKHWEVNQFNSHDDLSVWLST
FT                   TLIQALRNLIALFTHYFDSLNNMLEGFLDLLVSCICQENDTIARIGRSCLQQLILQNVS
FT                   KFNEKHWEQIGNVFEKLFELTTASELFEYDPLHQGRQNSSKTNDPKNAADDGNVHETVQ
FT                   RAQQEESSEDVGNETMDSVKKEDGTTSPSAVRSAKTFEDLRPKISIKNSIVVKCVLQLL
FT                   MIELLSELFQNEELEHHIPYKQYIQITKLLEKSYEFSRDFNADYGLRTRLVEARVVDKI
FT                   PNLLKQETSAAAVLIDIMFKLYLNDDNKKDELASRLIKICTGVVQGYVTLDDRTMERSI
FT                   ISWRPVIVEILQGYYEFDDDDFKKFCAPMYGFIIQILDKSVPTELRHAIKLFLGRVGEL
FT                   YLQIED"
FT   CDS_pept        complement(80514..81338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435519"
FT                   /locus_tag="CAGL0E00869g"
FT                   /product="Similar to uniprot|P39015 Saccharomyces
FT                   cerevisiae YLR150w MPT4"
FT                   /protein_id="CAG58644.1"
FT                   /db_xref="HOGENOM:HBG059808"
FT                   /db_xref="HOGENOM:HBG396732"
FT                   /db_xref="InterPro:IPR019084"
FT                   /db_xref="UniParc:UPI00003B61E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL9"
FT                   /transl_table=1
FT                   /translation="MSNPFDLLGNDVEDPQAAIPLATKEVVKKSTSSKKADVPPPSADP
FT                   AKARKNKGKLSGNEGAIRDKKAGRDNNRARDVGSSATARRNNDRKMTDRHSRTGKTDSQ
FT                   KKINQAWGDNDRELTVEEQAKRDAESELAEDAEAPETQPAGPQKMSLADYMNQVDNNDL
FT                   NKVPEARKVEETLQAEAKSDVPDYAPATKTKAVKSKQLKTKEFLQFDATFSDNNRDNRD
FT                   SNRRGGFRGNSRGGRGGNRGGNRGGKSNSSRGGKNTAEVNKKIDTSSLPSLI"
FT   CDS_pept        81876..83291
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435520"
FT                   /locus_tag="CAGL0E00891g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58645.2"
FT                   /db_xref="HOGENOM:HBG124527"
FT                   /db_xref="HOGENOM:HBG398803"
FT                   /db_xref="InterPro:IPR018818"
FT                   /db_xref="UniParc:UPI00017BD7B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL8"
FT                   /transl_table=1
FT                   /translation="MTTDKPLSTSSPEAVVAAAMVTPQLLSELLARSGPLAIRHITHAL
FT                   TDQIPDFSKLSSSKQRRLIMGAMDAGDRRNSVVFEKIGWGQWTVKPVLPDQDFDLVLRE
FT                   TNISNAKVKDIVSQESQRRRNSKKLATTGTTGTTGTTGTAAATAVTPGAAPAPAKHSET
FT                   TNINSANVSPKAQHAQPAQPRATVYLDENAVDSDDDEDPHADLLLSDHKQHKPTATTFL
FT                   NPERRRSTVLMAEHSPETSLEFELLAQKVRPIIKGRRRSSVKAHSPFVIKPSAAQTHQD
FT                   ATSVFRHNNNSTSAIAYQTSVSGPGAAVPTGNNTGNGKIDLDTTPNSEPTSRRASRLSS
FT                   SKESSIRSTLFPNKNYRWIAKNPGLAHSTNSINKQPQDHFKINHYDIATVDNVLNDHHS
FT                   ETDEEDWASIGAASLRRSSAISSSVNLVNNSPSPQSDDSIKHESLHSNDPRITPTKPAE
FT                   DKSAAYLLMSLKS"
FT   CDS_pept        complement(83838..85415)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500590"
FT                   /locus_tag="CAGL0E00913g"
FT                   /product="Similar to uniprot|P06101 Saccharomyces
FT                   cerevisiae YDR168w CDC37"
FT                   /protein_id="CAG58646.1"
FT                   /db_xref="HOGENOM:HBG059806"
FT                   /db_xref="HOGENOM:HBG397566"
FT                   /db_xref="InterPro:IPR004918"
FT                   /db_xref="InterPro:IPR013855"
FT                   /db_xref="InterPro:IPR013873"
FT                   /db_xref="InterPro:IPR013874"
FT                   /db_xref="UniParc:UPI00003B61E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL7"
FT                   /transl_table=1
FT                   /translation="MAIDYSKWDKIELSDDSDVEVHPNVDKKSFIKWKQQSIHEQRFKR
FT                   NQDIKNLEAQVGMYSFLNKRVDKLLGSLADEDLAEQDKVTKFLNENFDKNEKSVGENVD
FT                   PQIATYNEMVEDLFDQLRRDAIKDGQDPRNGAVLRELMLKHRKKIDDVTKEANEKLKQL
FT                   YKEKQAHISSDDIHTGFDSSFMNKYKKEEERKARELEKSAEKAGVTRTSETALPPKSIA
FT                   EASTGTQIINEEAQESQQAVQTQSTTDDEDMLHLFPETEQFSKIPTGDYKKSASFLMEN
FT                   YQIITEQQKDALMMKAFESQLKHDEKRTYQILHQAEILAFIDSIYNVQRSPTLDVQRLK
FT                   NSIEVFFKRVFLESRIEAAKAQFLDSVNTKFEHVKKRCVILEEEERNNEGQGVETIQLK
FT                   TVDESTQIEFELPDFESSDPNEIERVKIFGQLPKNLQEALKTKDLDTVNEAFADLPIDI
FT                   AEHALDLLGEAEIIKVAALLENEEEFKHLQEEYKNEHAMESLNIEEEAKSNDVAEEDEP
FT                   QNTADIVD"
FT   CDS_pept        complement(85715..86371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435521"
FT                   /locus_tag="CAGL0E00935g"
FT                   /product="Similar to uniprot|Q12030 Saccharomyces
FT                   cerevisiae YDR167w TFIID and SAGA subunit "
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58647.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="HOGENOM:HBG138910"
FT                   /db_xref="HOGENOM:HBG398309"
FT                   /db_xref="InterPro:IPR003923"
FT                   /db_xref="UniParc:UPI00003B61E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL6"
FT                   /transl_table=1
FT                   /translation="MDVDKDVDMKEDEVLDEFDDNEDEMPVDNAALFGRAEAAAGTGGD
FT                   AGAGAGADAEPSEGNAGNAEEKAYIDDGTGKLFQLPEFTRKDKTLGEVLDMMKENPPII
FT                   PDAVIDYYLTKNGFECADIRVKRLLALATQKFVSDIASDAYEYSRIRSNVAVQNANNGQ
FT                   TKARQLMNGQQSQLTQQQQQQMEKNSASKVVLTVNDLSSAVAEYGLNIGRPDFYR"
FT   CDS_pept        86682..89627
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500591"
FT                   /locus_tag="CAGL0E00957g"
FT                   /product="Similar to uniprot|P89102 Saccharomyces
FT                   cerevisiae YDR166c SEC5"
FT                   /protein_id="CAG58648.1"
FT                   /db_xref="HOGENOM:HBG059804"
FT                   /db_xref="HOGENOM:HBG203183"
FT                   /db_xref="UniParc:UPI00003B61E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL5"
FT                   /transl_table=1
FT                   /translation="MAFQVDEHKLLEMYNLNELNPADSVDNDWQRVSTIQYDLGAWQDS
FT                   GKMLEERPYALLSDLIAQQKGASQGSRGLQGGIDASTVNDPLDGQLVLEKMRQLRMNPE
FT                   QAPQYLVNSKNFDAIQFLRGMHNRDSFDELSQYLDRLDRELQTQAGDLQHLVQTNFTKY
FT                   VKIKSRLDQIYSNFSEGGEQENQNIMKVEKLKEELDETIRFTTQKLNPVINYEKKINNF
FT                   KLTKRFIEENKFFINLPKQLKSHLIQNNYNKLITDYLKGKEQYDKLVQYFENKVVAEFH
FT                   DNEEESNINKTPKVIEVIWSACQSIVEIYKSQLWRLITTPSVIGNANKIAGKQSSEIDI
FT                   SIETPEMFLPNISRLLDLNIDENPIIKWIESRIDYLETKLRDTAQNMILKITNAQQNII
FT                   RNQVSHAAETERDTDAVELEHYTNIDKLFSHGAFMKKGESGDSNNNSNTMISSAPTFGD
FT                   GTIISQGLTDSIIVIEMWLLILKYAQQLNELSARFIQLWEHTEKFLDGSYQTILINEKR
FT                   KENILLVGDFNACEKYQKQIHLSDDEVKGIRLKGESFVKMIADRIFILFQSSQSSLSQF
FT                   TSEDVSMDDMTWEKEIGLPSNYGFIPPNANGLSCLRYLPLIIEPILRFSSDLAQLKITP
FT                   KSIEIPKKLASIIIGRSVSAISSTKLRDIANFHKLENWEKYEFVNARKDDLNDSNYEYA
FT                   ITQFPTIIKSFQELSIKTIRDIVFSFEKLPTIGGVSIIEYPSKKVLTGIEIQQIISMEA
FT                   VLESILKNAAKDKDNPRNPHTILTLTNLQCIRESTFPDILQFFDDCFEWNLKTKNLELF
FT                   NLLAKMEQSIFGNYLSDLKISLRDTLESKFNEIDWATYTSTSFRAGDYIIESLMVLVSV
FT                   HSECSRDGPQLIDRILRESHIFIARYLFESFKPFIGNISADGLLQVTVDIQFFQRVLGR
FT                   LLDKDTESTLGATLQNCFQNNAERLKMCIKETEPIVNANLKRTSIQFSAFK"
FT   CDS_pept        complement(89783..91048)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348414"
FT                   /gene_name="TRM82"
FT                   /locus_tag="CAGL0E00979g"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase subunit
FT                   TRM82"
FT                   /function="nucleic acid binding"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58649.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG059803"
FT                   /db_xref="HOGENOM:HBG397716"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B61E6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVL4"
FT                   /transl_table=1
FT                   /translation="MFVHPLNVAISDSQNKYQYVVCKHTISVFAGEKLVGYWVDTDQRD
FT                   SHNSYKKLKSNAGDAKPKGSQGIGAPAVYSYIRNLRLTSDEGKLIACVDSDKSVVIFKI
FT                   DTSAEDPEKFLQVMKRQQFPKRPNALALADEDTTIIVADKFGDVYKLKIDEEPIRKIDD
FT                   QSEPILGHVSMLTDVAVAKDANNKSYIITTDRDEHIKISHYPQTFIVDKWLFGHKEFVS
FT                   SVDLPKWQTKFLFSAGGDKEIFAWNWQSGELLSQYSFEDAVKPFINDQHLAPARFQNEE
FT                   NNVIEYAVASIKSCGQQPYVAFFVEATPVLFILHCNTETGELSLAQQVEFKHNVVSISS
FT                   NGKSEYLVTFDNRDENAEQLIAFLTYSGDSNKPFSVDENLNKLNSSWISTFKQKDELLA
FT                   DADSVYPLYNIASLKKHGEHFS"
FT   CDS_pept        91396..93486
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435522"
FT                   /locus_tag="CAGL0E01001g"
FT                   /product="Similar to uniprot|P30619 Saccharomyces
FT                   cerevisiae YDR164c SEC1"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="CAG58650.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG028551"
FT                   /db_xref="HOGENOM:HBG397714"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI00003B61E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL3"
FT                   /transl_table=1
FT                   /translation="MSNLIRLQREYVLSTIDSIETDHGLKFLVIDAEVKRFFDMLNLTE
FT                   RELLSHVTSVDFIDSKSRKGQPGVSAVYMLKATQFNINCMDVDFQNRPPKYKNAHVLFL
FT                   VGIGGTLSEFYRSKRFVTQFTRSVKMLNMNFMVKESQYFQAYDIDKPLQLLFNPNCRDL
FT                   IDDVVERTVRALLTMCVMTGEYPIVRYYNTGLCRRIATDFQESLDDHARNNEDFFTDNS
FT                   RPRSVMVIADRTVDMFAPFLHEFTYQAMAYDLSDNITASDDIYTYEVENEAGEKQVKKT
FT                   PLLDIYDEDWAQTKHQHITDVLKYVDGKINELIAQNPKLVDRSKAKNAADLGLILAHLS
FT                   GFDEERRRYAAHKELVTELLQINSQRKLAEWAHIEQNIAGFGLDAQGHKCKHLTDELIE
FT                   VLARKEPDTLDKIRCIILYAIFRGGLIELDFIKLLTFIGVNEEHEFFHSFMILFKNIGM
FT                   LGINIIKEDPKTKPFKKVWFSDTIIDDPNVFDTSRYIPAVGNILSKIITNPLLLDEESF
FT                   PYVKDKPIELLDEEELGEGPHLATQNSTSLRKTRHRANWTKRNEPVDRSPRQRFFFYMA
FT                   GGITYNEIKSAYDQSLLKNKDVFIGSDGIFTPRSFMRSIEKLDAPREELHLNDDKKVND
FT                   RPPEFLFQDIAPTIERPTHVQRVPIHPDQSKQQLTPEKPQEPSSPKKKKRSKFNLFKKK
FT                   DK"
FT   CDS_pept        complement(93551..93982)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044044"
FT                   /gene_name="CWC15"
FT                   /locus_tag="CAGL0E01023g"
FT                   /product="Pre-mRNA-splicing factor CWC15 "
FT                   /function="RNA binding"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG58651.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG124529"
FT                   /db_xref="HOGENOM:HBG203182"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniParc:UPI00003B61E8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVL2"
FT                   /transl_table=1
FT                   /translation="MTTAHRPQLEARNGAKGALVPTGTEHARLLPGHTELKARKPKNKT
FT                   TSQIQTSSDAGSVDDSTSAGTNIGTGSATLGPSQVQKMIQPLEVEDKKDIKLVKKEDDS
FT                   VSWGKTAFSRRKKVVKPEKFTNDTVRSQKHKEFLNRFVK"
FT   CDS_pept        94265..94906
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348415"
FT                   /locus_tag="CAGL0E01045g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58652.1"
FT                   /db_xref="HOGENOM:HBG124530"
FT                   /db_xref="HOGENOM:HBG397666"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI00003B61E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL1"
FT                   /transl_table=1
FT                   /translation="MVENTDSTHGDAVNPGPEGEAVEVVDDLHSYISIKDYAYDESNAL
FT                   HYGYLEEEVPGEAVQEHDNYAGSDAEDGEDIDGNHTDKRASVVMPQDYVVNQKAVALYD
FT                   FEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFVSYLDSEESDSVRP
FT                   FYLTEMLTHGLQAEPEQDAKAGKKDDDEDEWEDIDQLESDMDSKLNISVS"
FT   CDS_pept        complement(95318..96454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435523"
FT                   /locus_tag="CAGL0E01067g"
FT                   /product="Similar to uniprot|Q03771 Saccharomyces
FT                   cerevisiae YDR161w TCI1"
FT                   /function="binding"
FT                   /protein_id="CAG58653.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059796"
FT                   /db_xref="HOGENOM:HBG395434"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B61EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVL0"
FT                   /transl_table=1
FT                   /translation="MEAVIVQAKEALGENDCKKALKLLKLYKSQVDNGSCSDPELYKVF
FT                   ADAYLEDGQLDKAYPCLVKSCELDPQGTKTGTDQFFTLGQVVGGPDGIQLISQGIENVS
FT                   NEGGDNLNGEQVNKIVGGLLSMIEIWMTDLCMEPEAESQCEELINKALEITERGSPDVL
FT                   ATLGSIRISQQKFNEACEAFSLAWELFEKKKDEISNNLDSESSGANELVELLQPLLSLA
FT                   KMCIEVGLYEIALKVIGAVRDIDEDNIEGYYLEGFTTYMIAKVGTFQQQNPTVEMKPET
FT                   IYEFNQHIQEIALNLEDEVVNGLIQDARISLSFAVKIGEASDPNDEVVSEIVAGANSVL
FT                   QEIGGEVDAKILMKIKKGEPLEDIEANLDDEFESDNDI"
FT   CDS_pept        complement(96819..99380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044045"
FT                   /locus_tag="CAGL0E01089g"
FT                   /product="Similar to uniprot|Q03770 Saccharomyces
FT                   cerevisiae YDR160w SSY1"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58654.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059795"
FT                   /db_xref="HOGENOM:HBG396224"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B61EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK9"
FT                   /transl_table=1
FT                   /translation="MGEERSNLFPGRNNIEVVISDDDLDDDYIDDGDGISIKPANSIDT
FT                   GVLRSIIEEEGWYDTGRYYDEVRNHRFYVTERYMDKRKIGLADMLNSSSILSLNYDNHS
FT                   MNDFERYDKKVRKEAELRDVLEDILKKQNNDGLQVVEDSILHEKYTSPNTETNNKKNSC
FT                   ARLRLNVLKSAFQGAYSKSANPSRSKNAHTNNDIRNNFDNMSSRTYVIDNASDGNVAID
FT                   ENIDYETMKRSVSIDGNVHSNFYDSDQEKKGKRYIHEKINKYLHDSTRRRNQLQRNLKV
FT                   RHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVVIATMMSFAELATLIPV
FT                   SSGFSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVSSTFYFSHYDHLKLTRGGTAGF
FT                   VTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITIMIVIVMLVLNAGHGFDVHGRVSFR
FT                   YWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRGRFIAVVSVMLVSTFAFSGV
FT                   EMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIFSVSINIYTGDPRLLSYYTGALE
FT                   SRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSSPWVLALENFGFCSFAAGFNAV
FT                   LIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGVPYVAIGFSSLFAIVAYLA
FT                   VDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRRDIISRDDVFYPYRSPFQ
FT                   PYLSMFGLLGCSIFVLFMGFINFIHGYWNTKSFFSSYGGLILFGVCYLGYKLISTSKIQ
FT                   RLDQLDLDTGRREIDRILWTEHRQYRGPYSERLKKLYNWLI"
FT   CDS_pept        complement(99759..103346)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435524"
FT                   /locus_tag="CAGL0E01111g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58655.1"
FT                   /db_xref="HOGENOM:HBG059793"
FT                   /db_xref="HOGENOM:HBG203181"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR017173"
FT                   /db_xref="UniParc:UPI00003B61EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK8"
FT                   /transl_table=1
FT                   /translation="MDNGKGQFLGPLVDSPEKFGFQRRSHGPRQMPKFLIAQQPQLRTK
FT                   PFKQDSWDKSNQQKMLQLEESIDDLTDLYERLRKMREMERKMMENKGLVDKADHAKDLN
FT                   DAIVFQGTCLDMCPIFERSRRNVEYTVYSYEKLSPDDKKAARSKALKVFARPAAAAAPP
FT                   LPSDVRPPHILVKTLDYIVDNLLDTLPESEGFLWDRMRSIRQDFTYQNYCGPEAVDCNE
FT                   RIVRIHLLILHVMAKSKVKYSMQQELEQLHKSLITLSEIYDDVRAAGGTCPNEAEFRAY
FT                   ALLSKIRDPQYDKTIQDLPDYIFQDDLVQLAISFRTIISNSGFIERGFIKTENCLNYYQ
FT                   RFFKLIKSDSIPFLMASFLETYLGEVRFYGMKALSHSLNKKHKPLDFKYVEDMFLFNDR
FT                   EELLYFCEYYSITITDDGVDLKTLPHHSHKIPEKKPLNQSYLQCVEEKLQLSSKISIVN
FT                   SGKPNSGEFFGNAIPQSKVKNLSVLKAAVQQPTNPTKPQNPFTFGKPEKRKDNSPLQVK
FT                   TPALLKPTSATLKIEKKGNPLVSQTMSSDVSTLPTTSSVFQRTESRSPSKDIELSKIEP
FT                   HQVPMKANFEFNQSKTTNSNKNTLNPQTTAKLKNIPKEPEKSNSGKISISKVQKESLIL
FT                   DIYNQVKNEVIHKNVSNIVEVSLKQRSHKSQIISDFSGDLFRAFIHEQLYMIYLQSHAD
FT                   ILLEKSMGKKYLLTWLSKTKKKINKKKEIKQRSESIRIVSKQLGIPNYSIVPNEVNSSF
FT                   VNKTSNVSFQSKGRDFSPLQLEKCNVSHSMVKQMKFWQPMDIKSLYFQKVLKKIPPSQN
FT                   ISILVILDNQNTIPNNWVLEKFSIKDSKKSTISVDDKNLNIIPYSLNSKDEDIKDTCLI
FT                   AFNTGVTDFDIFDLEMKLKSDGEVLVKMISDIAAKANIKFTILVLYWDSQETPFSEDLI
FT                   SQYLKLKRITKHFSSLLQDIIIVNIGGKDPHKALEYSIETCGDLFTYKLTGRGEYYQRL
FT                   KVEKRVASSDVDTINSQRIDAKLKRVLELEEKRYLQQIEETKKRKQNTYAHLESHILAS
FT                   PKRLKAKLPVLSSASGERKYRTPMTLKRRIVSTTPGDYPSTPTVIPPSNQGNAKRQKQI
FT                   ILSTPIQKKRPASLHVMPSSSSTDKTPVITVIGNGNLDENIHDSVLYRTPMNGSTINSN
FT                   DQSGIETPSNLSNLEELKNLISSVKKKFK"
FT   CDS_pept        complement(103874..104947)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195165"
FT                   /locus_tag="CAGL0E01133g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="NAD or NADH binding"
FT                   /function="NADP or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58656.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000063"
FT                   /db_xref="HOGENOM:HBG518238"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B61ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK7"
FT                   /transl_table=1
FT                   /translation="MKTAGVLGATGSVGQRFILLLADHPDFELKVLGASPRSAGKKYVD
FT                   AVNWKQTDLLPESAKDIVVVECKAEEFKDCDVVFSGLDADYAGPIEKEFMEAGLAVISN
FT                   AKNYRREEDVPLVVPIVNPEHLDIVAQKKKQNPKAGFIICISNCSTAGLVAPLKPLVEK
FT                   YGPIDALTTTTLQAISGAGFSPGVPGIDILDNIIPYIGGEEDKMEWETKKILGKLSPDN
FT                   STVELISEDDLKVSAQCNRVAVSDGHTECISFRFKNRNVPSVEELKKTLSDYVCDAYKL
FT                   GCHSAPKQTIHVLEQNDRPQPRLDRNRDNGYGVSVGRVRADPVLDFKMVVLSHNTIIGA
FT                   AGSGILIAEILLAKNLI"
FT   CDS_pept        complement(105187..105393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195166"
FT                   /locus_tag="CAGL0E01155g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58657.1"
FT                   /db_xref="HOGENOM:HBG124531"
FT                   /db_xref="InterPro:IPR013239"
FT                   /db_xref="UniParc:UPI00003B61EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK6"
FT                   /transl_table=1
FT                   /translation="MSGGREPKIMLSGPVVVKQRGVPQHVSREEMLAFLDKFVQQKEDA
FT                   TGGSLALLKRIQRDFKGLPPQTE"
FT   CDS_pept        107362..107850
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435525"
FT                   /locus_tag="CAGL0E01177g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG58658.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00003B61EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK5"
FT                   /transl_table=1
FT                   /translation="MSKVYFDIEADGQPLGRVVFQLYDDVVPKTAANFRALCTGEKGFG
FT                   YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFVKRHERPGLLSMANAGPN
FT                   TNGSQFFITTVPCPWLDGKHVVFGEVSEGYDVVKKVESMGSSSGATRARIIVSKSGEL"
FT   CDS_pept        108041..109279
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435526"
FT                   /locus_tag="CAGL0E01199g"
FT                   /product="Similar to uniprot|Q03769 Saccharomyces
FT                   cerevisiae YDR153c ENT5"
FT                   /protein_id="CAG58659.1"
FT                   /db_xref="HOGENOM:HBG059901"
FT                   /db_xref="HOGENOM:HBG203179"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI00003B61F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK4"
FT                   /transl_table=1
FT                   /translation="MDSLSKKIQNLGIHDLRNAARFAQNVIVQYEPYQVDVRRATNTDS
FT                   WGPTPKHLAKVLRNRYQVPLYLITEYILKRLIDHIAQRPKNLYEKARKDYVNYGSEWRV
FT                   VLKCLVVIEYLLMNVDDGDEINQVRSCLLTHKHLISKEVLNFKIKFSNDGKMEVHERGI
FT                   RKKGELIMQFIEDSKFLKQERLKNKKNALKIKQQGESDMLYNADAMASVSTYGSSSMRG
FT                   SNNFDYGEDLDFDDDDDDDIPVDNRPRRRPSHADQQRKQRREILREQIRNKEQQRRDYY
FT                   QKKKEEEEAANVPDLISFDDLEPKGTTNTSTKSLYPSDSRLPSKSATIGEVDDEDEEDE
FT                   FGDFQSEVAPGSSKPAATTANASTTKPAAATAAANDDLMDLFGPSKTPVEEVKKPAKKD
FT                   AFSDLFASSKSLI"
FT   CDS_pept        complement(109633..110415)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191823" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435527"
FT                   /locus_tag="CAGL0E01221g"
FT                   /product="Similar to uniprot|Q03768 Saccharomyces
FT                   cerevisiae YDR152w GIR2"
FT                   /protein_id="CAG58660.1"
FT                   /db_xref="HOGENOM:HBG339025"
FT                   /db_xref="HOGENOM:HBG444493"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B61F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK3"
FT                   /transl_table=1
FT                   /translation="MDYKEEQEQELEVLRSIYPDELEVVKEYPGVKFELQLKLELQELI
FT                   DTSHLSKDHTLHCTFQLPEEYPDVNPVISIEVEETLLNSDDEGEGEDEDEDEQQYDEHG
FT                   NRLMSKYENIPDTISIADYVSGPLVAELEEQIETDMLSGMQMCFALISSIKEKAEHYFL
FT                   EQLTLKQKQHDQELQEREKEEQAKFHGTKVTRESFLGWRTKFRQEHGLDKRDEERRLQA
FT                   HHGRLTGKQMFEQGIEGTLDDIDDTDVQEVATKLQDDL"
FT   CDS_pept        111051..112412
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435528"
FT                   /locus_tag="CAGL0E01243g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58661.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124533"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI00003B61F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK2"
FT                   /transl_table=1
FT                   /translation="MSDIYTEFSESVFSERHGQHQYLKMAHANMYGNGGASEVQNVEIQ
FT                   PEADDYEARIKEIEEYYLKTLLNEEPSKRNSGYVGASGIKSVPSLELDDQANPSSSSSD
FT                   VSIQDISTSPGMMYSKFNTHLVGNSPAVYGAAANNALFNNLNSLNESQYIYGKSINNES
FT                   LYFRQQQQLQQQQQQQQQQQQLLQQQQLQQQLQLQQQQPTFLDSNVQTNYANQEFVNSQ
FT                   ANVTPLNYTNIFNNEISAKPAKTHKINPFLQDKQVSRKSNLEVDIKHHYQANALPLTSE
FT                   NLQKMQDLSIDDMPIESINRKKFHIQKTTVDPTKQINSEPKVKEHQQQQQQQQINKGLY
FT                   KTELCETFTTKGFCKYGNKCQFAHGLQELKLKKTSNNFRTKPCINWDKLGYCPYGKRCC
FT                   FKHGDDRDIQIYKKAGTYTANPDGSDASERKLTEVQIKQKNLHANIKKLQKMTW"
FT   CDS_pept        complement(113167..119454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435529"
FT                   /locus_tag="CAGL0E01265g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58662.1"
FT                   /db_xref="HOGENOM:HBG124534"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniParc:UPI00003B61F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK1"
FT                   /transl_table=1
FT                   /translation="MSHTSDHELEDGLEKLKEQMKDVPEGSESVTDVLATKDNTDELPM
FT                   FMASNSYESMMRATNNSKDINFTMDLSENLLMECRRLQAMNEKFKKKIEQLKQENHDLV
FT                   EDQQKHTTGTEKLQQELDDLKHLNWDLEANLDSCNNALRLIRNEKNDLDENYKTTREQL
FT                   DAIRTESEVLKLENQKLQSQLSSHVANIDQESKSMRQRLSNLNDENDELSSKVNSLETS
FT                   LSTLKNGLLRFLKKQKLVEEDTSDLEDDFFDTRSIDTMATEINNDLPIEKLETMAQSHN
FT                   CKLIPIDQDTESYKLNSLPLESIINKINDSEDFEVISRKELETLREQVKNPEITIERVK
FT                   DSLSSDNKDQQIKLMKWIAQLNSRIILTEDKYNEMNNRIFNPNRAQLSETAEKIGLNVI
FT                   EKNDLENLKEKALNPSVDLIKIFARNNNMTAIPTERYEMLESSYNTPTKEFLEERANDL
FT                   NHTLIDKKSLNDMRESIENPDISFIKEAAKKFNEKIISTAEYEEMMRCLENPSLEFLTS
FT                   KAEQMKQKIIPAEVFEDLENTSKHPSMEFLNQKAFEAGYKVVSVSDYDQLKRSVEQPSL
FT                   DFITEKAEDYDQRLISSDEFEELMQISQDPPIDFLSARASAKGYEMLKTKQYDDLLRKT
FT                   NEPTAKELAAIASGVGYVAIPDSEYLTLKEISENPSMGILREKAEAYNHVVIDKNEYED
FT                   MKMKSNDKNAAIENIASFGFKAVPLSEYNELIDSTLENSSLEDLRKRLDSEGYVMVERD
FT                   IYNKLSLPVFERGSLDDTMKLCEKFSLRAVSKEEFEELEKSASSPVLSIDELIERVKSH
FT                   GFMVHSLEEHKELQKKFEEPDINYLIEKAQKYNVVLIDSNENSRNEELIKNTPLSFVRE
FT                   KAALHDCSIIETKKLEEMQTQIEQPTIEMLKETAEKIDCIVMTSEEKTKLDEHMAKPPL
FT                   DYLKEKARRQRKELVDLVEFRELIRKTTNPTGDEIKQYANSLQSVVLLNDEYNDLQKQI
FT                   EYPTLDYLVSSLEKFNYVAIPKEEYEHSVDRYNNPSNDYLSEKLADNGMIMVNNNEYQN
FT                   LLLSVDNPELAYLEEKAKAFRKIVIDKEEFQYKLDIFENPSLEFLESKANNINKQIIDK
FT                   DELNDLRDKLRNPTEDYLIEHAELQNKTLVDKTDYQCKLRQLENPTIDFLRNMARKESM
FT                   VLMAKNEAETMQAMLSQPDLDYLKASAKELGYEIVELARYRELVNNSETPSFEFLQSKI
FT                   HSMNYVIVRQEKWESVKQKAENPTEEELKSYAHNYNLKVFTSDELNDFIAQIKLQERNN
FT                   TSPSSKVKASKQYFEQLIKEQKQQPGKIKEHAQALGFVTLPTDEYENLIKNQKDSALKK
FT                   EEIYRAAREMNMTVIDKESYSKFIQQRSSPVKLTYEELQSLATKMDMDLIKRTPDLRSN
FT                   SSGTRLNFVEKEESAEDSSSSSTGEKSENLTQNKSPFLTSNTSSLTLEELTNKAKELGY
FT                   ILSPMRKSASPLSDIPDLTSESTATNSTLTNTHENHSSLDLSKITQDNHKAQSKTIPNK
FT                   LDINTVQELLKETEYELINKKQLKELKSVRKPSKPTKPTEKELQKIASTLGLSLLTQEQ
FT                   LKDLEDPAKLSDDDLKKEASKRSLIVLSLKSYKALLSKERQASKPIPKITRLEIVKKAP
FT                   VHGLIAIDQREYNSLKTDNKKIDIGKVDENMLRTRAKELGLVVMDKNDASHMERVSKPK
FT                   TKLELIKLLQIRYNLVAIPRAEYSKLKSQITNAKSTESPSSTAEIETNAKSSNITDVEQ
FT                   MKQELSSQGFLVVPSTCFISTAYAKTPTTKKVVVLPRMYYMTLLARSNPRPIKRTTLSS
FT                   RNNTSNLDSTLVSEASELPLKSKTAPSSPASEVPPNTISSALYGGTSFNESSTVKSEST
FT                   PLSFSPTQSPLHTPSKRTAKKPPMNRSTSVDTLGTLNSIASMNEKTMIPALTQTVIGEY
FT                   LYKYYPKLGHIGGEGRHRRYFWIHPYSMTLYWSETNPVMENAAQSKTKGVSILNVSVIP
FT                   DNSSHPSGLYYKSIVVTTDDRNVIFTCPTRERHMVWYNSLRYLLQRSIDGIPYDEIVED
FT                   SDNDMYAGKVFPLGRQGQHVPGRLGTRTTMRSPSISSLRDRVKK"
FT   CDS_pept        120804..122045
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500592"
FT                   /locus_tag="CAGL0E01287g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="dihydrolipoyllysine-residue succinyltransferase
FT                   activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="oxoglutarate dehydrogenase complex "
FT                   /protein_id="CAG58663.1"
FT                   /db_xref="GO:0004149"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0045252"
FT                   /db_xref="HOGENOM:HBG395225"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00003B61F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVK0"
FT                   /transl_table=1
FT                   /translation="MLSRSAVCAKRYITPRHVAAWKLPVQKVVPAYLSQYRWASTSVKV
FT                   PSMAESLTEGSLKEFTKKVGEFVEQDELLATIETDKIDIEVNSPVSGTVTKLNFEPEDT
FT                   VTVGDELAQIEEGGAPADGGAKPAAEESKPAEESKPAEQAKPAAPAAEKKSAPVKKPES
FT                   PKQEASNAAQQAPSTAAFSRNENRVKMNRMRMRIAERLKESQNTAASLTTFNEVDMSAL
FT                   MEMRKLYKDEIIKKTGTKFGFMGLFSKACTLAAKDIPAVNGAIEGDQIVYRDYTDISIA
FT                   VATPKGLVTPVVRNAESLSVIEIEQEIVRLGQKARDGKLTLEDMAGGTFTISNGGVFGS
FT                   LYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKT
FT                   VKELIEDPKKMLLW"
FT   CDS_pept        join(complement(123802..123933),complement(122390..123676))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435530"
FT                   /locus_tag="CAGL0E01309g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58664.2"
FT                   /db_xref="HOGENOM:HBG114955"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00017BD7F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ9"
FT                   /transl_table=1
FT                   /translation="MITSPLQGSPTSPYCILLQLYNRNWRSSDLHVASDLNSDSLCLYK
FT                   RLSMSYLKRKVYGSGKDKDLISLDSIPFTEKLLNPLTEENQFKQQVFEVIRELKLWDHE
FT                   CSDINKFKLRKIKGALTNIIYEAIYDDSSSLLLRVFGAKLEAIVARSYEIKVLQRLRES
FT                   QLRGPVILGCFANGRFEAYVRGSASVARNDLADPWVMQNIAMRMNKLHTEVELTSDEQY
FT                   LYGSCFQKLSDWFSILETVGEQWISDKKNLEKYLHVNDWQFFKDSVATYRDWCFANTHY
FT                   SSQDNFVFCHNDLQHGNVLLIDKDNEKNKNLMLIDFEYAGPNPVAFDISNHMSEWMHDY
FT                   DRLDSYKSDYDRYPSKDKIDEFIDCYLHHSHTPRTMLDKQKLKHDIELWRPCAQLFWSV
FT                   WAILQSGTINTTTVNSRDATPEVNGKFNDEPEFQYLLFCKEKLSCFWGDLIQFNLVDKN
FT                   DNRLIAESVNYLPL"
FT   CDS_pept        124599..126668
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348416"
FT                   /locus_tag="CAGL0E01331g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58665.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124535"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI00003B61F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ8"
FT                   /transl_table=1
FT                   /translation="MDGDWGTKVDSQEDFLKEGRSFNIFGGDDIGLNFDLGDFESGEPD
FT                   LGVMSNDFDTYILDNFLNDGGDAGHVGKVAEVEDLEIADICGTNNDKGAHIQPQSQSHS
FT                   QTLSHSQSQQQAQIQPQPQLFNDRASLDLLSSPLGEALWKQQEELREALRIQQELNAQV
FT                   VQKLDKTVEQQEQLQRVLQQQKQRASRADYSLSPALSDAGADKGNYMDYLMADGVDRAD
FT                   RADSGDSGENAGGSGSGSSSHCRDNKHNGSPVKRGKYGTNGKYGTNVRVKLDFEDVVSN
FT                   GAVNGGQHLSVLSPQSSNKLNIKKAAHRAVPYTPKSRVSSMTYTPSTLLTPQPNNGAGK
FT                   FDNVTISPESVTMSPVIGLGIHSGADAGFSLKPPPMDILPTIPGSTSATPAKQGNGQAR
FT                   GYSGPSVGLSAGPTRANDGFDKLGSAEDLLLEYPVNPSLSPEELAPEVGGAGDEYSQGQ
FT                   FQLERTETTLLPPEMSSPVRYSGASSLNVSPVLKSRHVKMSQPGSPVRLTLGRSYLDTD
FT                   EASDEDEILSSPTKITRKLTTLPRGSIDVYVKELPDRMYECLYPQCGKTFKRRYNIRSH
FT                   IQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEKSYACPCGKMFNREDALAVHRSR
FT                   MICIGGKKYANVVIKRSPRKRGRPRKEEGSPVKESIRRDSQGQLITRMERQLAQ"
FT   CDS_pept        127845..129146
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348417"
FT                   /locus_tag="CAGL0E01353g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58666.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI00003B61F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ7"
FT                   /transl_table=1
FT                   /translation="MDIVQLLFKRDDDDGPPPACAVDNDFNGHTNLRILSVFMVLISSA
FT                   IGVYFPLLASRYSFINLPSWVFFIAKFFGSGVIVATAFIHLLEPASDSLGNPCLGGTFA
FT                   NYPWAFGICLMALFALFLIEIVSHHYVGKTMGGGHNHSHNMPTTFGQTHMHGVEDDMVD
FT                   EDGSSSTHSHSHVAMDDKYGDVVKNNNYNYDDGSDDIESQKRPAFNVAQQKVRNDSNEN
FT                   DSLVGHVHNTTVDPLEHMPGHNHFSHDEVHQDITQIGSKANDQQKEQYLNQLTSLFILE
FT                   FGILFHSVFVGLSLSVSGDEFKTLFVVIVFHQMFEGMGLGARITECYWPHSKRWLPYLL
FT                   GFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVFDAISAGILVYAGLVELMAHEFLF
FT                   TNQFKGEHGLRNMLAAYFVMALGAGLMALLGRWA"
FT   CDS_pept        complement(129962..131689)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348418"
FT                   /locus_tag="CAGL0E01397g"
FT                   /product="Similar to uniprot|Q03761 Saccharomyces
FT                   cerevisiae YDR145w TAF61"
FT                   /function="DNA binding"
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="CAG58668.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="HOGENOM:HBG059781"
FT                   /db_xref="HOGENOM:HBG203175"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B61F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ5"
FT                   /transl_table=1
FT                   /translation="MSSQNSAQDSKNDNTSAPSGSGGPPSKSAIQQKQIQELTARFKQL
FT                   VTEAKKVGETTPRGKELLLQAAKLKAVYENYTRRQQALARAQQLQQQGSNTNAAASSGS
FT                   STTGTTGTANSSGSASTSGNNSSNSSAQLANIIKQVLTPEQNQQYEQLLQNFQVRASAI
FT                   KDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQELQNGK
FT                   KNFYLECARQNPALQRLLQRSTQQQRMMQQKKQPQPAQPQVQSQAMPGAQSQANANGQA
FT                   AIPQSVGEAPPTNMGQQQMPTTATGANISTPSGQQPVQGNTQDPKTQIKTEVGTPAPGS
FT                   QKGGRPAQPQQTPSGRGQTASQQSPVTGVNAAASSAGSSTVTKSSIFKPSDPTVPIADT
FT                   VSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKS
FT                   IGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERN
FT                   WNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASANAVSNKKKPANFQK"
FT   CDS_pept        132904..134679
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435531"
FT                   /locus_tag="CAGL0E01419g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58669.2"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00017BD830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ4"
FT                   /transl_table=1
FT                   /translation="MKLKNVALVAGCVNAVAAEKYLKLDFEKHRADIDEELPLTHSAAR
FT                   QLRKRASDDSVAFPLVAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSNNGYCKNS
FT                   DNKSRNLDALGSNRFAKRASSVASASPSSATDSDGGDDGDDSGDAEQFYPTAASEIPAA
FT                   AKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIADVFFA
FT                   VANFSNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKPTYANFPQI
FT                   LKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDTTQ
FT                   LEITLDGMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTGF
FT                   IELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKSDDDNCYVTFMPQGEPGILLGDNFL
FT                   RNAYIVYDLEDMEISIAQANFNGGAENIEAIVKNVPSAVKAPGYSASFTEFPSSYATTG
FT                   NIFSGYNSTNSTGSAGSKTTMTSSRTSRNTNTASAAGNSSSSTRAKKNAGFAHEVPVSA
FT                   ISVIMVFNILLSMLL"
FT   CDS_pept        135312..137465
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348419"
FT                   /locus_tag="CAGL0E01441g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58670.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124537"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B61FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ3"
FT                   /transl_table=1
FT                   /translation="MENQQQQDNSPPNDGSRSNNDDGRNATAGNTENSDNNVPRSNVTV
FT                   RIQYQYFTPQGLADASNGTVDPAATQDGGNGSQAHVQGSNTLPLPAGVNGLPAAMPFGN
FT                   AVDSPDLILSFQDVPLTSPDRLNSFITIAAELAMRRFQNMLNRPKGITNEAFKELPVIK
FT                   IEELPDKTETTCSICYDKFVDEPEDTAENSKKRKHESNSNEDSMDDITGEGKLPRTGSN
FT                   TPSSLMAATGISDNNNERTTISSILNPQSESDSSQSHESTHNAFIENTEGQDQAQATQE
FT                   QNPEYLHSPVKIPCGHIFGRSCLYEWTRLENSCPLCRKKIAEQTEEEEQRENNENTSNM
FT                   EAFEAIRRMLYNTTGQGNATEGQNNNNPNEANGQVGVNSDATSDGAANQNNISQATENS
FT                   TQGGVNLQTGELNDANSTNSTTNSPNNNNVTVSRTSIIFLRPMNPGEAPQGSQNVNTQA
FT                   LGNSIPFPPSPGLGTTDPAQNANGAQPPRPLTFRTPMQIQWLPITFINPGLANGEQGPP
FT                   EQNSRLRSLFDQIFSTSGSAGTVDDAPNSRSNSSSENNDASGSSTAGSNEVDQSTANPD
FT                   RVTSPRRSFFNAMSRFADRLRPSGRSNANQAFTGSSNAEHANDNQSGNGTSGSRLRDTI
FT                   ARALKERRQRQETERQQAGELFASGVGSYRNPTGNVVTFPINSEASFNQGASTSNEPIE
FT                   GSTNQTENDQDSNGNNDRDDQAN"
FT   CDS_pept        complement(138109..138738)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195167"
FT                   /gene_name="TIF45"
FT                   /locus_tag="CAGL0E01463g"
FT                   /product="Eukaryotic translation initiation factor 4E "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58671.1"
FT                   /db_xref="EMBL:BAA93571.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="HOGENOM:HBG346234"
FT                   /db_xref="HOGENOM:HBG559144"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="UniParc:UPI00003B61FC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P974"
FT                   /transl_table=1
FT                   /translation="MSVDEVTKKFEETVSVDGPKTVLSDAKDFEVKHPLNTKWTLWYTK
FT                   PAVDKSESWSDLLRPVTSFQSVEEFWAIVQNIPEPHELPLKSDYHVFRNDIRPEWEDSA
FT                   NAKGGKWSFQVRGRGAEIDELWLRTLLAVIGETIDEEDSQINGVVLNVRKGGNRFALWT
FT                   KSCDKEPLSNIGARFKQVLKLADEDTLEFFPHSTANDRHSQPTITL"
FT   CDS_pept        complement(139067..143077)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435532"
FT                   /locus_tag="CAGL0E01485g"
FT                   /product="Similar to uniprot|Q08281 Saccharomyces
FT                   cerevisiae YOL138c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58672.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058592"
FT                   /db_xref="HOGENOM:HBG202853"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B61FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ1"
FT                   /transl_table=1
FT                   /translation="MNFSPNKNMPAGSGGNGQDRVLHRTSSSAGKNAMKGVFSQPHLSG
FT                   ANSSTHMYIHDSAVRPKLTAKYSYGSTYAVGSQWYDFSSSNRGPSNSYGSSYEDKFIMG
FT                   NANRRRTGTPYQGNQFHGTHNHAHSHSQYSSSPHISSSRSKSSQKSDAKKSTIKFHHRT
FT                   NNEISSIDKVNDPSMQGLICAGKTHLGYYKFSTVDNSMTCVHDFITSNNRNTPKGNSWI
FT                   LPNLSKRTKGAKISNIADVKCGFHNYSNVIAICNNSTDISLYDLNRTTPAEDPMIQILS
FT                   GHTRAINSFDFNMSQTNLIISGGQDGCVKVWDIRSDSMKRQGRSDLNIKTANDSIRDVK
FT                   WMPSHNFASLPSSADGKSLNISSPGYTFASIHDTGVLLKYDLRQTTQVDKKINAHSGPG
FT                   LCLNWHPHQDYIATGGRDGKCSLWYVGDRRSTDQSPYSTTFLSSNATTNTSSIGIGYPG
FT                   NPVASTFIPETTINTGSPITKLKFRPNYDKIALNSLIALSSMGDEAEVNIYSLARKYIP
FT                   KHLLTTGKPSLGLVWWNSNLIFNVDSAGYINGWDITNEPTVLDELPKNIVRWRDVDGSG
FT                   LLFLNQDTGSYEVSDQDELIDLHTFQKQSSSTVKGDTATPGIGLMANIKRGLSHNNVSH
FT                   FPTERPIPKRSAFSNISKVPISSSTQSSVNKSSTSLSTLATQDELLENKFLKSPLVIPF
FT                   ELPEAYQYSRESKIMELNKRSYIPKVSSVRGSNIEVFKFLARELEFSFRQDKNNEDDAE
FT                   LSRQQSVNEENIRSDLMKRFDISENATWANIVKDKSNKTRERANSISIKQSPIVLSDES
FT                   EIKSPTIQKLESGDNNVKYESNITKEIQQEKTKNFNPEYRINLLLELVESSNHNASVYS
FT                   IIDDLPNFKIWMLIRDSLLWDIKMYSSFSENETPEELTGGQLEYPLTNTRKQSLVSDLS
FT                   RLGTSELSSDYAEHPHAYHGKSDYSSDASEGIKSPVSKLGEQLKGEESNKFVLGRRLSS
FT                   MSPKRSPDIPKLAAALKIHRQRNENNRESEIESSAIEEEEEDEEEDDDKFNDDEDFKGP
FT                   ATTKDNTIHSIPILNKREARTSFIDTFMTNENSPDAFHNVPYLNKNQSPGYGYSSPKNK
FT                   NGPSHSFANTPSKLAFLKKLSPRTMSSHSVTRAPSSDWHVEHDPTLQVPPPEKKGAPDN
FT                   LPPWNTTKLLRQIHANALEMGNVILAVNVLILFQDVYNIAPISIVKESVVHFVRLLHQY
FT                   ELFEIAAAILKYCPWDDLLGPEGDQSTVEIFCERCGELITNEQGKDLPHGYWYCQACSR
FT                   TNTLCVVCNTPLRKLTMAALKCGHEGHFECFTQWFITEGMSECPAGCTAALL"
FT   CDS_pept        143438..144874
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435533"
FT                   /locus_tag="CAGL0E01507g"
FT                   /product="Similar to uniprot|Q08280 Saccharomyces
FT                   cerevisiae YOL137w"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG58673.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058593"
FT                   /db_xref="HOGENOM:HBG202858"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B61FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVJ0"
FT                   /transl_table=1
FT                   /translation="MSKVSGEEEYELGGLHEVNADASATSYFMKDGERREIEEVEGRAV
FT                   VREVNWKGHDILLYDLDYEKLPMVRYQVAFCLVMFLVFGLNDQTTGSLLPTLTEHYNIS
FT                   TFTVSNIFLIQLSGYTCASLLNEKVHRMGGVRGAMVIVCMLCIVPLLVMAMKPSHFYIY
FT                   MICCFPLGLGLGVMDSAANVLIGNLTQNKNEWMGILHALYGAAAMITPPTVSYFVKWGH
FT                   WNLFFLIPLICCTAGLVLIYPAFKFETTAKYNYLSTLDGDGNETADTGVDETSLFQILK
FT                   NPVVVLYSIYMFLYLGAEITTGSWFFTYLLKTKSDNRIGMSYVAASFWSGITLGRLLLG
FT                   FVTKRLFSTEYNASNAYSWLSVVFFSLFVAIGLLNYSSIFYFACMFVSMFFGGFFIGPL
FT                   FPNASIVALQNLPPKLHISGMGTAVAIGGCGGAGLPYLTGLIIHSCGEEIVPFMSWSMV
FT                   VAFTIVWYLYPRFIPALKDN"
FT   CDS_pept        complement(145239..146399)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435534"
FT                   /locus_tag="CAGL0E01529g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="CAG58674.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="HOGENOM:HBG058594"
FT                   /db_xref="HOGENOM:HBG202863"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR014379"
FT                   /db_xref="UniParc:UPI00003B61FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI9"
FT                   /transl_table=1
FT                   /translation="MQELSSAESSTNSLFSMKSISSMDISRNTTPRPSPLGAAMSTNDQ
FT                   SFLSLASIRREMDRESKKDKFIVILVGLPASGKSSISSHLIQSLKNNTATAHLRSTVYN
FT                   AGKVRRMLCNGEKKKSIQIANDPSEDLFNPANAERKEVYAKITLENLINELDSDICDFA
FT                   IFDATNSTVQRRSFVFREIYKYNDREGANFNLIPIVFQVTCSNQDFIRYNIHNKTFNED
FT                   YFDKPYEVAVQDFSKRLKYYHSQFVPFTETEFNTIIESNSSQTAGKPSLYYYNILNAGL
FT                   DPSKQFQLSYTRESETHSMIVKETLRVISHFVTNYSELYGYSYINRVKNFFGESINTVV
FT                   QKPSWVANYIPGKLSTWDYSNKLRHLASLKKIVNNDYFNELNSIIN"
FT   CDS_pept        complement(147353..148045)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500593"
FT                   /gene_name="MED7"
FT                   /locus_tag="CAGL0E01551g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 7"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58675.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG058595"
FT                   /db_xref="HOGENOM:HBG396607"
FT                   /db_xref="HSSP:1YKH"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="UniParc:UPI00003B6200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVI8"
FT                   /transl_table=1
FT                   /translation="MSREESVSGANDVSSLYPPPPPYIKYFTSENVEKLKEYNERREEG
FT                   ESAENELDFLIPPPMPSSGSYRAFGSVWQIKDHLPDLETMGITQLYKKTSEGEAEVTDY
FT                   QYKIKELRRLSYSLLLNFVELVGVLSVNPELYESKVENIRTILVNIHHLLNEYRPHQSR
FT                   ESLIMLLEEQLEHKKQEVANIELVCQQVTEKLKQVQTLLKESQSQSQSQSQSQSQSQSQ
FT                   SQLQSDSQ"
FT   CDS_pept        148425..148733
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435535"
FT                   /locus_tag="CAGL0E01567g"
FT                   /product="Similar to uniprot|Q08273 Saccharomyces
FT                   cerevisiae YOL133w HRT1 RING-box protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAR58017.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG381683"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00017BD831"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ3"
FT                   /transl_table=1
FT                   /translation="MDQMEVDSEEVPKKKFQIKKWTAVAFWSWDIAVDNCAICRNHIME
FT                   PCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQPWHLARCGR"
FT   CDS_pept        complement(149084..151798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500594"
FT                   /locus_tag="CAGL0E01573g"
FT                   /product="Similar to uniprot|P42842 Saccharomyces
FT                   cerevisiae YNL313c"
FT                   /function="binding"
FT                   /protein_id="CAG58676.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396503"
FT                   /db_xref="HOGENOM:HBG434583"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6201"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI7"
FT                   /transl_table=1
FT                   /translation="MDTLLFTHLLLASPPDELDRLKLHTEQDQCIHAYARNILEGNSHN
FT                   VVEDILKNVGTFLDADGDILAALDSYTDRIISEDLSKALILAIASLQLFAQNNYTGPKA
FT                   DLNITKLIFNIDENEMLHKSFISLLSSAGQMAYEYMDDPIALTLALLLLEKITSQKSLF
FT                   NYQNDDELPPTVEISEDQSPFDCIAHWWRARALLAQLSVLPEMYGVQPAVVASIYDNIN
FT                   LVKNINLNIEEVSEEKLRKSLYVIYYLESVKCSLMINTEHHALPALTKVKKLTDFNFVL
FT                   TGARAKRTKYQQKAVSGLLILAKSKFFSNQPKENISTQPDVLQLNSEILLEKPTYEDIA
FT                   NEPLDDQIFKKQKFENDGIVEDKLLPVAIRQENIPLELQEIDPNAQPTLSDYDNIQLLL
FT                   RLYTLRQTSPAFDPLVEEELGALVGRIIYQEGPKNWTIFSRALWERSVIETTKAKTIER
FT                   GILQMQSLVEELGLKISTTLLPKATDPEYESSMPRLKYIHQIPFIPRWELDAKLAEKYM
FT                   SLGVLKSAVEIYERLGMSCEAALCYAAVGDEKKAEQMLLNRIESTPNDARAYSILGDIR
FT                   QDPSLWEKSWSIGKYVNAKNSLARYYFNPPPNANIEKNYGLALKHLNDSLRQYSLSFET
FT                   WYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAI
FT                   SSDSQKNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGEQAIDLPVVEKLVELL
FT                   VTSDYPKPNEEGEVKFTYFQRSCMDFICNTLPSVITTDARCWKLAARVELWRKRPWASL
FT                   ECEEKAYRAVSHNPDMDVDERVWNEVVEVCSDLVAAYESLGEMEGKHGEGSLVCKDWKY
FT                   KCRSTIKALMSRGKSRWEDTDGWEKLLELREQL"
FT   CDS_pept        152413..153819
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044046"
FT                   /locus_tag="CAGL0E01595g"
FT                   /product="Similar to uniprot|Q08271 Saccharomyces
FT                   cerevisiae YOL132w"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG58677.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B6202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI6"
FT                   /transl_table=1
FT                   /translation="MSTTMQVFILWVLFLGVGQCYLNPITIQNKHFVDSVTGEPFFIKG
FT                   VDYQPGGAAGINGESDPLSDPKKCARDIVLFQELGINTVRVYSINPDLDHNICMSMLSM
FT                   AGIYLILDVNSPLPNQHLNRYEPWKTYNPLYLEHVFKVVSQFSGYNNTLGFFAGNEVIN
FT                   DEESATNSPIYVKKLIGDIKEYIAITCDRLIPVGYSAADDLNYRVSLSQYLECSTNSNK
FT                   VYDSVDFYGVNSYQWCGEQTIRTSGYDKLIEAYRNYTKPVMLSEFGCNRVLPRQFGEVE
FT                   VLYSKEMYTVFSGGLVYEYSQEPNNYGLVKINHDGSVRMLPDFVTLQEKYKKIALPNRD
FT                   QLHKELEGQSIGLKRNVLCLDKYENLEISGKTENDIPAKAIKTGIQVKRGHILELLNSN
FT                   TLQVQFEIFDVYGQRWQGPKIVTPITRKTSNKKENEAKTNGANGTSESLLIESIFTMLL
FT                   MVIAVQCIIL"
FT   CDS_pept        154956..157367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195168"
FT                   /locus_tag="CAGL0E01617g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58678.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058602"
FT                   /db_xref="HOGENOM:HBG396603"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI00003B6203"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI5"
FT                   /transl_table=1
FT                   /translation="MSSSSESEPHSPQLSHTSVAESMVSMNTEDHNELYDHRQHISVPP
FT                   RLGQDSPGSSNLNARHMMLDDRANEDFGFMNIEGADSDCEPLGKDHHKLRSTALQNSNA
FT                   RPSRLAHTVNHQEVVQPATITTDNSELKKNVSAISASPPTKTRRQSNTFSLTDKKPLKR
FT                   TMSRHNSVNSAVSSSNRLNLAAVSRSISHKSVDDDNLKRKITRASFSSDNSQASRESQE
FT                   TEEDVCFPMPPQLHSRVNGIDFDELEEFAEQVNEQKKLCEISLSAQKSGSNGIQASGSS
FT                   SSANSYMSEAALKYTPKHLRKDLSPPKSESLNSNSSNSPDSNQPQGVSFGNNKIEGEDE
FT                   PYEEKPQAYTQTPENQFYGDGSFKAPDRFSFFSSEMEETIHATDIANLVTPGQSFFDLF
FT                   RGGEPTWWLDCSYPTDDEMRCLAKAFGIHPLTAEDIRMQETREKVELFKSYYFVCFHTF
FT                   ENDNESEDFLEPINVYVVVFRSGVLTFHFGPISHCANVRRRVRQLRDYVDVNSDWLCYA
FT                   LIDDITDSFAPVIRSIELEADSIEDSVFMARDLDFAAMLQRIGESRRKTMTLMRLLSGK
FT                   ADVIKMFAKRCQDEANGIGPALTSEVNIANLTSSSDPNVKYMQKLQMNTQPRGDIALYL
FT                   GDIQDHLLTMYQNLSAYEKIFSRSHTNYLAQLQVESFNSNNKVTEMLGKVTMIGTVLVP
FT                   LNLITGLFGMNVKVPGQDTSIAWWFGILGVMIGIAICLWFLASLWIKSLVPPATLNEAA
FT                   ESGAKSILSSFIPRGPKNENDPKYSRGRSKYGGPSNRSIASLPSKYSRYD"
FT   CDS_pept        157952..158497
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195169"
FT                   /locus_tag="CAGL0E01639g"
FT                   /product="Similar to uniprot|Q12016 Saccharomyces
FT                   cerevisiae YOL129w"
FT                   /protein_id="CAG58679.1"
FT                   /db_xref="HOGENOM:HBG056182"
FT                   /db_xref="HOGENOM:HBG328134"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniParc:UPI00003B6204"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI4"
FT                   /transl_table=1
FT                   /translation="MDEEPQHLFRFPFHLPSFDGMRTIGVYLAGVLYALGFWAFIDSVL
FT                   FSKYNNASDLHITFVDWVPFLCSTFGMLIVNSIEKNRLLQGALSGDNGMFGGMNMDSQL
FT                   AWQARSVLFLGFALLAGGISGSLVILIIKYIVRDYISFPTLGMGIENVVSNACVMLSCV
FT                   VLWVAQNIEDEYSYNLTL"
FT   CDS_pept        160703..164950
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142375" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195170"
FT                   /locus_tag="CAGL0E01661g"
FT                   /product="Similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /protein_id="CAG58680.1"
FT                   /db_xref="HOGENOM:HBG124539"
FT                   /db_xref="HOGENOM:HBG398753"
FT                   /db_xref="UniParc:UPI00003B6205"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI3"
FT                   /transl_table=1
FT                   /translation="MKYLSVFATFVAILSWACATVYPNFYKDKTIVLDGMGTEEFTIPR
FT                   DKILSLVNTSLTLKNFAHISIKEGVLIQEKSSVTIIPPIGASRKFNFTLGGVFDLENES
FT                   KFIFDGSGNTYEDEADAVNNFVFDIYANSSGIQVYKGNTVSVTLPTIKNSIPNYQGESP
FT                   HIRFAGSTLDQFIYKPPYVLVSLMIIAGKFEVLSPGSKTGSQFDKVIWRVDFGVSGLAK
FT                   TNPNTPSYGVDKLTGEITCEGILAVYNDMFAFTNNAVLHTLGYIGYSVVSPITLDLSMG
FT                   PIRRPTNYEYLVALPAGQDGITLTGYKYTADTDISDAHQYLFYYFYDNDATKEDEISVS
FT                   TDNSDVRILHSNPSQTVTVHGDSALNIGYYKGDRIDSFVGFDGLDFSKYKKELAVYFYE
FT                   SFQYSSTTTTKSDEYTTEIIEIIVSGTLGIDNKPSPVTISSTIYNQLRETTETVDLGNG
FT                   VTEYHVLDYFPVPQDDKEHPYGTSTKIITYSPPPVTITATTAADYVETDWISFFITTND
FT                   KGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVISYWTTTNEV
FT                   GSVITTEATKTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDSTLFNATRDYN
FT                   LPEAPHTSFGPAPPAETKTVDLGNEVTEYLVISYWTTTNEFGGLITTSSTRTYSPPPVT
FT                   ITATTAADYVETDWISFFITTNDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETK
FT                   TVDLGNEVTEYLVISYWTTTNEFGGLITTSSTRTYSPPPVTITATTAADYVETDWISFF
FT                   ITTNDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVISYWT
FT                   TTNEFGGLITTSSTRTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDSTLFNA
FT                   TREYIDAEAPHLSSSMKDVLPESEADYTTTIDKGNGEFETDLVSHITTKDSDGKPTTIT
FT                   TTIPLKPSEVGEAGEADYTTTIISDGHTITEVVSHVTTTDSDGKTITYITTMASYDQVD
FT                   EGVFTSAAPYSQPPVVTSTITEDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTITPGEA
FT                   DYTTTIISDGHTITEVVSHVTTTDSDGKTITYTTTIFSNDWLLVDSELDVKSNHPTSVV
FT                   SKENPYTTVDSQSTISSNSGNTVVTTKTPANGNENHGLSSVNGTSVSSGRNTIPSVSLI
FT                   ITNTLGFAGPINKPSYSTTSASSSVPQEVARDSSKYGENVSSVGIMLPQMSKPHASSAS
FT                   ISVVHSSSRPVISRGSRPSDVSARPTENTPTFGSMPVQSGAENDASVSSTNDNQNTHTA
FT                   QSRLQQLGKTSSDLGTTALLIPSSSAVNISHTGGPSDTQIASVLQGSGFKIKANKSEVM
FT                   ILLVTVFLFLGMV"
FT   CDS_pept        complement(166821..167948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435536"
FT                   /locus_tag="CAGL0E01683g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58681.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6206"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI2"
FT                   /transl_table=1
FT                   /translation="MSHEEVHDEFIAEDVTPNRPDETRGENGAPRRMLVREHRKIGRGA
FT                   FGTVVQAYLTQDEQTWYGPFAIKKVPAQTEYKSRELQILRLTDHPNIVKLEYFFTHTSP
FT                   KDNKVYQHLAMECLPETLQIEINRYTSNNLQLAIKHVKLYSYQIARGMLYLHALGICHR
FT                   DIKPSNILVDPKTGVLKICDFGSAKRLEPNQPSISYICSRFYRAPELILGSTQYTTQVD
FT                   IWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLGPPDKKFIFFSNPRYTGPLYSTPLF
FT                   NGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRFSPRRIMAHPFFDDLRNEKYFFPRE
FT                   QTQPVLLPELFNFNEFELQVIGELLQQIKPHSEEH"
FT   CDS_pept        complement(168593..169681)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044047"
FT                   /locus_tag="CAGL0E01705g"
FT                   /product="Similar to uniprot|P22133 Saccharomyces
FT                   cerevisiae YOL126c MDH2"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58682.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG242477"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI00003B6207"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI1"
FT                   /transl_table=1
FT                   /translation="MPHITGNNEADLKVSILGAAGGIGQSLSLLVKTQLQVLAGSADKN
FT                   LKLALFDVNKDAVNGVGTDLSHIDTQVEVSMHNPQEGDGINSCLKGADIVVIPAGVPRK
FT                   PGMTRDDLFNINAKIITQLTDSILENCDLTRVVVLLISNPVNSLVPVMVNRMSQKVNHK
FT                   NTGIEKRVFGVTNLDLVRASTFLREVSEDKIEKMPYVPVIGGHSGETIIPLFSQNPHSK
FT                   AVPSEKLGPLVHRVQYGGDEVVKAKNGAGSATLSMAHAGFQCVVKFAKLFLGGEKEFKG
FT                   TYYISLKDFNNQPIAKNADALLPLVNNVPFFALPMTLTLDGVQSVDSDIIENMNIHERK
FT                   ELLPICLDQLEKNIAKGLDFSA"
FT   CDS_pept        171119..172738
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435537"
FT                   /locus_tag="CAGL0E01727g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58683.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B6208"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVI0"
FT                   /transl_table=1
FT                   /translation="MKFLLFAAVAQAYLQLDFERQTAQDVALAKRHTSNGVANAMDVPI
FT                   EQIGDLMYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAPKKVKALPAT
FT                   GFATENDQVAKKLRTFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTF
FT                   KLNHHNVSNITFALANIANASMGVLGVGFPAEETTDDPSPGSLIDKEHYQYDNFPIALK
FT                   RTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPE
FT                   ITLNGLGFRDDKKNVTLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIK
FT                   LKKCPNAKDNSELIFNFAGAEIPVSLLNMVEKRKGKCYLEIRYHEELSKTGMLLGDIFM
FT                   RHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVPSAVKAPQYYNTFASSNLPSTVT
FT                   NDIFASTATASMEPPSSVLESLKSKSSSTSSIDTSVPSDDKKIIDDDHSGHDHAKRDAY
FT                   SNTAGILQISTTLVLVAMTLLL"
FT   CDS_pept        complement(172875..174323)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044048"
FT                   /locus_tag="CAGL0E01749g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58684.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B6209"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH9"
FT                   /transl_table=1
FT                   /translation="MKYTLLLNLISCAQALLKLDFEKVPEQNLALNKRDDKGLQLELEN
FT                   GGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNRKHSPKKSQIEPLNDAD
FT                   YPTSPNQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSF
FT                   NGVKVDNVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKE
FT                   QGIVKKIAYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQVSKPFQFEIT
FT                   LNGIGLQTADKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLD
FT                   KCPNKKEKRTVVFNFGGAEISIDIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLRHVY
FT                   VVYNLEDEEISIANANFNYSTPDIQEIVSTVPGAVKAPQYYNTYSVYPTATAVTGDVFT
FT                   PEATMSMSNNSVALRKRTTLKPLR"
FT   CDS_pept        complement(175652..177211)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435538"
FT                   /locus_tag="CAGL0E01771g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58685.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B620A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH8"
FT                   /transl_table=1
FT                   /translation="MRSIVLVSLLAFTQAYLKLDFEKTPKISDELTKRADNDSFIAPLL
FT                   NGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYCKNNKKFAPKKQDLMPITSD
FT                   DGFPTSPNQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTI
FT                   SLNGVKVENVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLK
FT                   QQGKIDKVAYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRFGHLVENPYELEV
FT                   TLSGLGLQRATSNITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKL
FT                   AKCPSKKSNDTIVFNFSGAQIKIKMVDFVEKHKGKCYLPCVSQESSFFLLGDSFMRHVY
FT                   TVFDLDDKEISIAQANFNSTKEDIEEISSTVPSAVKAPQYYSSYVDFPTEISVTGDIFA
FT                   PQATEFVPKPNNTNNKTNFTQDLLDIENMLLRRHYENRATTLSTSLPIFLIALSAVTAL
FT                   FL"
FT   CDS_pept        complement(178411..179961)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435539"
FT                   /locus_tag="CAGL0E01793g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58686.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B620B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH7"
FT                   /transl_table=1
FT                   /translation="MKELLYFTLLAGAQAYLKLDFTRVPSASVLEKRADDLSPVPLRND
FT                   VDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNKKKAPKSKDLQPVDNSGF
FT                   PTNPDQIGKKARNLDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLG
FT                   GLNISGVNFAVAEISNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQG
FT                   IIDKVTYSIYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVNSEYDVVNKPYELDITLN
FT                   GIGYQSMSSNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKC
FT                   PSKKDNAKLLFNLGGALIYVDIKEFTTKVKGKCYLEIIPSGAESDLVILGDNFMRSVYT
FT                   VFDLEANEVSIAQANFNSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASISSVTGDIFG
FT                   PEATAYMAPPANVSNSSNSSNSSAVSLERRSYDNAATPLRLNSIILIGVAAILATIFM"
FT   CDS_pept        complement(181154..182713)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435540"
FT                   /locus_tag="CAGL0E01815g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58687.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B620C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH6"
FT                   /transl_table=1
FT                   /translation="MKAIVVTSLLAFAQAYLKLDFEKSPKASSDLVKRDDEYVNVPLKN
FT                   DGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNPFCKENKKYAPKGKDVQPLDDSG
FT                   YPSASNQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSF
FT                   NELNISNVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLK
FT                   QNGVIDKIAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSLFQNFTDPFQLEI
FT                   TMNGLGLQGNDANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRL
FT                   PKCPSKKENKKLIFNFSGAEVAVDINQMMNKHKGKCYLQFAVHEDTSNDAIIFGDNFLR
FT                   SVYLVYNLEDKEISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAVTG
FT                   DIFAPEATMSMAPINKTNGSSNRTLNSSRFDLQKRVYSNQASLKNSSLIAFFLASLFAL
FT                   AL"
FT   CDS_pept        complement(183237..184802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435541"
FT                   /locus_tag="CAGL0E01837g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58688.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B620D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH5"
FT                   /transl_table=1
FT                   /translation="MVKPLVLLSLLAYAQAYVKLDFTKTPGSDLAKRDVVDPEAAQLTF
FT                   DKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPYCKNNKNKAPKKKDLESPGDDY
FT                   PRTPNQVPKSDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVG
FT                   NLNLSNLSIGVSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGL
FT                   IEKIAYSIYLNETGSKYGSILFGAVDHSKYQGPLYTFPLVNSKYKEGSDPFQFEITMNG
FT                   VGLVGKTDNITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCP
FT                   SKKDNQKLIFNFSGAEFSVNVTDFMEKHKGKCYLQFSALDGINFALLGDNFMNNVYTVF
FT                   NLDDKELSLAQANYNSSLKPDIEEIKDTVPSAVLAPQYYNTFSADPTATAVTGNIFAPE
FT                   ATMSMAAPANASRNSSLNSTFNSSSNYSRVQMKKRTYPNSSSSLQANSAILIMIAAAIT
FT                   AMFL"
FT   CDS_pept        complement(185870..187387)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044049"
FT                   /locus_tag="CAGL0E01859g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58689.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B620E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH4"
FT                   /transl_table=1
FT                   /translation="MLFLVPFLSVAQAYVALDFEKSHGDDLVKRDVQDVKLINSQKAML
FT                   YNIQLSVGTPPQNITAQLDTGSSDLWFPDSTNPYCKANKKQAPKSIASLDAGTRPTSPA
FT                   QVPKSLRNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNLYLNGLNIS
FT                   GLNFGLAYFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVT
FT                   YSLYLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTLNGLGIR
FT                   DNTTNTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSK
FT                   KDTREVVFNFNGVEIAIPLKQFYQKKSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVF
FT                   DLEAQELSIARANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDNATQVVGNIFDAT
FT                   ATASMAPKNQSNSSNLSRRALNYENNSARSSTLSIVLVLAAITTLFM"
FT   CDS_pept        188277..189803
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435542"
FT                   /locus_tag="CAGL0E01881g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58690.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B620F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH3"
FT                   /transl_table=1
FT                   /translation="MRIDRALTTAAAAGYLRLPFTKITDNSLAKRADDDYLNVQLDNEQ
FT                   IFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNRGKKPKKKDQPSSVDPGRN
FT                   GYPTKAEAIPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVA
FT                   LAGQTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVKKNPYMNFPES
FT                   LKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPLVFSNRDFGTPRPNE
FT                   LMVTLNGMSFEATDGNVTQILNATSKFPALLDTGSTDTHLPVDVYNALAESTNGTYDQT
FT                   QNKIRIPKCLSKKDKTILNFSLGGVNIGVPYKEMVKKIKGKCYINVAPTGSDFAILGDD
FT                   VIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVVSTIPGATRASAYSETYSPTFAVPS
FT                   ASSSGNTSSNGSTNLTRRFERRDIPLENKGVPTSLKGSVAAILLLVLWIA"
FT   CDS_pept        190465..191754
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044050"
FT                   /locus_tag="CAGL0E01903g"
FT                   /product="Similar to uniprot|Q12383 Saccharomyces
FT                   cerevisiae YOL125w"
FT                   /protein_id="CAG58691.1"
FT                   /db_xref="HOGENOM:HBG058604"
FT                   /db_xref="HOGENOM:HBG398107"
FT                   /db_xref="InterPro:IPR007871"
FT                   /db_xref="InterPro:IPR021721"
FT                   /db_xref="InterPro:IPR022776"
FT                   /db_xref="UniParc:UPI00003B6210"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH2"
FT                   /transl_table=1
FT                   /translation="MATDNTILRCEYIIPQKKRRCGMSRAANTNYCVEHSQGNAEVKDD
FT                   KERVRVPCPLDPSHTVWKHNLKKHVRICNKAKITQATAAQPYFIKDLNRGPAELVENEL
FT                   NNANLIESVQLLLEALNEYEEPQEQIKKNEFMESNRLIELSNTIKKHAKQQSSLIQNLF
FT                   DVELIPSGKIMEFGCGRAEFSRYINQTIINNDPYQLQDDLPKYVLIDRGSNRMKFDKKF
FT                   QDDLMALSKNPEKVKQRIAIDRLKLDIKDLKLSTVIEEHDGCLAISKHLCGVATDLTLR
FT                   CLQNCIEETNGKFKLQGICIAMCCRHVCNARDYINPDYIKSFLESKHSQINYKTFFGHL
FT                   SKMCSWATSGRRPGMNDDDIVQIEGDNQEQLSISLLQREKIGLFARYLIDNGRLEWVKQ
FT                   NLMNNKMKNAKIIKYIEPDVSRENNALLVY"
FT   CDS_pept        complement(191834..193135)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348695"
FT                   /locus_tag="CAGL0E01925g"
FT                   /product="Similar to uniprot|Q12463 Saccharomyces
FT                   cerevisiae YOL124c"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG58692.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG026232"
FT                   /db_xref="HOGENOM:HBG738188"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR016691"
FT                   /db_xref="UniParc:UPI00003B6211"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH1"
FT                   /transl_table=1
FT                   /translation="MKYLLYLVQSHTNFRLAELESVADLHGISVDLSHHREDSPYLIVE
FT                   LANEDEARKLIERCILARGIYEYWGEGEDYDELHNSIQNGDHFNELKQRYQNDTFKFEF
FT                   ECYRGNSKANRVSQIESFGYLEFKGKINMKKPQQVYTVLEEYVPISDNVSSTVPIKIRF
FT                   GRLIHYSDRAAMEKYDLKKRPYKGTTSFEAELSLVSCNIAQVKPGTIMYDPFAGTGSFL
FT                   TAGGHYGALVVGSDIDGRMIRGHGAAQNISANFKKYNEADKFLDVLTMDFTHNAFRKSL
FT                   KIDTIVCDPPYGIRESIKVLGARDPERFAGKENVEIDGVKAYLRKDYIPSKKPYALDSL
FT                   LDDLLQYSAERLPIGGRLAFWMPTANDENIETIIPLHENLELKYNLVQDFNKWSRRLLV
FT                   YINRGPEYHGVDNGGIKRSQHNFRERYFKNFRPV"
FT   CDS_pept        193462..194820
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436571"
FT                   /locus_tag="CAGL0E01947g"
FT                   /product="Similarities with uniprot|Q99383 Saccharomyces
FT                   cerevisiae YOL123w HRP1"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58693.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058606"
FT                   /db_xref="HOGENOM:HBG208282"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6212"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVH0"
FT                   /transl_table=1
FT                   /translation="MSSDEEDFNDIYDTKDESKVDAKDDVKAEEKVPEAATSALDQLAA
FT                   LQASSANPDSNKDDAAKMPWETLQNTLNQLQTVTKEESPDKSKEEKSSNASVDSGTNVQ
FT                   SGNTGDRTVKADLSKDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSR
FT                   GFGFLTFESASSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGKIFVGGIGPDVRPKEF
FT                   EEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNKFIDFKGRKIEIKRA
FT                   APRHLQKTGGARQPAQQSSNSQYGMGTGSNSSGQYPGYGFQDPMMFSNPMMSGYNPMFA
FT                   NNNPQMQEYFQKMQDYYKQVQQQGGMDYNQMYQQQMQQMAMMMPGFNPSTMGQQSQGSP
FT                   DANSTKSQSNEASTPTPDDQDRGNKDSSRRSGGPGGFRGRPNDSRRGYHPYNR"
FT   CDS_pept        complement(195338..196978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000152204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436572"
FT                   /locus_tag="CAGL0E01969g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58694.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG312498"
FT                   /db_xref="HOGENOM:HBG370455"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniParc:UPI00003B6213"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG9"
FT                   /transl_table=1
FT                   /translation="MSTSGAENGVGASRARKSTCTEANDTDKVGVKTISEVTDLQTIES
FT                   SPSTCEEPMSNKDVIKAAFKKYIKFIGPGLLVSVAYIDPGNYSTATSAGAANQFSLLCV
FT                   VLLSNFIAIFLQCLCIKLGSVTGMDLSRACRKHLPRWANWTVYFFAECAIIATDVAEVI
FT                   GTAIALNILIKVPLPAGVCITLVDVLAIMATYRPGASSMKVVRMFELFVALLVVGVCIC
FT                   FAVELAYIPKSTSAAKVFRGFVPSRQMLEHNGVYTAISILGATVMPHSLFLGSALVQPR
FT                   LLEYDVNHGNYSMLKDDEDEKNKETAVDERYQNYRPTRSAIKYCMKFSMIELGLTLFTL
FT                   ALFVNCAILIVAGSTLYGYPDAADADLYTIHDLLSKTLAPIAGTIFMLALLLSGQSAGI
FT                   VCTMAGQIVCEGHIHWKLKPWQRRLVTRAISLIPCLAISISIGKEALSKALNASQVVLS
FT                   IVLPFLVAPLIYFTCNKKIMETEITVKDAEEDPSDNDDMQLENGQTRKTVSMANNWVVS
FT                   IIAFVVWVFLSALNIYAIVQLGITHGEIS"
FT   CDS_pept        join(complement(198521..198540),complement(197603..198017))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044313"
FT                   /locus_tag="CAGL0E01991g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58695.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG210561"
FT                   /db_xref="HOGENOM:HBG594417"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="UniParc:UPI00003B6214"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG8"
FT                   /transl_table=1
FT                   /translation="MPGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSAGNEM
FT                   PPQDSEGWFYKRAASVARHIYLRKEVGVGKLNKLYGNAKSRGARPSHHADASGSINRRV
FT                   LQALEKIGVVELSPKGGRRISENGQRDLDRIAAQTLEEEE"
FT   CDS_pept        join(complement(200692..200722),complement(199494..199942))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044314"
FT                   /locus_tag="CAGL0E02013g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58696.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG007660"
FT                   /db_xref="HOGENOM:HBG499813"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="UniParc:UPI00003B6215"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG7"
FT                   /transl_table=1
FT                   /translation="MLVRLYTFLARRTDAPFNKVVLKSLFLSKINRPPVSISRIARALK
FT                   QEGAASKTVVVVGTVTDDARLFDLPKTTVAALRFTAGARARIVKAGGECITLDQLAVRA
FT                   PKGQNTLILRGPRNAREAVRHFGMGPHKNKAPRIMSKGRKFESARGRRRSKGFKV"
FT   CDS_pept        complement(201250..202845)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195468"
FT                   /locus_tag="CAGL0E02035g"
FT                   /product="Similar to uniprot|Q08268 Saccharomyces
FT                   cerevisiae YOL119c"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG58697.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058607"
FT                   /db_xref="HOGENOM:HBG396145"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B6216"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG6"
FT                   /transl_table=1
FT                   /translation="MIDLATVVLKRNFLSNKKSGNVAEGSSNETVVANGTAIGMEMEPD
FT                   IVLKNLRQAEEDTNEDLGLASTGFQKEAHVSNAEFFDLNKKPGAEITEQTHESQKSLIE
FT                   VDTDDSLILDNDREFPDGGLRAWSVVFGSFMGLIPVFGVINSLGAIESYISTHQLMNVS
FT                   SSTVSWIFSIYLTISFVSCIFAGGYFDRNGSTHLMILGTLFYVGGIFGLADCKDIYQFI
FT                   LSFSVLSGTGTGILMTPLVSAVASWFLRRRATATSIATTGGSVGGIIFPIMLRKLYVEI
FT                   GFKWAIRVLGFICLSCLVCSIALTREKSKPMVEPFKSKTELIKWYLSSSFKLSYFTEMK
FT                   FVFTTLGASFAESSLTTAATYLSSYAIARGNSENVAYLMLTAYNASGILGRYVPGYIAD
FT                   KFLGRFNVMIITISMSALLCLVIWLPFGGSTGALWAFACTYGFFTGSILSLTPVCIGQI
FT                   SKTADFGKRYATAYFVEALFNIPMLPIGGAIIGDRSVTHYNHFIIYVALLMAAGAFCYA
FT                   VSRYLCVGIRIKKF"
FT   CDS_pept        203578..205509
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195469"
FT                   /gene_name="RRI2"
FT                   /gene_synonym="CSN10"
FT                   /locus_tag="CAGL0E02057g"
FT                   /product="COP9 signalosome complex subunit 10 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="CAG58698.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG124540"
FT                   /db_xref="UniParc:UPI00003B6217"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVG5"
FT                   /transl_table=1
FT                   /translation="MTDESDNYNDFMMSDEDMDSIEMEDEENDVEGDEGQRGGQEWVQN
FT                   YEQGLSLWNDENYVAARQVFLKTLSMLVSEEELIEMRCKIHRQVLECWCKILMYGEPDN
FT                   EQSTEIIADFRNFVELVNELHGKANCSLDLSSMFHHVTMDFMPNIYDRTFIPGITDDEE
FT                   SSKWAKMTFKTTILQILQGSWVCHTFPEVGLLLQQELHVLQAWIKTFDKERDLYAISES
FT                   LRKDINTLNELQLILQCYIARYIEDQHLLCNEGEVFRMCLNQLDQKCNESLAVAQRSDI
FT                   NLILHFSKALFLILFELDQDDLGDGNKVTGSTCVRRFVTIHKFYQNIECCKEEFWECLK
FT                   NLEELGTNKFRFERFMQIIVGGFVLCAMIMHRGSQTRLAGTSGNADINPFDYEQLRIAP
FT                   DHIFVDKLRRIYDVFVGLQIQEMHSCLIELECIRAPLSRLFDQVCYLIQKRKLFSEIAP
FT                   IYSCISIQDLRQKLQIDPSVPPTRDEILVHLMRYCMQDRGINFKLDLVADTVTFYSEQH
FT                   SEPLHDAVFSETRMGHKSHKSSISKDRAIVEDIKAAHEMPEVEYAHDIGILESQVDSQS
FT                   HSKSNTKSMSRHVSGHDPDSFGQDTISFFDTLRLARETYQGSNIDNSVYTIAKLTNEAL
FT                   QEISNDVR"
FT   CDS_pept        207187..208575
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348696"
FT                   /locus_tag="CAGL0E02079g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58699.1"
FT                   /db_xref="HOGENOM:HBG058609"
FT                   /db_xref="HOGENOM:HBG202924"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI00003B6218"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG4"
FT                   /transl_table=1
FT                   /translation="MNREGISGPGGAIITHDSVSTGSSSNSKNNGGNNNNSNIPNGNSS
FT                   MGDDIMVLSRINDIERRMMMFENMFHALSGRLDHHFKKYDVLVSSQQQQISELNAVITT
FT                   LLNDQYRHAEFVRDKLSHSLHGISSTSISLNGISNQNNDNRSNGFANNNSSGVASGSSN
FT                   GVNSQGNTNNNSNRSSSTSHLNNPNMLGNNSSGTGNNHNNNSVGASNSNQSVTHTILDD
FT                   ILNEHDLQDKKYSGNRNPGDMNSRNDVNDKSQQSPRDPMSLKKTKFIHHRQYNDVTDGD
FT                   SVIPYTNPYVDQSGHQQNNLTSNILFNDSTSGQNAGNQGTQQATQNREEGMPSSPGRKS
FT                   YSSKRGPKKKKVMYHKPFQFIKSPHSVMEIWKEYTEGIDGQPSIREMESLYSTGWRRDA
FT                   AVNKRYSRRKVLWKAIETGLSRGYTLDYIIDLLENYRIIDPEKNTKQPIGWLCQVNNIP
FT                   DLLK"
FT   CDS_pept        209557..211014
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195470"
FT                   /locus_tag="CAGL0E02101g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="CAG58700.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG124542"
FT                   /db_xref="HOGENOM:HBG395964"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI00003B6219"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG3"
FT                   /transl_table=1
FT                   /translation="MSAAVDDVKTVEDVADVIAVESSDSQGFDDYDGHNDSPKEMPIID
FT                   NNQIDENDDFIAFSESSGGEDGDEAEEEQPQAEEEEYTDYPWTIDRDYSKEKELADWLN
FT                   YEILDFVAYISPSKEEIETRNRTIGSIRSAVKELWPDADLHVFGSYATDLYLPGSDIDC
FT                   VVNSKQGDKQSRNNLYKLANFLKKKEIATEIEVVAKARVPIIKFVEVESRTHMDISFER
FT                   LNGLEAAKLIRDWLASTPGLRELVLVVKQFLHSRRLNNVHSGGLGGFSIICLVYSFLRM
FT                   HPRIITAEIDPLENLGVLLIEFFELYGKNFGYDDVAIGVQDGSPIYMAKRSWKSLEQNR
FT                   GSFNLAIQDPGDVTNNISRGSFNLRDIKKAFAGAFDLLTNKCFELNSISIKERYGKTIL
FT                   GNIIKYHGKRRDFRDERGLVQNKAIAENESYHKKRSIIMHGELSAVNGKRSADDESNEH
FT                   HDDTQNKKQKVNDYDDAEEEDDYDPLA"
FT   CDS_pept        complement(211248..211820)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348697"
FT                   /locus_tag="CAGL0E02123g"
FT                   /product="Similar to uniprot|Q12322 Saccharomyces
FT                   cerevisiae YOL114c"
FT                   /function="translation release factor activity "
FT                   /protein_id="CAG58701.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="HOGENOM:HBG058937"
FT                   /db_xref="HOGENOM:HBG202935"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI00003B621A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG2"
FT                   /transl_table=1
FT                   /translation="MLFTKVLYRRADRFASARQWVRELRVSDVPVSIYRVRYDRSSGPG
FT                   GQNVNKVSTKCTLTIPGISRCEWFPSEVRGLLTKGVCVANPDESNAKQIVASTLSGRPS
FT                   SYYYPANDKFIVRADETRSREQNRRLCLDKLVREIQDTCRFPGVENEATVSKWDSIKKQ
FT                   TNKIRLEGKRQVSEKKSARKKPRLDLY"
FT   CDS_pept        212223..213179
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436573"
FT                   /locus_tag="CAGL0E02145g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58702.1"
FT                   /db_xref="HOGENOM:HBG124543"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00003B621B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG1"
FT                   /transl_table=1
FT                   /translation="MMKAKPGQPLVVRRQGWVSYKDDGFLSLLWQKRYMILNDCYIDLY
FT                   KGNKRTDSAIVSIPLTNIVCVSLHKAKPFCLEIVKVNSRPSMSVNGGGVASDSINKNNT
FT                   KSIYVALKTEQELYGWVDTIFAKCPLLSGVSSPTNFIHSVHVGFEADTGNFIGLPSDWE
FT                   RMLAYNRSNTPVDKPNIIKSSNSIRRKFSLPKRSSSMSRARSVLKPVKQSLSINRKSSL
FT                   RNDTTNMGKQACKITSHRNGARSPERGSQLWTYQNRNLGGRDSTVLSTRYDRHGHDQNR
FT                   DDDDYIINTNTAFVNSIQTNSNDENSILHYYEQFLER"
FT   CDS_pept        complement(213431..214039)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195471"
FT                   /locus_tag="CAGL0E02167g"
FT                   /product="Similar to uniprot|Q12285 Saccharomyces
FT                   cerevisiae YOL111c"
FT                   /protein_id="CAG58703.1"
FT                   /db_xref="HOGENOM:HBG058941"
FT                   /db_xref="HOGENOM:HBG202945"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI00003B621C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVG0"
FT                   /transl_table=1
FT                   /translation="MATPEFEFASKFLTLATLQEPKFAQNYQKPLKDVNSIGVALPALK
FT                   YKYDPTRVSKQLPSGADATASVELTLKSIRPPKFTFTDKFGSDATVFTVKQRVVDEGHC
FT                   RHIQSVKLLLKGKVLHDNMVLKDLGVSNAAITVMIAKEEEIKSTPPTIEARTPASVPWS
FT                   DIQALLNNKVANADEAKTMFEQLQKGYELAQQSSTPQLD"
FT   CDS_pept        214374..215171
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436574"
FT                   /gene_name="ERF4"
FT                   /locus_tag="CAGL0E02189g"
FT                   /product="Ras modification protein ERF4 "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG58704.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="HOGENOM:HBG058942"
FT                   /db_xref="HOGENOM:HBG397257"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniParc:UPI00017BD8A3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVF9"
FT                   /transl_table=1
FT                   /translation="MYTDLEDNENRFYTNSDVILEEGTLGSSLGRSSRRTHEKGEDVQD
FT                   PVFFNVHEVTESYFADITNPTVFRDHDEDHSLCVTHFMNVYASQDSRLFEETRVVRIPR
FT                   RFDMGNRWYPMFSDLLPGSEPGAILHDTDGLQFVPRGITQDGNVYGYSSVSPLSLYLTQ
FT                   QHFQEIVTTINDILLATYSTYGFYNILNIILEVFTLGLWSYVCKRINYALSIDPMKRLD
FT                   VYVRELNASPAFVEAQIKLINPRDSGFLSLDFQIPKPKSISTQ"
FT   CDS_pept        215568..215768
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436575"
FT                   /locus_tag="CAGL0E02211g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58705.1"
FT                   /db_xref="HOGENOM:HBG124544"
FT                   /db_xref="UniParc:UPI00003B621E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF8"
FT                   /transl_table=1
FT                   /translation="MFDEVGIIAVIEVTMTSTPIANYPITQLPNYTNSIVKEIGVLFIL
FT                   KMDEVALTQTLKCFNFWRSQL"
FT   CDS_pept        215934..216734
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436576"
FT                   /locus_tag="CAGL0E02233g"
FT                   /product="Similar to uniprot|P24867 Saccharomyces
FT                   cerevisiae YNL289w PCL1 cyclin"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAG58706.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG192607"
FT                   /db_xref="HOGENOM:HBG448666"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI00003B621F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF7"
FT                   /transl_table=1
FT                   /translation="MSEYKKALHVLMKSPVTDDIVKYLTNVTLKVLPQSNYPSPPSSPS
FT                   RHSKEHLPSLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLA
FT                   CLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDLILDLR
FT                   PLLEPIKEDLQRSYLQRKRIYSNNQQKVSAGAYHSYNYTKGHNYTNSNSYNSYNSYNSY
FT                   NKLQSKYVPKSELYHHRNISVSSNLSSTSTLVDRNSPPHNYVYV"
FT   CDS_pept        217905..218279
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436577"
FT                   /locus_tag="CAGL0E02255g"
FT                   /product="Similar to uniprot|Q08245 Saccharomyces
FT                   cerevisiae YOL109w ZEO1"
FT                   /protein_id="CAG58707.1"
FT                   /db_xref="HOGENOM:HBG124545"
FT                   /db_xref="InterPro:IPR013326"
FT                   /db_xref="UniParc:UPI00003B6220"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF6"
FT                   /transl_table=1
FT                   /translation="MSAQELGKKVDETNEQVAAKVEESKEQLVDKVDEVKQGSEEAADN
FT                   AKAQVEEAKENAAEAVEEAKEKTAEAVEDAKAKTEEAKDKAAKKVEEVKKDSKKDSKKS
FT                   EKENKNFFSKFTKKISSFFN"
FT   tRNA            complement(218683..218754)
FT                   /gene_name="tRNA-Gly (TCC)"
FT   CDS_pept        complement(219246..220883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436578"
FT                   /locus_tag="CAGL0E02299g"
FT                   /product="Similar to uniprot|Q08109 Saccharomyces
FT                   cerevisiae YOL013c HRD1"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58708.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124546"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B6221"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF5"
FT                   /transl_table=1
FT                   /translation="MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEG
FT                   FNILIITVFTLLNSTLLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKY
FT                   FFTLATCALVLLYMKVFHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSY
FT                   VISFCVSTAYNIASSIFTAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILN
FT                   TGLQFYEFHLSRKFSQNNPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRF
FT                   LQTLVHVVMAMVLNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDL
FT                   NNDPNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPIC
FT                   RLPVFDENGEILAPSSANVSQTNLNPGENPDQRDEADDELEDDTSIADLPITDNISAIP
FT                   LTSDYPFSIRNVGQEVCKELGGTSEEMTHDVDEEILEFEIEDSTTGRALPARMTIKKRS
FT                   HTNKVSVPSESIIASHPEQDNNEKMHNM"
FT   CDS_pept        complement(221428..221829)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195472"
FT                   /locus_tag="CAGL0E02315g"
FT                   /product="Similar to uniprot|Q12692 Saccharomyces
FT                   cerevisiae YOL012c HTA3"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAR58018.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00017BD539"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ4"
FT                   /transl_table=1
FT                   /translation="MSGKMHGGKGKSGAKDGMRAQSSSARAGLQFPVGRIKRYLKRSAS
FT                   GKARVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLI
FT                   RATIASGGVLPHINKALLLKVEMGKKNRN"
FT   CDS_pept        222703..224817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195473"
FT                   /locus_tag="CAGL0E02321g"
FT                   /product="Similar to uniprot|Q08108 Saccharomyces
FT                   cerevisiae YOL011w PLB3 phospholipase B "
FT                   /function="phospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAG58709.1"
FT                   /db_xref="GO:0004620"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG397277"
FT                   /db_xref="HOGENOM:HBG540863"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI00003B6222"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF4"
FT                   /transl_table=1
FT                   /translation="MLPSLFLVLVLVLCSGSSGYSVADQYAPKLAYCPSDDINLVREAS
FT                   GLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQLFHRIFDAGMVPRIGIAVSGGG
FT                   YRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGCSGGNWLVASLSWNNWTSVQD
FT                   ILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIKTARRWDHITNAVKAKQEAGF
FT                   NTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAGDMPLPITVADGRYPGSNA
FT                   IALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVAHTAKKCIEGFDNTAFIM
FT                   GTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVAVYNPNPFKDTRYVMENF
FT                   STSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSADNKLQWPDGSSLVHT
FT                   YERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTSLKYIPPLVVYYPNSE
FT                   YSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIACAIMKRKQEALDL
FT                   ELPSECERCLARYCWDGTVDDTPLDELKQDVHHSFINPEEDKDGDGIDDYSDEDFTDDD
FT                   VDDYHFFHYSNVDEIHHAATYTGKLLPTGAIDKGSNKPLINLSSKLGIPATSIAYAIVT
FT                   FICTLSASLL"
FT   CDS_pept        225336..226430
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436579"
FT                   /locus_tag="CAGL0E02343g"
FT                   /product="Similar to uniprot|Q08096 Saccharomyces
FT                   cerevisiae YOL010w RCL1"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG58710.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG020852"
FT                   /db_xref="HOGENOM:HBG381263"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR013796"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniParc:UPI00003B6223"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF3"
FT                   /transl_table=1
FT                   /translation="MSSQYVVFQGPENFRHRIIFATLSGKPIKIEKIRSQDLNPGLRDH
FT                   EVSFLRLMEAVTNGSVIEISYTGTTVIYRPGIIIGGPYTHTCPPSKPVGYFVEPMLYLA
FT                   PFSKKKFSIVFKGITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPQGGGEV
FT                   HLVVDSLIAQPITMHELDRPVISSIRGVAYSTRVSPSMVNRMIDGAKQVLKNVKCEVNI
FT                   TADVWRGENSGKSPGWGITIVAETKKKGWCYFAEEIGGSGDIPEEIGSKVAYKLIEEIS
FT                   KSAAVDRNQLPLAITYMVIGKEDIGRLRITREQVDERFIQMLRDIKKIFGTEVFLKPVD
FT                   DIGSDDFIATVKGIGFTNTNKKIA"
FT   CDS_pept        complement(226597..227370)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044315"
FT                   /gene_name="MDM12"
FT                   /locus_tag="CAGL0E02365g"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   12"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG58711.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="HOGENOM:HBG058361"
FT                   /db_xref="HOGENOM:HBG202793"
FT                   /db_xref="UniParc:UPI00003B6224"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVF2"
FT                   /transl_table=1
FT                   /translation="MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDF
FT                   GFGKIAPNITLREISSPLQDFYDAVNEEYEEDNETSSEMHGRDGQNVGESGEEAVVEKK
FT                   ETDTQFLIEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQ
FT                   VFISMLCDVSDPVLDDVDCVLDPNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGST
FT                   LRSVGQLEEFIVQKLKDFLRKELAWPSWVNLDFND"
FT   CDS_pept        227701..228288
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436580"
FT                   /locus_tag="CAGL0E02387g"
FT                   /product="Similar to uniprot|Q08058 Saccharomyces
FT                   cerevisiae YOL008w"
FT                   /protein_id="CAG58712.1"
FT                   /db_xref="HOGENOM:HBG110424"
FT                   /db_xref="HOGENOM:HBG397391"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="UniParc:UPI00003B6225"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF1"
FT                   /transl_table=1
FT                   /translation="MSYVGVRCLNRSLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQG
FT                   TPSQVYDVVSEVSKYHEFIPYCEDSFVNERDDSNKPKVAGLRVGFKQYDERFVCDVDCK
FT                   SKVSGKEVYVVRAESLSHNLFDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSIS
FT                   SIFAKSVTELVMDAFARRVYHLKKAAVLENPQ"
FT   CDS_pept        complement(228740..229813)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195474"
FT                   /locus_tag="CAGL0E02409g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58713.1"
FT                   /db_xref="HOGENOM:HBG124468"
FT                   /db_xref="UniParc:UPI00003B6226"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVF0"
FT                   /transl_table=1
FT                   /translation="MKSSQVTQIFLLIASFLVSSVDAVVVATQPSHHLHMRGLPKLVTT
FT                   SETPTPTSTEEPSTSSTSDNSESSETEGSSTEITSTSESSIYSESVTASSTTSDTDSET
FT                   SSTTSYTSYTPSTTSVSVGPIYIPSAQNNKYVYHATHPSGTVFTAFGSCLAFIALVLVL
FT                   VWIALTLRSWKNARKEYQIRERENKYQLDPYYFQNGDKDDYSSSDSDVASDISEKILKK
FT                   KASRMSLYSLGGGSAFNLLSSEKLDTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDS
FT                   SAFNSLTSTPREQSVANIIVPQNGLNKLGDPPFTGKNLSNMDISSTPGVAIPKPNGNQK
FT                   RGRPPSAHLDDLLDGIQ"
FT   CDS_pept        complement(230796..232949)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348698"
FT                   /locus_tag="CAGL0E02431g"
FT                   /product="Similar to uniprot|P04786 Saccharomyces
FT                   cerevisiae YOL006c TOP1 DNA topoisomerase I "
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAG58714.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG269325"
FT                   /db_xref="HOGENOM:HBG521929"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="UniParc:UPI00003B6227"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE9"
FT                   /transl_table=1
FT                   /translation="MTVSDDEDGVILKRRKLYNVVKDESDDEENHITGLKSSIVKAEEG
FT                   DEETKDAKLVNTDNDSPISDDLEENVSDDLEEDYKWWEEQDKDDTIKWTTLEHNGVLFP
FT                   PPYEALPSHVKLYYEGNPVDLPLEAEEVAGFFAHLLETPHAQNPVFQKNFFEDFKHVLN
FT                   DAGGTQNGIEIESFDRMDFSAMHDYFVQLKEEKKSMTAMQKKEIRLEREKFEEKYKFCE
FT                   LDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRIRPEDIVLNLGEGAPIPPPPSGHQW
FT                   GEIRHDNTVQWLAMWRENIFGSFKYVRLAANSSLKGQSDFKKFEKARELKKHIDRIRKE
FT                   YRNNFKSKLMVERQKAVAVYLIDVFALRAGGEKSEEEADTVGCCSLRYEHITLKPPNTV
FT                   IFDFLGKDSIRFYQEVQVDPKVFKNLALFKKPPKQPGHQLFDRLDPSLLNKFLQNYMTG
FT                   LTAKVFRTYNASKTMQEQLDLIPNEGSVAEKLLKYNAANRTVAILCNHQRTVTAGHAKS
FT                   VAKSSDRIEEFKWQKERLKKGILQIEPDRIKDTPNYFEDINSIDKEIEAKIHERIIERE
FT                   IQKYHNKFKRENDKRKFEGEEPLPEETLKEWLDNVKQLKQQYAEELATGIVQLKASMNS
FT                   VEKLEKAIERLDQRISTSQVQLQDREANSEVSLGTSKINYIDPRLSVVFCKKYGVPIEK
FT                   IFTKSLREKFKWAIESVDETWRF"
FT   CDS_pept        complement(233352..233714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500847"
FT                   /locus_tag="CAGL0E02453g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAG58715.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG410450"
FT                   /db_xref="HOGENOM:HBG726964"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="UniParc:UPI00003B6228"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE8"
FT                   /transl_table=1
FT                   /translation="MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNL
FT                   IRAELLNDNKVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSN
FT                   FETEWNLQTLAADDAF"
FT   CDS_pept        236580..241061
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500848"
FT                   /locus_tag="CAGL0E02475g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58716.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG435761"
FT                   /db_xref="HOGENOM:HBG738583"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="UniParc:UPI00003B6229"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE7"
FT                   /transl_table=1
FT                   /translation="MSNQQGSVNHAIGSGAAETVNVTQNATSNVGINDNQKIDGNAESS
FT                   NSINNTSNNNNNNERIILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTPASVGFSVAS
FT                   LDNPLPPATKKPEIKLHPLPQQQQPRIYTQQQPQQQQILQQDQQEILQNQRQGSTGASE
FT                   TSTTQSPLVSGPAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFK
FT                   SQTIDTPGVIERVSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTV
FT                   LNTAPQKSPSPSDIQTNNQQTQAIAQEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFS
FT                   QAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFK
FT                   KFLPDSSASGSEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSY
FT                   NTQQNQHQQQNLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQA
FT                   IKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQ
FT                   QHMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIG
FT                   NKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENI
FT                   VHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF
FT                   IAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPG
FT                   LGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWN
FT                   KIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPK
FT                   NQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSD
FT                   ALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQ
FT                   QKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNR
FT                   NIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLS
FT                   ELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVK
FT                   HAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKR
FT                   HASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQE
FT                   YSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESR
FT                   AANISEKTQEIRKVLSHYDGNSNDDVNEKFNYILANGTIDGYVRQSAAVVQETEKTYND
FT                   DSGRNTSSIKSIIGSATERTEKPLINGSPIID"
FT   CDS_pept        complement(241355..242485)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436581"
FT                   /gene_name="PFA4"
FT                   /locus_tag="CAGL0E02497g"
FT                   /product="Palmitoyltransferase PFA4 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58717.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058367"
FT                   /db_xref="HOGENOM:HBG397668"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI00003B622A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVE6"
FT                   /transl_table=1
FT                   /translation="MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQF
FT                   CQTMIWLSYYLAIYTPPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMM
FT                   DHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSE
FT                   LIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILI
FT                   ENVWYIFPNLRNEHVESQAEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYP
FT                   FSGPQDDGLHFQKNEESMIEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEG
FT                   EQVIRIRTPEKKLSRSEWLNDWGESLEDFGVDVDVE"
FT   CDS_pept        complement(242867..243814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436582"
FT                   /locus_tag="CAGL0E02519g"
FT                   /product="Similar to uniprot|Q12442 Saccharomyces
FT                   cerevisiae YOL002c"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58718.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG177628"
FT                   /db_xref="HOGENOM:HBG749828"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI00003B622B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE5"
FT                   /transl_table=1
FT                   /translation="MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIP
FT                   EWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVP
FT                   TYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVAS
FT                   MVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSA
FT                   VLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSH
FT                   QIFHILVVVAALCHLKALLGSYSLVHYRFMIDMY"
FT   CDS_pept        244814..245842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195475"
FT                   /locus_tag="CAGL0E02541g"
FT                   /product="Similar to uniprot|P20052 Saccharomyces
FT                   cerevisiae YOL001w PHO80 cyclin"
FT                   /protein_id="CAG58719.1"
FT                   /db_xref="HOGENOM:HBG124469"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI00003B622C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE4"
FT                   /transl_table=1
FT                   /translation="MTPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQI
FT                   NDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVY
FT                   PAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNY
FT                   RIIPRDNNITFCKMEVQKNFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIE
FT                   VVGKYSSSPDKTKKVNYDIDMPAKTLHEHQQNDAVKNCSNNNSNYQTASNNIPIPQTIP
FT                   QNRPKRNFDTVEERHNIYIEEKSKMNTNGLAEKLTSSSYKKQITEDKKNQILDNSIYPS
FT                   SI"
FT   CDS_pept        246427..248640
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044316"
FT                   /locus_tag="CAGL0E02585g"
FT                   /product="Similar to uniprot|Q12149 Saccharomyces
FT                   cerevisiae YOR001w RRP6"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="nuclear exosome (RNase complex) "
FT                   /protein_id="CAG58720.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0000176"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="HOGENOM:HBG058368"
FT                   /db_xref="HOGENOM:HBG395977"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="UniParc:UPI00003B622D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE3"
FT                   /transl_table=1
FT                   /translation="MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKS
FT                   MKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSS
FT                   TNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIE
FT                   ESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSL
FT                   QDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVF
FT                   TNPLITKVFHGAFMDIIWLQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKT
FT                   SKKYQLADWRRRPLSKAMMAYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALR
FT                   RFEYSKYKPKIPVANIFTPVEKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDE
FT                   SPRYVMPNQLLVSLVAYGPVDPISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEV
FT                   KSINNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEI
FT                   LLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEE
FT                   THNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILAS
FT                   DNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK"
FT   CDS_pept        complement(248998..249624)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195476"
FT                   /locus_tag="CAGL0E02607g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAG58721.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00003B622E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE2"
FT                   /transl_table=1
FT                   /translation="MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADF
FT                   LTKEVVLDDDKVVTMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWK
FT                   DEFLVHANISSPESFPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAI
FT                   NVDTAFEEIAKSALQQNQNDAHAFEDDFNDAINIQLEGESNSCSC"
FT   CDS_pept        250010..251656
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348699"
FT                   /locus_tag="CAGL0E02629g"
FT                   /product="Similar to uniprot|Q12001 Saccharomyces
FT                   cerevisiae YOR002w ALG6 glucosyltransferase "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG58722.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG146833"
FT                   /db_xref="HOGENOM:HBG621987"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="UniParc:UPI00003B622F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE1"
FT                   /transl_table=1
FT                   /translation="MSSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTE
FT                   WIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGL
FT                   DYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVV
FT                   YFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEF
FT                   YAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAM
FT                   FSPFYIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSL
FT                   ILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTS
FT                   RDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFI
FT                   TPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVIL
FT                   NCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL"
FT   CDS_pept        251868..253325
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199176" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500849"
FT                   /locus_tag="CAGL0E02651g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="identical protein binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="negative regulation of catalytic
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58723.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0042802"
FT                   /db_xref="GO:0043086"
FT                   /db_xref="HOGENOM:HBG540727"
FT                   /db_xref="HOGENOM:HBG752219"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00003B6230"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVE0"
FT                   /transl_table=1
FT                   /translation="MFSFYLITSVYYFWIFTSVDAATIPVDLSHRESASHDYTLINRLL
FT                   NLWRGKGIEYNFNTGSKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSS
FT                   SIFLQDSDFGKATQYNDISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELV
FT                   EHDSIVRINNYKMQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYV
FT                   DHEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGS
FT                   GSMSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFA
FT                   VAAGNESDDACNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGS
FT                   KNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGT
FT                   LSYLPAETVNLLVYNGGGKNLSKFWGT"
FT   CDS_pept        253705..254496
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500850"
FT                   /locus_tag="CAGL0E02673g"
FT                   /product="Similar to uniprot|Q12339 Saccharomyces
FT                   cerevisiae YOR004w"
FT                   /protein_id="CAG58724.1"
FT                   /db_xref="HOGENOM:HBG058373"
FT                   /db_xref="HOGENOM:HBG562115"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI00003B6231"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD9"
FT                   /transl_table=1
FT                   /translation="MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDL
FT                   VKALKRTLQAEVKPMITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECIL
FT                   NVVDVKGKNKHRYVVACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEE
FT                   ESKLFRGLNDPKYAGLKGEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQ
FT                   QTETSADQSQPTKRRRSRKHKHGSKNSTDTNENGNLSEEEN"
FT   CDS_pept        complement(254591..257431)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436583"
FT                   /gene_name="LIG4"
FT                   /locus_tag="CAGL0E02695g"
FT                   /product="DNA ligase 4"
FT                   /EC_number="6.5.1.1"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA ligase (ATP) activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58725.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003910"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058371"
FT                   /db_xref="HOGENOM:HBG396164"
FT                   /db_xref="HSSP:1Z56"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniParc:UPI00003B6232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVD8"
FT                   /transl_table=1
FT                   /translation="MADEGGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHV
FT                   QFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTL
FT                   IKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITID
FT                   DLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEH
FT                   KLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSY
FT                   QKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANF
FT                   INLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDV
FT                   LYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEG
FT                   IILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEV
FT                   IQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLE
FT                   YMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWK
FT                   TCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYNIISSVNKALEDFAELEHRSDIFD
FT                   GMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVE
FT                   CNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERD
FT                   INKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGRIVFLLSDNNNIQKESFMV
FT                   DAYGGKVTNELSSANLVIVVGAVTQRRINDIRKQISSEVIKQDHPPRIPDMVSEGWLYD
FT                   CIKQNTQVAEDNYRLP"
FT   CDS_pept        complement(257708..258685)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500851"
FT                   /locus_tag="CAGL0E02717g"
FT                   /product="Similar to uniprot|Q12094 Saccharomyces
FT                   cerevisiae YOR006c"
FT                   /protein_id="CAG58726.1"
FT                   /db_xref="HOGENOM:HBG247739"
FT                   /db_xref="HOGENOM:HBG527152"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="UniParc:UPI00003B6233"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD7"
FT                   /transl_table=1
FT                   /translation="MAKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDS
FT                   SFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREI
FT                   VEAHGASVVECSWARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACF
FT                   AIVGRTDLAHELLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQE
FT                   RKLKAQTEDVWMMGNTNRGNSGLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII
FT                   EDSEDDNNESDYSNEESSDEASDEDYEDEHVDEVVNRVGKLAIE"
FT   CDS_pept        complement(259023..260054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195477"
FT                   /locus_tag="CAGL0E02739g"
FT                   /product="Similar to uniprot|Q12118 Saccharomyces
FT                   cerevisiae YOR007c SGT2"
FT                   /function="binding"
FT                   /protein_id="CAG58727.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051843"
FT                   /db_xref="HOGENOM:HBG736033"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6234"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD6"
FT                   /transl_table=1
FT                   /translation="MSKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVER
FT                   GDVDSVLKQSGISKGLEECLECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAM
FT                   AGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG
FT                   YSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDA
FT                   RGADSGAGAGAGAGGAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMM
FT                   QDPSIRQMAEQFTSGNGTPNMDDLMSNPALRNMASSMFGGAGAPGADADAPGAEPKGEI
FT                   DEK"
FT   CDS_pept        260593..261195
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348700"
FT                   /locus_tag="CAGL0E02761g"
FT                   /product="Similar to uniprot|P38210 Saccharomyces
FT                   cerevisiae YBL006c"
FT                   /protein_id="CAG58728.1"
FT                   /db_xref="HOGENOM:HBG059839"
FT                   /db_xref="HOGENOM:HBG204116"
FT                   /db_xref="InterPro:IPR013895"
FT                   /db_xref="UniParc:UPI00003B6235"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD5"
FT                   /transl_table=1
FT                   /translation="MKLDYYSVIGGLGSLDRSHSVVLGPQELRELVKNTEENRSDTALP
FT                   DLYRNNKERVNIHGYLGGRVDMKEVSEMTYDLNHTLLGGYVPRQQLETLCSTDFARYMH
FT                   RKVDCGDAMQVYDTFLADNHLGLAQRPRIHTQTTQSPQAQSQAQGQGIAQPMQDKIPPV
FT                   QHDTHVRKVVVCKRCSARFLGPSRMKSLRRHNCKAAI"
FT   CDS_pept        261665..265276
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436584"
FT                   /locus_tag="CAGL0E02783g"
FT                   /product="Similar to uniprot|P32790 Saccharomyces
FT                   cerevisiae YBL007c SLA1"
FT                   /protein_id="CAG58729.1"
FT                   /db_xref="HOGENOM:HBG059978"
FT                   /db_xref="HOGENOM:HBG396086"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="UniParc:UPI00003B6236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD4"
FT                   /transl_table=1
FT                   /translation="MTIFLGVYKAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVK
FT                   KRIIGSDAEEPQGLVPSNYIEAAPVISTMRALYDFDQAQNPQEELVFKENDMFDVYDDK
FT                   DPDWILVRSHSSNEYGFVPGNYVEPAGGAGMSSTAPAASATPAAAPVAAPITTAATAFA
FT                   PPPQHVDRVKAATPAAEENDREPEEDIPPPMPPKQTEDRYMDEEEDVPPPKPMRPTADN
FT                   ARDSNRERARSRMNYDDYEPSESRRSRDMDDYQSPRRSRPQNDYDDEVHTWTVSEVEGK
FT                   KKHKGKLSIGNNRISFTPNKGSTQEWSIDKLISYDNEKKHMFLEFKDPYKSFELHTGNN
FT                   DTCNEIMAIVGEFKGAQRDPGLREVEMATKSSKRGVALYDFEAESPDELTIRQGDAVYV
FT                   INDKKSKDWWMVELISNGKKGLVPAQFIEFSKSKESSGLLNSIKKFTNRSPKPSKVHDD
FT                   EEDDWKHDAGQDNSSSKGRSRSRKNSLSSRRKRSSSVSAKKDYPNPKKSRLWVDRSGTF
FT                   KVEAQFIGCADGKIHLHKANGVKIAVAAEKLSDDDLIYVERATGFSLEKYKSRKSESKG
FT                   GDRDREKRRRIREQEEREYERKLREREIAELKRARELLDEERNRLHDKELPPIKPPRPQ
FT                   STGGAHTSGKSDYDWFEFFLSSGVDVNNCQRYTINFDREKITEDMQADINPPMLRTLGV
FT                   REGDIVRVMKALDKKFNREPAQSNATGQNNMFTEADGSLKNNSGPNSGSSGLPEQLLSQ
FT                   PAMQASQNSNQDDDAWTAQPAASAANTVQKKSEFTGSMQDLIDLQPLEPKKNEQPKSDQ
FT                   IPVPKVENLEPVKTGQSAATNIQPNQTGTSKLVPLDPFKTGGNNILPVTTGFVMMPIAT
FT                   GGLLPLQRTGGVAMPMTTFGSQSTGGLIPMTTFGAQLTGGALPLQRTGGLLPLQSTGGA
FT                   IPRTSFNMPPAGSVLPVQRTAGGLMPVNTGGAIPQTSFGAQLTGGALPQTSFGAQMTGG
FT                   AIPQTSFGAQMTGGALPQTSFGAQMTGGALPQTSFGAQMTGGALPQTSFGAQMTGGALP
FT                   QTSFGAQMTGGALPQTSFGAQQAGYGMQQPAFNSQLTGSAIPQTSFGSQQPAMGMQRTG
FT                   GFQPQSQFGMTLQRTGGMQTNQFTGGAMQQQPITPAMGAFNTGIQNITQGMQNTFVSQP
FT                   PLQNQPTGFGFGNGPQQQPQQRQANIYNASAANPFGF"
FT   CDS_pept        complement(265374..267896)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500852"
FT                   /gene_name="HIR1"
FT                   /locus_tag="CAGL0E02805g"
FT                   /product="Protein HIR1"
FT                   /function="chromatin binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58730.1"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG189689"
FT                   /db_xref="HOGENOM:HBG396168"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVD3"
FT                   /transl_table=1
FT                   /translation="MRIVKFPWFSHHEESRDYEIYTVDVSPDGKRVATGGLDGKIRIWS
FT                   VDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMD
FT                   EENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNF
FT                   ERLKRFDVHQSLVKGVIFDPANKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIA
FT                   SPLTTYFRRLSWSPDGQHIAVPNATNGPVSSVAIINRGTWDSSISLIGHDAPTEVARFN
FT                   PRLFKSDVEKKAKNAKDELSKDTKNNKKLESIIATAGQDKSLALWITSRPRPIFVAYDI
FT                   AQKSITDMAWNPNGNILFVTSLDSSIVMLMFDANELGMPIPIEGNMEQLHRYGVDKDSF
FT                   DLPESVNQLLLEDKYGTKKKQHELSSSTQSTALERRLEPNQFQKKINSREISPLKSTEK
FT                   VNILIPKRKKDMKMNKVIVKDGKKRVAPTLISTAGLQPTVTNVKEVASSSGKVVKPVLK
FT                   KTNDINEYSGRLSTPSIPIPRLGIHTLVMGLKERGKDKFERGAEVGPDDELREASNQIT
FT                   FDGESYGQDSLMKDEYRMTLNNRLTKEKVSSNEPYLRYIENTGVIADTDAVLLECGSID
FT                   DFFTLEIRNGVERAIQFDSDALFDNPTRILGYHEGQRTIEAFIPNVIISGVGSPVSKYW
FT                   SLATADGFIYIISYNGQLLIPKINLGQKVVKQVVCSNYLLVLTERGLFYAWDISAKRSV
FT                   IKNVSILPIINNDPVEGNRVRVNKSIRKFEFEVSEKTVIVHLTNNRSFKWLAYFGCWSE
FT                   IQELVAPRETVANILLTENEIPPQSSSI"
FT   CDS_pept        268238..268993
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436585"
FT                   /locus_tag="CAGL0E02827g"
FT                   /product="Similar to uniprot|P32788 Saccharomyces
FT                   cerevisiae YBL010c"
FT                   /protein_id="CAG58731.1"
FT                   /db_xref="HOGENOM:HBG124471"
FT                   /db_xref="HOGENOM:HBG204265"
FT                   /db_xref="UniParc:UPI00003B6238"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD2"
FT                   /transl_table=1
FT                   /translation="MAENNSDSGDEFGDFEGVTDDQEQLVLYVNELVPKVNLGDVCQQK
FT                   HDLEELLAEERPRVIYEQLVELHTVLQPITWKSSHLRSHLLHVMRLEEHDKSDKHIIEE
FT                   AVDDQLYTRICSMLPTFSAEQVRSPALILRDQFKYMYAPPLTHSSLQGEAIHEQEEHVP
FT                   SLLAVKMDSIQSAKEMEQYHDKLCNAIDALIVTLKQIELQQANLTADKTTYENVVTNLT
FT                   GHTQRLQRDEIELYNKHKNRRKRFSWIGR"
FT   CDS_pept        complement(269153..271300)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436586"
FT                   /locus_tag="CAGL0E02849g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAG58732.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG175971"
FT                   /db_xref="HOGENOM:HBG324690"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI00003B6239"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD1"
FT                   /transl_table=1
FT                   /translation="MDKPLLSEKEKGASKDSSSLQPEKVKDYQYEEASFISKFIYDVIL
FT                   FLLSKILGCFFREIRSRGSFKVPRNGPVIFVAAPHANQFVDPVVLMSLAKKLSNRRISF
FT                   LIAEKSLQHPAIGFLARRAMAIGVVRAQDNLATAQGKITVDPDNYKKIIGHGTQFTKDF
FT                   KPKGLIGLPRSLGHVEIQSIESDTELTLRKEFKMNKTEVKHILTKGTSYKYAGKVDQSV
FT                   VYHRVFEHLAHNECIGIFPEGGSHDRTDLLPLKAGVAIMALGCMAQHPNTNVKIVPCGM
FT                   NYFHPHKFRSRAVVEFGDPIEIPTELIEKYKNPSTNKEAVKELLDTISDGLQSVTVTSQ
FT                   DYETLMVVQAMRRLYSGQFHQKLPLPLVVEMNRRLVKGYETFKDDPEIVQLKTDIMAYN
FT                   AHLSQFNLPDHLVEHTKINVARNLGLLVFRSLRLTIMITLSLPGLILFSPVFVIARKIS
FT                   NDKKRAALASSTVKIKANDVVATWKILMSMGVAPILYVLWSSLATYYLRHKDISKVIIF
FT                   ILSYLACAIVTYSALVVGDIGMDIFKSLKPLYISITTPQGLKRLQVERRQLAKRITEVV
FT                   NNFGSVLFPDFDYKALSEEYAVDEEEEERKTAELRRRRIIKRQKERENARGISDKNDYD
FT                   DQTQDSDAISLVNSDNSLSNIPIFSSALGGKSEASSTYSLLPSSSTVSESDAEMEQESK
FT                   EPSALSQKITAAMFSKRNENE"
FT   CDS_pept        complement(271722..272837)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111151" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436587"
FT                   /locus_tag="CAGL0E02871g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="methionyl-tRNA formyltransferase activity "
FT                   /protein_id="CAG58733.1"
FT                   /db_xref="GO:0004479"
FT                   /db_xref="HOGENOM:HBG059598"
FT                   /db_xref="HOGENOM:HBG272957"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniParc:UPI00003B623A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVD0"
FT                   /transl_table=1
FT                   /translation="MLPFISVRRVYARKFSTKPLNILFFGSDEFSAYALRSLVKLKHKQ
FT                   VIDSIQVVSRPPKWCGRKKSVLKSPEIVQYAQDLRLDQPIHVDSNEEMLQLSSLCESQK
FT                   IDMIIAVSFGKLIPNGLIGRVPYSLNVHPSLLPRYRGSAPLQHTLLNQDQYTGVTVQTL
FT                   HPTKFDHGSIVAQSDPLPVSDLLASRPLPPLINQEDTRPPKLAKLMDQLGIVGGNLLAD
FT                   VLEKRTYQDPVSHIESNYEPSYAPRIKTEDKMINWNDSATDLLNRLQTLGPLYTFKRVQ
FT                   LKSKSPLSLKRVLIHDFDVIERVISNQTCGTFTQDNHDSITIACGRNTAILIKKLQFEA
FT                   CAIETPEQFMKKLPKRCGKTLAKELVFVNET"
FT   CDS_pept        273462..276254
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044317"
FT                   /locus_tag="CAGL0E02893g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58734.1"
FT                   /db_xref="HOGENOM:HBG124472"
FT                   /db_xref="InterPro:IPR016531"
FT                   /db_xref="InterPro:IPR019350"
FT                   /db_xref="UniParc:UPI00003B623B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC9"
FT                   /transl_table=1
FT                   /translation="MEGRRVPGPRPIGAQLGIGIQSPGLYIPRNPRNYDPDDDDDADDT
FT                   TYSENDVRRKKQKTWLNSVDDAIPKNILDFSVIASEEVDTSEGAKVLSEALVNEIDDEM
FT                   DLLTDNTESDADSNLAGEELHNSSMKWQLGWDSIQTDVPKELELYPSVDIHHNYDLAYA
FT                   ATVNDNPRENSYIPSDIINEMAQKEKANRNNTVNDHSESKKFTPLDPNTDFLVAIGKVL
FT                   TKADIKNDQEERALVAYRHPLSPSNLIITYMEKENITVQNKEKADSNVIIYRPSQKTYT
FT                   SITINLNSVIKCIKFSKLAESLGSYSDMVGVLTENTLTVIKLIKFDAKEKKIDYTLFNP
FT                   LESRLISDFTIADFDFNPWDTDIIATIDTKGNWSIIEIPTVKKKMPNPESLNLKVKSNH
FT                   FGSIFDIEEMSNWKRIRWSNNHTRLVVMNESRLIELDFKQNWQQEVIQAKTWSKIRDVV
FT                   DLNDNFKLILTSREIIVTTINSSKNTRDSNHKINLKREVSWLHNISEDDASLRCRVQKY
FT                   QFQRKTLFFVYLYSKRFNVVYIHGFSIGYNDTIQSFGVSKIIYIPGIYNIDSIDVETLE
FT                   INDYYTDSIDLGDITSTLLIYDIVGNKLINYTLNNSANFDNIQLNNMAIERFRGPLVKY
FT                   PIPNVQALFKELQKEYLYAIRQYRKITRQKQRDNLQDFGYELSQKLNKVIEDSHDVRSK
FT                   TSIKLQSLMPKIPVQSDLTEIQSFLEQLSEHYSELGLIFTNVIKTLNQIIHEDIPTIDV
FT                   FYNKLLQCWSIVESNDLKKVADKVTKEIVTLTVWNAIKCTKKSDIDELRSLNYGKLSEE
FT                   QKSIVDQWDLTDDQLQDGLVDDGEASEQIRRPVQFSQYQESQSQIPVIKSSQTVRTRIN
FT                   SQRKSKTPSSQLAPSQASILPSSMSPAFSLDSQPPLLSQTFSQSSQPKKRKKKRMGGFG
FT                   "
FT   CDS_pept        277254..278750
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436588"
FT                   /locus_tag="CAGL0E02915g"
FT                   /product="Similar to uniprot|P53189 Saccharomyces
FT                   cerevisiae YGL028c SCW11"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG58735.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG124473"
FT                   /db_xref="HOGENOM:HBG204319"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B623C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC8"
FT                   /transl_table=1
FT                   /translation="MLPFIQLLYLALYLTSDVLAMPLRKREIVTRVHTASTTNTVTNFF
FT                   STTTQVIIAPTVQVIISGDTTLFSTMVGEGGDINAEPTTTITSIIQVKRVSLANEQPTA
FT                   TSTTPMLDSSSSSATTTSSAISSDITTTSIPSSSSIPTTTPSSSSSSSSSSSSIQSSSI
FT                   RFASQVVNLENVEANQNQQKQEEQQHVHNTAHISTPVVEMTTTTSSSSTTTLEPTASQS
FT                   STSNNNADTTIKSAPIAIAYSPYNNDGTCKSADQVKEDLQLIKSKGINQIRMYGTDCNS
FT                   LQTVLPNAKSIGLSVNQGLWITSSGVDSIDIPLQQLINYGQTNGWDVFAYITVGNEAVI
FT                   SQYCSVSDLVSKIGQVRGQLKAAGYTGQLTTSEPPVTYEQHPELCTASGIDFVGINPHA
FT                   YFDTYSSADTAGSFVKGQIELVQKACGTGNIVVTETGYPSAGIQNGGNIPSKPNQLIAI
FT                   QKILEATNNQVTLLSCFNDFWKAPGPYGIEQYFGILDNLP"
FT   CDS_pept        complement(279282..279626)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217382" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436589"
FT                   /gene_name="CGR1"
FT                   /locus_tag="CAGL0E02937g"
FT                   /product="rRNA-processing protein CGR1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG58736.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG124474"
FT                   /db_xref="HOGENOM:HBG395657"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniParc:UPI00003B623D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVC7"
FT                   /transl_table=1
FT                   /translation="MVEEEAKGLPVSKRVWKQEKEPLRANSRVVKNKKLTSWELKKQKR
FT                   LEEQQYKERLKALKDEKLETKRQQIEAMKLRREKKEEKERYERLAAKMHAKKVERLRRR
FT                   EKRNKALKER"
FT   CDS_pept        279860..282352
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500853"
FT                   /gene_name="CCM1"
FT                   /locus_tag="CAGL0E02959g"
FT                   /product="Mitochondrial group I intron splicing factor CCM1"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG58737.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059593"
FT                   /db_xref="HOGENOM:HBG204400"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI00003B623E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVC6"
FT                   /transl_table=1
FT                   /translation="MRTVLPVHRFVRTVYLPARRLVKANVGAQKIAPAASSAILPKDLD
FT                   IDIRGIEDPKVLEMKVKQLQEFTRNIKTEIKRRAKQKHTEEQPLELSNNEDISAVFNAV
FT                   VNTPKKADSIGKGITEKLMENTVDQIIDNVVPKAIQERIADKSLMVRALVRTSVHTPIE
FT                   SNMLVKKLAESEMRLKGLPQEDIRTFLKKSIKNLNFTNILELDKMLLEYVGNDISKFSD
FT                   NMYKCLFSNLSKLNAQSTQHSKDDLVIKMFNKLLKRYDTNLNTTNANVWNEKMTNVILS
FT                   YCINYSIKLKDFEITDKFVSKFKNDYKLLPDKQNYTSIIHFYSKLGLSDKAWDTFDTMK
FT                   FLSRSHAPDTKAYNSVLMLCKQEKDFRKTIDLYHEMVDKKVPMDARTYTTMIHTLAAAS
FT                   TDSYTSEGKSDSLRILGWKLINELSKNLQYDVMKNKHILISMLSLSAYDGDLGMARALY
FT                   YKIFHQKSDELYATMNPAQLENLSAKDILSYVLDPKVLNYLLLAYSRYDKGRLPLILAN
FT                   DEGSTLRRNVINAVDFGGHSSEMSALELANKITIPFLPYSEISENWQIIAESRALWLFN
FT                   LEYGGITDISLTSSIQENAMIYRDQAIDINEFKLKIMNDLIEWKTENLNNTVLNPTLLQ
FT                   TFLTIPLKSGNREEFYSRLNAFTFQQHNLNSVMEKFYEYKPESEEYNDCLKYFESLKRK
FT                   ILMSNSHYDLVMKAATKFGDIDAANQVWKDRGEYRKTTSFAKLPTKDRIISDSNFAKLM
FT                   VEFFVSQRLYSDAMAVVLSSKNFIKWDYSMVKSLHHGLIEAEDIINIEKLLDVVNRSKG
FT                   TKKAVDVINEQIEELKLS"
FT   transit_peptide 279860..279922
FT                   /gene_name="CCM1"
FT                   /locus_tag="CAGL0E02959g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVC6 "
FT   mat_peptide     279923..282349
FT                   /gene_name="CCM1"
FT                   /locus_tag="CAGL0E02959g"
FT                   /product="Mitochondrial group I intron splicing factor CCM1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVC6 "
FT   CDS_pept        complement(282560..283720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436590"
FT                   /locus_tag="CAGL0E02981g"
FT                   /product="Similar to uniprot|P48236 Saccharomyces
FT                   cerevisiae YGR149w"
FT                   /protein_id="CAG58738.1"
FT                   /db_xref="HOGENOM:HBG059592"
FT                   /db_xref="HOGENOM:HBG395686"
FT                   /db_xref="InterPro:IPR021261"
FT                   /db_xref="UniParc:UPI00003B623F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC5"
FT                   /transl_table=1
FT                   /translation="MATEEKDELRSELSLGNLVELLDPIASKIHYTQFPTIQNYDYKKT
FT                   WQRAKDKLNGDHKRLIKKHRERLVEQIKKWDGPLNRLFFHKTSTLEKLFYPFTLFNIFF
FT                   IGFIMGRFPQYFHVYYTVLFCILIPIRFYTYYKTNNHYFLADLCYFVNILCLAYIWVFP
FT                   RNQTLFLSCFALTFGSLSFAVITWRNSLVIHSIDKTTSCFIHIIPPCSIFVIYRAISPE
FT                   YRAERFPGAVILDPRNSISLKTNIINTSLYYLIWQVLYHYFITLRKSSKIQAGQRETSF
FT                   HYLTTHQYKDFWAVKLPTPWPIVIYTLSQYLYQLSTMLLCNIWIKYDEIWSQFFLLAIF
FT                   LCAAHNGATYYIDYYGKSLENEVTKLKVEVEELQEELDMAQSGSDI"
FT   CDS_pept        284043..284660
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093533" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436591"
FT                   /locus_tag="CAGL0E03003g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58739.1"
FT                   /db_xref="HOGENOM:HBG124475"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI00003B6240"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC4"
FT                   /transl_table=1
FT                   /translation="MFRSMFPGISRGVSTRPLGFGASRATTRVAASRLTNRFATRMSGA
FT                   RMATTTAQAKKEKGIKLLMKKYGSSALIVYIGLMLIDLPLCYLAVHSLGDETIAIYLNR
FT                   AKRLFGYGKDEYELVDEMNRKKHEKEAKVQYSESWWTQMKNSHMLTELILAYGLHKSLI
FT                   VVRIPLTAAITPYAAKIFKKYGLVSRLNFTRTMADDAKIRYK"
FT   CDS_pept        285579..285911
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500854"
FT                   /locus_tag="CAGL0E03025g"
FT                   /product="Similarities with uniprot|P48235 Saccharomyces
FT                   cerevisiae YGR146c"
FT                   /protein_id="CAG58740.1"
FT                   /db_xref="HOGENOM:HBG124476"
FT                   /db_xref="UniParc:UPI00003B6241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC3"
FT                   /transl_table=1
FT                   /translation="MAAFNDYCAVCEKLLDGLDIYCSEECKHLDEAFRDDAESTIDPLL
FT                   KSPLLYAQSGIDHEDMDDLELPASDSLQVPRTMGRLRNLCPIQEVCNDEKAAAQNYRLW
FT                   LQYNST"
FT   CDS_pept        join(complement(288759..288878),complement(286341..288485))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182967" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195478"
FT                   /locus_tag="CAGL0E03069g"
FT                   /product="Similar to uniprot|P48234 Saccharomyces
FT                   cerevisiae YGR145w ENP2"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58742.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG124477"
FT                   /db_xref="HOGENOM:HBG434023"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00017BD590"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC1"
FT                   /transl_table=1
FT                   /translation="MAPRNKVTARLVYITSMNAFHQTNANNFFGTHGVYTLLQSTVFVQ
FT                   INKAQHKKTIKYCKMVLKSTSANDISVYQVSGTNVSRSLPDWIAKKRKRSLKNDLEYQN
FT                   RVELIQDFEFSEASNKIRVTKDGNYAMATGTYKPQIHVYDFANLSMKFDRHTDAENVDF
FT                   VLISDDWTKSVHLQNDRSIQFQSKGGIHYTTRIPKFGRSLTYNPVNCDLYVGASSNELY
FT                   RLNLEQGRFLNPFKLDDEGVNHVTMCDVNGLISVSMENNTVEFWDPRARTRAAKLVLEN
FT                   DLDNSDFQVTTSSFRRDGLNFACGTSTGYSYLYDLRTSEPYQVKDQGYGFDIKKIIWLD
FT                   NVGVENSDNILTCDKRIAKIWNKDTGKAYASMEPSVDINDIEHIPGSGMFFTANEGIPM
FT                   HTYYIPTLGPSPRWCSFLDSITEELEEKPSDSVYSNYRFITRDDVKKLNITHLVGSNVL
FT                   RAYMHGFFINTELYDKVSLIANPNAYKDEREREIRRRIEKERESRIRTSGAVSKPKVKF
FT                   NKDLVEKITTKRGDSAASKILTDDRFKEMFEDEDFKVDENDYDYKQLNPVKSAKETDEG
FT                   AAKRIRALTAAEESDEERIAMKNGHYSDSESESESESEEDKAELTEAEKRKAEKQRKVI
FT                   ERRRKDKEEAEKFLDGMKVSDSGLSVNGEKRSVTFAEQVKTLEEENTDKKSTAQVLRRN
FT                   HRGAAELTFVPGKKSPKPKRMHRASSDSDEDDDDNKPDNGRAKPRFEGRRRASKNVFRG
FT                   M"
FT   tRNA            288968..289040
FT                   /gene_name="tRNA-Ala (TGC)"
FT   CDS_pept        complement(289401..290372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500855"
FT                   /locus_tag="CAGL0E03113g"
FT                   /product="Similar to uniprot|P13856 Saccharomyces
FT                   cerevisiae YGR152c RSR1 GTP-binding protein "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58743.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI00003B6244"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVC0"
FT                   /transl_table=1
FT                   /translation="MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSYRKTIE
FT                   IDNKVFDLEILDTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIK
FT                   DSQRVPMVLVGNKADLVDDRIIPVEEGIGVSSQWGKVPFYETSALLRSNVDEVFVDLVR
FT                   QIIRNEIETVTNTTNNHPSLSQASLNDPLRKNGSQGNMSSNNDRPHSPFKNTRSNSNAT
FT                   PSSQQSTKKSTLSRTNTNRSNSPGSLKKHQSGSNQDTLRKQIATNSSRNTQQDKKGTAP
FT                   ATAASKKQKPRAHASSPQSSASPAEIKQEKKKKKKNNLCTIL"
FT   CDS_pept        291237..292742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436592"
FT                   /locus_tag="CAGL0E03157g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="cystathionine beta-synthase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /biological_process="cysteine biosynthetic process via
FT                   cystathionine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58745.1"
FT                   /db_xref="GO:0004122"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0019343"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="UniParc:UPI00003B6246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB8"
FT                   /transl_table=1
FT                   /translation="MDSRHNVIDLVGNTPLIELKKLPKAYGIRPRVFAKLELYNPGGSI
FT                   KDRIAKSMIEYAEEQGIIHPSRSTLIEPTSGNTGIGLALIGAVKGYRTIITLPEKMSNE
FT                   KVSVLKALGAEIIRTPTEAAWDSPESHIGVARRLEKEIPGAIILDQYNNMKNPEAHYFG
FT                   TGREIQKQLEDLKLFSHLNAVVAGAGTGGTISGISKYLKEQNPEIKIVGADPVGSILAQ
FT                   PENLNETEITSYKVEGIGYDFIPEVLDRSLVDVWYKTDDKPAFKYARQLISNEGVLIGG
FT                   SSGSAFTALVEYCNDHPELSEDDVLVAIFPDSIRSYLTKFVDDEWLKTNDLWDDEILKR
FT                   VDFDEKKKPATDDVFKGATVKDLHLKPVVAVKDNALVSDVISILRDNAFDQLPVLTQDG
FT                   KLTGLVTLSQLLKKLSTGKVNNTDTIKNLYLDFRKLNNFDEVSSYNENKSGKKKFVQFT
FT                   SESTLAELNKFFEKNSSAVITDGLKPVHIVTKMDLLSYLASTA"
FT   CDS_pept        293323..294588
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000936" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195479"
FT                   /locus_tag="CAGL0E03179g"
FT                   /product="Similar to uniprot|P39927 Saccharomyces
FT                   cerevisiae YGR156w PTI1"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58746.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG124479"
FT                   /db_xref="HOGENOM:HBG204403"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6247"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB7"
FT                   /transl_table=1
FT                   /translation="MSDPRKRNTRHQLTPDNLSTSILVTNIPSDWNQDVVSSVVAGSGP
FT                   IIDISSRKDPRTGKVNGLVYDYREPQDCRRAYDLLQRVEKLPFELERIIPSNYKNRTES
FT                   VKDKPEIQLDRENFPWNAQLSLPFDMISEVPLPKKAPTATATSSNTTKNNDNNIVNSIG
FT                   SNGVVVFPEILIKSSQNLPKLEKEALESSDPISANLSKIPPAQMIEVISNLKMLANQHN
FT                   TKRSQLETFLKSNNDILMTMSQAMLEMGFIDYEVVTQVMKDVTKESKSGKSTNSNSNSN
FT                   SNSNSATPIMPQFNTMATPPMAMGGMVPPVNNMNMGGMVPMQGFMPAAPQFNYSPPPPV
FT                   PAPMQVPMSGPVSTPTQAPPVPMPAPVQMNEPEINVIKLQQLPENQREMVKQVLKLTDS
FT                   QIAALPEQQRAMVTNLRKEYLY"
FT   CDS_pept        295320..297881
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348701"
FT                   /locus_tag="CAGL0E03201g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="phosphatidylethanolamine N-methyltransferase
FT                   activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="CAG58747.1"
FT                   /db_xref="GO:0004608"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="HOGENOM:HBG059396"
FT                   /db_xref="HOGENOM:HBG738799"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR016219"
FT                   /db_xref="UniParc:UPI00003B6248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB6"
FT                   /transl_table=1
FT                   /translation="MSVVANVEVKMKGRTRSSGIHFDPPETHDMVRSLFDPRIKKSYLE
FT                   IVIASVILSNFVVCYWLLNSYGLQVAKYCFLGQYVFWRLSYNLGIGCVLHYQSHYETLT
FT                   NFAKTHRLFSKKNNAFLAKFAQFEISSKMPTNYNISEYPEELNVWLLFRQFVDLILMQD
FT                   FATYMVYVYLSMSSWRFTWRTGLGLAMILFNIWVKLDAHRVVKDYAWYWGDFFFLQDSE
FT                   LIFDGVFNISPHPMYSIGYLGYYGLSLICGDYRVLLVSVFGHLLQFVFLKYVETPHIDR
FT                   TYGTSETKELTNGTVDDQIAREHNDYTHPLISNGLFLENFDKLRFTDYFTVFTTWAIFS
FT                   WTVFGTPTSRRLFYLTFVAKLSTWLLLSYVLYRQSKEKWFTKLYLKNGYTQVHCFQQWQ
FT                   FLYNYSLVISYTLLVCQTLIKIKEIFPAIDYSQIIFGLICCALQIWCNTEIRSAISDFG
FT                   WFYGDFFLINYIVDRKLTTQGIYRYLNNPEAILGVAGVWGSVLMTDFAWENIALGMLWT
FT                   ATNFVLVKFIETPHVSKVYGPSADRMSGVEKTLYNIKPLRRVSELVDKAEHIILRSFLN
FT                   HETPLSSNYLKSGSPISFSNNSDDSDSGSEEAVPKPDRADKDILWENAVEHAIHKVSSQ
FT                   LGPYCDLEILGLDEKNKAILPNVLTVEWKLPTKLYHEKDWIGLYNVLDTKNIRERTRVS
FT                   SSGHWSGTSPEGYPHDLKNTKCIQEFQRTENYVCGKISFDANLMYFKHGIYEFRYHSKG
FT                   THRVLLVSKPFEISYPHFEASSAEVLNIELKKFLTELHVLKNNRFDDKGNDYFKILNLK
FT                   RLIRDSVGIELSTDYIKRVNGDIDVIAKRVWEIKEVLDKLE"
FT   CDS_pept        complement(298037..298783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436593"
FT                   /locus_tag="CAGL0E03223g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAG58748.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG204404"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="UniParc:UPI00003B6249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB5"
FT                   /transl_table=1
FT                   /translation="MNVQDRRRLLGPSSAKPLVFSTTASKPDETKKHDDNNEEKIALHT
FT                   GFIANCNGSALVEIKDTKITHHQTSLITSVYGPKSVRGSFTSQASLSIQLKNGLLEKYE
FT                   SRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRKSNIY
FT                   KILPHCISSITMALIDADIEIIDLAAAGQHNGSVASFIKGGQEVVGFWKDNEDNSDIVE
FT                   CIETCKSQYLEYRALMRTYLANRAAA"
FT   CDS_pept        complement(299473..300750)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436594"
FT                   /locus_tag="CAGL0E03245g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58749.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B624A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB4"
FT                   /transl_table=1
FT                   /translation="MAKSTTKKVSKKDLKLAKKEVESSSDSSSSSSSSSESSSSDSSSS
FT                   ESSDDEEPKKTKESSDSSSSDSSSSESDSDSESDSEESKEDKKESSSSSSSSSSDSESD
FT                   SEESKEDKKESSDSESSSSSSSSSSDSESDSDSSSSDEEEEAKEEKDSKKRKAEDEEEE
FT                   SSPKKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYV
FT                   DFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFL
FT                   GNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQG
FT                   EYIDNRPVRLDYSTPKPNNGGNGGNGGSRGGFRGGRGGNSGGFRGGRGGNNGGNRGGFR
FT                   PSGSGANQAPLGKPRTAFAGQKKTFD"
FT   CDS_pept        complement(301874..302338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436595"
FT                   /locus_tag="CAGL0E03267g"
FT                   /product="Similarities with uniprot|P53289 Saccharomyces
FT                   cerevisiae YGR161c"
FT                   /protein_id="CAG58750.1"
FT                   /db_xref="HOGENOM:HBG124480"
FT                   /db_xref="UniParc:UPI00003B624B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB3"
FT                   /transl_table=1
FT                   /translation="MQDVPVKARRLSREQIINEMEKEQDAIVVKLLKEIETLKLENTRL
FT                   RQRLAMFAEDAQNNNHSTQAARRRAGSVTSTTYSNSAILTDDEEDEDHNGHRRDSFLRV
FT                   PVSPTHSRQASMSSSASSSSNRRPSLVVKEQRQLELLEFRKRNASLSKKK"
FT   CDS_pept        303072..305162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436596"
FT                   /locus_tag="CAGL0E03289g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAG58751.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG124481"
FT                   /db_xref="HOGENOM:HBG204409"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="UniParc:UPI00003B624C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB2"
FT                   /transl_table=1
FT                   /translation="MSEDSAEQVRKTFIEQVRMRKAALEQAKLAKQKAEEDAKRAAEEE
FT                   EKKKQEAAEAEVRAAEEAKAAEAKAQAEAEAAAQKEAHAEADVDAIEADVEEKVDDSES
FT                   NAEVEVDAKEEAAPEEKTEEAVVAPENSISVFLENVHKAEGIEDPYTMEYPAGLEKPDP
FT                   RYKKETMKYTYGPTFLLQFKTKINFQVDEQFKASVLSKIVIPPSSGNRRNNSTRSLRDP
FT                   ALLPNSSRNGSRRSTRNSKRSSRRGDRDRDSRRGARDSFRKGDENSEKQDQKPPAEPVA
FT                   PLVPSANRWVPKSRLKKATTEDGEPTVRYAPDGKTVLLEKEDVERKMKSLLNKLTLEKF
FT                   EPISTEIIEIANQSQWEKNGETLQIVIEQIFLKACDEPHWSTMYAQLCGKLVKDLNEDI
FT                   ADENNEGKSGPKLVLLYLVARCHTEFSKGWSDKLPTNEDDSPMEPEMMSDEYYQAVAAK
FT                   RRGLGLVRFIGFLYNLHLLTVKMMFECFRRLMKDLTGSPSNEVLESVVELLNTVGQQFE
FT                   TDSFAIGENVLLGSDLLDTLFELIQNVIDAGKISSRIKFKLIDLKELREEKNWNNDKND
FT                   QGPKTIKQIHEEDEKARQLKAMNSSNMGSRNNSRRSGGRDRDFPSRQGSNRDRGLRNSK
FT                   REFSSRSSTNISKDSFITTRSASGRYTNAQTARNPLQKEEAPIKHSASTNMFSALMNDD
FT                   EE"
FT   CDS_pept        305985..307004
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500856"
FT                   /locus_tag="CAGL0E03311g"
FT                   /product="Similar to uniprot|P53290 Saccharomyces
FT                   cerevisiae YGR163w GTR2"
FT                   /function="GTP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58752.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG012988"
FT                   /db_xref="HOGENOM:HBG329490"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="UniParc:UPI00003B624D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB1"
FT                   /transl_table=1
FT                   /translation="MSLENTDSKAMVLLMGLRRCGKSSICKVVFHNMQPLDTLYLESTS
FT                   NPTMEHFSTLIDLAVMELPGQLNYFEPNYDSAELFKSVGALVYVIDSQDEYMNAVTNLA
FT                   MIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYL
FT                   TSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDINSKIYVSTDSNP
FT                   VDIQTYEVCAEFVDVTIDLFDLYKATQNLISDGNEQPKKRELKNVSQLANGVVIYLRQM
FT                   IRGLALVALIRPNDTDTENCLTVVDYNIDVFKKGLEKIWANSTTDAAKVAAIDNGDNA"
FT   tRNA            complement(307160..307231)
FT                   /gene_name="tRNA-Arg (TCT)"
FT   CDS_pept        complement(307479..312086)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI21044318"
FT                   /locus_tag="CAGL0E03355g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58753.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B624E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVB0"
FT                   /transl_table=1
FT                   /translation="MHPYVDNHTNVINPNLIGLIIVLGHLLFCIQGIGQLIWLLRYRHH
FT                   HRDRCISIRTRELSARNWFFITLYVVLSLSLTVLHLLLGKGTIELYHDNPWVTWAFSVQ
FT                   LLYALIILLPSFIIESFTLNYAMANQIMYSIFLAIVFLFQLSTNTEEYSMISPFSINNK
FT                   FLTILFALHVVLAVSLTTLYKPVKKLTTLYNDNEWFKDFNFLVNITFVWLNPLLTETHK
FT                   LNYIKNPEKLPLPPINLDIRYFTKELTANWETQKWSGRNSLMGALWKTFGTTVLISISY
FT                   ETTRDLLTIMQPLLLRSFIKSFNKGDYQEYPPLHSFLISMAIFAIDILSIFLTNQFYII
FT                   IFEAGLGIRGSLAAMIYQKSLRLSLASRNESQIGDILNMASVDVLRIQKFFEDAQTIIG
FT                   SPIQILVVLFSLYFLLDKAIYAGLSVMAVMIPLNTLLSRKLKVLSKTQMKFKDSRIKTV
FT                   SEILSSIKSIKLYAWEEPMLKRLFHIRNDLELMNLKKIGIMSNFISFAWNAVPLAITCA
FT                   TFFTFAVISKTPLSPEIVFPALSLFNILNSAIYSIPSMISRIIETGVSISRVKKFLLLE
FT                   ELDNSFIERSVTPEDDTTPVLKINNATFLWRSKENLHKDDKNGENDVEARIESSQIALK
FT                   SIDNFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGNNDHLSPQFQINATTVAYCP
FT                   QEAWIMNASVKDNILFGHKYDEAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGG
FT                   QKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKSIVLATNTI
FT                   SVLKHSTKIYLLENKSIAQEGNYDDIMNNQQDSKLKNILHEFDLEKPDTPAVQEGTDPT
FT                   SAINLLLEDALSGDDDEEEDNEQLDIQQISTRRASLVSLKPIQHLSNYDPKKKTSQQDE
FT                   KSERGRVKNSVYVSYMKACGYLGISFFFLFLTLTRCFDLLQSFWLKHWSESNQKANGNY
FT                   NLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTP
FT                   TGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIYL
FT                   YYQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAYEQIRRFSHLNYERIQFSI
FT                   NCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVTS
FT                   SLIWIIRSSVLIETNIVSVERIVEYCDISPEAPEVKEEHRLDDNWPNQGQIEFKNYSTS
FT                   YRENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITS
FT                   IGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEI
FT                   NDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDV
FT                   ETDKIIQETIRKEFADRTILTIAHRLDTVFDSDRIIVLDGGEVKEFDKPETLLEQKDSI
FT                   FYKLCDNGGYLKNRT"
FT   tRNA            join(complement(314472..314509),complement(314412..314448))
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        315140..315493
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436597"
FT                   /locus_tag="CAGL0E03421g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58754.1"
FT                   /db_xref="HOGENOM:HBG124482"
FT                   /db_xref="UniParc:UPI00003B624F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA9"
FT                   /transl_table=1
FT                   /translation="MTIQMLQILTIYLLLLHYVIANIAYSVSTPFPQWLTDITGLKKWP
FT                   GLDPPFIPNIKLDNIPENSRYNHERCRTRWGYSPPKIAHLIAMVVALRQIFTPAQLLHK
FT                   HLMMDLQYILTNY"
FT   CDS_pept        315568..316038
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436598"
FT                   /locus_tag="CAGL0E03432g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG58755.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG124483"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI00003B6250"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA8"
FT                   /transl_table=1
FT                   /translation="MVNEGHFIGTHTWSHKHLPSLSNRQIAAQLQWSIWIMNATAGVIP
FT                   KYFRPPYGGLDNRVRAVAARLNLTPIVWNFDTFDWKLSKNQITEEDILKNVREWKKKYT
FT                   EGIILEHDTAEKNVKVALQINDIIGSNQMKVDTCLPAHSQLSTIKLPLDKQY"
FT   CDS_pept        complement(316082..318685)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436599"
FT                   /locus_tag="CAGL0E03454g"
FT                   /product="Similar to uniprot|Q06704 Saccharomyces
FT                   cerevisiae YLR309c IMH1"
FT                   /protein_id="CAG58756.1"
FT                   /db_xref="HOGENOM:HBG058674"
FT                   /db_xref="HOGENOM:HBG202533"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniParc:UPI00003B6251"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA7"
FT                   /transl_table=1
FT                   /translation="MFKQLSQLGKNLTDELAKGLTDDLGNGSQTDLTAVPDDNSGLPRE
FT                   VQLKLRKFEKYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFF
FT                   KNLNDKNSMLNEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKENSNKLV
FT                   EKVKLLEEEAQAMKLENDKLTKSTETQLADKQKLIDQLKGQIQELEDKSREAFENSNDV
FT                   TGETESLKSTIDEKQKEIDSLKAQILEISTKSQNTSLISTTTASTGKGKKKKNKKSKGG
FT                   VNNASLPAPIETANLSVDMDGLQNELKDIKMKCEEWKARYEELQSSSKSTVEIETKNSA
FT                   LEEELVKVRDSLKQKNIEIEEVRDMLREVGNDLVDARDQIKNANSNAGKEVEEVKKELD
FT                   NLRSKNATMIETYEKTQLELKAKIASLNGEISEMKLNQTTILKEKEIASKDAIEKLSDE
FT                   NKTLKAQLKDINAIKLTLTQREKTIGYLEEQVKQYNEKNAVVQATIEKLEKELKSKESQ
FT                   LTTIQNENESLKKEAKTNVVSLENYLKENGKLSERLSILQEKYDTAQNLKSNSNEQVDS
FT                   IKRQCNELNVKLKESNKRIMSLEDELNEYMNTLQEKSRECDTMRRLISDQQNEESSGRQ
FT                   EIENKLALLTDERNKMESELALQTSRKNREIQNWKNMNDDLKSQLNQLQFREKQLLSQI
FT                   EDLNNISQTLKRSTNNDEDESGELKKVAGNLKEALQKADKRISELQESNEQLMKLNSDA
FT                   NKKYERLSNNYRTLSSQLSTLREKSSIDRLSRPSNESIRSRSNSEVSVTSNSSAKISPR
FT                   ASEAQPDVNEKIAYIKNVLLGFLEHKDQRAQLLPVIAMLLQLDNNDEKRLLMNIK"
FT   CDS_pept        complement(319193..323887)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436600"
FT                   /locus_tag="CAGL0E03476g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58757.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG058673"
FT                   /db_xref="HOGENOM:HBG202534"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniParc:UPI00003B6252"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA6"
FT                   /transl_table=1
FT                   /translation="MSSESLAQDGHELTTVYPMDVVVVQFEFNAGNKKEKYLSMQPGDT
FT                   VYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKPLRDHHRLFGKRSSSRSSRRSSFN
FT                   STSRPSVAMNVIGGNAGTGDGGSIGAYLNVVNSRNSMSRRGSSHLAQSSTSPMLMTSTS
FT                   GSLERTNSMPHNALSPRMKGQDNARSSSVISHKPNLSTSSSRSMSSVEVRNQREASKSS
FT                   ETTADKHEEIKVLSLEEIEMVINSLHSDITPTWVPIPLVTTSGVEGKTNDKLVYYNKDL
FT                   DLYCSELPLISNLNFESELEANRDTKFPTHDHLVSLQPKYLKTITAPSPRTTPSSDIPA
FT                   DIDDAASTNKSEKDTNDHGNTDNTEAKKYEKVEKNEKNEETDGHKKQHSSHVKQPVMSR
FT                   SDWFYQLSKDITTWSELHDLTAYYAKLAHRMFLSDNKYNFMKFFDLTSNYITFMVLACR
FT                   LIQNQEKLRNLPKDIKKVFKHMITSLGKININSRLFFDASLRKKYQFTGVESLANNTQN
FT                   QNIDNNDDAAAAGKAREDIFENSPNAGDSPLAGKRNVSTSTTDTLIPYHKNSLTTEEDS
FT                   GNNSDLISPSYIDANQFYAHSLSNYQRNSVTASTPRTSIQSTGINSSAATPTAKENIPK
FT                   SLTKTIYDIIDTEFNRLFKHIQYLHHILQMSVINGDDALPQLLPRFLKSSFNGGSWNNP
FT                   FSSFISSDSTINQKNSSHSSTRNSNNDILSRSHNSSLSAIQGKLGDSFASAAGSSGFVN
FT                   DNPLMHSSSAGNLPPLASAPSFVNSSKGNPARHFLRNRPSKRRSRYPLNNETLATMNRI
FT                   SSQIYDRLNSLNGEHLNIMNQPKTRMRNLEINSSIYEQVNQNNLMLEILENLDLTIFIN
FT                   LKRLIKAPPSTLDPESQEFLIHAMSSISSVLIEFFDIKQAFHDIVMRLIMTSQQTTLDD
FT                   PYSFASMRSNLIVGYYEPMKRTNTIGMKSFNQRKTDKHAAELYKSLVSQDVEFNDLNFL
FT                   NNSDDFIDACEKYVEIANLSCIVVEQLTEERENLLNYAARMMKNRLTTELLKGEQERWF
FT                   DIYSENNSDDEDELPRENEAGEENEAQKEVSGQVTELPWFLLPEYEDDLIYDTKGKIRG
FT                   GTKVALIEHLTCHSIIDASFNVTLLMTFRSFMTTREFFYALIYRYNLYPPEGLSFDEYN
FT                   IWIERKLNPVKCRVVNIMKTFLTQYWTPKYNESGVGVIVSFAKMAISEKIPGSDILLSK
FT                   INENIFGNDAQTPLEGENPLNSLQSVGLPTKNNVEQTAVKLHSSMKSSDLLDIDPYLYA
FT                   AQLTLIEHDLYLRITMFECLDRAWGNKYCDMGGSPNITRFIANANSLTNYVSFTIVKHA
FT                   DVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIYRLKQTWNLVPTETKEVLD
FT                   NLNSLMDSKRNFIKYRELLRSVKDVACVPFFGVYLSDLTFTFAGNSDYLDGKTDIINFG
FT                   KRSKIANIIEGILTFKKFHYKLKRLDDVQTGIEEGLEGVPHIEKQYQLSLQIEPRPETT
FT                   KTGNTSGHHSHDRLNKSSNPEYAEEKPQPFINFRRKKQTSKFFG"
FT   CDS_pept        complement(324476..324961)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436601"
FT                   /locus_tag="CAGL0E03498g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58758.1"
FT                   /db_xref="HOGENOM:HBG124484"
FT                   /db_xref="UniParc:UPI00003B6253"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA5"
FT                   /transl_table=1
FT                   /translation="MQDIREEMDDTVVIGDEDVLSTSSGSSVEVVEAPASSERPVLTPQ
FT                   IVALWATMMAVVLTVSVWYMQRYGYISTLTPIGGESVYVFKSAGGDSIKVVAPRGMQGQ
FT                   YMLDFDQGTMRRVLGDHTLVRSFYDVAERVRPRFKSGVSATRSLLKRYRDMLSQRIG"
FT   CDS_pept        325118..325798
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348702"
FT                   /locus_tag="CAGL0E03520g"
FT                   /product="Similar to uniprot|P36523 Saccharomyces
FT                   cerevisiae YLR312wa MRPL15"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAG58759.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG058682"
FT                   /db_xref="HOGENOM:HBG202536"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI00003B6254"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA4"
FT                   /transl_table=1
FT                   /translation="MGMGPTTAQQDRLTMSMIGRRWYMHAGARVRGLRRDPVSYLKNPA
FT                   GLVYTDVGGDYHASVRERMGFQEHGIELSDAAILQCLTHKSFAHGSRPYNEKLNLLGSQ
FT                   YLKLQAAMHSVGPENSFGNLGTPVSKGLVSYQTAAEYVIAKNLEPLVFWKVSDPLNDGP
FT                   IKGKSKVMSTVLNSFIGAILLQQGEKKASQFIVEDLLNPSNTQSLLNITLRKLDQQKET
FT                   VHSN"
FT   CDS_pept        complement(326046..328583)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436602"
FT                   /locus_tag="CAGL0E03542g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58760.1"
FT                   /db_xref="HOGENOM:HBG124485"
FT                   /db_xref="UniParc:UPI00003B6255"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA3"
FT                   /transl_table=1
FT                   /translation="MAENGTKPLDIEKKKRIARAYDAITIYFSKRKREKYNIPRPIKLR
FT                   VGELSSRKFFQLLTDLHHQCDYRDGRLKESDPIISESQLQKKLCTLDKSTYMKLLNDTI
FT                   KSFNERGLSYLVTSHRSTEEIQRLSQQYCKVSVMNENLKQKKLELELAVREKRNKSFSI
FT                   NYLKNSMYKSDTLIAKFEAPKDGIPYVLIVQLTECLSSLTAYVSNTKRDFDVEGIFKTI
FT                   LSVNEVFREINLFMDVPRYKKQIFVLRLAISHMITSIRFFLLQPKAIPKLAVISSISDI
FT                   HFKLCVLVNQVGMKITETDESMVQRSALVNGKKREVDAVQKVETMLADSVASKKLEAKT
FT                   EVIPQSNTNAKDTSVDFSGPLINKNSLLDNIHKENPGRDVTLSAESELYKEVNKKNNYS
FT                   ENVELPVNNSSKKMGEDCLVKSHEDIDDLNDKSGLIESTTSSGRLAKSVHSGMQTDSKP
FT                   VVPSFKIDTVEGYDSSEDLNAEPDLNAEPDLNAGLDLNIEPDLNAGINLDVESDLSIEP
FT                   DLNIGQDLNSKMVSNMETEVAEDKDKRDASKGKAIHKLETEIDDMGVSSTDSESVDSLD
FT                   QENGNVPHNSLYTKNEDEKKQRFKEKVKKFGTTAGLGLRLISESNNEPTTKPKLTNQEL
FT                   AKNIKGSTLAPSGGQKMSLKSDLSSRNSLHPLLKKFVAYEDEFWESSPLLPLHNFGSGS
FT                   ENRLSRINVQSIGQLINILNTMYEKFDLKYQKLLETLKNNKSTRGSIRRESNAIAEIVA
FT                   QLADKVMQILTKDENTEILKKFSGHIERLESYNNGLASFAGLNVKGKIEIQSEDAEYAS
FT                   HSFKQRISETLYRISTTCKDVIKGFQEYNDGDD"
FT   CDS_pept        complement(329297..330934)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436603"
FT                   /locus_tag="CAGL0E03564g"
FT                   /product="Similar to uniprot|P32457 Saccharomyces
FT                   cerevisiae YLR314c CDC3"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAG58761.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00003B6256"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA2"
FT                   /transl_table=1
FT                   /translation="MSFEGSVKKEPIEDDVGGYSIGAAAQAQHAPQMAPQVPQDMKDVR
FT                   SSVSASVTPANDAEVAMDQEYYADSADHADHADHARELGQVLPEQPDLKIVRRQVTGYV
FT                   GFANLPKQWRRKSIRKGFTFNLLCVGTAGLGKTTLVNTLFGRDFAPGAMESNIPGDYQA
FT                   EMDSVDEKVENLKIEDTDENGIAAMAAAAGVANGQGKAAEEENLTSSIHMEKQSAVIEE
FT                   NGVSLKLTVIDAHGFGDAIDNSDAWQPIVSEVNKRFDQYLDAENRINRGVIEDTRIHAC
FT                   LYFIEPTAHFLKPLDIEFCKQIHEKCNLIPVIAKSDILTDEEIAIFKSRIRRQLDEAGV
FT                   TLFEPPTYALDDEETVAATKELANKVPYAVVGSTEMVTNSEGKLVRGRTYPWGIIEVDN
FT                   SAHSDFNFLRDLLIRQYMEELRERTVKVLYEKYRSEKLINLGIKQDNSVFKEYDPETRQ
FT                   KEEKQLHEAKLAKLEAEMKAVFQQKVSEKEKKLQKSEAELFARHKEMKDKLTKQLKALE
FT                   EKKHQLEISISKQVSQSPVQPKKKGFLR"
FT   tRNA            complement(331517..331588)
FT                   /gene_name="tRNA-His (GTG)"
FT   CDS_pept        331962..334802
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195480"
FT                   /gene_name="NPR3"
FT                   /gene_synonym="RMD11"
FT                   /locus_tag="CAGL0E03608g"
FT                   /product="Nitrogen permease regulator 3 "
FT                   /biological_process="meiosis"
FT                   /protein_id="CAG58762.1"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="HOGENOM:HBG059862"
FT                   /db_xref="HOGENOM:HBG203824"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniParc:UPI00003B6257"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVA1"
FT                   /transl_table=1
FT                   /translation="MNEFLPDSCLLGVMLAVSSHSGPQVIYHYPPSNRILETARDAHMN
FT                   QQLGTTGLKRETEGRSMKSRGHPGNWDMNSELDSDLHSSKMERTASSSSSSSLSSPSSG
FT                   LSDSELSTDYADWSTSGSSSDSELDLQTPDDSRRSQLENAGARSTRNVSPVSMSRNTSL
FT                   GREPKDNGQKISASKLLDILNDPKSQFTKINTNDTNDDQFNMEEDDDLIEFDYMTSEKR
FT                   VDITEEFFTEANYQDTSKFFEFDIDFLAELCCPSREMCNTRFELTVDEYCFLGHPIHVD
FT                   SSGNWRKSRKRNNSLSKSKRSGSLTGSRKRSGSKSSNHDKSFSAETPNSPESSKIIEEV
FT                   GSLHKSRTLSNPQNDHFTKDMTMFHVCFIMDPNLIEYNKRVDDMYQYVVARLSVLLRYL
FT                   QSKNDYVSEQCELILKEKEKVFKNSKHYKSLSLPSEKGRYLYQRLLAKSSLARALTECV
FT                   EKIKKNEIACLEITDHRTVSLQIPIQNEFSILPQYKLYPVLKGSFLTSIQNNKFLEKSA
FT                   NIDDNHHAKSARDTNLISDHVNTFSNGQTKNEIFYSKNMENALTAQNDYDDDDLLLYSI
FT                   LLLDDPDKIIADLDNYSSNDDIGGVILKQLVKVIQPNVPLLSYQYIINELLAEKPLSSS
FT                   TTANKSKQNKDNKTNTFYSALLRSCALHLIYWRHARAILPISFKNTYIVSPLSPVEADN
FT                   SEMIKGNRKPSITDLNVTSNSSSKIPVIYLNQQSFKLKFPSLPSLPTFLNILSLGKPKA
FT                   FGNIIPSKEHKPIYMAALIWLIQKGYLTQLLTFVYIRVDKKIKMKVDEDLEKEGFRTNR
FT                   RRRQEDNVDNKLLSTDENANEPPKSTKVDINDNTLEGRDTEYDSDSFDYDDPEFNHDYT
FT                   IILEPERATALEKRWIYKCIQDQPQDIKILFNKVMKYMNGRTAMETVMLKEHISRHDIK
FT                   RLLTSLGNYIVELNHW"
FT   sig_peptide     331962..332024
FT                   /gene_name="NPR3"
FT                   /locus_tag="CAGL0E03608g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVA1 "
FT   mat_peptide     332025..334799
FT                   /gene_name="NPR3"
FT                   /locus_tag="CAGL0E03608g"
FT                   /product="Nitrogen permease regulator 3 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FVA1 "
FT   CDS_pept        complement(335328..337568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142374" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195481"
FT                   /locus_tag="CAGL0E03630g"
FT                   /product="Similar to uniprot|P38741 Saccharomyces
FT                   cerevisiae YHL024w RIM4"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58763.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG124486"
FT                   /db_xref="HOGENOM:HBG203819"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6258"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FVA0"
FT                   /transl_table=1
FT                   /translation="MSDSRSESSSSLSVYASISSSTSTNAFNFRADSGQQGINDSHKIT
FT                   TENKNTTIKSPVSHENDKYTNKLKAENETTPDNVTNTADTIGDYKGRPSACIFVASLAS
FT                   SLPDDQLCMNVTKHFQNYGQLVGVKVLRDDHNRPYAFVQYINDKDAKHALKNASGTVLN
FT                   GRKLRCEAAKVNRTLLLINSKPIEYTEVIDFCNNFGKLEVLVPGKQSSSIRQGGGFNKL
FT                   APFRSSIGINIKQNQHNSLDNSTVSTSWFTQFVFREDAIRAFANIKDSNFWDVQWVQNV
FT                   EVSPKYNLLNRADQFVKRNPSNDSNERDSDDFEKDEKAKYGSTFSLNARESDFQQDTDS
FT                   VSTISSASKSNDKIAADLKFAYRQINTRDKFQIDKKSIFVGQLDLSTTKEILVKRFSTH
FT                   GKIRNIDVVSKPTTVFAFIEYETEQAAAAALDKENHSILLSKTMHVQYKEIGGPHGRRL
FT                   FKRNSYFKEVSKTFTPPEANLAPPPINMYMRMVSDNDSTLIPFPYIGYPLPEGIHEIDI
FT                   VPFSGNPYIKAGVSGRNISATGHWSSVRSNSNQSTIADVSSLNINNTTSLQAKDITSET
FT                   RNGGTTLDGDKSQSSDGEHHVGSPLSTTSTEPLNSSEKQNFNRYNNGTNGSYTYVSRRK
FT                   FISRRNGYGYNEPPRNCFFPPYVYPFQYPIGSIHAGPNASGNHPYMMVYPLPPPPPPPH
FT                   SGIKNSIIPPTPLGIPQSNTSIPPMTSSSSTQYMSTDSPKFIPEKKKQELEY"
FT   CDS_pept        complement(341431..342099)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044319"
FT                   /locus_tag="CAGL0E03652g"
FT                   /product="Similar to uniprot|Q07821 Saccharomyces
FT                   cerevisiae YLL027w ISA1"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAG58764.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG124487"
FT                   /db_xref="HOGENOM:HBG202531"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="UniParc:UPI00003B6259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV99"
FT                   /transl_table=1
FT                   /translation="MLRNTALRGVRWGSTSVNTVGARPPFKFMFQKEAKPSTGNSLRAT
FT                   NGKWSSYKLPTPSATTSIPDIRNDTVKSVTLGIHNKESPAAKTMAVPVKERAHEGLKTS
FT                   NKGKKRRLVPHKQLISLTPAAVAHLRSLCQQPEPKLIRISAKHRGCAGLSYDLSYIDAP
FT                   GKFDEVVEQDGVRVVIDSKALFSVVGSEMDWVENRLFSKFVFKNPNSKGTCGCGESFMI
FT                   "
FT   CDS_pept        complement(343351..345084)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436604"
FT                   /locus_tag="CAGL0E03674g"
FT                   /product="Similar to uniprot|Q07824 Saccharomyces
FT                   cerevisiae YLL028w TPO1"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG58765.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B625A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV98"
FT                   /transl_table=1
FT                   /translation="MSSTSSDRPYDPLAPENEGVASSDVESTDSGEIRSYGPEEVLKNG
FT                   SQIKDKGPALSKNSTQTSAVESAVAANRRLSKILTNTVDEPDVLEVDYSKCPPMGGGRP
FT                   FPPTLPEKTQFEVTFDGPNDPLHPFNWPLRKKVMLCIILCLNCISITMGSSIFATGIRQ
FT                   ICEIYHVIPVVAILGITLYVLGFAASPVIYAPLSEIYGRRGVLVISSFGFALFNFAVAT
FT                   AKDLQTIMICRFFAGFIGAAPLAVVPAAFADMFDTNIRGKAICLFSLGVFVGPILAPVI
FT                   GSYITQHTTWRWLEYVIACFASAIFVAILFFFEESHHPSILVGKAKELRKLTGNWGIHA
FT                   AHEDVELSVKEIAEKTITRPIIMLFTEPLLLIVTIYNSFVYGILYLLLEAYPIVFEQGY
FT                   GFHTNGELPYISLIIGMAICGAFIWWMDEDYLRRYRKKGGLVPEARLLPMVVAGIVFPI
FT                   GILWFCWTGNYPHKIHWIVPTIAGAFTGFGLIGIFLPCLNYIIESYLLIAASAVAANTF
FT                   MRSGFGAAFPLFAGYMFNGMGVNYAGLLLGLLAVAMIPVPLLFLKYGPGIRKRSKYAYS
FT                   L"
FT   CDS_pept        complement(347116..348294)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500857"
FT                   /locus_tag="CAGL0E03718g"
FT                   /product="Similar to uniprot|P18888 Saccharomyces
FT                   cerevisiae YHL025w SNF6"
FT                   /protein_id="CAG58767.1"
FT                   /db_xref="HOGENOM:HBG124489"
FT                   /db_xref="UniParc:UPI00003B625C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV96"
FT                   /transl_table=1
FT                   /translation="MAVVKKKRYLSKSLKNGRAARVQRNRTEYAGINGSSLLSGSMELL
FT                   EVDEESQSLVMGDDESVAEFEQRRLAAESMNAITHDESDTISFRNYLLANYLRGANYFN
FT                   ALTIHNVPVSRIKPPKLFQSPISLMELKKMIELQKAGIGKIKAVMDTWIKERESMVSTE
FT                   HTKFYKSRMKVLDTDGLEGIHHVVKNIESRLGGRLQDRAYHLYDPEVFGTKFRGDMREA
FT                   PEDYWEKYPELVKERKEKEAKMLREKEEEELRKKEEEERRKREEEEAKQRQQLEDDQLK
FT                   RNQQPSETPSGALPLQITVPLSGAENSSGGHTPAPGMVTASMGNSSDIGLGTDQQPQPL
FT                   PVTQEPLLNVASAQIPPQDQAQDIENVFGEYEAEPFNTGFDDEFADLDNVFF"
FT   CDS_pept        349598..350470
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436605"
FT                   /locus_tag="CAGL0E03740g"
FT                   /product="Similar to uniprot|P38740 Saccharomyces
FT                   cerevisiae YHL026c"
FT                   /protein_id="CAG58768.1"
FT                   /db_xref="HOGENOM:HBG124490"
FT                   /db_xref="InterPro:IPR018852"
FT                   /db_xref="UniParc:UPI00003B625D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV95"
FT                   /transl_table=1
FT                   /translation="MYHGVKEKITLWRFPHTMSGDCALTVFIQVCVTWVAEELFIGWDD
FT                   YLGTCGHIPWPWKIPQNKWVRLFFEVDRGMRRMYAEWLDWSQEAAVVLDDEKNGPPGTV
FT                   TPQHTSQMVAHPIQQEPNDESTANDSENPDEHRNKEDRMSFEDTSSKDHLNPQTGFKPL
FT                   TFKEYLLKQFIHYDNHGFMWNFIEWAIQKVIRGLILSAIIWFFVWPVTMGILAGIGTKI
FT                   GSHEYYFNHYPFPQVMKMIYGVVIGLISTPATIIVIMLRNDWHEADYQERELRKDLENE
FT                   ADTSKSDEE"
FT   CDS_pept        complement(351240..352994)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436606"
FT                   /gene_name="RIM101"
FT                   /locus_tag="CAGL0E03762g"
FT                   /product="pH-response transcription factor pacC/RIM101 "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58769.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124491"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B625E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV94"
FT                   /transl_table=1
FT                   /translation="MYGIFYAPEKLQIRRKDREKKKYLVSHTWIVKTPLPLISGQSYIN
FT                   INKKTKKNSNIWEFRILPETSNTSLNTAMHTMVKNGQQTPVLLGSKIEPRDSTSIKSLV
FT                   NEPNTPTDMYHPKIKTEYDMTIKKESPTSTEPLKETTKDTSKDTPKETLICKWSHCYRE
FT                   FQQAELLYHHLCQEHVGRKSQKNLQLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFACS
FT                   TCSKRFKRPQDLKKHLKIHLSDLGIDAPKKKRGPKVGSKRVNSKSFHKVSYDQVPAIGS
FT                   ASQPRFNHYAPMQASQPVSYEHWVQMEMPHYTPVYSPALAERVQAISAPTLYVQGFENR
FT                   EPVVAATQFFTRLSTNMAYQVPNIQNQHLYVPNYVGRPDNLYLHSTAHSSDNSVKTSSS
FT                   SSPIETSVPTTHHTDNKRSPLPAIHYVPQSNIPLVHSHVQPHYSANEVRPLPSLSSISM
FT                   VTPKYVIDQNLPKYNRTYDTFSTNQKSCADEEEEIYDSDVSDDEISDMMNKVNLSDKNA
FT                   NEEEYDSDEEDFIATFKRVNILKDYAICTLLEEEYDTEDEPEPVLQPNVAESKSFDAHL
FT                   MTFPEILI"
FT   CDS_pept        354229..356043
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000867" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436607"
FT                   /locus_tag="CAGL0E03784g"
FT                   /product="Similar to uniprot|P38738 Saccharomyces
FT                   cerevisiae YHL029c"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58770.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG059434"
FT                   /db_xref="HOGENOM:HBG203791"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B625F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV93"
FT                   /transl_table=1
FT                   /translation="MSKSLKHIKQQCRDRELVQEVIELVRRNDHDSLAYVARTLGIPPQ
FT                   LRFVVWPILLKYHPMCISPNIMSNTVVWDPLTSSYHLTNADAAQDVNSSGYVANGAANG
FT                   SANGYEISKTSTNSSTSDDVVNEDMVHLEKIILKDLRKYFHSRATSSSQAVSSSSSSTA
FT                   EPSSPTVSDECEIIDSLKNAILRFLSKWSRIFKYEIGLAWLALGLAEWFPALLPAKFDL
FT                   NDECFLVLNGRRHAHTSSGNNNSTSISQLFQEYPLLDYLKNKLPSERLFTFDQLYERLL
FT                   LVLIHSPDTALEQNKIKRDFPQDSTHISNYFPVISGGDLSFRTQIFFKVFSTILPELYQ
FT                   PLIEEVNLQPNSSRTSWLYWWFKCAGARSLQRQDRGRIWDLFLGWRPKPDHVTINFYLN
FT                   YNTKSFAHLYHKSPSICHSKFWNKYEKNDTFWFPDLDSIPLGTPPYTHDVTIIKELLRR
FT                   NKYEERASDSNDTDQECCMNSIPFSIISPHTQLIFIYVAILQFNEFKLLEFEETEIAEF
FT                   LNNVPMLSKADDTAFKKLFDTGSTLDNVVLHDEASKRPSSSSNNHMLIEVGSDGKSSHS
FT                   FNDLMKMAGDIWRKWLWRELEENLNNEP"
FT   CDS_pept        356594..357376
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436608"
FT                   /locus_tag="CAGL0E03806g"
FT                   /product="Similar to uniprot|Q07872 Saccharomyces
FT                   cerevisiae YLL038c ENT4"
FT                   /protein_id="CAG58771.1"
FT                   /db_xref="HOGENOM:HBG124492"
FT                   /db_xref="HOGENOM:HBG202496"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI00003B6260"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV92"
FT                   /transl_table=1
FT                   /translation="MSLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYS
FT                   KKTLKDVIQVIRKRLSGVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVI
FT                   EYLSSFEAQSSSDEPMVNQIRFLCNDIITLLEDEELLEKRRRDVIQFRSSISSPGRKST
FT                   DNSHIKTYDRQFQLSRPKSDKFLDENQDIQYMDSMDQDNPLDSIIESNLKNRGRRAGHA
FT                   NTHPLLESLEEEDQNSLLPDKENLPAGNSKFLASNPFR"
FT   CDS_pept        complement(357552..363242)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436609"
FT                   /locus_tag="CAGL0E03828g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG58772.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058338"
FT                   /db_xref="HOGENOM:HBG396849"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV91"
FT                   /transl_table=1
FT                   /translation="MEKEKDLVEKVDLRFALADTAEKFQAVLDTFLAPLLLKLASPHEP
FT                   VRQQVFESIKNILQRLGSLPTVRIPVLRLVEQAKKADGHNNVALYSLLFASKGVDRLND
FT                   SQEIQAMIPTVMGGISQLPEMCAARMFNLLCRLLLLWKPPMVSSLEEDQVSKLLALEDP
FT                   RDLEFLMLKFTKFFMMVPNSNTNSGIIPRGYSSPGLSAAEIEFFTYKAGVAFNKDQLLR
FT                   YKTAIFHFVTRGLIVFSMEEQLRDPENDPTNDDLKAVSLVTFLCVVSTDNSDLGELAIT
FT                   RLKRVHIPYENESFVNFMISLFTGDKSNGIPPTSSNIQETIFSILNRSIYATTSPENVK
FT                   LICAISLNSTNHKLASLCLSFIRHVAKNNYDSLTLISSASSESDHYGINLPSMIRNNIQ
FT                   TNGWPRLQLGQGQQFNLSIKQRELQYETLGDLLKNDFDLIKDISYIEFLFTSLKNDIPQ
FT                   CTASIQHALNSVLHHLPQLHSDNKKKLKKLLHSILADDYYKIELKENGKLGTVEGKERE
FT                   DALMSARYMAIKFTNSAFSFDDEEARMLNIFGTSTENRLDITEEAKKGLHPYWFRINYF
FT                   KSFKTSANAVVESLDQQLGSQITKTKLPTLKTMSSLLLEEVHLLKEDRNSQRVIDKCLN
FT                   NAVSFLRNCLVEEAIQGKNTIIVQDQDWLVRIEEAIVSDSNVMELVSEYISGIHEKYFV
FT                   DLLRLLLDEFTERDHSGTQVSIAAAKNHIYQDFLLLLLKACHSDVLKYIYDKVDNLSYL
FT                   AINITTYPNTEVITSSRALGIIGSSSEEVSNLLIEKFKLSNDLTASKLSHEHLKSILPN
FT                   ILILSHLLPRLSMRGYKDANMTAQLHATLDMLENFFSESITFERKLVLSATAEILKYGL
FT                   LCILDASDTQSKIKKLLFLLGKKYLNDEDCTRVLSYLSLYTSSVPEMENIADLLWKTTN
FT                   SKEIDYLFSVGECISIIAGGWHSKILLDDLDIYDPKLVTQLKQDFNDRYAEEVLKKVMT
FT                   LCTSPNPTLKKAGTMWLLSLVQFTSSSPVIIEKCAEIHRCFVSALIHKDEIVQESAARG
FT                   LALVYELGSTDVKEDMIKGLFKSFTSNVDGLKISSGSISESTELFDKDTLKTTDGSIST
FT                   YKDILSLASEVGDPSIVYQFMSLAKNSMLWSSRKGIAFSLGSIMSKASLEKYLIQNKDL
FT                   ANKLIPKLYRYKFDPYTVVAQSMNDIWNTLIVDSKSTIDQYFDSILLELLEGMGNKEWR
FT                   VREASTTALMDFVRSQPEEKFSGKILDIWTMAFRSMDDIKESVREAGTRFTTVLSKMLV
FT                   RSIDTSNNVSPEHSEEILSNILPFLMGTKGINSDAEDVKNFSLKLLLDLVKNSPKPLSK
FT                   FAPEIIYQFITLFSSLEPQVVNYLSLNAKNYNIDMKEIDNQRKNGIAVSPLFEALTKLI
FT                   GTTNENQVSEVVDAVIRGIKKSIGLPSKVAAAQVVILIVKHYSLAIKQYSGKLLKRCVD
FT                   MFEDKNEAVSIAYAQSFGYIYKVISAEKSLKYAKQLKVLFFSNSIDHIKIVVAAAILSL
FT                   FRNAPSEFAELARVLTPVILLGKNDIDQATANVFSDLWTDTASSGAGTTKLYLDEIIDT
FT                   IRDNIQSNDFSTRRSCAKTIAGISLSIDENTPRKTLSKIFDVTIQSLSGRSWDGKEDIV
FT                   SALVSISEKCTTYLNGNKELATKIETTLCTEISRNNIRYVRSISKDYLRFVRIVPSDKL
FT                   YCSFNKELLTKLFAENDENAATEIKTNPEVQLQSNKRMKTSITQHLSKDNIQAVDFMIQ
FT                   VLHEMAKDCIPYMENKYPLEFLNMILEYAQHLTLSHTMSKTWRVRESVCLIITELCKNF
FT                   PLTIINQEIEDKFKSIWSSIFNENKTHETTENVKIETIRLGGEMIKKFSKLSDQIQRDL
FT                   SIFTEEELSTARLAVELKNVGI"
FT   CDS_pept        364089..364859
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348703"
FT                   /locus_tag="CAGL0E03850g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG58773.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG299101"
FT                   /db_xref="HOGENOM:HBG616382"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI00003B6262"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV90"
FT                   /transl_table=1
FT                   /translation="MIRRGVLSLGISGRRLMSTEAPRLKTFKIYRWNPDQPEVKPKLQE
FT                   FKVDLNECGPMVLDALLKIKDEQDASLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQ
FT                   DTSKQAKIYPLPHMFIVKDLVPDLTNFYQQYKSIKPYLQRKDYPADGKEVLQSIEDRKK
FT                   LDGLYECILCACCSTSCPSYWWNQEEYLGPAVLMQAYRWLVDSRDQATQERKDMLNNSM
FT                   SLYRCHTIMNCTKTCPKGLNPGESIAKIKQQLAF"
FT   CDS_pept        365450..366124
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436610"
FT                   /locus_tag="CAGL0E03872g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58774.1"
FT                   /db_xref="HOGENOM:HBG338865"
FT                   /db_xref="HOGENOM:HBG382530"
FT                   /db_xref="UniParc:UPI00003B6263"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV89"
FT                   /transl_table=1
FT                   /translation="MSKGPSFVTVRSEAISRESKTESLLGKYSTYAQAASSDATSQEKH
FT                   LDEQIEKLLGERQDIIDNLTKIAEDTPNISASKQSQLQRHREILQEHWKNFRGIRSSIQ
FT                   QERNRLNLLFSVKNDIAQQQQATDNELFNDEEAYNQNESRRIDQSHNILDRLIVQAWET
FT                   RENFNAQSSTLNSAGNKALQTLQRIPGVNLLIGKIGTRRRKNAIILASVTTICILFLFF
FT                   TW"
FT   CDS_pept        complement(366711..368519)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348704"
FT                   /locus_tag="CAGL0E03894g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58775.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124331"
FT                   /db_xref="HOGENOM:HBG202480"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR012269"
FT                   /db_xref="UniParc:UPI00003B6264"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV88"
FT                   /transl_table=1
FT                   /translation="MESIHDAMSDILGKDQHNGRHGDNHSRRPGRRGSNTGSNYDFERQ
FT                   SMEYEPSVMPHTNYIPEYRLGRDDNTIFPIQEVIPNSQDAMEELAARSRRQRAATATIN
FT                   ANNNDFQRNNDGLGGHGENGDEIHGEEDLDIDDPLRDNVPMMVKPKILHQNPQTPTVLP
FT                   STFHPISKWSSVKRYYLKEFLAEFLGTMMMVFFGQCIDIQVNAGAQIQRNQYLAYVERL
FT                   NRTKAVTNDTLEILNALPLLVSTTTSGTADNVPKNWAAAVVMGYFAAGGSAISGAHLNP
FT                   AATVTTFFFRGFPARKMPFYFAGQLLGGFMACLLSYIYYKRVIMEGYPHWYESETVAGF
FT                   FVTSPKPYLSTERQITSEFMCTAAMQLCVFALTDPYTSLSADIFPLLLFLMALVVNSSM
FT                   SFQTGSAMNAARDLGPRLALWALGFDRKNLWIHHHRYFWVPMIVPFWGSMTGALLYDFC
FT                   IYQGHESPVNWPLSLYKEKFMKLWHRRPGWKNRTRKRRTSDLSDFSYQNDDDDNLTDND
FT                   FKDKPKTAKTNVKPNQGGNPADEAGKFVRFQSVSQRGGRSRHNNSTTILEEDSIETASL
FT                   GHSQSDSVDNSDKHSIHNATDEKVSY"
FT   CDS_pept        371422..373440
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436611"
FT                   /locus_tag="CAGL0E03916g"
FT                   /product="Similar to uniprot|P32190 Saccharomyces
FT                   cerevisiae YHL032c GUT1 glycerol kinase "
FT                   /function="glycerol kinase activity"
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /protein_id="CAG58776.1"
FT                   /db_xref="GO:0004370"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="HOGENOM:HBG252634"
FT                   /db_xref="HOGENOM:HBG511469"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI00003B6265"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV87"
FT                   /transl_table=1
FT                   /translation="MISVNDGNIQMDKDGNIPLIASIDVGTTSSRVIFFNKQGQEVAKH
FT                   QIEYSTSASTQKYAVHGSRRQSIKDQTKMANPEKDKPVFTSEGIAIKENEYLTIEEFHG
FT                   ANEGPTLKFPKPGWVECNPMNVLVNVVQCLGTTYELLDNLNNDRAQNNLPLYRVDCVGV
FT                   ANMRETTIVWSKKTGMPIVDYGIVWNDTRTLDLVKRKKKETEKEKRLRMKDKTGLSVFS
FT                   TYFSCSKLVWLLENEPEVKKAYEAGDLMFGTVDTWLIYHLTASNAFVSDVTNASRTGFM
FT                   NLDTRDYDDELVEFWGIDRNKINFPKIVSSAEYYGDLSIPKLFKSQVPGHIWELLLKYT
FT                   EGEFQVPIQGCLGDQSASLVGQMAFKPGAAKCTYGTGCFLLYNTGCKKLISKHGALTTF
FT                   SYWFPYLEEKENPEYGAPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDVGPIANSVPDS
FT                   GGVVFVPAFSGLFAPYWDPEARGTIMGMSQYTTASHIARAAVEAVCFQARAILLAMSND
FT                   AMGEAEKDSTFKTEISEEGSYQKSLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRRSP
FT                   TAECTALGAAVAANMAYERPQDRVLWRDLQDAKNWIFYEGMTKSEYQAKETKQNLKIFR
FT                   SQSTDEDRHKHWIQWEAAVKRSKGWLKDVEGEHPVVA"
FT   CDS_pept        374210..374980
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348705"
FT                   /locus_tag="CAGL0E03938g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG58777.1"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG296697"
FT                   /db_xref="HOGENOM:HBG499814"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI00003B6266"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV86"
FT                   /transl_table=1
FT                   /translation="MAPGKKVAPAPLAAKNAKSNKAKNPLTNSTPKNFGIGQSIQPKRN
FT                   LSRYVKWPEYVRLQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETASE
FT                   KKERLVKEAAAIAEGKTRQEASPKPYNVKFGLNHVVSLIENKKAKLVLIANDVDPIELV
FT                   IFLPALCKKMGIPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALSKLITTINSNF
FT                   ADKYDEVKKHWGGGIMGNKAQAKLAKRAKAAEGN"
FT   CDS_pept        376571..377464
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436612"
FT                   /locus_tag="CAGL0E03960g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG58778.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG203771"
FT                   /db_xref="HOGENOM:HBG429167"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV85"
FT                   /transl_table=1
FT                   /translation="MAEQVEEVPVENHEEVIHSSLFEIDPEDTIFIGNVAHECSPEDIE
FT                   AIFKEEFGDVQVDIPQKEHKEHTPASKHALVKFPSQIDYTALKEKYNRTVVKEREIHIK
FT                   KARTQEELRNMSRFRRGGFRGGRGGFRGGRGGFRGGRGGFRGGRGGFRGGRGGFRGGRN
FT                   QNRVPLSELERSTDTLYINNVPYDATKEELASLFGTTAENVSMPMRKSRDHETGALVAS
FT                   ETLNRGMAFVTYAEFTGDISAKASEFNGKTLKDRALIVDVAVVKQDEPEQEEKENSQEE
FT                   EQQQEKEEAKEEPAQE"
FT   CDS_pept        378442..383421
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17436613"
FT                   /locus_tag="CAGL0E03982g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58779.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG734884"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B6268"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV84"
FT                   /transl_table=1
FT                   /translation="MSRGTYKGLQKFWDFDDITQYGRVHYIEFVAPVVLTLGLSMFVVQ
FT                   NIARHYYRYDILKQKKTSVIEELLLDEQALGEELNRQGEHEEVDPLLPRERQTSQYQSL
FT                   QKYFSGDDSLKEKHFSIERIQPIKTNGRPHGNPIIVKRDFLEKSRVIIEFLLVGFEVML
FT                   QLYRFLHLSSTKKEFMKQSSSALFIEWCFLLFVVAARLVNINDDVKWVNLYPGNLWSVS
FT                   FFAYMIIFFTYILPFRSVLIGNITDKILQRYYITQTFVTGALFLNLFTARIGNHHAILY
FT                   DSGEGVYPSPEPVASIATFIGWSWLDKMVWKAHQVTLEKGDVWGLVMEDYSMFVVKRFD
FT                   RFKQKFATKRHFSTFLFIFFSKYLLLQAFWAALDGIITFIPTILLKRILEYVDDPTTAS
FT                   ANLAWFYVFGMLACRIFVAITQAQALFFGRRVCIRLKSIIISEVYSKALRRSVAANNKF
FT                   GDEEPNKADANQDNDTLANLNDGDKESSEKDQTSNIGAIINLMAVDAFKVSEICAYLHT
FT                   FIEAMVMSVVAFSLLYKLLGYAAIVGILIVIGMIPVNFKLVSLMGKYQKKALGITDKRI
FT                   QKLNEALQAIRIIKFFSWEDNFFSEIDEIREAEIQMYINKAYAWAFSAFIWFLTPTIVT
FT                   GASFTVYIYVQKQVLTAPVAFTALALFQLLKQPLDQLSNMLSYVIQSKVSLDRVQNFLD
FT                   EEDTQKYNQLKVAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSG
FT                   KTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI
FT                   LFYSPYNEDRYKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSN
FT                   CRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGRTCVLVSHNIALTLKNAELVVMLENG
FT                   RITNRGDPISLLKDGILGEDELVKSSILSRNNSTSNFANSSADLRKMADESNARKPEES
FT                   ENPDLKKGKLIMEETKSEGVVGKDVYLWYLNVFGGWKIMCFLLLIFITTQMVQISQSWW
FT                   VRAWVSRKLKVGLQFWSTNKLFTTNVPLLELKQHWLSTGTYLNSNVSPLKGKNATHTTL
FT                   YYLSIYFAIGITQALFAGTKTVINFVAGINASRRIFKKLLSKVLHSRLRFIDSTPIGRI
FT                   MNRFSKDIEAVDQELTPFLEAAFFCLVQCISTIILITFITPQFLFVAVLVCVLYYLVGY
FT                   FYINTSRELKRIESITKSPIYQHFSETLTGVATIRAFGDEIRFIMHNLEKIDENNKPFF
FT                   YLWVANRWLAFRIDMIGALIIFGSGVFILLNLNRIDSGMAGISLTYAISFTEGALWLVR
FT                   FYSTVEMNMNSVERLKEYMDVPQEPYNEGTITTSTNWPTEGKIEVKDLSLRYAENLPRV
FT                   IKEVSFDIEPHNMVGIVGRTGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRR
FT                   SITIIPQDPTLFTGTIRSNLDPFGKYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSD
FT                   NVNKFLNLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQ
FT                   TIRNVFDKSTVLTIAHRLRSVIDYDKILVMDAGEVIEYDQPYTLLLDKNSHFYSMCEQS
FT                   GELETLIDLAKKAFVKKMNAE"
FT   CDS_pept        complement(383622..385205)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044320"
FT                   /locus_tag="CAGL0E04004g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="cell surface"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58780.1"
FT                   /db_xref="GO:0009986"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177066"
FT                   /db_xref="HOGENOM:HBG396662"
FT                   /db_xref="InterPro:IPR001899"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6269"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV83"
FT                   /transl_table=1
FT                   /translation="MSKDHEVVPLLYDNDLEVGSYESLPREEKYLDEHEVPQGRHLGIF
FT                   STTVLFISRMVGSGIFSTPSNIFVSCGGNSFIFFTVWLLTALFAYAGLYIFLEFGYHLP
FT                   RSGGRKVFLEHSFTHPKLLMSVTVACYSIFSGVALSGSVVFGKYFLAAIGYGSETYNAG
FT                   NTSKYISIGFVVLATAIHGISVRSGIYIQNALGVVKLMLILMMCLTGFYAIMIYDAPTV
FT                   TQWDSPFFSFQDKSAFSLNSLASAFISAFFCFAGWDSVHSVTSEVKNPARTLKISGLCS
FT                   LAICALCYTLMNVAYTKVLSYEEIANAGPLVGSVLFKKLFGAQVGGALMTGSVAVSAAS
FT                   NVIVVIYGISRVNQEIFREGYLPFSKVLARNWPWDAPLFSLLTCALLTCTWIIILPSEG
FT                   SSFNYLISVEGYGNQVFLLLVAVGLLLFRRQKTYQEHDNSIKASTLGVYSMILLCTYLV
FT                   VGPFFGDQSANKIAFLPPYEVASVAILLSCVLFWFVKFIMLPFLFNYRLVSKTTTLSDG
FT                   LRITEWKAYY"
FT   CDS_pept        386039..387946
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436614"
FT                   /locus_tag="CAGL0E04026g"
FT                   /product="Similar to uniprot|P03874 Saccharomyces
FT                   cerevisiae YHL038c CBP2"
FT                   /protein_id="CAG58781.1"
FT                   /db_xref="HOGENOM:HBG124493"
FT                   /db_xref="InterPro:IPR016424"
FT                   /db_xref="UniParc:UPI00003B626A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV82"
FT                   /transl_table=1
FT                   /translation="MASKDLKKLLDAYWVEFRRRPSNVRFKYKPTIHYLKNAILDEKRS
FT                   VNRVRSNQLKSEWFRIKDPNLQRSSLTDLRKLLLFDLVADENTKFQLVSDSAILRRKLV
FT                   PLRDNWKRIASLMLHPLDGNLFNDNDDPIHALNDTYSTKLGFRYYQAIRAHSKDNAHKI
FT                   DELLWPKFEFSEFCRGVAIGDNILQHLNEDDLKRIRFINPITGNEMPLTRSPELIPEGY
FT                   NAIGLFPYFIEEHRQAFPKDPLWKTYSLYQSSILDTDSIRGQYNHLISNTNIPEWHKNE
FT                   KVQVEVRMDNIDDVNTFDKVKALSNRYYKLWVDDAKNDPTCPADIIRSVLFSGAFREQL
FT                   ISEEFLKHYIAFSAYSKILRTTKKWKRDIEDRKIIDLLSINWKPWDIFIAGRYQELCEK
FT                   YNRTNFRIYEDVLKYKTELEAFIYDLNIHTHTMASEMKMDTDQFFAVKEGCKYSRAAEI
FT                   LALYQHLLRNPEIINVFHPVMTNYMVKQISTNNIQVTGQFPVNEKGLSLGKSILEMIQL
FT                   TLKCDNMMYENRFSTDKSNRSKIKSDTRDFKLVITCNNSMTHEMQGLIRYCTPMSIAFT
FT                   SVLEEHHVPSFSECIYKKYIAEFDATVCLYQRVKPKTKPASTEKLIKSTLSKLEANFTD
FT                   "
FT   CDS_pept        join(388302..388315,388792..389209)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436615"
FT                   /gene_name="COF1"
FT                   /locus_tag="CAGL0E04048g"
FT                   /product="Cofilin"
FT                   /function="actin binding"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="cytoskeleton"
FT                   /cellular_component="nuclear matrix"
FT                   /protein_id="CAG58782.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0016363"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG197657"
FT                   /db_xref="HOGENOM:HBG628477"
FT                   /db_xref="HSSP:1COF"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI00003B626B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV81"
FT                   /transl_table=1
FT                   /translation="MSRSGVAVADESIQAFNDLKLGMKYKFVLFSLNDAKTEIVVKETS
FT                   SDPSYDAFLEKLPENDCLYAVYDFEYQISESEGKRSKIVFFTWSPDTASVRPKMVYASS
FT                   KDALKRALNGVAIEIQGTDFSEVSYEAVLEKVSRGAGSH"
FT   CDS_pept        complement(389432..391189)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044321"
FT                   /locus_tag="CAGL0E04070g"
FT                   /product="Similar to uniprot|P38732 Saccharomyces
FT                   cerevisiae YHL039w"
FT                   /protein_id="CAG58783.1"
FT                   /db_xref="HOGENOM:HBG058805"
FT                   /db_xref="HOGENOM:HBG203750"
FT                   /db_xref="InterPro:IPR017119"
FT                   /db_xref="UniParc:UPI00003B626C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV80"
FT                   /transl_table=1
FT                   /translation="MSDKLDGLLAWARENGAQLREDCLEYNYDEKKGYHVLIKDIDALW
FT                   EFKDAGVITVPRKLFITRQLAQQYFKINDQKLSTKYNNNPNGLTEFFLSYITFTKENEY
FT                   EFFRPYINILPKLNSMRIHPFFWTKEELQLIKGSDLFLTIKFKLLALYDEYRNYMKLYE
FT                   FGNGDLSIINGDIQLSDDELFAIIEHLQHILKKSSDAIEWTSFVAYVWSNLIFFSRAFP
FT                   SLITGEDKKELNLAFLLPIVDLLNHNNTTKVSWNYSDDTFNYTNKDLAYLKNGDELFNN
FT                   YGEKSNVDYLISYGFLNSQENIHNSVNLTLRLDPTFISQAKEHVENLEIVSNDTVLFKI
FT                   SKNDPLPVSLVHFFGYVTKLKSEEHITLRSILEGSDQLINILKQKLEYSKEKAKISSNS
FT                   VHSSVGKIIKQYFNEEKKLFQFSLDSLLKKQKDIISAAKDNIVSFKSIFKSDKVFANSL
FT                   LLSYGVTKYEDILAKDMANEALLLWVVRASNKDAYKDGLRTVNIPPFVLETFEEISRTI
FT                   SIAKDDVTEFLSIYKRLFPSLGDKIPEVYKVGEWGIKQFIIADALIDRLVWVRDSNSEP
FT                   LFIQKLTFQ"
FT   CDS_pept        394380..396317
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195482"
FT                   /locus_tag="CAGL0E04092g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG58784.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325340"
FT                   /db_xref="HOGENOM:HBG540955"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B626D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV79"
FT                   /transl_table=1
FT                   /translation="MKDSDMTNMEEIQRNNSYPSNSDKDYEDEKGSGSPVINEFSKVDQ
FT                   ISTAQSEMDEKMAEQTEQQRTMTGVKNIIIRKTEIMAEVYDKWYYHAILLFTAFVCGYG
FT                   YGLDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSDVYGRFALFCVS
FT                   IVLYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPT
FT                   WPFIINTWISGNVTSRANPLKNWSWDIGMWAFIFPLSCVPLLCVMIHMWWLARKTEEWQ
FT                   ELSKEKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLGCILVPLTLAGGTKSKWNNSHV
FT                   IGPFVLGFVLIPILVLWEYKFARDPIIPYKLVKDRGVWASFAISFLIDFIYYMAADYLY
FT                   TVLIVGVNESVKSATRISSLSTFVSTVGSPIFSLLITRFSRLKPFIICGCGLWMLAMGL
FT                   LYHYRGGAESHSGIIGALCVWGVGTTLFTYPVNVSVQAATSHEHMATVTALNYTFYRIG
FT                   SAVGAAVSGAIWTQTLYKQLLKRVGDAALATEAYASPYKFIVTYTWDTPERQAVVQAYR
FT                   YVQRLETIVALVFCAPLLIFSLCLRDARLTDKVAHDNIAEGEYVDAKDDDPIYEWFKGA
FT                   TTRFRRKSKE"
FT   CDS_pept        complement(396810..398309)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044322"
FT                   /locus_tag="CAGL0E04114g"
FT                   /product="Similar to uniprot|P32317 Saccharomyces
FT                   cerevisiae YEL052w AFG1"
FT                   /function="ATP binding"
FT                   /protein_id="CAG58785.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG320636"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI00003B626E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV78"
FT                   /transl_table=1
FT                   /translation="MLVANVRALRCLRPQYNRITTLLYRFNHTEAVSIPLKEYKRLVKI
FT                   GTLRDDEYQKGIISSLGHLYDSLVNYKPPEVKTPSALDQLSLMNSLKSKLGFFGKGSSQ
FT                   DVSKIPKGIYLYGDVGCGKTMLMDLFYSVLPPHLTKRRIHFHQFMQYVHKRSHEIIKEQ
FT                   NLDALGKAKGRDLDSIPFLAAEIAQTSHVLCFDEFQVADVADAMILRRLLTALLSPEYG
FT                   VVLFATSNRPPDDLYINGVQRKSFIPCIELIKERTEVIFLDSPIDYRKIPRPISNVYCY
FT                   PKHDEEYFSHEFEVIRKTHIQEWYSYFAQDSDSKNPDGTNLHGQQTFNDYKLSIWGREL
FT                   NVPKCTPPKVAQFTFKELCGQPLAAGDYLTLASNFRSFIITDIPYLTIFVRDEIRRFIT
FT                   FLDAVYDNGGKIATTGAADFTSLFVEPDQLINDYKLKEQKKQDGFEEQAIENDELVEKH
FT                   GFSKEIAQKSKIFALDEERFAFARALSRLSHMSSSDWVSKP"
FT   CDS_pept        398753..401083
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113467" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436616"
FT                   /locus_tag="CAGL0E04136g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58786.1"
FT                   /db_xref="HOGENOM:HBG058045"
FT                   /db_xref="HOGENOM:HBG203706"
FT                   /db_xref="InterPro:IPR007244"
FT                   /db_xref="UniParc:UPI00003B626F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV77"
FT                   /transl_table=1
FT                   /translation="MRELGASMESLSLETPTVRDGLVDVTALFMEMGKKLKPETIVKDS
FT                   KFNLFDGTHSLEVNNEKLDSTMIQLTPEELQFDVGVAYGEELDASTDDPSKLDIVIAIS
FT                   DRLLRSIISWLNDYQSLPTTVLSCIYVEHVLKYYMMDENADQNDITCLETGDPFYDQVL
FT                   NSIIIGVCNFMGFMYKVLTAGVIFEEEDLNFNHMGLNNFSMLPGINESLRALEVSRTYL
FT                   DNLLDTMPSHDSKINRLRLLLNVTETLVKFEYLVDCSSEKGEQLLNVLETSAKSLIEQG
FT                   PFSIPPPLGAFSMGIQRKLTNQFPPKKLIEPKFNFAGYIIISEHVKLVNKLKTLNTAKD
FT                   IFTFALYFNKLSQKHVLARALFSLILIKPDQSILNKHSIIDFLQMHLKEISGRDWIIGE
FT                   AIDYELQGILQEAGNVLLEFYQNAAQNTCRYRQGYNRQILLWDSLQAQLESKSSDISVS
FT                   QADIDTVTGDKEEGSVFIYVCASWVYIMKLTAMTEFILKGFELDIYKPYESFSMYWYCY
FT                   CLQLHLKDCLEKLINLVSDKMNSIYAINKKMKKLKAGEKKENVRKQYRHAMDSIMPDLK
FT                   ESTCTLSLLLKKCEIHRALCLGEVLQFAILRSYQLIDGEIGNKLIVSNRKLLHDLRFKT
FT                   FSSIGVPELPSYDVFKKTLSDFTVQEPLFDLKMEKTLKCITNELTVAEKNLAEIIALLE
FT                   ENSNSSEDFAGYDAVKNETHDYYDTISKSIMEIKNNVTALVKNHNNYVHDKGNYEMMLT
FT                   KPDKASPYYVVMDMVEKRSHHKT"
FT   CDS_pept        401745..402728
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348706"
FT                   /locus_tag="CAGL0E04158g"
FT                   /product="Similar to uniprot|Q99288 Saccharomyces
FT                   cerevisiae YDR051c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG58787.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG124494"
FT                   /db_xref="HOGENOM:HBG649033"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B6270"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV76"
FT                   /transl_table=1
FT                   /translation="MHNCTCTCHAECSKPLKKPRLIILVRHGESESNRDKGVNEKIPNH
FT                   LIPLTSRGWSEARNAGVELLKLLNMDGNCKSVIESLSQKYRVEDDRRNMLKTSECNNMK
FT                   KKIDRSIVFYTSPYRRTKETLKGILEIIDDFNEISAEIKLTEDEKYEPCSKKKHAIWPN
FT                   NMMIPVGEYENNTHTALKHKDTCCYLRYKVKDDPRIREQDFGNYQNVSSMNDVMEERKN
FT                   YGHFFYRFPQGESAADVYDRVASFQESLFRKFERRTEANHRDVVVLVTHGIFARIFLMK
FT                   WFRWTYEEYESFINVPNGCLIVMELDEATDRYVLKTELPKWTTNTA"
FT   CDS_pept        complement(402825..403553)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182099" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195483"
FT                   /gene_name="ALG14"
FT                   /locus_tag="CAGL0E04180g"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG14"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58788.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG193935"
FT                   /db_xref="HOGENOM:HBG735599"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniParc:UPI00003B6271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV75"
FT                   /transl_table=1
FT                   /translation="MPFLSTAHLCALLLILGCFYIGRLIKVIPILRFACAGEAEIKPLF
FT                   IQPKSNDGIHLFVFLGSGGHTGEMLRLLQNHQEVLLNKRNTFYIGYSDDDSKARFLSMV
FT                   EKYDFKAERIHFYPFAKAREVNAGPIASIVTISKTLLTGFTNVLSIKMNTLGQPHLTLL
FT                   NGPGTCCIINFWLKLLEWLIYIPYLSNGSNVVYIESLARIESLSLTGKILYLLADVFVV
FT                   QWEELKVRKAPRSEYYGILV"
FT   CDS_pept        404636..405310
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436617"
FT                   /locus_tag="CAGL0E04224g"
FT                   /product="Similar to uniprot|P38243 Saccharomyces
FT                   cerevisiae YBR071w"
FT                   /protein_id="CAG58790.1"
FT                   /db_xref="HOGENOM:HBG124496"
FT                   /db_xref="UniParc:UPI00003B6273"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV73"
FT                   /transl_table=1
FT                   /translation="MLRQKKNNNGTSKRNSMFLDSFFLGDHSKTNTDVHSSRSKHTSSI
FT                   QTKNISQPTLKSSSRIKPLMSTPLRNGDSKDMGRGRLQRSSMVLDNNMVRDYNLALKHL
FT                   DTIATDESEQTGNSDTNSNSSLSVSEKSGTSSIFSTKDTSQYREAELDLQALMFEDCIT
FT                   DEENLCDEVIIMGKNKSLIKIYDNINRKKIEDQLILDTTEFGNIITQKTFDTSYKRSNL
FT                   EF"
FT   CDS_pept        complement(405705..406232)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000272647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195484"
FT                   /gene_name="CGI121"
FT                   /locus_tag="CAGL0E04246g"
FT                   /product="Protein CGI121"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58791.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191460"
FT                   /db_xref="HOGENOM:HBG283673"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniParc:UPI00003B6274"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV72"
FT                   /transl_table=1
FT                   /translation="MNFKIPQFPDFEISITAFENVTNSESIRSKVATLPYAFLDARMIY
FT                   SQEQLYAALYRVLVEQNYNKLRTKTIHSEIMLCLSPTSNIGDAFKKFGIKEDSSTVICL
FT                   HIKDRSDEPELPSLSSIVEGQEISLSKEFINQHRDIGMVGHVYKINGEMIENSTEDQVS
FT                   SMIVNMIQLRGL"
FT   CDS_pept        406619..407983
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500858"
FT                   /locus_tag="CAGL0E04268g"
FT                   /product="Similar to uniprot|Q03703 Saccharomyces
FT                   cerevisiae YML037c"
FT                   /protein_id="CAG58792.1"
FT                   /db_xref="HOGENOM:HBG124497"
FT                   /db_xref="UniParc:UPI00003B6275"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV71"
FT                   /transl_table=1
FT                   /translation="MDNEARGEQQLEDLIRQLPSVPKASHSEVDLRDDLTLYNLLDQAE
FT                   HGRKLMNYIVSTTSSESETVFKLEKLRHREHQLARTWFDEEKRGTVKISSAMLQIETPI
FT                   VFSWSNQGDSETSSPVIEKPESPSQFRNISKTKELTTNQKLLNSASLAAKEKKVPTFEN
FT                   SIIEDNYFHDNTIDNLATQSSNSERNTSKEWKRSSFKVDPLQEFVATELPKLKKKSDEE
FT                   VKGKKAKKKGLLWFWGSSKHKDKGKHSSKHTRTKDANLETHDNIESIDNENEAHNNVSE
FT                   EDVWDFDMSQDFGEGDESNEVIGLGIQGDIKSIKSAGTSVKNNINDIDLLGYGNSNEAD
FT                   EVSMPSQTKLSTLEKPPGMEVLHIKDNPGMKSELNNIAGDVGKVQDHVIKASDDDGDDD
FT                   DDDDDFGDFQQVVDESASIATSGNLASTQFPIISSSNHTVTPALTSFVPLQPKKK"
FT   CDS_pept        408757..410127
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111198" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436618"
FT                   /locus_tag="CAGL0E04290g"
FT                   /product="Similar to uniprot|Q03697 Saccharomyces
FT                   cerevisiae YML038c YMD8"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58793.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059581"
FT                   /db_xref="HOGENOM:HBG397713"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI00003B6276"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV70"
FT                   /transl_table=1
FT                   /translation="MYKTILLLITGWYVCSIGLMLYNKWIFDPQRGLGIAYPIGLTGCH
FT                   QLILWCISSVYLRYTKARKERRARELDSEENAIIANNNEPIVDVETLEREKRQLFWRFI
FT                   LPTAIFSAGDIGLGNMSLRYVPLTIHIIIKSSSITFVLLFSCLFKIERFHWRLFVIVFV
FT                   MFAGVVMMVYKPINDDSNTNKDGSETSSASFYFGCVLVLLSSCLSGLRWVYTQLILRNQ
FT                   TNTREVEKLDDNVSDYIENKSTDSSSERCEVNVPGQSVIQESITKKPATPENKNNPIRT
FT                   INKLSPVMALFLFLTSLAVEQPYRHLFSTNFSVKHVFLAIFGLMVLPGLGVFTFTLCEF
FT                   SILGKTKVLTLSIAGVVKEVLTIIFSMLILHERLHGILNWVGMVIILLDVTYYNYFRYK
FT                   QKMQEDYVRLEAPAAGFEDKYMGNRRPLETDSMTEIPPYSITSDNTFQEYEMNKIIK"
FT   CDS_pept        412800..414866
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436619"
FT                   /locus_tag="CAGL0E04312g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58794.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124498"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6277"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV69"
FT                   /transl_table=1
FT                   /translation="MPSFSLLRPRETSLWKAVKNLIDAIIVPDSGKDALPVEPAGVSAA
FT                   PAKAAMSAMSAKPTRKYRRNKKVADDSRSTKSRDSLDNASTMFPKISYNGDISLGTAKP
FT                   CALDMNSMNGSGFNFTFNSNDVIETNFDMMQLQLPDFPQQPQQDFAIHNDLNINLPVQP
FT                   EVQVKQEPKPVDSITSIKKDTKAKSETLDDDEKEFVCHYCDAKFRIRGYLTRHIKKHAI
FT                   EKAYHCPFYNGQEVPSKRCHNSGGFSRRDTYKTHMKARHLIYPEGVNFASRNESSGHCA
FT                   KCGGFIAKAATYVEDHIESGQCPALPAGYYSESLRRTSKSASKSATPASISSQSVSPTT
FT                   IPASLPTNYQKKRRNKMKKITTSNGTTRYVSTLQSWVEPKVLENKDALEAMAIVASETG
FT                   RNDVFTTLDDNKILMDSQYYVAKSGSRQNSTRKNSDKTIKQNSRQRNSTGKPDNGNGLV
FT                   TPEYGYEQIKQGSRSNSNSKGVNLHIAPPNMGVKLEHADNMLASPATSISTGVMNSISP
FT                   ISNSAMDSSSTHSSYASSLNDNCGINTTQKMQHTQTSNILPNNDMANAGPDFSNLVDLD
FT                   KIGFDAMLALCPVNNDQENYKEDKNFMLSNMQASGNRINFPADIETNLNKSAADIQLGN
FT                   TSMRPQNFDTQHFPREHMVVADVDPTNAGLMSDLHVKENQKYMQYYQQFFSMN"
FT   CDS_pept        complement(415588..417189)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000042780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195485"
FT                   /gene_name="ERG11"
FT                   /gene_synonym="CYP51"
FT                   /locus_tag="CAGL0E04334g"
FT                   /product="Lanosterol 14-alpha demethylase "
FT                   /EC_number="1.14.13.70"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="sterol 14-demethylase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sterol biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58795.1"
FT                   /db_xref="EMBL:AAB02329.1"
FT                   /db_xref="EMBL:AAB32679.1"
FT                   /db_xref="GO:0008398"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG495396"
FT                   /db_xref="HOGENOM:HBG566517"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI00001281E6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50859"
FT                   /transl_table=1
FT                   /translation="MSTENTSLVVELLEYVKLGLSYFQALPLAQRVSIMVALPFVYTIT
FT                   WQLLYSLRKDRPPLVFYWIPWVGSAIPYGTKPYEFFEDCQKKYGDIFSFMLLGRIMTVY
FT                   LGPKGHEFIFNAKLADVSAEAAYSHLTTPVFGKGVIYDCPNHRLMEQKKFVKGALTKEA
FT                   FVRYVPLIAEEIYKYFRNSKNFKINENNSGIVDVMVSQPEMTIFTASRSLLGKEMRDKL
FT                   DTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQQAISGTYMSLIKERREKNDIQN
FT                   RDLIDELMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTSAATSAWCLLHLAERPDVQEE
FT                   LYQEQMRVLNNDTKELTYDDLQNMPLLNQMIKETLRLHHPLHSLFRKVMRDVAIPNTSY
FT                   VVPRDYHVLVSPGYTHLQEEFFPKPNEFNIHRWDGDAASSSAAGGDEVDYGFGAISKGV
FT                   SSPYLPFGGGRHRCIGELFAYCQLGVLMSIFIRTMKWRYPTEGETVPPSDFTSMVTLPT
FT                   APAKIYWEKRHPEQKY"
FT   CDS_pept        complement(418090..418800)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044323"
FT                   /locus_tag="CAGL0E04356g"
FT                   /product="Similar to uniprot|P00447 Saccharomyces
FT                   cerevisiae YHR008c SOD2"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAG58796.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG164256"
FT                   /db_xref="HOGENOM:HBG507761"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniParc:UPI00003B6278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV67"
FT                   /transl_table=1
FT                   /translation="MLSTSRIAFKSTQLRAASTVLRRTKVTLPELEWDFGALEPHISGQ
FT                   INELHYSKHHQTYVNGLNTAVDQFQELTHKLSKDPNDLQAARDLIQVQQNIKFHGGGYT
FT                   NHCLFWKNLAPEKNGGGEAPSSSSALGQQIEKQYGSLDKLIEVTNAKLAGVQGSGWAFI
FT                   VKNLENGGQLDVVQTYNQDTVGNQFVPLVAIDAWEHAYYLQYQNKKVDYFKAIWNVINW
FT                   KEAAKRYETSKVTK"
FT   CDS_pept        complement(420184..421932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044324"
FT                   /locus_tag="CAGL0E04378g"
FT                   /product="Similar to uniprot|P38758 Saccharomyces
FT                   cerevisiae YHR009c"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG58797.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG097646"
FT                   /db_xref="HOGENOM:HBG603845"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI00003B6279"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV66"
FT                   /transl_table=1
FT                   /translation="MSERDIATPDFQLYPSGNAAEKTHIVIVGAGIIGSCTAYYLTQHP
FT                   DFDPSTHHITVLESREVAGGASGKAGGLLASWAFPQQIVPLSFQLHQELSDMYDGATNW
FT                   DYRRLTTVSLEADLKLADQHIPLYEDHNGVISEAPKTSYSLNVPPPKKTALKKKKNDKM
FT                   KNNFSLSGSSDEEESSDSDIEMKPNHRDLNGKKDASLSKSEDDEEDEDDGNASIISGPT
FT                   GNTSLKDEVATTSQENPSDRNSSTNIGSLKDGTTSSIYFNNQNLKTQLPRDLTWLRNDI
FT                   VTDWSSLGGTDSTAQVHPHKFTHFLLQKAMETGAVDLIRGQVINISVDDTGAATGLTYI
FT                   PMQWSRSDKLNDGPDEGTEKSKQKRNSKVPIKITDIHHLVLSMGPWTSKLLKNCPISGL
FT                   RAHSITIRPSADGDSRGKRKNNGNKPNIENYVSPYAIFTELKTGDNEYFSPELYARRDE
FT                   VYVCGEGDTLAGLPEASDEVEVIEEKCDQLYHYVSKLSPVLSEGEILTKQACYLPVLNV
FT                   PTSSGPLIGETNIKNLFIASGHSCWGINNAPATGKILSEILLEGEAKSAEISALDPKLY
FT                   FDATMH"
FT   CDS_pept        422802..424157
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044325"
FT                   /locus_tag="CAGL0E04400g"
FT                   /product="Similar to uniprot|P38705 Saccharomyces
FT                   cerevisiae YHR011w DIA4"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58798.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG053760"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI00003B627A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV65"
FT                   /transl_table=1
FT                   /translation="MWAAVRHYSSKTLFLKPAKFDVKRIIRDIGLYKDSIARRELVGQE
FT                   QLVGALDGQLAATYERTKDIHAKISAVQTERKALEFSIRQHKVHGDEVLKELRSLKSQF
FT                   SALAEQLQEANSKIQDICLRLPNLIHESAPDTAPVIDRWINKGLYESFEQQENRDHVYI
FT                   MTKCKQLLDLASASNISGNSWYYLINEGAQLETALVNYALDQAEKHGFQRCIPPSIARK
FT                   EIIDACGFTPRDMNNEKQIYEIEDGNNKLGLTATAEITLAGMNANKILDLDENNPTKRL
FT                   VGVSRSYRAEAGARGKDTKGLYRVHEFTKVELFCWSLPQHSEKVLEDLKEFQVKLISDL
FT                   GLCAQVLNMPANDLGNPAYKKYDIEVWMPGRGKFGEVSSTSNCTDFQSRRLFTRYQNKE
FT                   SSKLEYVHTLNGTAMAVPRMILAIIENFYDPSTNMVTVPSPLIPYMNGKTKF"
FT   CDS_pept        424507..425274
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000293431" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500859"
FT                   /locus_tag="CAGL0E04422g"
FT                   /product="Similar to uniprot|P38759 Saccharomyces
FT                   cerevisiae YHR012w PEP11"
FT                   /protein_id="CAG58799.1"
FT                   /db_xref="HOGENOM:HBG317909"
FT                   /db_xref="HOGENOM:HBG461966"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="UniParc:UPI00003B627B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV64"
FT                   /transl_table=1
FT                   /translation="MLVLALSDAHIPDRAVDLPSKFKKLLSIPDKISQVAVLGNSSNSS
FT                   EFLKFVTDITPNVHIVRGEFDRATIPAIHTDKVPVVKTPGQERTIKSNRVELPMNAVIT
FT                   QGEFRIGCCSGYTVVPKNDPVSLLTLARQLDVDILLWGGTYNVEAYTLEGKFFINPGSC
FT                   TGAFNTDWPVFSDILGNTDVKKEETKTDDSSSKSKDAKNGPDHLYVSDLDINGANVPSF
FT                   CLLDIQGSTCTLYIYLYVDGEVKVDKVIFEKQR"
FT   ncRNA           425563..425689
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR13"
FT                   /db_xref="Rfam:RF01223"
FT   CDS_pept        complement(425981..426679)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436620"
FT                   /locus_tag="CAGL0E04444g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAG58800.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B627C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV63"
FT                   /transl_table=1
FT                   /translation="MAITIRRATVNDMICMQNANLHNLPENYLMKYYMYHILSWPEASF
FT                   VATTTCIEDELDEHEDDNLSIPDPEKPGIMIKLDPTYVAPGEKLVGYVLSKMNDDPDAS
FT                   NEAPNGHVTSLSVMRTYRRMGIAEKLMRQALFALREVYKAEYVSLHVRQSNRAALHLYR
FT                   DTLAFEVLSIEKSYYQDGEDAYAMKKVLDLDELKISNYTHRKGQEKLEDDLKSDLLEDI
FT                   ITEGVDKIMV"
FT   CDS_pept        427512..428360
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436621"
FT                   /locus_tag="CAGL0E04466g"
FT                   /product="Similar to uniprot|P23624 Saccharomyces
FT                   cerevisiae YHR014w SPO13"
FT                   /protein_id="CAG58801.1"
FT                   /db_xref="HOGENOM:HBG124499"
FT                   /db_xref="UniParc:UPI00003B627D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV62"
FT                   /transl_table=1
FT                   /translation="MARSKDSKVLQPRTTNVRKPAGTYKNKKRHNKSELEKNAKSVKRR
FT                   RIEPSVSDFNNEYISMRLEPQGIRPSIARNNGASVEREISFGDLINAPPVSTSTPTHVP
FT                   SLSSLKYPEITYNNVRHKKLFATMSYERQNSTYNTQPGDNHNYMLISNNSFSYRADQIA
FT                   SPTTYNNNKPENGQAADIFIPNEKMKSIDISKLSIYSKVDDSVVNQNHRILNEYDVPFP
FT                   QLIATSARMADTYPTFNEYPTEDMPDVHGDINSMKNAQFPSDTNDSYDSSGGQATYFNS
FT                   K"
FT   CDS_pept        429244..430908
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195486"
FT                   /locus_tag="CAGL0E04488g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58802.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058034"
FT                   /db_xref="HOGENOM:HBG202804"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B627E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV61"
FT                   /transl_table=1
FT                   /translation="MSANYYQVATPKSPHDLLNSEDDQNNHEIRGGEGVLSSTLDNNNS
FT                   SPSRLNSGLLRSAGDSEDAERLKYEVAKSELLDKLNLQIAMNHKQIENIKKELKKTDGR
FT                   MTLLNSLHDDEKLKDKIEEYTKAKCEQAKRELEMEKARQSMGYNMDTSSLSYVPGSRPS
FT                   ISAGSSTSGHHYHTRSKSNSHLLEFSNLRPLDSNLPNQTSRLPSKGLQDNTSGKDIIPG
FT                   GNANFSFTTTFNPTQLYAHHKRNYSSTCLTSNSGVVGKNENNEAIFRRYDGILIIIKCS
FT                   FCDRSGFTSAQGIVNHCRLKHSKTYNSQPLAVLNNQTLLPEEKQDADVLNEFKKQKVDP
FT                   AKEYLPSIKNSILNPEKRTPSPKQNNQQKHVTIDSIDPKHTKHLEKLYSGRNNDFKDLI
FT                   DMVKEAPKDLQVVLDVSSDPDDEDEEDTESNGLDLDIPSAERSEDEKSYTPSNASDQGS
FT                   SPNSIVTPNEANFPKSPVDEQPRRNLRKRKDMGEDEESEKLFTRRVLRERLRPAEKKAR
FT                   VDVIALTELPPEEKRSSHYNLRAKSKLRSSSGSLDLE"
FT   CDS_pept        431224..433335
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436622"
FT                   /locus_tag="CAGL0E04510g"
FT                   /product="Similar to uniprot|Q12204 Saccharomyces
FT                   cerevisiae YOR022c"
FT                   /function="metal ion binding"
FT                   /protein_id="CAG58803.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058033"
FT                   /db_xref="HOGENOM:HBG396169"
FT                   /db_xref="InterPro:IPR004177"
FT                   /db_xref="UniParc:UPI00003B627F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV60"
FT                   /transl_table=1
FT                   /translation="MLHAHQIRRTFLRYRYNCRCAIRFNSSCHWFFATDVPKSDPYQDS
FT                   NEEETREPTKFIAFSKNDSDRIEKLYQQTPKKDERRIIPVKEDYLFNVDVDQLELRPSY
FT                   WKGPTYDIRRGLWFNSLNQPLNPDLAAEIEEKFKSINFEELETTNDENKKSKEFQDIFK
FT                   LSAPYKEGKFVLFVDKNVAFLLQDVDGGEFQIKFLRSNIGQSIPINGMKITRGYDSKHG
FT                   TSISERVKNLVKEKETSTSKPESNKNDSTLGKLGSLLSFESSSGILSRLAGAISDTSDA
FT                   TTDNDNKKQYMKNEMEHDYYDEESTSSESKDKNTINDREINHLVLCVHGIGQTLGKTYE
FT                   YVNFVHTINLLRSNMKKLYSAADDLKNLNKLNRYKDWQSNSNVQVLPITWRHSITFQTD
FT                   RNGPNLESPLLPTLDEITVDGIVPFRKLMADGIFDILLYCDPYYKKMIKAEVTKQLNTV
FT                   YKRFVKFNPNFNGKVHLVGHSLGSMILFDLLSNKKDYKLEFEVGNFFGIGSPIGILKLI
FT                   QRTMVGQKQILDADHNVNFQLPECQNYYNIFHVCDPVAYRVESLVDRRMAEYEHTYVPH
FT                   WSESDGIASKMLEMGGNILKEIPLNSMITEKNEEENTSKSSTGTQYKLPEELKSKLLKL
FT                   NYSGRIDYALRSGILDIDILSALSSHVSYFEEPDIAGFLLKEILAGHKPVEQVTVTKSK
FT                   LFKPKSNTV"
FT   CDS_pept        433710..434348
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195487"
FT                   /locus_tag="CAGL0E04532g"
FT                   /product="Similar to uniprot|Q12314 Saccharomyces
FT                   cerevisiae YOR021c"
FT                   /protein_id="CAG58804.1"
FT                   /db_xref="HOGENOM:HBG286668"
FT                   /db_xref="HOGENOM:HBG507886"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniParc:UPI00003B6280"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV59"
FT                   /transl_table=1
FT                   /translation="MKYIIEHMEEGFSEWVTLEYAQILRDVGNDNLLLTSLPEGTNDSD
FT                   IPELLRKMGLKWTTKSLSDIPEAVPSWEPLQNGRVCLLDPRAELDLQPEDSKQFDYFVF
FT                   GGILGDHPPRDRTKELNIAYPGLLVGRRLGDKQMTTDTAIRTTQLIIKDQKKFEDIKFI
FT                   DYPEFRFSKKEATEMPFRYVLDSQGNPILPEGMLQLIKKDSQQSLDDLL"
FT   CDS_pept        complement(434608..434820)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195488"
FT                   /locus_tag="CAGL0E04548g"
FT                   /product="Similar to uniprot|P81451 Saccharomyces
FT                   cerevisiae YOL077wa ATP19"
FT                   /protein_id="CAR58019.1"
FT                   /db_xref="HOGENOM:HBG756506"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniParc:UPI00017BD6B2"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ5"
FT                   /transl_table=1
FT                   /translation="MAQAYRILGKNVPPHYLSIATLATVGGVIGYFKMTGKKEEKASTP
FT                   IAPAKDDIDIEALLQSFVAQEGEKK"
FT   CDS_pept        439395..440117
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436623"
FT                   /locus_tag="CAGL0E04554g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58805.1"
FT                   /db_xref="HOGENOM:HBG124500"
FT                   /db_xref="UniParc:UPI00003B6281"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV58"
FT                   /transl_table=1
FT                   /translation="MKNFIKKKHKKMSLAIQTPESLISDDFGYTQPKRFNYLDTFSNLS
FT                   RNTSLTSLKSSSRVSSDYSYRPRDETLKKPDCDGILDNKNSSQIRTVPTLCSSDKLSRC
FT                   DKSTMKYHKKSESDEFEQFTSPDLHFEAIDSISVNNISDNVYESHTDLNSYQQDEEYEN
FT                   SDDESNTGLSSYFAPIYYGLNSNTFFQPSFDTLFDAEKKARSYTFGFDDFRIKKPSKKT
FT                   VNNFVRLMQQKRHNTKSP"
FT   CDS_pept        complement(440794..442842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500860"
FT                   /locus_tag="CAGL0E04576g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58806.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059777"
FT                   /db_xref="HOGENOM:HBG203136"
FT                   /db_xref="InterPro:IPR006572"
FT                   /db_xref="InterPro:IPR013939"
FT                   /db_xref="UniParc:UPI00003B6282"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV57"
FT                   /transl_table=1
FT                   /translation="MASNENLISHAGGVYAARSPLKETDANSKPAGTLTINNEDRDLKK
FT                   RLIETTNEKLQLRKRAKLERGRSIEGAVQVTKGVALRNVESQGRSISGQGTVSGTASNQ
FT                   SGNNNNKVALGELLEWQMNWRNIMRRDSRIYFDTTDEPDITKHAKSKLEKRKLLLKCGF
FT                   MSLGAQITQFFDTSVTIVISSRSIDNITQLNETDILARAKKSYMKVWGYDKAARFLKNL
FT                   DVDLENLEKNKLPTIASPSLSNLLQNEKLFGPSDRDPRTRRDDIHYFKYPHIYMYDLWQ
FT                   TWAPIITLEWKPQELANPNNLPYPTLKMGTFGRCPFIGDRSCDESSYKRVLKRYSRDKS
FT                   NKKYALKLRGLYQHHADPTVSMTKNLIFIPHLCLDSAQCYEKWQEQHMKEQYRIKHKDG
FT                   ELPIQKDSKDGTNEDKESEIRQNEKEISIGKIDNDNGESKIEEIAENSKLVQRDSVWKG
FT                   IVPTVKLEQSKRSLPQLNRQETEEFPDDLCTVKKYSRDQYEIKASGVHQSNDIATSFGN
FT                   GLGPTRASVMSKNMKSLSRFVVDKKIATQTTSGNNVSSSTNLKHMSAANGNAAKVSNES
FT                   IMEVQHKVNDDTSKEVQKTTINPENNLINAAPGNNNSSNLTSHLVQNNQVTSKRPLMKN
FT                   SGYCENCRVKYEYLDLHVVSEKHLSFANNDINFEAIDSLIEKLGFQF"
FT   CDS_pept        complement(444525..445412)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437711"
FT                   /locus_tag="CAGL0E04598g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG58807.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B6283"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV56"
FT                   /transl_table=1
FT                   /translation="MSNLKSTAASLLLRQYRELTDPKKAIPSFHIELEDDSNIFVWNIG
FT                   VMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGD
FT                   PMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKNPEQYKQRVKME
FT                   VERSKQDIPPGFEMPTSDTAYLSQHKNENPHEQHQNQRDISENFWYDSDLEDDEDVGSL
FT                   MNDGDSLGYNDDDVYNYQSYRNRGGDEDEDEIEFEDDDEDDSIDNDSVMDRKQPHKAGD
FT                   ESEDVEEVEKIVKK"
FT   CDS_pept        446284..447573
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437712"
FT                   /locus_tag="CAGL0E04620g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58808.1"
FT                   /db_xref="HOGENOM:HBG398340"
FT                   /db_xref="HOGENOM:HBG429547"
FT                   /db_xref="UniParc:UPI00003B6284"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV55"
FT                   /transl_table=1
FT                   /translation="MQLNHLLLSALISVASAANTTVPDVPSSCSFTTTTATAQSDLDKL
FT                   AGCENIVGDVVISGSLGNAALANVKAIYGSFKVNNATSLNNLAADSLQKVTGTLALQSL
FT                   TILTSASFGSLEEVDTINLITLPAISTFSSNLKSANNILISDTSLESIDGFSDLEEVAV
FT                   FNINNNRYLTSLKSSVKTVSDSLQFSFNGDQSSLTFDDLLWANNITLRDVDEVSFKKLE
FT                   SVNSSLGFINNSISSLSVDNLKSVGQSFSIVSNDDLTSVSFANLSTIGGALVVANNTNL
FT                   KDLSTFKNVQTIGGALIVTGNFTTLDMSSLKSVRGGADIETKAGNFSCDPFKKLQSKGG
FT                   IQGDNFVCKNGATSTSISLTSRSSSASQSSSSQRASATASGNSSNSASTAASTSSANKQ
FT                   KSKGAAAGLADSFQGSSLMGALAAVALALI"
FT   CDS_pept        complement(447934..450141)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195735"
FT                   /locus_tag="CAGL0E04642g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG58809.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG038904"
FT                   /db_xref="HOGENOM:HBG318848"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI00003B6285"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV54"
FT                   /transl_table=1
FT                   /translation="MTSFELHVANSPNNSYALANVVAVSPSDFPNNSYILLDNLFVFTT
FT                   RHSNEIPPKTIGLNGNQRTWGGWSLNQSVQVRPFDLVAYTSKHSYIGNMDVEISFRSRG
FT                   KAVNTKFEQDDLSRHFVKMFESQVFSPTQYLIFEYKGHIFDVKIKGLQAIDIGDVQPKP
FT                   HVSTKIETKSILTNQSHVSFYKGRDGLVNLTAGSSLQTSNPNAVIRPDFKFEDLGVGGL
FT                   DKEFTKIFRRAFASRIFPPAVIEKLGISHVKGLLLFGPPGTGKTLIARKIGTMLNAKEP
FT                   KIVNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFKQRGSRG
FT                   DGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPDE
FT                   EGRVQIFEIQTKKMRENGMLAPDVNLKELAALTKNFSGAEIEGLVKSASSFAINKTVNI
FT                   GKGSTKLNPKELSQLRVTRADFLNALDEVTPAFGVSEEDLKTCVEGGIINYSESVDNIL
FT                   KHGARYVRQVKKSDRSRLVSLLLHGNAGAGKTALSAAIALNSGFPFVRMISPNDIAGMS
FT                   EAAKIAYIDNTFRDAYKSPLNILVIDSIETLVDWVPIGPRFSNNILQVLKVALKRKPPQ
FT                   DKRLLILTTTSSYSVLRQMDILSCFDNEIGVPDVGNLDELNNIMIETEFLDDAERVKVI
FT                   NQLARTRPAINLGIKKILTNIETARHDEDPANEFIDLIVNS"
FT   CDS_pept        complement(450752..451354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044588"
FT                   /locus_tag="CAGL0E04664g"
FT                   /product="Similar to uniprot|Q12025 Saccharomyces
FT                   cerevisiae YDR056c"
FT                   /protein_id="CAG58810.1"
FT                   /db_xref="HOGENOM:HBG253138"
FT                   /db_xref="UniParc:UPI00003B6286"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV53"
FT                   /transl_table=1
FT                   /translation="MYFLVYMLVLLGLVNSEKLSLFASNRDNGKRVSLGEITVDEKAHN
FT                   ITGTTLDASSLIGTYCFGAEGESYSNDCFCYLKVDGKKHNYTLMVDVNDDIVESLTWMM
FT                   NDYSNGTTAEVRLPVHAPQPPPIKLKKTTKTYAEKKAESKLDAAKKKGKEEEDNEEEDQ
FT                   RTFFEKNWKKMLIGFLIYNLIAGFSKSQQQQGQQQQQ"
FT   CDS_pept        451626..453716
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437713"
FT                   /gene_name="YOS9"
FT                   /locus_tag="CAGL0E04686g"
FT                   /product="Protein OS-9 homolog "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG58811.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="HOGENOM:HBG124501"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="UniParc:UPI00003B6287"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV52"
FT                   /transl_table=1
FT                   /translation="MLVVAFASLLGAARAIMMPIDDPTTSDKFQITYANESLWDTLVMK
FT                   NKTALESGELFDLGPDTKCFLPNMTRLHEQNVQSVNDPEYKQKLIDTLDMGAHIIDASL
FT                   KNQCLVSQNGFWTYRYCGSGDFTQYHGVAPDPNDKLTYTLGRSSKQIENREFQLLYDDY
FT                   GYYISEIIESGDICDVTGTPRAIEIQYTCGNVMRPGTLQWTRETKICHYEAQVIVPDLC
FT                   QLELLSKNQDKKNAVPIICHMSNDVPDKHNIVDIVSNYDVSFVANQVYFLLPMNNSNVD
FT                   RALLMYTGNATEDGLEMDPFPMEIYKKFIDVMNKMLGLGLLSPPDGKPFDVHDSYQWIG
FT                   DIVDMHGNYLNRLRLDVDVNMEATLIIDKSINFTGPNNFQWYFRGSDRTKNSKSRFGSL
FT                   TNDNMMLAGGSIINVDDISKENAQELLEKLVAAGKLSGVIEDNKITQGSPIEASKTKVT
FT                   KASESTPVSEKNKKAKTVTKTIIRSRDKEEYFKENEKQGEENNAQVPFSAHNNEQHGTI
FT                   SKSERKEENTNQKQLANTQKGDTDTPPQSSQSSANDKLSRSGMGQKEPGVDEIGSELRG
FT                   NSKKALGSNIDNSSGRSTLNDNSDRIAVENEAREIINSNAYDQSEASVDPNYRNDQQRL
FT                   NSAKEHTFSQSKEKKSINSEEILETKILNSETLGNNDGVASDVKDEEVVESDRNGVIDD
FT                   EL"
FT   sig_peptide     451626..451670
FT                   /gene_name="YOS9"
FT                   /locus_tag="CAGL0E04686g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV52 "
FT   mat_peptide     451671..453713
FT                   /gene_name="YOS9"
FT                   /locus_tag="CAGL0E04686g"
FT                   /product="Protein OS-9 homolog "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV52 "
FT   CDS_pept        complement(453839..454867)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186395" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437714"
FT                   /locus_tag="CAGL0E04708g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58812.1"
FT                   /db_xref="HOGENOM:HBG059677"
FT                   /db_xref="HOGENOM:HBG395372"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI00003B6288"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV51"
FT                   /transl_table=1
FT                   /translation="MTSSKELLVKEDIHSIDKLPKIENYKAPKYPVVLCHGLSGFDKLI
FT                   LIPSVFRLTKMISSSINLNNSDHFLEIDDDTEGASVRNKGLLEIEYWIGIKEILEKNGC
FT                   QTITTKVPGMGSIEERALALNASIEREVKKLQKKQKKNSWFSRNEKIKLNLLAHSMGGL
FT                   DCRYLIAKLPKRNYQVASLTTISTPHRGSEMADYITKLFFDLKPKKESAPNIHLPICFY
FT                   QLTTTYMQYFNENVRDDPKVKYFSYGSYFKPKWYNVLAWPWKVIAKATNDGLNDGLVTI
FT                   KSSEWGEYQGTLKNVDHLDIINWKNKLQDDYLKYFPKIGYEPINILDFYLHVTDNLARN
FT                   GL"
FT   tRNA            455162..455233
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        complement(456202..456645)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348954"
FT                   /locus_tag="CAGL0E04752g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG58813.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B6289"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV50"
FT                   /transl_table=1
FT                   /translation="MSSKRIAKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPY
FT                   AGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLL
FT                   SICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAREWTKKYAV"
FT   CDS_pept        complement(457385..458650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348955"
FT                   /locus_tag="CAGL0E04774g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAG58814.1"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="HOGENOM:HBG124502"
FT                   /db_xref="HOGENOM:HBG203214"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="UniParc:UPI00003B628A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV49"
FT                   /transl_table=1
FT                   /translation="MFDSKKNKTKFAHVREVQVEDPLLKDQEDRRGNDDAFTVINDVSQ
FT                   LEWFFNPSDNGGAKNKKKKSHGLLKAMKQSVETKVETQTLYFSDYKSKRCGFVQLLYSS
FT                   VLGGLYKGFQLNFKVFSCVDEEVKCDVWESFKLDEVSAFEPLKFVSKNVSFEFKEIEFK
FT                   DNIYDKFATLHIRADIPQQDNNVKDLKLEMDVSLLPGFMINPDGCNYYLDKAVALDKLY
FT                   SEESNKMIRHVFIPKGVADGKITYKKLNSKSGKYDDFSILLTNSPIVYIDAVQGLQPNK
FT                   AASRWNFLCFQSEHHSVLCMEFTTTSEHGNKTMTIWSTSEDGKLKTIGSSLDKHKVKFN
FT                   KTHKDKENGWDYPTSIQFPADFHEDHLRLINRYDVLGELPGVVKSVAQNIAHIKPYIYQ
FT                   YCQESTYKNEKGVSIVESTFIS"
FT   CDS_pept        complement(460077..462038)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437715"
FT                   /locus_tag="CAGL0E04796g"
FT                   /product="Similar to uniprot|Q04924 Saccharomyces
FT                   cerevisiae YDR221w"
FT                   /protein_id="CAG58815.1"
FT                   /db_xref="HOGENOM:HBG059984"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="UniParc:UPI00003B628B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV48"
FT                   /transl_table=1
FT                   /translation="MRVSCLLSALIVLSHADASVDVIGVPKDLQSAYKADGKGKWRCLN
FT                   DSSIEIDFSRVNDGVCDCPDGSDEPSTGACGELTEFYCQNEGFIPRYISGSKVGDGICD
FT                   CCDCSDEVNTPQTSYRGRTCQELKKQYEDILQQERLNYEQGLKALSQKFEIKKIDSKEK
FT                   QLKNIEDLDKQLSKTKDKLQKSKARYEKEKQFYVEKVKLNDPIAFELQKIDMNQLTADL
FT                   NSTFATVIQAASAFQDITKILDDLSIGYTRSLNDKVVNENVKKYDAMINSKEFDRATIS
FT                   SKVETELHEQLLDYFVKEIPRLVYDKKSDETNPEYVIRKAGFVKALVSGKTSYSNEIVN
FT                   KGVRKFIKVMDTVASNYNVNFQDRKVIEAAAAYHDFLGKYENLLNGNTKFTVPDKLIEN
FT                   IDTIIKIVETHAKDILSGNLHIEGGESGPSESSLEELNQLRKQLKSHEKQLHSLEEKVK
FT                   GLELEKQQSVLARENATLLAFQNILEQLNAHKSGCVSSKVNEYSYEICIERDLNGELTG
FT                   MLTQRSLNDPMRVVRIGSFTGFNTLNEHESQAKHQSHLSAKYPDLDVRHLRNERLKMVN
FT                   GSIEDEFEYLYGDELDNMDLPIVLGFTRGEKCWNGPSRAAEVSLRCAPEFNIEAVTEPT
FT                   KCYYNIVLAGPLGCVPRT"
FT   CDS_pept        462438..463712
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195736"
FT                   /locus_tag="CAGL0E04818g"
FT                   /product="Similar to uniprot|Q04922 Saccharomyces
FT                   cerevisiae YDR219c"
FT                   /protein_id="CAG58816.1"
FT                   /db_xref="HOGENOM:HBG124503"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00003B628C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV47"
FT                   /transl_table=1
FT                   /translation="MDEDILQYMRPSSLTDLPLNILFNILSNLEAHDLMTVSCTCSMLR
FT                   TLSNENLIYRNKVKGSNGANWWTRRLVTDVFDILDQKRNFLLTMTTRHNVSVIESLRHI
FT                   QNKFNLNEEPHRKKTRSYSHSRIDEVDGSGNIIITKNNNGISSDKRNFTDIISNRDALT
FT                   YQSILQGIKAVVDSQDENMVDRSHTTKDRVHQTYTIGELSPSTSDKSRSSDDSIFSGKP
FT                   ILGENEWKAHDEPSSPFKGVLNTDTVSTGSSSLSSSSDSLDRLRNSKHVRDKAALFEKL
FT                   LFKENNEISPKKNIRKTVHINQPINNDKKVKSYGGLSNSKSMFDFVPELQLKDGIETRK
FT                   ISDGYIQEVERLEGSASPKFLESKATSKDLELLKNSANVKERSQCLESTHQQRQKHKRS
FT                   QLKMIITSDNKISYQKIDDGEEVGY"
FT   CDS_pept        464344..465546
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195737"
FT                   /locus_tag="CAGL0E04840g"
FT                   /product="Similar to uniprot|Q04921 Saccharomyces
FT                   cerevisiae YDR218c SPR28"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAG58817.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00003B628D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV46"
FT                   /transl_table=1
FT                   /translation="MTTIHGVGSAARFPRPISTHTIDAIQLRQKKNAKKPEHLCLLILG
FT                   ERGSGRSTFLANLCNYPDYTQSQAVEVCDPRRSHIAQKLKIIKKHLDLSSHINAPMILD
FT                   LVIMEGFGDNFDNSGTSATISAYLNTQFENYLAEEEKIHRTGIIEDTRPHACLYFIKPN
FT                   MRGLNDFDIEVLKKIQKQVNIIPILTKADILSQPELVSNKEIIKRQLRDNNIEIYDFGN
FT                   DRIGDVFSYNDMHPFDKYTRSQNINEMVPFATTCSKLKYVHPWTAETLHIRKYSWGELI
FT                   VEDFSNSEFAYLKGILFGSHVQELRNFTQNVLYETFRARKLLERRSAIVESNSIQQDIH
FT                   HSMHRIVGLHFKQSDNSSKLSPNKLIDEKDQLLLDYERKLRDLETRLNSEQSKSTMSSI
FT                   P"
FT   CDS_pept        466023..469223
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437716"
FT                   /locus_tag="CAGL0E04862g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58818.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG124504"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR013914"
FT                   /db_xref="UniParc:UPI00003B628E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV45"
FT                   /transl_table=1
FT                   /translation="MSKKENIGKDRPLQHAIITKPEANEISDSSTGNCNRFGSSSIISN
FT                   SSNPIKYMNTNDIFDSAKGRNGQLSGSVTSTKKSIDTFKTPVRNGSAEIIVDNERYSPL
FT                   GLKKASNQRTPDLEKIANFFKNKRTPRRNKILETSEYSDSDDTPISQRMVMHEDLSPSK
FT                   ASTAKKNLLNDVTAIEDTTETVIDDSRLSTGLKEIVLPIGEPFLNNSSPFRDGTANPYH
FT                   ASQLGAEEVSHIGSHRSDNNNENSNNGKTTAVDEHSQYNTISDGRFIFRISDKNEANSA
FT                   AATQRIQGSQNETQSTELLDNTTQHDTSLIKENGVTSNSQNSLDSKTPEVYKTGYESGM
FT                   SSQSVIDVTTPLNSVLLSHDNVIEVPRTSSPSKSKVPRTKITSSQNDQHLDTQYSSYNQ
FT                   KVYLQVISAANKDYEQTYGDTQLIEDKESHIISDGEQTQELPEIEEEAELDDSISQHHS
FT                   TRNFSQDISSKTEQIRATANILATSSEDDANDHESPCNKRAKISEKEGLAKPDKINSNN
FT                   LYKQEWIKKLKLQNDNVQNLGTLEPKDIIFEDAVWYQYDANLKFYPGRIESIDYIRNKA
FT                   QIRHKTGTVEVNIGDVYYLNLLIGDHVDCGGYTGEIIALKCLSENSKDFRCVRGFDHVL
FT                   LKRLSGNGKLGLEVFEMPISDICMSIEQWMKRSKIHVVSHPPSLEPGNDLSTPSRSGKR
FT                   SSRTSPRKNNKNAIYIESSTPAKLKSETAKEDQRSSPIVPINISFNTSMPECTINDDYD
FT                   NYNEALFVFSSLADNSTELTERIEQLGGLVLEEGFSSVFEYCAQNRFDDTIIREKYGIT
FT                   VKNIQPELIPKDDSPIFTRSFACVVSRRHLRSLKYLECLALGWPTIHWKFIEDVGSISH
FT                   ASINQLWNYLLPSGESLRLAEADQRLGVIISNNIFEFTRNYLKGYSLNQQCSNRSNILR
FT                   DYTIIVLGSSQLDNFLNFAFSCLGAAHVSYIFPSSISDYSDLLKNTLSKKQRLVVIENI
FT                   FRLLGELRDYEGINVTDNIILFVNCNSNEKDDKLVDMLRRNQKREAIPDYLSINIESKE
FT                   WLIQTIINGSNGFSRVVG"
FT   CDS_pept        complement(469532..474001)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437717"
FT                   /locus_tag="CAGL0E04884g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58819.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124505"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B628F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV44"
FT                   /transl_table=1
FT                   /translation="MSSKVNKELPSIPEHLKYKGFTPSGKPRLFVCQTCTRAFARQEHL
FT                   TRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVHGGNCGESLLRKKRSKRMSSKQMS
FT                   NSNGPLQQSPGSLPTENHSNDKIIANGDPLVAFEAGSTDVNSRKRKKKNEFLERTKKMA
FT                   TPTLMRRASFSAQSAENYAKPLGRSQMRGPARRPSSRLTNVSNSSSLTNANAHNSNSMF
FT                   PELNTHHPVDNVEFSTPQLLPVDFGNALTFNEMDFFSLDEENEGSVDFSIEDFNSFQYQ
FT                   GGENNKTLNEANNGPHVHNKVDEQAVDFDFLKSPFNKYNDPLSSDVHLDVDDKPRNNIP
FT                   RINENSILDQFHKNLLYSSSSNPEISRSESSPSSSVTMPNELPDLNNHVPITQGGAGTP
FT                   GYSPFSVNSFGRENTSQKSKTNGKSSGLANNNNNILHTKSLFTHHKRNNESLKEATLSG
FT                   STENSPHENGYGDYSNVDKLINTTTTPGFVATSVSPNKISSHLHGQHSDYLPNEVDSNP
FT                   EVFDDNISPKQGDYNTKPSYIDNIQKLTSRKNSLFGNIYNKSPAEILRKESATPDTHSV
FT                   TPQYITEINEITSFNKDLQSIFNDFMKEEEKDIIYGKQNGDLFNLLVNGEGTKTTNNLG
FT                   GQLQTNFSEIENLSANGPIHDANNNYTFYGLDYLGAANITKSSPPESGSNMKRCKLFTT
FT                   KLRILCHSALKFYDLNCSNSTLSKNSSDTMLFSKQILLPSANELNECISLFQENFLSHH
FT                   PFIHQDILNLDIDSLRKYVYENEEFKSELDDCWNIDFDGSTNVHDIPIGSNKQAMGIAS
FT                   LVCLPLFMATCGSIYKNDNNFKTMELYEASRRVLHVYLETKKQEQISIQKDPTVSLIMK
FT                   RKMQNQQHHVWLIQSLILSIIFAFFADYLDTIDTQLVVRQVAAICSIIKSNILADITYS
FT                   SNQTSSFDSSFKYILYETKIRTVLMAYKFSQLLTIYYNMDCTSYFDEHTVEQLTIPDDE
FT                   YKWQTQRLFQDNSFIDANVPMTSSHSADKSSAINLNQGSSKSLLELQSGGKYQKQHTVS
FT                   FKQFYDSFAFNNRGLHAIPEYLAINMVLYEYSIRNHSKFHVFLTRLDNKKLEANIPAPP
FT                   FLANEEQMAFSGKKAKILIKDAIALRNYLMSMKVFNDVDKSFANKICKTGLKEIFYEFL
FT                   YSDQNNLLTHGSYNLMTDFLIALNFAIKNLTRLVKYKRKGSDELEFDKNKFSIFNLQAY
FT                   YYDFLTVIKFIMDFERTPNFKLLSIFTELRKLADCVFIPLLNEFYSIEFTQYTAVIPEQ
FT                   SFNNKKATDDLPHILERLEKMIGNVLVYSFNDNSFLNMFDDKVQNEFQFNPMSNLQHFL
FT                   KSPKINDSQLINSNRDDGQKEHINNGEPFDDTSINHTKSSVNLVLRHQQLQQQHAESTD
FT                   SDSSLRMRTHKQGFAERYQLSAKFASIGKCVFKLVKEDFCNAHILDKMSNDYSELCKLL
FT                   EKEVYKFDLSGLEIDSRKDNPIHYDVKF"
FT   CDS_pept        complement(475578..476663)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044589"
FT                   /locus_tag="CAGL0E04906g"
FT                   /product="Similar to uniprot|Q12449 Saccharomyces
FT                   cerevisiae YDR214w"
FT                   /function="ATPase activator activity"
FT                   /function="chaperone binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58820.1"
FT                   /db_xref="GO:0001671"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG175235"
FT                   /db_xref="HOGENOM:HBG324693"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="UniParc:UPI00003B6290"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV43"
FT                   /transl_table=1
FT                   /translation="MVVHNPNNWHWVDKNCLGWAREYFQEKLVGLAAQEGDCQLSVTSV
FT                   KTVDGDCEVSQRKGKVISLFDLKIVLAYDGELAGDKFEGTVSVPEVAFDSDPEDYQFVV
FT                   TIFQETSKLNERVKPLIRERLVPQLRSAFQQFGPDLLTTHSSDIQVGADQVSSTFTRAN
FT                   QEASVPVAGASQAKAPASAQSTAKSSTQVQKPVEKATSGASASKPGTTSRVVNTSSMHL
FT                   EPSFNVPAAELQRTFLDRMRLQQFSRSELRMLHSGSGSGAGGETLGEGDEYELFGGNVR
FT                   TRVVSVGDSSIKLQWRLSDWTPEWFSELSIEFHESQEYHETKLKITWDKIPVGQEDRVR
FT                   QNFEEYYVRAIKLTFGFGAVL"
FT   CDS_pept        477209..478426
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195738"
FT                   /locus_tag="CAGL0E04928g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58821.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG266905"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI00003B6291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV42"
FT                   /transl_table=1
FT                   /translation="MWIARNNLKVLSRARIPVWRAYRFASTAASEADEEALEFQELNPL
FT                   LLKRVSGVSKELAELEKQISNGYDEDVQRKYNSLMSLQDVYDRYKEQLGNYRELKEMID
FT                   VDKSLAEEAAAELHELVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGGSEAMIFA
FT                   KDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAGVHRVQR
FT                   IPATESKGRTHTSTAAVVVLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGGQHVNT
FT                   TESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSKLAELEQQQKAEKERQVRKEQV
FT                   TTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQAESI
FT                   IETNQS"
FT   CDS_pept        478863..480884
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501117"
FT                   /locus_tag="CAGL0E04950g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58822.1"
FT                   /db_xref="HOGENOM:HBG058543"
FT                   /db_xref="HOGENOM:HBG397461"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI00003B6292"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV41"
FT                   /transl_table=1
FT                   /translation="MDEIDANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLD
FT                   SLYVRLKNCSPLSFRAGYLAGPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVK
FT                   VMELSLHNIQSKYVWILDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGST
FT                   SNNLIVSRLTTDDLWKLPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANF
FT                   PNEILIVDGYFDNVCETEKGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFA
FT                   IGNLAARYPWFFDKVKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVD
FT                   LPDEKPLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLRE
FT                   KEENKSLSGPNNITVSDNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAA
FT                   SILLPPLPDINFIVNPKHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTV
FT                   TSEKTKYQELEKTIAIRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLIS
FT                   EHFSGENFEMDSQKDVSITTTREDLNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKR
FT                   FSNLVDATASNEESLREIKDEVTQNLDLDMVDIPNETI"
FT   CDS_pept        complement(480915..482930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437718"
FT                   /locus_tag="CAGL0E04972g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58823.1"
FT                   /db_xref="HOGENOM:HBG058542"
FT                   /db_xref="HOGENOM:HBG204272"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniParc:UPI00003B6293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV40"
FT                   /transl_table=1
FT                   /translation="MLNDINDLLDLEKHIDEIEQKRNTLANELETYRNGVVTRKIHEEQ
FT                   ESIDLLAERILAATDNLEAIEQLKTEFGELRILKELETDIKNRNKKKETVDELQKLEPE
FT                   LNEVIESNDENTITDSIINLHDKISLICNDEVIHLDDYIQYFIFKFEDELVRPVISTKM
FT                   NELQDKLLKSYWDNQKKNSLTTNQINDLRSKSSELFRLNNCLFNNSSEPLANMKAIANN
FT                   FKVRFTYHFHNSTTDIETYFKFLKDYLHENLYQCISIFYDPSVGLSKAIIHQEFINNVL
FT                   NPIREKIRSTLSTNDLKSAIFLISQILATDKILSKTFHYQGSGLASLISDDQWEKWINY
FT                   EEEITKKQFSSITGNTEKELLQSANNFNELIKKTYVYLEPLLTLEYDPAQKFKLQCCSN
FT                   IFLNLFSMYLEHTLAVDTLGEKRSKDEELQQTLIKLNNLCIVANKIIELQGMEPFVLLT
FT                   DIVNRNEAKNYISVFQDILNDYEQNIQIDIQRSIVHRLQKLLKDTLRNYFKITGWSTDY
FT                   SQEELTTPSSEIIAAINLLTRIFIKIDTLQVPPSIVIQIKNDILNVLVLYFTESILKLN
FT                   KFNKRGLLQFELDFNKLKDCLSLPYDNFNFKERMLTEILHILRLKYDSAQSHFYEKQYI
FT                   KQGLYDDLRAQNKIEVLKDTEIQDALYRIAYGNIVE"
FT   CDS_pept        484427..485002
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044590"
FT                   /locus_tag="CAGL0E04994g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58824.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG297151"
FT                   /db_xref="HOGENOM:HBG606796"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI00003B6294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV39"
FT                   /transl_table=1
FT                   /translation="MKYIQTEQSIAVPEGVTVSIKSRVVKVTGPRGTLVKSLKHIDVTF
FT                   TKVSEKLIKVTVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKLRYVYAHFPINVNTI
FT                   DKDGKKFIEIRNFLGDKKVRLVPVREGVDVEFSTTQKDELVLSGNSVEDVSQNAADVQQ
FT                   ICRVRNKDIRKFLDGIYVSHKGFIEEEL"
FT   CDS_pept        complement(485522..486652)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000060335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437719"
FT                   /locus_tag="CAGL0E05016g"
FT                   /product="Similar to uniprot|P28777 Saccharomyces
FT                   cerevisiae YGL148w ARO2 chorismate synthase "
FT                   /function="chorismate synthase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="CAG58825.1"
FT                   /db_xref="GO:0004107"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG003316"
FT                   /db_xref="HOGENOM:HBG292336"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniParc:UPI00003B6295"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV38"
FT                   /transl_table=1
FT                   /translation="MSTFGRLFKVTTYGESHCKSVGCIVDGVPPGLTLEEKDIQPQLTR
FT                   RRPGQSALSTPRNEKDRVEIQSGTEFGKTLGTPIAMIVRNEDHKPKDYSEMDNYPRPSH
FT                   ADFTYSEKYGIKASSGGGRASARETIGRVAAGAIAEKFLHYVSEVEIVAFVTQIGSIKM
FT                   NRDPFDPAFHQLLNTITREQVDSMGPIRCPDASVADLMVKEIEKHRDAKDSIGGVVTCV
FT                   VRNLPTGLGEPCFDKLEALLAHAMLSIPASKGFEIGSGFEGVSVPGSKHNDPFYFDKDS
FT                   GKLRTKTNNSGGVQGGISNGENIYFSVPFKSVATISQEQKTATYDGEEGVLAAKGRHDP
FT                   AVTPRAIPIVEAMTALVLADAVLIQKAREYSKNVVR"
FT   CDS_pept        488786..493240
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437720"
FT                   /gene_name="INO80"
FT                   /locus_tag="CAGL0E05038g"
FT                   /product="Putative DNA helicase INO80 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58826.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG192256"
FT                   /db_xref="HOGENOM:HBG398013"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="UniParc:UPI00003B6296"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV37"
FT                   /transl_table=1
FT                   /translation="MSLSALLNNDDPVEDTKLYLESLNREMDRLIKRDQLELMYQDWKF
FT                   ANYQEFELISEWNTQCKELVGDGNDLQNNDLMTEEVHLDDLYDNIQRIRNEWKDYESYK
FT                   ETRSQLLSKSIQAKPIKHRRRRRTKLEMEAAANLAALSQMGTTDVKTPEIINDHGNRSK
FT                   ASRSDTTNKTDNTMAGINSPTSDVDSGHKDELDQTKLIKKQEASSSTNSAASVTASVAN
FT                   GIVEDQKDEAERTIEANRIGSNMQNSDQDTMDDLKKTNDPSSDIDSDANTSVNDGSDEN
FT                   LSNKLDSDDLHSEPADNEEEPVSSDAEKDQAENINQTDESEEEIIVKEYDDNNDEDFAP
FT                   EIKKPKPNGKIVTINSDRPKIVRELIKLRNKGKAPKSSKRRYTAVNITEYSPTEKKISV
FT                   KITLKQMHVKKLKKILQDARKAEEKRLQEEAKQIADQESPRKRRKIDRSENTKQEDEDD
FT                   KEDDDLDGLPTYGMKMSLKDAKAIQRHYDNTYTMIWKDMARKDCMKISRLVQQIQSTRA
FT                   LNYKKTSSLCAREARKWQTRNFKQVKDFQTRARKGIREMANFWKKNEREERDLKKKAER
FT                   EALELAKKEEEEKESKRQAKKLNFLLTQTELYSHFIGRKIKTSALEGNEVAEEDEDNYD
FT                   LTTTAPNKNDFHAIDFDNENDEQLKLKAAQNASNALAETRAKAKAFDDAHRQQQSTESD
FT                   DEEEMNFQNPTSLGEITIEQPKMLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGK
FT                   TVQSISVLAHLAEHHNIWGPFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVL
FT                   RKFWDRKNLRYSEKSPFHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWK
FT                   NLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNS
FT                   SLNQQQLRRLHMILKPFMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSS
FT                   NYDAIENAAAEGSDIAGGGNSDQSIINAVMQFRKVCNHPDLFERADINSPFSFTSFGKT
FT                   SSLISSSIATSGGLTETISELMYSSTNPINCAIPKLIYEDLILPNYNNSIDIMEKLLLS
FT                   DFSIYDPVNNKEMCQYLGLLTGLAYGSFRKIHKSNYFERIINLKKESKQSSQNLITVVS
FT                   NANDLIADSIVHADTNLPNLTGIRNDIYHNDYLNSIQPGYCPKVVAPPINFNVNGSLNF
FT                   TNKMSSYLFNPVITTALSSIPPPTQYNMFVKKCIPIEEFPISEMYPNPLNKHFSSNISM
FT                   PSMDRFITESAKLKKLDELLVELKKNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDG
FT                   SSKLEDRRDLVHDWQTNPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMD
FT                   RAHRLGQTKQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGKTKDTNIQTTHTRPEH
FT                   EQLTPKSLSSEPEATNNLITVKN"
FT   CDS_pept        complement(493370..496669)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437721"
FT                   /gene_name="NUT1"
FT                   /gene_synonym="MED5"
FT                   /locus_tag="CAGL0E05060g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 5"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58827.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060093"
FT                   /db_xref="HOGENOM:HBG204269"
FT                   /db_xref="InterPro:IPR014801"
FT                   /db_xref="UniParc:UPI00003B6297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV36"
FT                   /transl_table=1
FT                   /translation="MESKSLNTLALRCAARKIPASEFLNLYKEFYNETFPANSIDNDDA
FT                   KTQEGSGSQDKTDVEESISKPVGSKNDPVAILCAEFMKLLENGKYVILADYVVEVLFVN
FT                   YHSELVREFLPKLKDLMNKGILIHFFSKSCAFFVNLTDNLVISQLIKDLRATIVPCILE
FT                   TNFCDISNELVVAIAKFLQAVLRFTPQPIQINSETYRDNTFNLTKRLSLINKILSKKFA
FT                   GIIDKKLQFKEVLGPFTKDSTLDFDNSPSITSPQFIPSPLPSMKERSVTSSQSAIKYKD
FT                   LKLLRYYKNIWLNSKLMNWQPFDSEFISNYSAIKSSLYPDQVQNIQNVDLLFTDLIETA
FT                   FTCFAQFVSNKLYHQSNSTYNLLERKWILFLSKILPLLVYKNSSRTAHVIGNALDGIDD
FT                   KVIKAISAYYQENDDGRSRNDDLFDDYPSTSLDIRHDFIKSLTMLGVVPPVFITNYLRG
FT                   DQTVDSKALATTDDLTFTNQQGIIEIVNDIPNFIRSSLEGMEMENVSEPTLVSSNGLLQ
FT                   VLSNFDTVSPTKQFELANAIVDMLSESSTTFELNTFVKLTAVLTFNYSHSLTSILMYVT
FT                   PEVLTKLYLEFVDKHWNSQVIGKQETDGESQFENVNISMSFSWAILMLTILYKQYHIDF
FT                   VSMRADYTTDNIKNSFAITFVENLPDISDLFFIDEKNSDDPEVQVKSHKLVRDWLNDLF
FT                   VNGSLSDSLLQNIEPKQLAILVPYIFKQVTLAMEIGAVGDLQNLIGGFEYFLQPFMLVG
FT                   LIKVMYWLEQYLSCLKSDETDEKLIQKVLSLLNTIICPSTLNEDSKAFHFAVLRLNAIP
FT                   LLGILYQFRSNKHAESNYGIYSSDNEGNPTLELMISRLISSLSISPVYDIDSTILVTDN
FT                   NFVQKPPKFQSFFVTNEISMNKMLTNQMNSFWSLHSSTYYNLDFLKTLIDTLTPKQFLL
FT                   DVLRTLEYKVETLGVKDVRNKSSSNESDQVIDYLFYFLVLYDIENSEDAKAMAQFMEDT
FT                   VDISINGDSGIVKQETQPKSEYNPDDDIDMLFGENDTSMQANEEDTLDNKELKSDRNCA
FT                   LGKNRHTFGFIIHEIKLSYGTLESDSMSYEDYKKICEYHSRYLKMLKTCIF"
FT   CDS_pept        complement(497232..498374)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000921" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437722"
FT                   /locus_tag="CAGL0E05082g"
FT                   /product="Similar to uniprot|P53112 Saccharomyces
FT                   cerevisiae YGL153w PEX14 peroxisomal protein "
FT                   /cellular_component="membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAG58828.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG060094"
FT                   /db_xref="HOGENOM:HBG398716"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="UniParc:UPI00003B6298"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV35"
FT                   /transl_table=1
FT                   /translation="MPVTSERKELFDSAVSFLQDSAIKDAPLDKKVEFLKSKGLGDEEV
FT                   ELALQEAGRRFRDAGNAASDEETATQGNLGHSLNTTTRRRQEYMYEAIPPPLPQRDWKD
FT                   YFVMATMTAGLFYGVYEVTKRYVVPNLLPESTSKLEQDKEDIKKEFEKVDQILSAIQDE
FT                   QADFKEKEQEKLNELDEVISDLKMALRETTNTKEKMEDDFRLLKLEITTLQNSIDKFMS
FT                   DNSNVKELETLSREVMSLKNLITVAKTNKDIQNGTGGSNLSGMPGKSLSPGGLPGADSI
FT                   PSAADILARMNISGVAGKSAVQDHDPNESGTEPQWKKVKDNMVDSSEFIPEWQRAKTPN
FT                   DQAKLDIPEWQKAALKSDDKLDIPDWQNIKSSSQNTSEDN"
FT   CDS_pept        498733..499509
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437723"
FT                   /gene_name="LYS5"
FT                   /locus_tag="CAGL0E05104g"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase-
FT                   phosphopantetheinyl transferase "
FT                   /EC_number="2.7.8.-"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="CAG58829.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG124506"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI00003B6299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV34"
FT                   /transl_table=1
FT                   /translation="MSDWLSLAKSNDPHIVVLTMDVHLSYFRDEYNFEEALRLLPFEWQ
FT                   CRVIQKRAHKDKVTALCNRLLQLYGCRLELNTQAIDFTQGKYGKPFVKNTESFNFSMTN
FT                   GENFVSIIMANLFQTEVGIDLASINDFTSEGDLKIYEDVLSTEEYEKINNQTNLLDMKR
FT                   LFAFYWSVKECYTKYLGVGLNGDLKIINVSLFSAPLINEAVSTFKLKDITFHSRWVSDN
FT                   EILTYCFPAQYDFLKPIHAILNVVSVIEGIKTQFLT"
FT   CDS_pept        complement(499556..500656)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044591"
FT                   /locus_tag="CAGL0E05126g"
FT                   /product="Similar to uniprot|P18898 Saccharomyces
FT                   cerevisiae YGL155w CDC43"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG58830.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG192245"
FT                   /db_xref="HOGENOM:HBG204267"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI00003B629A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV33"
FT                   /transl_table=1
FT                   /translation="MQNMPDQIKKKHVKYIERHLQLLPAKYEDNDVNKMAILYYSFQSL
FT                   SLLGEDIQGKYSKYIPWIKSHLITKSAPKQNQRISGFVGSLNVRVDGVITFNLPNTLFA
FT                   LLVLALLKQHHYICHEMDGESIGRFVGLCQLPNGSFKSALDLSGTSVSPVDGEDLRFCY
FT                   IAVALLYIIGCRSPADYSKYINVSKLLDYIKNQQCFDGAYGQYGEAHAGYTSCALSTLA
FT                   LLKARETIDENFVEKTLTWLSHRQVSSSDIMRKQEEQNPFYDTDDHGGFQGRPNKFADT
FT                   CYATWCLNSIQLLTKEWQGYVDQRSLENYLLNVTQNQIIGGFSKNDADDPDLYHTCLGI
FT                   SALILLDERLDGSLFLPAHISKLFLK"
FT   CDS_pept        complement(501079..504324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437724"
FT                   /locus_tag="CAGL0E05148g"
FT                   /product="Similar to uniprot|P22855 Saccharomyces
FT                   cerevisiae YGL156w AMS1 alpha-mannosidase "
FT                   /function="alpha-mannosidase activity"
FT                   /function="carbohydrate binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mannose metabolic process "
FT                   /protein_id="CAG58831.1"
FT                   /db_xref="GO:0004559"
FT                   /db_xref="GO:0006013"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG286952"
FT                   /db_xref="HOGENOM:HBG370915"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="UniParc:UPI00003B629B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV32"
FT                   /transl_table=1
FT                   /translation="MFRQQAVEERNYDPQFKPVQGIYEDRLRQFLDQGGPFSHQNLPKF
FT                   YDRERIRLDGKHVKVQWYQVPFEDGSDPTSPDKRPSWKSIIEKDKKGELNFQDASIGQP
FT                   FGPSWSTTWFKVHLKLPSHWIGKKIIFDWDCSNEGVVIDPETLLPATAFSGNERTEYQL
FT                   PKNESGEYFFYIESGNNGMFGCGAGSTINPPDDHRFFGLNKADIVWPDWEARALRIDFW
FT                   MLGDAARELPGDSWQKHKARQVGNLVMDAFDPEDRSSVRRCRELLHKEYLDDFADSPKV
FT                   YQNGSDVMTSVYGIGNCHIDTAWLWPFAETRRKIVRSWSSQCTLIDEFPEYQFVASQAQ
FT                   QFKWLLEDHPEFFKKVLVPKVQEGQFIPVGGSWVENDTNMPSGESLARQFFYGQRFFMK
FT                   HLGTKSTVFWLPDTFGYSSQVPQICRLSGIDKFLTQKLSWNNINSFPHSTFNWAGIDGS
FT                   QLLTHMPPGNTYTADSHFGDVLRSSKQNKTTEFYGAGLMLYGKGDGGGGPTREMLEKMR
FT                   RIRSISNRNGNVVPKLDVGKSVDEFYDNILKNTDNGSILPTWNGELYFEFHRGTYTSQA
FT                   RTKKHMRFSEIKIHDLEWIATKVSILFPDRYKYPANEINKLWEDILLCQFHDVLPGSCI
FT                   EMVYKYEAIPRLDEVIERCNKLIEDALKCVQKDKHKDELTLRTLPWLETDFAGEKDISK
FT                   KFFASVKDKDDCYLLSNGKWEVSICKKRGVIKSIKDTKDNIEYLDLKNGRNKFGANQFV
FT                   IFDDKPLSWQAWDTELYSVNQFNYLEDADSVKIVGDSGNECTVESRFKISKNCEIITKV
FT                   SLKSTDEQRADESIIHINTKVENWESENKFLKVEFPVNVRNDFASYETQFGITKRPTHY
FT                   NTSWDVAKFEVCNHKFADYSEHTKGVSILNDCKYGFSVHGNLMRLSLLRSPKAPDAHAD
FT                   MGSHEINYAIYPHRGELNYKTVRNAIEFNFNHKYQISKEYADKLQSIISIEGEPNVILS
FT                   NIKRGEDDEELNSNYALKKLRSRSLIARVYESLGGESRAVLKTSLPLREVQIVDNLELD
FT                   AIEDVNFKKLDDGTYEIPITLKTFQIASYRLIF"
FT   CDS_pept        complement(504848..505906)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437725"
FT                   /locus_tag="CAGL0E05170g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAG58832.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B629C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV31"
FT                   /transl_table=1
FT                   /translation="MASDNSNTTVFVSGATGFIAQHVVRQLLDQNYKVIGSVRSAEKGD
FT                   HLKNVIFKGGDFNYEIVKDISDPTAFDHVFEKHGKDIKVVLHTASPFHFNTTDIEKDLL
FT                   IPAVNGTKGILESIKKYAAQTVERVVVTSSFAANTSTVDMFYAKDSSKTITEESWNQDT
FT                   WESCQSDPIRGYCGSKKFAEKAAWDFYNANKDSVKFKLSIINPVYVFGPQNYVEPGKKI
FT                   LNTSSEVINSLVHLKKDDPLPEFAGGHIDVRDVAKAHILAFQKDELIEQRLMLHAGLFT
FT                   TQTLLDIINEQFPELKGKIPAGKPGTGNPDDALTPVDNSKTKKLLGFEFIDLKKDLYDT
FT                   ISQILEAEKNSN"
FT   CDS_pept        complement(506831..507868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195739"
FT                   /locus_tag="CAGL0E05192g"
FT                   /product="Similar to uniprot|Q02895 Saccharomyces
FT                   cerevisiae YPL088w"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58833.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B629D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV30"
FT                   /transl_table=1
FT                   /translation="MVASNLVKQVRFGGSGLKISPIIIGCMSYGSKKWADWVLEDKEKI
FT                   FGILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKYQIKRETVVIMTKVFFGVDEDLN
FT                   LQPGVKIDEQEDLVLTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHRLDKETPMKEIM
FT                   KALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSLYNLLIREDEREII
FT                   PFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLELDKLTEDQKEIINRVEE
FT                   VAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELPEEDIKYLEEPYLP
FT                   KKFYY"
FT   CDS_pept        complement(508275..509315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348956"
FT                   /locus_tag="CAGL0E05214g"
FT                   /product="Similar to uniprot|Q02895 Saccharomyces
FT                   cerevisiae YPL088w"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58834.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B629E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV29"
FT                   /transl_table=1
FT                   /translation="MVASNLVKQVRFGGSGLKISPIIIGCMSYGSKKWADWVLEDKEKI
FT                   FGILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKYQIKRETVVIMTKVFFGVDEDLN
FT                   LHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHRLDKETPMKEI
FT                   MKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSFYNLLNREDEREI
FT                   IPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLDNLTEDQKEIINRVE
FT                   EVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDEDIKYIEEPYL
FT                   PKKLYY"
FT   CDS_pept        complement(509715..510749)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437726"
FT                   /locus_tag="CAGL0E05236g"
FT                   /product="Similar to uniprot|Q02895 Saccharomyces
FT                   cerevisiae YPL088w"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG58835.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B629F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV28"
FT                   /transl_table=1
FT                   /translation="MTTKLVKQIRFGASGLKISPIIIGCMSYGSKNWADWVLEDKEKIF
FT                   GILKRAYDRGLRTYDTADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVFYAVDEDLDL
FT                   HHGLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLGTYIDVLQIHRLDKETPMKEIMK
FT                   ALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSFYNLLNREDEREIIP
FT                   FAKRHNIALTPWSPNARGLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEIINRVEEV
FT                   AKKHNTSMAIISNSWVLSKGCNPIVGLNSIARVDEAIASIDFELPEEDIKYLEEPYLPK
FT                   KFYY"
FT   CDS_pept        complement(511264..511590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000042711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195740"
FT                   /locus_tag="CAGL0E05258g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58836.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG386095"
FT                   /db_xref="HOGENOM:HBG519078"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniParc:UPI00003B62A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV27"
FT                   /transl_table=1
FT                   /translation="MASNDNYDPYLLSEDGGQSKAAALKSEIDDTVDIMRNNINKVAER
FT                   GEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLKMRMCLFLVIVILLVVIIVPIV
FT                   VHFS"
FT   CDS_pept        complement(512208..513263)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437727"
FT                   /locus_tag="CAGL0E05280g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="3-beta-hydroxy-delta5-steroid dehydrogenase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="CAG58837.1"
FT                   /db_xref="GO:0003854"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B62A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV26"
FT                   /transl_table=1
FT                   /translation="MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGD
FT                   NLKNAIFKSANFNYEIVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLL
FT                   IPAVNGTKGILESIKKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWEN
FT                   CQTDAVRAYFGSKKFAEEAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNV
FT                   SSEVINQLVHLKKDDPLPQVACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQT
FT                   LLDAINEQFPELRGKIPAGEPGSNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQ
FT                   ILEAENASAKL"
FT   CDS_pept        complement(514301..516790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501118"
FT                   /locus_tag="CAGL0E05302g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58838.1"
FT                   /db_xref="HOGENOM:HBG124507"
FT                   /db_xref="HOGENOM:HBG202917"
FT                   /db_xref="UniParc:UPI00003B62A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV25"
FT                   /transl_table=1
FT                   /translation="MSFDWLNVPGLNTATDDRQNSTLPTVSFDFGVTDDSSKEQGMHFL
FT                   DETMKSSSDPSLVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNIN
FT                   GNRYHNPIHEEEDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKL
FT                   ADVFQFLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMIL
FT                   EKAPIPRPRPILNKEGGNEFYEEVEEDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGK
FT                   TVRKRIRRKVKNSVFKNKKVRFAEKVTFQDAPHYGKDKQNKDTSTTTDDDSSYVSTDEP
FT                   LDLSLPMDQLLKVIAKRKKNSALVSSVPTEQQETEEEREILSDMKDSLSHFKQIQGPDS
FT                   VTQIPPLVAQGQQSTIFNTGYKVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSH
FT                   MSPNSIPGAFDSQPVQVPAIQATSSDVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNI
FT                   GHVASPQPVGVTFQSTGNQLNQPTHLDLRNRSPLQNLPHQSQQQHLVPQAVNSQPQQQQ
FT                   LHQQGILQPQVHQSTQQHINNSLQQHLPNNNPTNLSAPNANLNSPPLESPGMLYASNAA
FT                   SNYFQSLLSNSPSPNASQANIHTTINSNMSSGIQPNRQPNVQSNANGHLSPNVSYGNNM
FT                   QMSTQGLQNQGSNMQQMQSQQLPVYSNPTGTTNYQYPGPGSLQRQNSQPVNSQAHRPSF
FT                   SSMLPPQQQYFQSDTQNTNYQNQGHANQHIPINNNNQSYHNMQNIPTGQMSTQDILGDL
FT                   QSLKNQVDALQNQYGRL"
FT   CDS_pept        complement(517463..521317)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348957"
FT                   /locus_tag="CAGL0E05324g"
FT                   /product="Similar to uniprot|P15801 Saccharomyces
FT                   cerevisiae YOR330c MIP1"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA-dependent DNA replication "
FT                   /cellular_component="gamma DNA polymerase complex "
FT                   /protein_id="CAG58839.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005760"
FT                   /db_xref="GO:0006261"
FT                   /db_xref="HOGENOM:HBG113301"
FT                   /db_xref="HOGENOM:HBG315217"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002297"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR016265"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="UniParc:UPI00003B62A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV24"
FT                   /transl_table=1
FT                   /translation="MLCALRARAQVGVRLPLPLPLLLRVPNMALPVTVRWAHVGEGSAA
FT                   PPEQPRTNPLGIQYLSESLQQQVFPGATGHSEDPELVKLAKLSLSNHDLLGRKTTITKP
FT                   IAFKLPELQGSSLDEHFQRLGLYASEPYRTMALEKFKSIPEKPKNWIRKPGWYRYEKGK
FT                   EPTRVDFPSEDTLVFDVETLYKISPYPTLATAVSDKAWYLWCSPYICDPKDSDKHEVYE
FT                   HLIPMDTLNKEKLIIGHNVGYDRGRVLEEYNLKPSKAFFIDTLSLHVATAGLCSRQRPL
FT                   FLKNKKLKENLTAEPEEIEEVTEALELNDVADPWLKVSTMNALSDVALFHCGIKMDKTT
FT                   RDYFASTNKQDVIDKFQLLVNYCATDVITTSKVFDKVFPSFMKKCPHPVSFGGLKALSS
FT                   CILPTDQIKWQNYIKNSENKYQDSKKVIDDKIIEIVQETVKLKDQKGFQDVIKTNPWLR
FT                   QLDWEIKPLRLTKKGVPVKNQKLPGYPEWYRSLFPNKEAELPQITMRSRIIPLFFKLSW
FT                   EDSPVIWTEDCGWCFIKPKSQEKQYKDKNYRLADEATIKNHFEKLVEMGQYKKTDIGND
FT                   LLFKVPHPNGPDNNCTTLLSKPYVHFFEKGILKSESELASIALKMNASGSYWMSARERI
FT                   MSQFVVPKEDFPEQFLPIKVGKDLKPTESSQAIIIPQIIPMGTVTRRAVESTWLTASNA
FT                   KKNRIGSELKAQICAPEGYSFVGADVDSEELWIASLFGDSVLRIHGGTPIGWMCLEGTK
FT                   AEGSDLHTKTAQILSCDRNEAKIFNYGRIYGAGVKFASQLLKKFNPTLSEKEAKETAVK
FT                   LYESTKGKTKRSKVFKKFWYGGSESILFNKLESIAEQDNPMTPVLGCGITNSLMKQNLK
FT                   ANSFLPSRVNWAIQSSGVDYLHLLCCSMNYLISMYNIEARLIISIHDEIRYLVADKDKY
FT                   KLALALQISNLWTRAMFAEQMGIRELPQNCAFFSAIDIDKVLRKEVDLDCVTPSNEIPI
FT                   PFGESIDIVKLLERPECHLELPRETVDLSKFGFKKREPVFVKYNNNYSADFLKYFLKMQ
FT                   IQTTSWKVSKLEEEYIQNQTEKDMTNEDRLEYGFLDYLSDVKKGKRDKLTIMSKAFISD
FT                   ALSSRGLDLDAQLNLDPSKTETIHNITSDDKSRLQAQEDFSLLHDSVSTLEHIDTKSPT
FT                   REKATTISTASLEINTNSKKGRRRTGRLLERKYNKVIGGKNAFDAFYASIDQPKKFVEL
FT                   QEQRIINEVIHDIIEGREDTPTKKPRQSKPKSTTPVPRAKQRTHPFTENLVKGSTHLTK
FT                   "
FT   CDS_pept        521995..522696
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044592"
FT                   /locus_tag="CAGL0E05346g"
FT                   /product="Similar to uniprot|P22203 Saccharomyces
FT                   cerevisiae YOR332w VMA4"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="CAG58840.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG285939"
FT                   /db_xref="HOGENOM:HBG525538"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniParc:UPI00003B62A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV23"
FT                   /transl_table=1
FT                   /translation="MSMITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIK
FT                   KTGIVRAETSAIDSNFSARRKKITLQQQITKSTISNKMRLKALNCREESLNDIFDEAKS
FT                   RLSELVSTGKYRDILVALVVEGMIKLLEPAVVVRLTEKDYKKFGKDSKLIDDIVKSYKD
FT                   TVKGRDIEVSIAEDNFLQENAIGGCIVSDSEGRIEVNNSLTERLHILSQEALPAIRLEI
FT                   FGPSKTRKFFD"
FT   CDS_pept        523128..524498
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348958"
FT                   /gene_name="MRS2"
FT                   /locus_tag="CAGL0E05368g"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter mrs2"
FT                   /function="magnesium ion transmembrane transporter activity"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitochondrial magnesium ion transport "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58841.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0015095"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045016"
FT                   /db_xref="HOGENOM:HBG058873"
FT                   /db_xref="HOGENOM:HBG397594"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI00003B62A5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV22"
FT                   /transl_table=1
FT                   /translation="MRPLVRYRLIPWCLRQAVCQPVSKPIGYRLISTRGGNRSPQGKKT
FT                   IPLLNKPESSNVGAFPSAHQQLLSLKPITPNDSFISSTVFDSKGAIVAVSKKFQKWEFL
FT                   RKHALYPRDLRKIDTSSVDIIPSIQVKPNNCIVLNMLHIKALIEKDRVYVFDTVDPSSA
FT                   VKLGVLMYDLESKLSPKMGTQVQYYEHRALESILINIMSSLEAEFKLHYSICGQILIDL
FT                   ENEVNRDKLRELLIKSKNLTLFYQKSLLIREVLDELLESDDDLASLYLTVKKTEEDDFS
FT                   DLEMLLETYYTQCDEYVQQAESLIQDIKSTEEIVNIILDANRNSLMLLELKITIYTLGF
FT                   TVATLVPAFYGMNLKNFIEESYLGFGAVVVFSILSAYLVTRANFKALKSVTKLTMLKSS
FT                   NPSQASYNMKTNSTLRPALARIRGLFKWRKNPDSNGQPIWNKQDRDVIWKWLMDEKK"
FT   transit_peptide 523128..523241
FT                   /gene_name="MRS2"
FT                   /locus_tag="CAGL0E05368g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV22 "
FT   mat_peptide     523242..524495
FT                   /gene_name="MRS2"
FT                   /locus_tag="CAGL0E05368g"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter mrs2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV22 "
FT   CDS_pept        complement(524717..527587)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437728"
FT                   /locus_tag="CAGL0E05390g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58842.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="HOGENOM:HBG347903"
FT                   /db_xref="HOGENOM:HBG354397"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniParc:UPI00003B62A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV21"
FT                   /transl_table=1
FT                   /translation="MTIGDKQKWTAHNVRKTFMDYFEEKNHKYVKSSPVVPFDDPTLLF
FT                   TNAGMNQYKPIFLGTVDPSSDFYTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEM
FT                   LGNWSFGDYFKKEAIDYAWKLLTEVYGIPADRLYVTYFEGDAKQGLEPDTEALDLWKKV
FT                   GVPEDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNQDDPDVLEVWNLV
FT                   FMQFNREQDGSLKSLPAKHIDTGMGFERLVSVLQDVRSNYDTDVFMPLFARIQEITGAR
FT                   PYAGKFGDEDKDNIDTTYRVLADHVRTLVFALADGGVPNNEGRGYVLRRILRRGARFAR
FT                   KYMNYPIGNFFSSLAPTLIDQVKHIFPEVAKDPSFLFEILDEEESSFSKTLDRGERIFE
FT                   KYAAAASQTESKTLDGKQVWRLYDTYGFPVDLTELMAEEQNLKIDGPGFEKAKQESYEA
FT                   SKRGGQKGGDDLIKLNVHSIAELNSENVPKTDDSFKYGNENVEGKILKLHDGEKFVTEI
FT                   SEPGKKYGIILDKTCFYAEQGGQEYDTGKIVIDDKAEFSVENVQLYNGFVFHTGTLSEG
FT                   KLSVDDVIIASYDELRRFPIKNNHTGTHILNYALKETLGNDIDQKGSLVAPEKLRFDFS
FT                   HKKALTIEEVTKVENICNEQIKNNYNVYYKDVPLDLAKSIYSVRAVFGETYPDPVRVVS
FT                   VGKPVDDLLANPSNEEWGKYSIEFCGGTHVKTTGDIKYFVILEESGIAKGIRRIVAVTG
FT                   TEAFEAQRVADQFAADLEAADKLPFSPLKEKKLKELGVKLGQLSISVISKNDLKTKFTK
FT                   IEKVVKDEVKSRAKKEAKLVLDEVKGHFTENPESQFFVKFIDVPANAKAITEAVNYMKT
FT                   SAKDKSMYLITGNDPEGRVAHGCFISDVALEKGIAGQELAGKVSGIIGGKAGGKGNVFQ
FT                   GVGDKPAAINDAINEITTAFKEKLSI"
FT   CDS_pept        528279..532259
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437729"
FT                   /locus_tag="CAGL0E05412g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="UDP-glucose:glycoprotein glucosyltransferase
FT                   activity"
FT                   /biological_process="protein glycosylation"
FT                   /protein_id="CAG58843.1"
FT                   /db_xref="GO:0003980"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="HOGENOM:HBG202918"
FT                   /db_xref="HOGENOM:HBG253266"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="UniParc:UPI00003B62A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV20"
FT                   /transl_table=1
FT                   /translation="MKYWLLLFLQLTVVRSMAVVVNERAQVWTLLSWLGGNKHEILTGL
FT                   YPLVSGVDEQAVGAGKLAQECRDIVKGKYNDPDFAALFYKFAQEYPMGYLNDYGVQPGS
FT                   NFVVLNGENYTEPDKIYYFKSGDLAAQAAVEDATIIDSHDVVIGDATNSDGERLPLVIF
FT                   YGCPDNEDEYEQFSRTLYLEATENKKLRYVWRSTCVPQKSQDENKFPVGITVTGLQTIE
FT                   NVLNSGIELDLPDRVAQPKAKDLENLVVEELEKLDYKLISAISVFFSTTGHNFVETFKY
FT                   AKKLCNSLPLIMPQMLKIKEFDTYINESNKSLKKNNIDHNMLGLYVNGQYLKITQTYIN
FT                   SLLHVLRTELDFITGIHETLKKAIPDVSLQNVKRLMDLFSMSSIPNLSFLQPVKVDTHR
FT                   IQGFSESVIYFNDIEKDIQYEDFSENVEVFFKESKYGILPEFKQNWNELVFVIDFDKIE
FT                   ADVDAREALGGMLRAIQIVQNGYPQRIGLIPFSSSGNKRIIRKIYELKSKKNLEDVVDY
FT                   LQDILELNFGRESNFKKLPDYDHVRKELSINSTSIIINGNIFPFRKNTWNYLVSHVMKK
FT                   DVTYIKEELGKLNKQTADDVDIRGLLHLKSLSKRNTKFIKDYFIEAAYTRVNESFLKEI
FT                   SNRVIQNINDTGHNIIHTITLIDDFNTENALIRLKNIVGVKFNGLKFRVIHTGDIGSSS
FT                   CWNKFYQGKNIVNEVSKIKLNNKCKSSNGVGKYRLPILTKVLPDVSFSELSNGPLLLVN
FT                   GRVSLMNEEDIPTISDIESLLVHESKRTIDLLYNLEEVFPDFSEKTIEPEFIESLSSFM
FT                   TKMFYHGANSIEGSLPFSTETSVPRMNLRSLFVANNITTFRQHADEKPVDITLIVDPVE
FT                   ERSQKFLTLANQVMDLPFVNINLILYCTQNITLVPNNRIYFENMSSTTVLKSGGFEYTL
FT                   DKPWYVRTDEHDKLSGHVLEVHNYAADQMVTIGIVEGERDVCLMLRDSKGNIIDKTTTM
FT                   RTYGFAELTIPNLGDSYVVESCDSRYRVDSYELNAKSDYTPTDRIHWRTNLPNSLFVKV
FT                   SKVKEKKEINPDTETVNFFTTIANHEEEEQMKETMLKIIATTGERPVTFYIWDEPSITE
FT                   SFRDYGRLLNKLLPGREIHVEFVKYEWPPWLRPQRFRQKRLAISKLLFLDLLFPSNVSK
FT                   VLLIGPNMDTYNLTSVYDMTLKRAIAMPKAQGKGYWSEGHWAEKIQKHSLVFHSVEPFI
FT                   LVDLDVLRSLGGGDYLRIHYQQVSADIKSLEVIDQDLLNDIQIEMPIRTLRKSALKTVE
FT                   VSTREMKKLKSKLIALENDPIDVPESKSKGEDEEQQYFDDEL"
FT   CDS_pept        532814..535264
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501119"
FT                   /locus_tag="CAGL0E05434g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58844.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059911"
FT                   /db_xref="HOGENOM:HBG202920"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B62A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV19"
FT                   /transl_table=1
FT                   /translation="MEESRVHSDIKTSSSYEHSLFDINVVPVNPVPGRKRKVNDGHDDK
FT                   SANGSEQTSGNPSRESSANVTSRPTKKRLACSNCRRRRKKCDLQYPCFTCDKLGLECNI
FT                   NEEDLRKKRYTNTYVKSLEDHIAHLEKCMRSLVEVYAPGRRDDILNAMKMGDLIPDISQ
FT                   VVRNTSPVPVKIEQQHKMSQTPTVGIFRDASSSVIAPSSEIKRPSSATPSTTSNGDKPS
FT                   KTFVKGSIYSDSVNSKGKSNSQPNSSVSVASLLSNNSSPITNVESKERISDLKTTVIVR
FT                   NKVYDGVEADTLPANPNIIKALSNFYKWLYPGHFVFVHRESFLYGFFVHANDNYKNSQY
FT                   CSEELIYAMSAIGSRLSPEIMHLSESYYEKSKKALLDIVFDEKSVPRITTVQALFCLAF
FT                   YELGKGNMQMAWYFSGLAIRVGYAMGFQLDPKVWHVDDDTDEKLTQSELEIRSRIYWGC
FT                   YIADHFICLMLGRNSTLSVSNSTIPESDELPEIEGTEEFKFVGRHVLQVSLPLKNLIVL
FT                   SRIVQVFTSKIFIESETLEEKLEFLKKFNTQVDYWKHSLPEFLQWTNDTLKDEDITTDP
FT                   TISYFWYYYYIVQMTFIKPFIEQSEESCQLIESLLDQLEILLGNFEKKMGSFKKATLFQ
FT                   VYACLLASSSLKSILAVQTSSDEKKRFQLGKSVVQFKQQKKFFDDILQNHLSKVYELAL
FT                   ATHEDQDIDQFSFETGPTLYPLNQVNNDVNYAHDFSLSNEIDDLIRDFFSIEQIDTMEP
FT                   QLGVPSTRRATVIPSKTQVPEPEMVPSQGHHTESPQPRKLQLDQDQNGPPKRYLGSLFM
FT                   HTKR"
FT   CDS_pept        536135..537091
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195741"
FT                   /locus_tag="CAGL0E05456g"
FT                   /product="Similarities with uniprot|Q99326 Saccharomyces
FT                   cerevisiae YOR338w"
FT                   /protein_id="CAG58845.1"
FT                   /db_xref="HOGENOM:HBG189963"
FT                   /db_xref="HOGENOM:HBG203623"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00003B62A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV18"
FT                   /transl_table=1
FT                   /translation="MVLSPRPEQAQLHVALKTPLISWSAHSMIDEEMDSIPSPPQSPRW
FT                   GSYRGYAAPVPVSGTKPRSAILVAPLVCKDTDIVVETTLGFLSQYRHFNNTRSTPVHSE
FT                   PNVRATRSNNTATHPVSKPSEQRTSRRRVPRKNYKLQLEDELDSFVAKSTKQKVRKSVT
FT                   PVRSHARSNNHSTLPSSPIASANALNGASQYEANMSWAKLVDYSPPLSTLPPNNNKSLR
FT                   IEWKGSPMDLSNDPLKDKLHPAELVLAEILRLPCDLYLDSKRRFFLEKVHKLKKGLPFR
FT                   RTDAQKACRIDVNKASRLYAAFEKVHWLDDSNFEKFL"
FT   CDS_pept        complement(537663..538577)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437730"
FT                   /locus_tag="CAGL0E05478g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="CAG58846.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG397872"
FT                   /db_xref="HOGENOM:HBG435531"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="UniParc:UPI00003B62AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV17"
FT                   /transl_table=1
FT                   /translation="MAQLKRSAEEIKKIKFIKRHKSQVKNPLDPKDGVSNCILKVPVAL
FT                   YVSLAPMYLKEPTNGIMKQHLDPMIMKYNSKVGGVVLGYDNLEIIDADPLNPSDAEEKL
FT                   IKITPDTPFGYTWCHTDLYIWKPQVGDILEGHIFIQSASHIGILIHDAFNASIKKNNIP
FT                   NDWSFIHNEDEEQEEQQDDENNKNNYNNRSIGHWVNANGETIDGKIKFRVRSVYTTGRV
FT                   ISVDGTLLDDPSIWGQGQSRSPAEKLPVVSNKKIIFDDEVSAENKETHQELEIPEPNEN
FT                   KEGEILYEENSSESSSDDSSDSE"
FT   CDS_pept        539213..544144
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437731"
FT                   /locus_tag="CAGL0E05500g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58847.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG024264"
FT                   /db_xref="HOGENOM:HBG598940"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="UniParc:UPI00003B62AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV16"
FT                   /transl_table=1
FT                   /translation="MDISKPVGSEISSVDFGILTSADIRNLSAKRITNPTVLDNLGHPI
FT                   SGGLYDLALGAFLRNLCGTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLF
FT                   CHHFKLKSLDVHRYACKLRLLQYGLIDESYQVDSIQLDNVLDSMEAVEDDGEGENKNDM
FT                   SATLSKELKQKRKEFVDISIAKAISEGRTSERGTFTATVNDERKKLLHEFHKRLLMRPK
FT                   CDNCGMYSPKFRKDGFTKIFETALNEKQLTNNRVRGFVRRDMLKKKEQSDKLAGKETSE
FT                   DSFDIGRNPSTRPKTGSTYVLSTEIRNILRSVFQKEQQVLQYVFHSKPNLSRKLVKADM
FT                   FFMDVLVVPPTRFRLPSKLGDEVHENSQNQLLSKILTTSLLIRDLNDELSTLQKDKVSL
FT                   EDRRIIFSRLMNAFVTIQNDVNSFIDSTKAQGNTGGKVPIPGVKQALEKKEGLFRKHMM
FT                   GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAIINGPDKWP
FT                   GASQIQNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVYRHIKNRDIVLMN
FT                   RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN
FT                   LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHAT
FT                   RAKLVTLPPAIHKPIPLWTGKQIITTVLLNVTPPDMPGINLKSSNKIKNEYWGKHSEEN
FT                   DVIFKDGQLLCGILDKSQYGASKYGIVHSLHEVYGPETAAKVLSVLGRLFTNYIMNTAF
FT                   TCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTPSNDPELLKRLEEILRD
FT                   NNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQAMALSGAKGSNVNVSQIM
FT                   CLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYFHCMAGR
FT                   EGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYGGDAVDVIKESH
FT                   MTEFNFCLDNYDALLKKYNPSALVEHVDVETALKYSKKTLKNRKKHKDEKHYKQTLKYD
FT                   PVLSKYNPAKYLGAVSENFQDKLELFLDKSSKTFKEYESINEKKFRALMQLKYMRSLIN
FT                   PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMT
FT                   LPIWNDVSDETADTFCKSISKVILSEVIDKVTVTETAGSSRSYVINMKFFDESEYNEEY
FT                   DVSKQELQTVIAEKFLRSLEAIIVKEIKKQKKVSSSDIGMAVPKAQTTMGAVEGSSKKM
FT                   DEDNDEEQYHNKTKQAVSYDEPDEDEIETMKEAEKSSDEELDSDMESKSESSDSEDDDE
FT                   DVNMDEFESHIAEANNNMSKDQRDRQSAIITNHKFVTKYNFDDKSGKWCEFKLELAADT
FT                   EKLLMVNIVEDICRKTIIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVD
FT                   GITSNDIASVLQTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAF
FT                   NRQGMETSTSSLMKMSYETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL
FT                   SKVSN"
FT   CDS_pept        complement(545500..546432)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348959"
FT                   /locus_tag="CAGL0E05522g"
FT                   /product="Similar to uniprot|Q12182 Saccharomyces
FT                   cerevisiae YOR342c"
FT                   /protein_id="CAG58848.1"
FT                   /db_xref="HOGENOM:HBG124509"
FT                   /db_xref="UniParc:UPI00003B62AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV15"
FT                   /transl_table=1
FT                   /translation="MEYVPPQQLDSNIFFGSLATLTEPHTLQQRNIRFFIGVGISNHVF
FT                   ANAYEMLSKPYNDELVMVNFEDEMMMTQDYNTTFNDETNELISKYHRNNTQLLQQLLDG
FT                   KNNTLGSNIHDLLTPPVTPISSSRSGRYSYLDEDVIPNSTLGTKVHSNTFRKSHLEKFK
FT                   VFNELISLFKSMESNNNILILSEFGNDYELMTLLISIIMKKDPSVSVMDALQFVKSSRY
FT                   SDEPIVKEEQIIWSSGLINYHEFVRASGMFWGLGSTMGQKLGSPTRMNKKNRVNEEAMH
FT                   DGIISPSAKPATADGCLQRKIASCKRVRI"
FT   tRNA            547230..547302
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        complement(548237..548965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437732"
FT                   /locus_tag="CAGL0E05566g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58849.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124510"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B62AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV14"
FT                   /transl_table=1
FT                   /translation="MATKIEQHDLDNWVNTTNEKYPFSTSESSTSLATSGSPWFEPLEN
FT                   IISSNSSSSVTSPSDSNNFLLTENGYDNIFAFNENDKDFQLKTEDDDDQLVSFEAAMES
FT                   MPATCKKQKKKAPRKRLTQNQKEAHNKIEKRYRININSKLAKLQQIIPWVASEQSTFEV
FT                   ADGNKRATSKTEEGDDAFANFPSTTPKLNKSMILEKAVDYILYLQNNEKLFEMEVHRLK
FT                   SELGAVKKENQELKQLATGN"
FT   CDS_pept        551061..553724
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195742"
FT                   /locus_tag="CAGL0E05588g"
FT                   /product="Similar to uniprot|P12689 Saccharomyces
FT                   cerevisiae YOR346w REV1 DNA repair protein "
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /function="magnesium ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58850.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG058877"
FT                   /db_xref="HOGENOM:HBG202923"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012112"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI00003B62AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV13"
FT                   /transl_table=1
FT                   /translation="MDDDLDRLLEDENITEHETNTVSTPPPADNKSPQAPNKRQAYTRG
FT                   TYFYEKARNQAQQDAILKRQLFELESPSEFNRHEVYPQIFQGLVLYINGFTTPGRFELH
FT                   QMIVVHGGKFLHHMSAKRSVTHIIASNLPLKKRIEFANYKVVKPNWIVDSIQQKKLLPW
FT                   RDYALIDTLDPDQQKLDLPLKEPTSKETATSNRNRQSGPLVSCKDPNFISDYFKHSRLH
FT                   HLSTWKTDLRAKFLKDFIENNTALRKPVKDVDTYTVFHIDFDCFFATVAYLTKDPSIKC
FT                   DIEKDVIVVCHGSNNSDIASCNYVARGYGIKNGMWVGHAKRLLPQGVNIVTLPYNFDEI
FT                   QAKSEIFYKTLAAMKLFDMILPISIDEAICVVVNTHPISQESANTDGGSQSSNLDQLCK
FT                   DIRLSIFSATNGCSVSIGCADSLLLARLALRKGKPNGYFIIDREQVQGSKDGSNEFLAT
FT                   FKLKDLPGVGHSIVTKLLTAFKCKDMNLAELKQRASLEFLKNCVGVKLGTKIYLALQGQ
FT                   DDEESTRMLFDPENYFERKSLSIEINWGIRFDNIHEIDDFIDRCCDYLLNKLNELERKT
FT                   SQLTLKVMRRAANAPVDPPKYMGMGRCDAFNRTSRLGIPTNEHGTIATEAKAMYRSLAC
FT                   PAKELRGLSIQFNKLSKLDESLSNVRSNLFDLLQKTPKMDLSPTRSPIDFDSIEKRSPP
FT                   KSLKKLNDIYSNKYDIPSTYEAQFMEALPTQLRAEVRNELKIKRKVEDMKVTDLKKKRK
FT                   LTEEKERNKYNHFLGKFSIFDPIKFQGQPKFKDICSLVKEWVHSTLKEAGPHDRDVQLF
FT                   EKYSKKLCNTNRAHFLCRLAHIISMELDLMEDESQNSEGFQEWESILLKRIIPLLNQNK
FT                   HTFQTERKLDIEFDFT"
FT   CDS_pept        complement(553946..555472)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437733"
FT                   /gene_name="PYK2"
FT                   /locus_tag="CAGL0E05610g"
FT                   /product="Pyruvate kinase 2"
FT                   /EC_number="2.7.1.40"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG58851.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG378296"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI00003B62AF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV12"
FT                   /transl_table=1
FT                   /translation="MDSRLHRLINLEVTPGKDVRKTAIIGTIGPKTNNVDTLVALRKAG
FT                   LNIVRMNFSHGSYEYHQSVIDNARKSEQVYPGRPLAIALDTKGPEIRTGTNVDDVDYPI
FT                   PPNHEMIFTTDDKYAKACDDKIMYVDYKNITKVIQPGKVIYVDDGVLSFEVLEVVDDKT
FT                   LKVKSLNAGKISSHKGVNLPGTDVDLPALSEKDKEDLRFGVKNGVHMIFASFIRTAQDV
FT                   LTIREVLGEEGKDIKVIVKIENQQGVNNFDEILEVAHGVMVARGDLGIEIPAPQVLAVQ
FT                   KKLIAKCNLAGKPVICATQMLESMTFNPRPTRAEVSDVGNAILDGADCVMLSGETAKGN
FT                   YPINAVTTMAETAIIAERAIAYMPLYDDLRNCTPKPTSTTETVAASAVAAVQEQGAKLI
FT                   LVLSTSGNTARLVSKYRPQCPIVLVTRNPRTARFSHLFRGVFPFVYEKEPLDDWSEDTH
FT                   ARLRFGVDMAKEYGFVKNGDAVISIQGFKGGVGHSNTMRVSIVGGEKEDI"
FT   CDS_pept        complement(556856..558652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044593"
FT                   /locus_tag="CAGL0E05632g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58852.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B62B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV11"
FT                   /transl_table=1
FT                   /translation="MFWSKEKEKDAVSVVSLGEEDVQHETITAMGSGGSGSRRGDEKFG
FT                   KMPGDVDVFSLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSST
FT                   LHTCGPAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGF
FT                   ADAWNYYYCYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGES
FT                   EFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGSFLDI
FT                   YTGIIKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVA
FT                   YNDPALENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSR
FT                   SLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVI
FT                   SGFIGWICVCIAYIRFHKAILFHGMQSRLPYTARGMPYLIYWPLLVISIITLTNGYEVF
FT                   IPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEKT
FT                   RECDASRVLPTKWWEKALDALL"
FT   CDS_pept        562625..563611
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501120"
FT                   /locus_tag="CAGL0E05654g"
FT                   /product="Similar to uniprot|Q08959 Saccharomyces
FT                   cerevisiae YPL206c"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG58853.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG059293"
FT                   /db_xref="HOGENOM:HBG512055"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI00003B62B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV10"
FT                   /transl_table=1
FT                   /translation="MQVISHRGYKAKFPENTLLGFENAYKAGADAIETDVQVTKDGVMV
FT                   INHDASTGRLYNKDLTIVDSTLEELKKLRTINGDQQILTLEELLHWLLEHRDTKLLLDV
FT                   KPLLPKIAMVKIYTMMLRVSEDVSFWHEHVMWGLWSVDWVEYGVETGVLKHFDVVAITL
FT                   SLDVARKFVDFFKELEDDNYNLLSISVHFVSTWTEQFRFEILPILKRERIQLFVWTVNN
FT                   IIDVKYLNQYSVDPQMIGIVTDDPQEAKEVLVPAFKPLPTTEKKSDFVAFKAPKWTTKD
FT                   GFRFHSYLIIYQFVTALLFSSWFRKEFVPGYSIASLMFMFLRSIHFI"
FT   CDS_pept        complement(564034..566436)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501121"
FT                   /locus_tag="CAGL0E05676g"
FT                   /product="Similar to uniprot|Q08960 Saccharomyces
FT                   cerevisiae YPL207w"
FT                   /function="FMN binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG58854.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG265454"
FT                   /db_xref="HOGENOM:HBG628142"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="UniParc:UPI00003B62B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV09"
FT                   /transl_table=1
FT                   /translation="MDSTELTIGGLLVVGSAIFLTFFSGRITVLLVAVVGFCIFVNERH
FT                   NHASSNTGASEIAATLSEKTVEEVLPLPKKKKCCGGGVGGKCCSETKKEGDHSDGGSCC
FT                   SSKKKLVEPLLQKLKEEKPASATEEPSYPISVDFTEAFKSTSKKSKKVPKIIVGVNKKK
FT                   ESEEDIVKSALTVSNEKLLSSQIYVFYSSLQGAAERVARTVYEDLKNVKDLNNEPILMN
FT                   LDELNDIDEYFVDVPVDNALYILVVPSYDTDCPLDYFLQTLEENYHDHRVDRLPLKKLM
FT                   GYAVLGIGDKESWPDKFCYQAINVDHWIAKLGGRRIFPVGEVCMKTDGMQGVDKWTNLL
FT                   ADTLEDDEPIIYQYDNDAESDYEEDEEQIDFDSDTDVQDVEDIGGKQQSKGDYGMEVKQ
FT                   MVAKNSPTYNNLTKQGYRIIGSHSGVKICRWTKNELRGKGSCYKKSLFNIASSRCMELT
FT                   PSLACSSKCVFCWRHGTNPVSKNWRWDVDEPEYILENALQNHYSMIKQLRGVPGVIAER
FT                   FADAFKVRHCALSLVGEPILYPYINRFVELLHQNDITSFLVCNAQHPEPLRNIGKVTQL
FT                   YVSIDAPTKQELKKVDRPLYKDFWERMLECLDILREVQYHQRTVFRLTLVKGFNMGDIT
FT                   SYADLVARGLPCFIEVKGATFSGSSDGNGNPLTMQNIPFYEECVNFVKEFTKELQRRGL
FT                   GYEVAAEHAHSNCILIANTKFKVNGEWYTHIDFDKFFSLLKDTERKEQFTYMDYMAKTP
FT                   EWALFGNGGFAPGNVREIRKEKKKKNREEREKALKEAQAALEVQQDA"
FT   CDS_pept        complement(567169..568968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044594"
FT                   /locus_tag="CAGL0E05698g"
FT                   /product="Similar to uniprot|Q08961 Saccharomyces
FT                   cerevisiae YPL208w"
FT                   /protein_id="CAG58855.1"
FT                   /db_xref="HOGENOM:HBG059290"
FT                   /db_xref="HOGENOM:HBG204035"
FT                   /db_xref="InterPro:IPR017119"
FT                   /db_xref="UniParc:UPI00003B62B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV08"
FT                   /transl_table=1
FT                   /translation="MDNFAVMDELLLWGHKIGCKWPLELEFKYDKMKGIYAVCKQDCVR
FT                   PVIEVPSDAIITNKLAIEYFTLNANEKSQANSWLKLLFAKMVFDKDPTWVDGVDISKKF
FT                   HPYIQALPKLIHSPLVWNPSELETLLVGTNLGGSVKEKLCSVIKEWIVLIESREDLKSK
FT                   VDGKYLINFENYNDLVYEDIYNIFVKPVEFEFADLVWLSFPAFLYSHLVFTSRAFPEYV
FT                   IDKNANEFSVILLPILDLMNHNYNSKVQWFPKEHQNGTSFCYQCLADMKAGDELDNNYG
FT                   GKGNEELLNGYGFVIDDNIFDTVALRIKLSEEELMDILTNYPDISLPTIDDYTTFAFDL
FT                   ERPIKSRESNGSNIETYKDGILYLINSTNTKPLIDLIGIFSYIRLSRELQDTTQRYDEL
FT                   APFLSGIQMLKVALKQKLNGATSGTVLDEDQIVEMNDFRVHCSKVYRESQIRILKAAIS
FT                   SLKSIEKTQFREQKGRLLTIDKIIKYDTRFYENELTNLFEGQEAVFDSAFDLFVIWIIM
FT                   KSTNGSFIKKYEPIKKSFETFRQQPLSVEEEEALGFHKHILNGKSDIDISTTLYAIEYV
FT                   KRHVITRLNSRGEEDETIFVIPL"
FT   CDS_pept        569265..570341
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437734"
FT                   /gene_name="IPL1"
FT                   /locus_tag="CAGL0E05720g"
FT                   /product="Spindle assembly checkpoint kinase "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="cell cycle"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="CAG58856.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020663"
FT                   /db_xref="UniParc:UPI00003B62B4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV07"
FT                   /transl_table=1
FT                   /translation="MENKATLARNIGEKRVSPRSKVNGTGKSWRISYSPQRMDGVSSGR
FT                   NVSKIPSPVRERLFLKNQERKPLGVSPLSNLSPNSLGRNSLEKSTYNNKLSLKDFEVGR
FT                   KLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDHPNIIKL
FT                   YAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIADALHYMHKKRIIHR
FT                   DVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLSPEMITPREYDEQVDVW
FT                   ALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPESISKDAKDLISKLLVTDTTQRL
FT                   SLTGVKTHPWILKNKPFW"
FT   CDS_pept        570755..572698
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044595"
FT                   /locus_tag="CAGL0E05742g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="7S RNA binding"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="CAG58857.1"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG059288"
FT                   /db_xref="HOGENOM:HBG204034"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="UniParc:UPI00003B62B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV06"
FT                   /transl_table=1
FT                   /translation="MVQKNLTELLSQLNVQSNNSEHVDAAKTCKELIDNGCSKEGEVFR
FT                   QWLVALIKQDKYQAAFDLIKHYKDLDNRHGSEFVLEKLYVYYKLNSVHEFEQVYKTYSE
FT                   HVTNKNQMERGILHIRAQFCYKNGINKEAHEIYEHLSESNKDEADDNSELICNILVPLT
FT                   ADPKLSETWANLKHEITDMLSSEKSYDVLFNYSIILVALKEYELAFKVLDKAHELAVPE
FT                   GYQNDLDTIELQKSYLLQITGQTVQSKEILKPLLDRLVPGSPLQLIANSNYHAFVDYSK
FT                   FTTNFDLLLRQINQERFYSYHLQKYTHEQWKLINNNLLFLNLFNNNQINRKETILAKTL
FT                   HNYKNLIDNVAIEPYKTQAKKLYHFTMQSIDSGINGSAIGNLLLTVQLLVVEKQYDNAI
FT                   RICENFLSKSGYAEKSPKLFDQNHLVVCTILFQLYRMSSRIGNINRLVAILEMLPEEYI
FT                   NDNSSFWIYVAYEALANGNIEKSREILQRLSTDQTNITPEQNELINAVLSSSESAFDEA
FT                   VRLVEDIDVEQIRSAGIRPIAPKSAEKSATSILRAQKKKLDIKKKKKRTARANKFLAKR
FT                   EVVKKNPDPERWLPLKDRSSYRVNKKQAGKTTQGGASSKKIEQALDITKKNTASKSGKG
FT                   KAKPKKKGKGRK"
FT   CDS_pept        573064..574713
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437735"
FT                   /gene_name="PUS1"
FT                   /locus_tag="CAGL0E05764g"
FT                   /product="tRNA pseudouridine synthase 1 "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58858.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG175106"
FT                   /db_xref="HOGENOM:HBG736083"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B62B6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV05"
FT                   /transl_table=1
FT                   /translation="MEEVAPEQVQEVQGNTEAHIDSTTASTAPTEALPSDKQSRKANEI
FT                   DSMADGAPAEKKQKTDQRQIIREPKLDDNGNPIPREPRLPKRKVAVMIGYCGTGYHGMQ
FT                   YNPPNPTIEAALFKAFVDAGAISKANSNDLKKNNFMRAARTDKGVHAGGNLISLKMIIE
FT                   DPEIMDKINANLPEGIRIWDIERVNKAFDCRKMCSSRWYEYLLPTYSLIGPKPGTILNN
FT                   DIESSKTELPGVLDEDLESKEFWENFEAAAKKEFTPEEIAAIKDYSPPPREEFDDQEEL
FT                   YQKVKQWKLLENTHRRQYRISEMKLNKFRAAMNQYLGAHNFHNFTLGKEFKDPSAIRFM
FT                   KEIKVSDPFVIGDAKAEWVSIKIHGQSFMLHQIRKMISMATLIARCGTPVERISQAFGP
FT                   QKINIPKAPALGLLLEAPVFESYNKRLEKFGYKPIDFSKYQEKVDAFKMKHIYDKIYAE
FT                   EVSDNVFNAFFSYIDSFNKVTGAQTEESAESNKPATKSIFEFLSAHGIPGIDYGKNEKE
FT                   DSNKESSNDQVNKESAPATSKPAEAVEQTEKN"
FT   CDS_pept        complement(574930..575730)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437736"
FT                   /gene_name="LEA1"
FT                   /locus_tag="CAGL0E05786g"
FT                   /product="U2 small nuclear ribonucleoprotein A' "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG58859.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059285"
FT                   /db_xref="HOGENOM:HBG204032"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI00003B62B7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FV04"
FT                   /transl_table=1
FT                   /translation="MKFTPGAVEDAPSYYVDHDNGKYNTQKCVILRNLGLEGDDIAMPA
FT                   SLNHLAKPTHILDLTNNDLVFFPDLHHRDDIETLLLSKNRLMVLDAALLPSKLKSLSLA
FT                   FNGIENFETLIPLSHCPSTVRDLVLIGNPICHLSEYRQRILALVPSLEVLDFKLVSQAE
FT                   KAQAVKDHVAVMKKIKEDNRQIHQRKKKALAAEVDGKNTFGRNTKSLTEAAKVTKPRDK
FT                   TIEVMNTVVGKLTEEKKKKIREQLANASSMEELERLERLLTGGV"
FT   CDS_pept        576899..578521
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044596"
FT                   /locus_tag="CAGL0E05808g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="hydroxyethylthiazole kinase activity "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAG58860.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004417"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG052912"
FT                   /db_xref="HOGENOM:HBG326763"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="PDB:3NL2"
FT                   /db_xref="PDB:3NL3"
FT                   /db_xref="PDB:3NL5"
FT                   /db_xref="PDB:3NL6"
FT                   /db_xref="PDB:3NM1"
FT                   /db_xref="PDB:3NM3"
FT                   /db_xref="UniParc:UPI00003B62B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV03"
FT                   /transl_table=1
FT                   /translation="MKFSKEQFDYSLYLVTDSGMIPEGKTLYGQVEAGLQNGVTLVQIR
FT                   EKDADTKFFIEEALQIKELCHAHNVPLIINDRIDVAMAIGADGIHVGQDDMPIPMIRKL
FT                   VGPDMVIGWSVGFPEEVDELSKMGPDMVDYIGVGTLFPTLTKKNPKKAPMGTAGAIRVL
FT                   DALERNNAHWCRTVGIGGLHPDNIERVLYQCVSSNGKRSLDGICVVSDIIASLDAAKST
FT                   KILRGLIDKTDYKFVNIGLSTKNSLTTTDEIQSIISNTLKARPLVQHITNKVHQNFGAN
FT                   VTLALGSSPIMSEIQSEVNDLAAIPHATLLLNTGSVAPPEMLKAAIRAYNDVKRPIVFD
FT                   PVGYSATETRLLLNNKLLTFGQFSCIKGNSSEILGLAELNKERMKGVDASSGISNELLI
FT                   QATKIVAFKYKTVAVCTGEFDFIADGTIEGKYSLSKGTNGTSVEDIPCVAVEAGPIEIM
FT                   GDITASGCSLGSTIACMIGGQPSEGNLFHAVVAGVMLYKAAGKIASEKCNGSGSFQVEL
FT                   IDALYRLTRENTPVTWAPKLTHT"
FT   CDS_pept        complement(578837..579790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348960"
FT                   /locus_tag="CAGL0E05830g"
FT                   /product="Similar to uniprot|P21560 Saccharomyces
FT                   cerevisiae YPL215w CBP3"
FT                   /protein_id="CAG58861.1"
FT                   /db_xref="HOGENOM:HBG059284"
FT                   /db_xref="HOGENOM:HBG397577"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniParc:UPI00003B62B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV02"
FT                   /transl_table=1
FT                   /translation="MSLYRAGWRRALLQANGNSMMHIHSRSLLHTTRLVQQSVEESGKS
FT                   TGIKHKNIRAHKLAHSKYEDKSYQLPKWKEALGEFVVRTFKLDMDKVRAGPVAGSYYYN
FT                   LCKQQGLQYEDEELSETAKFFYEELGLPRTFSQWFQITVLHEWILFVRMRAMPFQYGRN
FT                   YQQKLVDRTFSDIEVRLFEEMNVNSGRIADQYMKDFNAQLRGAVFAYDEGFFTDDATLA
FT                   KAIWRNLYAGKPNVDITHLEKLVKYVRGQLYVLSQLSDREFAMGQFKFVSPNEIVEKLT
FT                   PEQEQLRKEKVIEKYEKMDKDPHQLPSDKSNLSYTN"
FT   CDS_pept        580757..584269
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195743"
FT                   /locus_tag="CAGL0E05874g"
FT                   /product="Similar to uniprot|Q08965 Saccharomyces
FT                   cerevisiae YPL217c BMS1"
FT                   /function="ATP binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58863.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG330916"
FT                   /db_xref="HOGENOM:HBG350173"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI00003B62BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FV00"
FT                   /transl_table=1
FT                   /translation="MEQTNKEHRKSKEKNTAKKKLHTQGHNAKAFAVSAPGKMARTMQR
FT                   SSDVNERKLHVPMVDRTPDDDPPPVIVSVVGPPGTGKTTLIKSLVRRMTKTTLSEINGP
FT                   VTVVSGKHRRLTFLECPADDLNSMIDVAKISDLVLLMIDGNFGFEMETMEFLNLAQHHG
FT                   MPRVLGVATHLDLFKSQSTLRASKKRLKHRFWTEVYQGAKLFYLSGVLNGRYPDREILN
FT                   LSRFISVMKFRPLKWRNEHPYMLADRITDLTHPDLIERKGKKVDRKVALYGYLHGTQLS
FT                   SVPGQRVHVAGVGDLTVAQVEKLPDPCPTPYYQQKLDEYEREKMKEEAAATGQITSTTT
FT                   RRRKRLDDKDKLIYAPMSDVGGLLMDKDAVYIDVGKKKDSLSFVPGQEKGEGEKMVTSL
FT                   QQTDKTIAEKFEGVGLQLFSNSTELHGVEEEEEEENDDDNMDEEMSDNENGVQDQGRTS
FT                   LRAPRLYGKSIQQKDDEIDNLPSDDELEENEDAEPKLVEIDFDEKSHTKEKLALDSDSE
FT                   FELSDDDSWERKAAGKLNGTIQKKRVWDIGKLIYMDNITPDECIKRWKNEDTSDDEEED
FT                   IEADEDEEFFKKAEAKEQTSAEADLEKFVPYFEKIEKLVTKWSSFDAISDRFVGAPQLD
FT                   GKKNSTDSANGDDDEEEVYGDFEDLEADGDSDKEKSDENNEEEVESDGSFTNFDAEEKK
FT                   ELTIEEERQLNAAKKEKLRTQFEMEEGENFKEDDPDNEFDTWYELQKAKIAKQLEINEK
FT                   ELQDMTPEQRLRIEGYKAGSYVRVVFEDVPMEFIESFNPRFPVIMGGLLPTEQKFGIVN
FT                   ARLRRHRWHKKILKTHDPLVMSLGWRRFQTLPVYTTSDSRTRIRMLKYTPEHTYCNAYF
FT                   YGPLCSPNTPFCGVQIVANSDTTGNFRISATGVVEEIDVDVEIVKKLKLVGFPYKIFKN
FT                   TAFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPDGHFRAAFEDKILMSDIVIL
FT                   RSWYPVKVKRFYNPVTSLLLSNKTEWKGVRLTGQIRAAEGVATPVNPDSNYKKIERVER
FT                   HFNGLKVPKTIQKDLPFKSQIHQMKPQKKKTYMAKRAVILGGDEKKARSFVQKVLTVSK
FT                   AKEEKRQSKKSDQRKERLKKLAKLEEEKSQKDKEKKKEFFSKYGKKRSNANDDGDFKAK
FT                   KSRK"
FT   CDS_pept        join(complement(585415..585439),complement(584585..585129))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437737"
FT                   /gene_name="SAR1"
FT                   /locus_tag="CAGL0E05896g"
FT                   /product="Small COPII coat GTPase SAR1 "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG58864.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1M2O"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI00003B62BC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUZ9"
FT                   /transl_table=1
FT                   /translation="MVWDVFGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKND
FT                   RLATLQPTWHPTSEELAIGNIKFTTFDLGGHVQARRLWKDYFPEVNGIVFLVDSADPDR
FT                   FDEARVELDALFNITELKDVPFVILGNKIDAANAVSEAELRSALGLLNTTGSQRIEGQR
FT                   PVEVFMCSVVMRNGYLEAFQWLSQYI"
FT   CDS_pept        complement(585960..587405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501122"
FT                   /locus_tag="CAGL0E05918g"
FT                   /product="Similar to uniprot|Q08966 Saccharomyces
FT                   cerevisiae YPL219w PCL8"
FT                   /protein_id="CAG58865.1"
FT                   /db_xref="HOGENOM:HBG124888"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI00003B62BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ8"
FT                   /transl_table=1
FT                   /translation="MTVQEDVDKDDGEGGDSHPDGFSDNFGKDHKGMGFGDYLMYSQED
FT                   SLFELPIKTGYNLNFSELNDSLPASNVPQLSQPSKKVRFENDEIEHDGNGSATSVSRDM
FT                   DGSNGDNEDGVNTSQDDDLELSPKASANGKPREDIENLIQKASVFNEVLGENLAKLNTL
FT                   SSDGLPSRVMSRMGSEMSTARSDSMSCFALSDSEGDGELMLDSGHSGSDPFTHSNILSQ
FT                   INGEYSEDDGVLLLSPYQSSTMYNNFIDTEIGPASSTERVNEEQFFEISPPENFQAGGN
FT                   KTSDIVHDNTCVLLSKYQHNNEIFEYSVEDTMHNYTETLDILLRLSENENMISEKADNN
FT                   ENYHYFSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTREYNDGPLRLKH
FT                   KLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELALIFCLKDNNL
FT                   LINSEKLSATACILEELKAQESQ"
FT   CDS_pept        complement(588450..590972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437738"
FT                   /locus_tag="CAGL0E05940g"
FT                   /product="Similar to uniprot|Q08967 Saccharomyces
FT                   cerevisiae YPL221w BOP1"
FT                   /protein_id="CAG58866.1"
FT                   /db_xref="HOGENOM:HBG058898"
FT                   /db_xref="HOGENOM:HBG396900"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI00003B62BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ7"
FT                   /transl_table=1
FT                   /translation="MLLSHTLWCVFMLLMRFSNLVEARRKLTATSLVTCMENSQLSARS
FT                   FDVVFDPDDRSLHYTLDMSTQIDGYIFAYVDVYAYGFKVITKSFDVCSMNWKQFCPVHP
FT                   GNIQIDSIQYISQEYVNMIPGITYQVPDIDAFVKLYIYNDQNDILACIQVFFSNGKTVS
FT                   QTGVKWVFAVIAGIGLLLSATLSTFGNSVAASHISANTMSLFLYFQSVAVVAMQHVHSV
FT                   PPIAAAWSENMAWSMGLIRVSFMQKIFRWYVQSTGGTPTLYLTATTMSVLTQRAIDYVR
FT                   NLEYVKRAENILYGNQNTLIFRGIKRMGYRMNIENTSIVCTGFTFFVLCGYVLAAFIIV
FT                   CKYSLELSIRNGWIKADRFQAFRINWKVLLKGAMLRYIYIGFTQLTILSFWEFTERDSG
FT                   AVIVIACLFLILSIGLMVWASYRTTYFARKSVQKYNNPAALLYGDDYVLDKYGFFYSMF
FT                   SANFYWWNNILLGYVFIKSLFIGFAQASGKTQALSIFILDLFYFVAIIRYKPYLDRPTN
FT                   IMNIVICLVTVINSFLFMFFSDLFNQKYAVSAIMGWVFFIMNAAFSFILLMMILAFAYM
FT                   IAFTKSPDTRFRRANDDRAAFQKKNAAYHGDVLERSGSKMKNSATADLWALGNMAGDHE
FT                   ANWEANANVKKNRLSNIFLGPDEDYDDEEEFANQTFTQRVIRKLSMKRGKSKRSNRPEI
FT                   ERRYSDGTSTNGSSANKSEPKVLEGELSKDEEDINFVNHLVTPRSSYSSGGSPVRRSYI
FT                   GLEGNSSHDIQARENLMSARDESQRFSDLTDITGPRMDPFRDNNSNTVRYSNGALGPPR
FT                   DISLDSIPYANQEATNSTDILDQSGKYL"
FT   CDS_pept        complement(592576..594522)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000008335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437739"
FT                   /locus_tag="CAGL0E05962g"
FT                   /product="Similar to uniprot|Q08968 Saccharomyces
FT                   cerevisiae YPL222w"
FT                   /protein_id="CAG58867.1"
FT                   /db_xref="HOGENOM:HBG111346"
FT                   /db_xref="HOGENOM:HBG683993"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniParc:UPI00003B62BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ6"
FT                   /transl_table=1
FT                   /translation="MVDGGKTLVEALKNPLLSSSRLIKLLRADSKVPTVDAAIKLIETH
FT                   GPIHESFHTPRHVDKGAHFAYSIPQNRTGYSPLLVNEKALKDMNIIRDQELTKILDGET
FT                   LYYDESRAIFPYSTNYAGFQFGQFAGQLGDGRVVNLFDLKDKSGEWQTLQIKGSGLTPF
FT                   SRFADGKAVLRSSIREYIISESLHAIGIPSTRSLQLTLLPTTKAQRGGTVEPCANYCRF
FT                   APTWLRLGHFDIYRWKFDIQSMAKLSDYVIEEVFHNNIEQEDLNEYTIDYFPDEPGQPN
FT                   PECTAIDSKSTTKYDLMFRKIVNLNAECVAYWQAYGFLNGVLNTDNTSILGLSIDFGPF
FT                   SFMDQFDPQYTPNHDDSMRRYCFANQPGIVWWNLLQFGQAISVLLGSGKYNLPTVLKAK
FT                   DIGDIDKGTQRQLLDRVNSLIHLCGNEYKYRFTSKYVELMAKRLGVDVDAVIPEGDKQT
FT                   RAKHINIFLKETIEPLLEVLQYTKVDYNNFFYKLEEYNGSQHVNNDSLDDFMGLNPHYV
FT                   RLFFSAEEFALLGRYYCGEHTMNSDVKAALEYLQKIKQWTTTLGKLPRSNAKHVNPKFI
FT                   PRSWMFEEVIDDLTLQLRDGHKPDLSALQKLSNMSTNPYDPAQWDQTRPDLQERWLQEQ
FT                   HPSKLMKQASCSS"
FT   CDS_pept        595299..595727
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437740"
FT                   /locus_tag="CAGL0E05984g"
FT                   /product="Similar to uniprot|Q08969 Saccharomyces
FT                   cerevisiae YPL223c GRE1"
FT                   /protein_id="CAG58868.1"
FT                   /db_xref="HOGENOM:HBG124512"
FT                   /db_xref="UniParc:UPI00003B62C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ5"
FT                   /transl_table=1
FT                   /translation="MSNLLNKISDKLHGNDDKEESNSSMSYNTSSNKNLDRDDYESGQS
FT                   YGFNDSNNYDTNARSHEGYGQGGSNTMPSKHGDTYYNPNERTNDFSETRGMSGTTNLDT
FT                   DDWGEDVEADVIDSKRYNKGSGAFPSYNSGNMNQNDEY"
FT   CDS_pept        596376..597611
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437741"
FT                   /locus_tag="CAGL0E06006g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58869.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG395980"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00003B62C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ4"
FT                   /transl_table=1
FT                   /translation="MSMIRARLTLNKRLNATLICQPYKRLLHSSRAIAHQHKDQEQIPD
FT                   HEHNHDPTIEEHGLKSMLSHSHSHGHSHSHSGENAFLTLSKDNVLTNPGVRITWIGLGS
FT                   NVLMAVGKFFGGIAFHSQALLADSVHAMSDLVSDFLTLFSVSLSSKKSNDMYPYGYGKV
FT                   ETVGSLAVSTILAGAGVSIGWSSLCAIVGPIVPHTIIESLHNIFGSMIDFSGSHSHSHT
FT                   SATDVNAAWIAGGSIIMKEWIFQATKRVAIKTNSNVLMANAWHHRIDSLTSLVALVAIS
FT                   SSYFFGIQSLDSLGGLLVSVLIIKAGGEGMVSSVKELTDQSLSKKDERYLEIESILKKQ
FT                   IPLLDRGNLELDRLVVMPSGPKMRAITTLSVPQDSNISVHDMDNVTAELRKSMLDGVKN
FT                   LSFFDVRYTSKY"
FT   CDS_pept        598020..599018
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437742"
FT                   /locus_tag="CAGL0E06028g"
FT                   /product="Similar to uniprot|P40350 Saccharomyces
FT                   cerevisiae YPL227c ALG5"
FT                   /protein_id="CAG58870.1"
FT                   /db_xref="HOGENOM:HBG534149"
FT                   /db_xref="HOGENOM:HBG752660"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI00003B62C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ3"
FT                   /transl_table=1
FT                   /translation="MALIGEVGILQVAIALGISALVGLYSIIYLFSHNPRQPFAEELRY
FT                   HTFDDKGGIVRFDVDRVNEGDLHLDDILISVVVPAYNETDRIHVMLDDTIKYLRSQFPN
FT                   RWEILIVDDGSKDGTTEYCLKLAAEEYKLQPKELRVIKFIENRGKGGAVRQGLLHIRGK
FT                   YGLFADADGASKFSDISKLIDSIQKLEKSDDEKKPKAAMAIGSRAHMVNTEAVIKRSLL
FT                   RNCLMYGFHTLVYIFGIRSIKDTQCGFKLFNRPAIDLIFPYMHTEGWIFDVEILLLANK
FT                   KAIPVSEIPISWHEVDGSKMALALDSIKMAIDLVVIRMAYILGIYNPYKQC"
FT   CDS_pept        complement(599197..601005)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437743"
FT                   /gene_name="CET1"
FT                   /locus_tag="CAGL0E06050g"
FT                   /product="mRNA-capping enzyme subunit beta "
FT                   /EC_number="3.1.3.33"
FT                   /function="polynucleotide 5'-phosphatase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="CAG58871.1"
FT                   /db_xref="GO:0004651"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="HOGENOM:HBG252766"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="UniParc:UPI00003B62C3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUZ2"
FT                   /transl_table=1
FT                   /translation="MSEHHSKRALSLDDLVNHDENDKSKLQKLADNESSVRSDDNRPGA
FT                   IENIVNGNNSNSDLNSNGVIEEDTDTDDDVGGEFTFDNGITFDYDKQDRFSPEKKRIQA
FT                   RKKDTSKTTPSISNESPSNSKESSVPVDPLSSNISATDRKDSSEEKPDLTGPELVKEPD
FT                   TNEYKRPSIQSITNAEDTTYNDHKAAGMEKTSNKHSLPNILSDSIDETVTEEHKPKTET
FT                   EQTITEYQQENKQKDNVNESNSEETHDIKNDNMNQVEKIFQEKTSTLSKKNSVKKDLEL
FT                   LNEISASSKPNKYKNTPIWAQKWKPTVKALQNIDTNDFKIDNSILDIIPDDDLTKSVQD
FT                   WVYATLYSIDPDLRPFIELEMKFGVLLESKSPDRVNPPVSSQAVYTDMDAHLTPNVDET
FT                   VFKELSKYIQSLSEITENAGKFNVIEAQTKDAVYRVGTSTQRPRFLRMSSDVKTGRIGA
FT                   FIEKRHISQLLIYSPKDSYDVKLSINLELPVPENDPPEKYQHQTPVSERTKERVSYIHN
FT                   DSCTRFDITKVQNHNKGIKSNDVEITHEIELEINTPALIKAFDNIMTDSKEYATLIRTF
FT                   LNNGTIVRRKLSSLSYEIFEGQKKIQ"
FT   CDS_pept        complement(602040..602573)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437744"
FT                   /locus_tag="CAGL0E06072g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58872.1"
FT                   /db_xref="HOGENOM:HBG124513"
FT                   /db_xref="UniParc:UPI00003B62C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ1"
FT                   /transl_table=1
FT                   /translation="MQSLDNEYRVRGFVSPSSTPPGTGMMNSRTVSSSSSVSSDSSNPS
FT                   SAMMLNFYKGSVEDPASILYRNNICKSFEDDLFFCPRSLLSPQEQKKCQEIDSLFTYQQ
FT                   HASSPLLPATLHELSNVPMSPTSSPTAFNTNPMMNFNNMTNKRTASTVHRPMSPRSAKF
FT                   NPYKSQSFNPSDIH"
FT   CDS_pept        603704..603877
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348961"
FT                   /locus_tag="CAGL0E06094g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58873.1"
FT                   /db_xref="HOGENOM:HBG124514"
FT                   /db_xref="UniParc:UPI00003B62C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUZ0"
FT                   /transl_table=1
FT                   /translation="MRANSRTAELVCAQSFPQNSKRARMIAPPKSKTLRTTTPRSSNTH
FT                   TTPLPTDSLQRT"
FT   CDS_pept        complement(604945..606786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437745"
FT                   /locus_tag="CAGL0E06116g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58874.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124515"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B62C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY9"
FT                   /transl_table=1
FT                   /translation="MTNEITGVEKKTAKGRFKKPKEKNFKCTGYPGCEMSFSRAEHLAR
FT                   HIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAKDNVKNNSQHHQIHVNGAKSSNIT
FT                   LKYSDWRPRSGTFSAANGVGNAAAVSRDRNNNFKSRNNNMNGSNEDSMVYHHYDGNGYK
FT                   NGGIDMKSNKQTRKSILKDDKRKRSYSSDNFSTSSSSSSSSPPSSNGDSCFSAGITNKN
FT                   SNGGSSGSSSASSYTNNGKGKHMISSEGNDYVHHKKNHNNSISSGSSSSSSSSNETALN
FT                   KDEKGKLIGSINTNNKTIGNGRDSTFRNAAIGGSSMANLLPNNSNNEGNTRYGKYWSPP
FT                   VMMGPNKYDGSNAENSGFTIYKNFPSERNQRYKESFSRRNWFSEGSQTVAQLPSVVYNG
FT                   RDGQNNDYYSKVAPPLFSGNMNNLPHITDFYKGKSDSAEPYRKSINGRRFSAPYVHDRL
FT                   HLQPNLSKQLSTPGSEEQTRGSAINVQKTMESPPYLIPVNNEPLMVSSFSGQNMSGSNN
FT                   NSMNVHSNGCGPLSGAPSTMITTTATVTPQDGQQVDPAQTLNENEDIVMKDHVQRDELQ
FT                   MAKPVIIKNNNGTTFARGNRLPPLQSFSRTDTMSNPY"
FT   CDS_pept        complement(611835..617486)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501123"
FT                   /locus_tag="CAGL0E06138g"
FT                   /product="Similar to uniprot|P19097 Saccharomyces
FT                   cerevisiae YPL231w FAS2"
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58875.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053544"
FT                   /db_xref="HOGENOM:HBG325769"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI00003B62C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY8"
FT                   /transl_table=1
FT                   /translation="MVMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVLLKDFNTER
FT                   VVEIGPSPTLAGMAQRTLKNKYESYDAALSLQRQVLCYSKDAREIYYTADPAEIEPKEE
FT                   PKAEEAAAPAPAAAPAATPAPAPVAAPAPAAAAADVPDEPVKASLLLHTLVAHKLKKSL
FT                   DQVPMSKTIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEDTPLEELAETFQDTFSGALG
FT                   KQSTSLLSRMVSSKMPGGFNMTSVRKYLQSRWGLGQGRQDSALLVALSNEPASRLGAEP
FT                   DAKTFLDAQVQKYAQISGLDLSAASSSASAGGAGASASGATIDAAALEEITKDHKVLAR
FT                   QQLQVLARYLKMDLNNGERKFLKEKDTVAELQSQLDYITNELGEFFVNGISTSFSRKKA
FT                   RQFDSSWNWARQSLLSLYFEIIHGVLKNVDREVVTEAINIMNRSNETLIKFMEYHVSKT
FT                   DVSKGENYKLVKELGDQLIENCKQVLDVDPVYKDVSKPTGPKTTIDKNGNIKYSEEPRD
FT                   KIRKFSQYVQEMALGGPLTKEDQPTIQEDLTRVYKAISSQAAEQDVTEATRAEFEKLYS
FT                   DLIQFLKTSKEIDAQQTTQLAGIVDDALDKDSTREVASLPNKSTISTAVSSTIPRQTVP
FT                   FLHLRKKAPSGEWKYDRHLSSLFLDGLERATINGVTFNDKYVLITGAGQGSIGAEVLQG
FT                   LLQGGAKVVVTTSRFSKKVTDYYQSMYAKFGARGSTLVVVPFNQGSKQDVEALIDYIYD
FT                   DEKNGGLGWDLDAFIPFAAIPENGIELENIDSKSEFAHRIMMTNILRMMGCIKKQKSAR
FT                   EIETRPAQVILPMSPNHGTFGGDGLYSESKLSLETLFNRWHSESWANQLTVCGAVIGWT
FT                   RGTGLMTANNIIAEGIEKMGVRTFSQKEMALNLLGLMIPEIVELCQKSPVMADLNGGLQ
FT                   YLTDLKEFTAKLRRELTETSEIRKAVSIETALEHKIVNGNKADEAYAKVEVQPRANIQL
FT                   NFPTLKNYKDIKKIAKEELEGMLDLERVIVVTGFSEVGPWGSSRTRWEMEAFGEFSLEG
FT                   SVEMAWMMGMIKYHNGNLKGRPYTGWVDAKTNEPVDDKDIKAKYESKILEHSGIRLIEP
FT                   ELFHGYNPEKKQMIQEVIVEDDLEPFEASKETAEQFKHEHGDKVDIFEIPETGEYSVKI
FT                   LKGATLYIPKALRFDRLVAGQVPTGWNAKTYGISDDIISQVDPITLFVLVSVVEAFITS
FT                   GISDPYEMYKYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDMPVQNDILQESFINTMSA
FT                   WVNMLLISSSGPIKTPVGACATSVESVDIGVETILSGKAKICIVGGYDDFQEEGSYEFG
FT                   NMKATSNTLEEFEHGRTPAEMSRPATTSRNGFMEAQGAGIQVIMNADLALKMGVPIYGI
FT                   VALTATATDKIGRSVPAPGKGILTTAREHHGAMRFPTPMMDIKYRKRQLVSREKQIKQW
FT                   VEDELEMTKYEAEGLSDSERNAFFAERSEEIKKEAQRQLKSAQAQWGNEFFKNDPRIAP
FT                   LRGSLAAFGLTIDDLGVASFHGTSTKANDKNESATINEMMKHLGRSEGNPVIGVFQKFL
FT                   TGHPKGAAGAWMLNGAIQILNSGIVPGNRNADNVDKLLEQFDYVLYPSKSIKTDGIKAV
FT                   SVTSFGFGQKGAQAVVIHPDYLYAAIDEGRYNEYAAKVTEREKAAHKFFHNGMIYNKLF
FT                   VSKEHAPYDDSLEEKVYLDPLVRVENDKKSGELKFSSKGIQKHDTYLSESAKKTSEMIS
FT                   GSLKEETKNVGVDVELIASINIDNETFIERNFTSEEVKYCSSQPSAQSSFAGTWSAKEA
FT                   VFKSLGVKSRGAGAPMKEIEILRDVNGKPTVTLHGEAKKLAQKESIKAVSVSISHDDFQ
FT                   SIAVAIANK"
FT   CDS_pept        complement(619492..620340)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437746"
FT                   /locus_tag="CAGL0E06160g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58876.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG344349"
FT                   /db_xref="HOGENOM:HBG735129"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI00003B62C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY7"
FT                   /transl_table=1
FT                   /translation="MSYNNPYAEESHEKYEMTEQDGGDFVEFMNQISRINQGLDRYEAI
FT                   IDRVDRLHKELLTEVNEERVQEVRTALDNYVAQASDIQYQLKDDIKDAQRQGLRDTNKQ
FT                   AQAENSRQRFLKLIQDYRIIDADYKDENKEQAKRQYMVIQPEATEEEVEAAITDVGGQQ
FT                   IFSQALLNANRRGEAKTALAEVQARHQELMQLEKTMAELAQLFNDMEEMVVEQQENIEV
FT                   IDKHVEEAQQDVEQGVGHTNKAVKSARAARRKKLWCWGIVFVIFVIIVVAVVVPSVVAT
FT                   R"
FT   CDS_pept        complement(621285..621926)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195744"
FT                   /locus_tag="CAGL0E06182g"
FT                   /product="Similar to uniprot|Q12143 Saccharomyces
FT                   cerevisiae YPL233w"
FT                   /protein_id="CAG58877.1"
FT                   /db_xref="HOGENOM:HBG059719"
FT                   /db_xref="HOGENOM:HBG204023"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniParc:UPI00003B62C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY6"
FT                   /transl_table=1
FT                   /translation="MNYGTGKVALSVGQLRSVYGQLHSILEERMSLVMPGDGDAEGDED
FT                   MVRREVQLRLQEYLLRVMEMAGDSIEVTDADPEKSIRELIMESRQKYMEPFDLDLNERV
FT                   REQYHKWEDANVKIAQLRRRGPETVRSMYLEEQEKYLNEVDKRIDALEDTDQETSEDTT
FT                   QEYVPEVMSEEDRQLFQEALKSVLDTQARIPEIRGELASNNNLLNYLDKT"
FT   CDS_pept        622523..623017
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437747"
FT                   /gene_name="VMA11"
FT                   /locus_tag="CAGL0E06204g"
FT                   /product="V-type proton ATPase 16 kDa proteolipid subunit 2"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG58878.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG211385"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI00003B62CA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUY5"
FT                   /transl_table=1
FT                   /translation="MDMVASDNVYAPLYAPFFGFAGCALAMILSCLGAAIGTAKSGIGI
FT                   AGIGTFKPELIMKSLIPVVMSGILAIYGLVVAVLIAGNLSPTEEYTLFNGFMHLSCGLC
FT                   VGFACLSSGYAIGIVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIIALILNTKGS
FT                   E"
FT   CDS_pept        join(complement(626688..626872),complement(623237..625826))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348962"
FT                   /locus_tag="CAGL0E06226g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG58879.2"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG403372"
FT                   /db_xref="HOGENOM:HBG515894"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI00017BD86E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY4"
FT                   /transl_table=1
FT                   /translation="MFPKLSLKTVASSFARLPATSFLKVTKAPIATSIVNGRSFFTDTK
FT                   YKCGKCERQKEISKTIRIKFANMNSENREVLPTNVTPIHYNLSLEPNFETFKFHGLEEI
FT                   NLKVNDKTNDVITLNSIEIDIHSAKLDDVEPKQTKFDHDKQTVEFVFPEGTLAKSNDPT
FT                   LKLDFTGILNDNMAGFYRAKYQDKKTGETKYMATTQMEPTDARRAFPCFDEPNLKATFG
FT                   ITLISDPSLTHLSNMDVKNETISESKKVTTFNDTPKMSTYLVAFIVAELNYVENKEFRI
FT                   PVRVYATPGDEHLGQYAADLTAKTLAFFEKTFGIKYPLPKMDNVAVHEFSAGAMENWGL
FT                   VTYRVVDLLLDEENSSLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMS
FT                   WYSCNEFQPSWNVWQQYVTDTLQHALSLDALRSSHPIEVPVKRADEINQIFDAISYSKG
FT                   ASLLRMISKWLGEDVFIKGVSNYLNNFKYGNAKTDDLWDALAKASGKDVRGVMNIWTKK
FT                   VGFPVISIEENGSEIQFTQNRYLTTGDVKPEEDETLYPVFLALKTKSGVDNSLVLSERS
FT                   KAVTIDDSSFYKVNTDQSGIFITAYPEDRWEKFGKQSDLLSVEDRTGLVADAKALSSSG
FT                   YINTTSFFKLISNWKDEKSFVVWDQIIISLASLKAAWLFESPEVKDALEAFSRNLVADK
FT                   AKTLGWEFKESDSFATQRLKVALFGAACAARDEVVEKAALDMFEKYVSGDKKAIPALIK
FT                   PSVFNAVARKGGKDNYEKIFNIYKNPVSTDEKLAALRTLGRFKEADLLDRTLGYLFDGT
FT                   VLNQDIYIPMQGMRAHKEGVTALWKWLQENWDEIARRLPPGLSMLGSVVAISTSGFSSL
FT                   EAVDEIKTFFNTKSTKGFDQSLAQSLDTITSKAQWVDRDRESISKYLSDNGYM"
FT   CDS_pept        627651..628241
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437748"
FT                   /locus_tag="CAGL0E06248g"
FT                   /product="Similar to uniprot|P36054 Saccharomyces
FT                   cerevisiae YKL159c RCN1"
FT                   /biological_process="calcium-mediated signaling "
FT                   /protein_id="CAG58880.1"
FT                   /db_xref="GO:0019722"
FT                   /db_xref="HOGENOM:HBG124516"
FT                   /db_xref="HOGENOM:HBG202410"
FT                   /db_xref="InterPro:IPR006931"
FT                   /db_xref="UniParc:UPI00003B62CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY3"
FT                   /transl_table=1
FT                   /translation="MDSLVTDTIILTSNERDITGQEILPILASWFEDNVLSNIQVLPAN
FT                   PIQLLLLKNFKRCLIICPDHAVSNAVMQKLKLKVPLPDLIFNYSITDSQNNSSVKKDYL
FT                   KVPEHQRLFLISPPSSPPPEFDYSKCEDKPSFKTHAHQPEKILRQATSFVAIESQVGTI
FT                   TVNTCDDYNNGGPGLEGVRTALPPKSIFDDIDE"
FT   CDS_pept        complement(628636..629079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437749"
FT                   /locus_tag="CAGL0E06270g"
FT                   /product="Similar to uniprot|P36053 Saccharomyces
FT                   cerevisiae YKL160w"
FT                   /protein_id="CAG58881.1"
FT                   /db_xref="HOGENOM:HBG175774"
FT                   /db_xref="HOGENOM:HBG630513"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniParc:UPI00003B62CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY2"
FT                   /transl_table=1
FT                   /translation="MGKRKKSSRGPVKRVVQKLDTSFNCLFCNHEKSVSCTLDKKNCIG
FT                   HLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNSGRGSDSEHDNDDENSDSDYESD
FT                   SDEAAAPQDSDEQEVDSDEDERIGASKRGRGALVDSDEEEESE"
FT   CDS_pept        633372..634598
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437750"
FT                   /locus_tag="CAGL0E06292g"
FT                   /product="Similarities with uniprot|P01119 Saccharomyces
FT                   cerevisiae YOR101w RAS1"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAG58882.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG124517"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00003B62CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY1"
FT                   /transl_table=1
FT                   /translation="MIPLLYEADWSNSPRHHDSNFRIMVLGDPKVGKTSMIMQWLTDNY
FT                   RSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEKDVIDFNLDNSHRFQYTNKDLIKLEI
FT                   LDANIHDISEYYSNELRSLQVKQSDAIVICFDGKSQTTFEHVREYYNTIKDALGEEQIP
FT                   VVICNTKIDYLMEDKVEFNELINFLAELDLDYENDYFETSSKHNINVKELLFSLLYRIE
FT                   TNKEMKKKEEALKSETLEISPTPSHYEPNSPFSSRSNKSDSNSLKSLDENRIGITDSRG
FT                   NFYPKCDNKDEYLKMDDLIIPSEFITKTRTMKLQGGDETKKELQHGIISADHSETNDTT
FT                   QDERNTKISPIFKTFPKFKSSTPPKPISSRESVNNNLEKVLKRKEKQKKDKKDTKMTPP
FT                   FKSTSCIIS"
FT   CDS_pept        complement(634890..636785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246590" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437751"
FT                   /locus_tag="CAGL0E06314g"
FT                   /product="Similar to uniprot|P36056 Saccharomyces
FT                   cerevisiae YKL155c CAP1"
FT                   /function="methyltransferase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAG58883.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058399"
FT                   /db_xref="HOGENOM:HBG395954"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR016522"
FT                   /db_xref="UniParc:UPI00003B62CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUY0"
FT                   /transl_table=1
FT                   /translation="MSLRLFNLKICTSNLQTLHKQWRRYSVISKETIKNFDIDRPRSDD
FT                   HLNYNINIGSNAQEKRLLPETLEGRSHRNIIELNSEVAKCINNNILSLHIPNNIRRVAK
FT                   NYFEELQTKNSIHRSTKSPMEVDAHIASIFLQNYTAIFQTLMELKKRKKSFRPKRVLDI
FT                   GFGPATGILAFNDVMGPDYKCETKDSVIYGHIEMQKRAKLLLSRQYNEIPDNDEAVSEC
FT                   REQNVDDIPEEDSLVGAVMTKKININTNLRTNLPTASEYDLIIMTHQLLKTKEKFNTEV
FT                   EENLSNVLNLLAPNGQLIIIERGNPIGYETIARARQIMLRPENYPDEKGKIPRPWEKGY
FT                   IRNRFRENSNSIPHEDYASAKTDYYLYEIAPYPHHGKDILQTGKPIYYELKEGKNLKFI
FT                   NFQKTVRRPKFSIEHKRGQLLSAPWDRKGDRFVDLSGSGRRNGNDYEIVNFCYIIMERT
FT                   STDKSTLEKIKRARENSKNNHTAADFNLECSSVTWPRIITEPVKRKGHVTLDVVTATGL
FT                   IEKWTIPKSFSKEIYHDARKAIKGDLWPHSAKTKILGMAPMKLNKLKEAEKRAILESRK
FT                   EFKRKEREVALSLNEINNATNEDHLSKINDSDLEGVDRMRELANAYGYYFDRRKM"
FT   CDS_pept        637212..637976
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437752"
FT                   /locus_tag="CAGL0E06336g"
FT                   /product="Similar to uniprot|P36057 Saccharomyces
FT                   cerevisiae YKL154w SRP102"
FT                   /protein_id="CAG58884.1"
FT                   /db_xref="HOGENOM:HBG058398"
FT                   /db_xref="HOGENOM:HBG398153"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="UniParc:UPI00003B62D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX9"
FT                   /transl_table=1
FT                   /translation="MVASSLMIALVLVILTTLLIAFQVKKTLVSGHKSSQSSSYVKKVP
FT                   TIIIAGPSYSGKTSLFHKLTSDETNAKLLTVMSQEPSFALKYKGTMTTLADYPGHVKLA
FT                   YKLKNGIIDLKGNLKGILFVLDSTIDPKNITETAEYLTEILLILEKIREPIDILIACNK
FT                   NESFTARQPLKIKEALENEITRIFERKKKSLGNIERDIGDVDEINENLDLSFDISKGFK
FT                   FDYLEGNVEVLAGSVHKNKITTWQEWVGSHLV"
FT   CDS_pept        complement(639077..639820)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437753"
FT                   /locus_tag="CAGL0E06358g"
FT                   /product="Similar to uniprot|P00950 Saccharomyces
FT                   cerevisiae YKL152c GPM1"
FT                   /function="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG58885.1"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0046538"
FT                   /db_xref="HOGENOM:HBG469482"
FT                   /db_xref="HOGENOM:HBG658938"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B62D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX8"
FT                   /transl_table=1
FT                   /translation="MPKLVLVRHGQSEWNEKNLFTGWVDVRLSAKGEQEAARAGELLKE
FT                   KNVHPDILYTSKLSRAIQTANIALSKADRLWIPVKRSWRLNERHYGALQGKDKAETLET
FT                   YGEEKFNTWRRSFDVPPPVIEADSPYSQKNDERYRDVDPNVLPQTESLALVIDRLLPYW
FT                   EDVIAKDLLAGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKP
FT                   SKPSYYLDPEAAAAGAAAVAAQGKK"
FT   CDS_pept        complement(641589..642581)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195745"
FT                   /locus_tag="CAGL0E06380g"
FT                   /product="Similar to uniprot|P36059 Saccharomyces
FT                   cerevisiae YKL151c"
FT                   /protein_id="CAG58886.1"
FT                   /db_xref="HOGENOM:HBG026335"
FT                   /db_xref="HOGENOM:HBG622920"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="UniParc:UPI00003B62D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX7"
FT                   /transl_table=1
FT                   /translation="MLSKLSHKELLKLAQRQCIPPLLSTFHKGQAGGRVCIIGGCEDYT
FT                   GAPYFSANATALMGCDLTHVICEYNAATVIKSYTPNLMVHPYMRMSNSYLPNGDPVHSD
FT                   MDKIKNLLQRMHVIVIGPGLGRDKDMLKSIKEIIRFDLEQLGGQLPIVIDADGLFLVSE
FT                   DHDTRALLKRFPRGRIILTPNVVEMKRIRDSLSKQCSSEIDIVNELKCILVEKGTEDAI
FT                   YSPGEGNDILKNKQEGSNKRVGGQGDTLTGTIACMLAYCRAIYDFKVYRPDHNSEYLKD
FT                   WIDYAMLSCYVGCTITRESARLAFKQSGRAMQTTDVNNRVGEVYARLFD"
FT   CDS_pept        643478..643768
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437754"
FT                   /locus_tag="CAGL0E06402g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58887.1"
FT                   /db_xref="HOGENOM:HBG124518"
FT                   /db_xref="UniParc:UPI00003B62D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX6"
FT                   /transl_table=1
FT                   /translation="MYNEINECLTKQTSLPQFPPSIILANQLPRTSLTLYIQASSITRV
FT                   RCIPTSVLQCNTFLNSPKVHFVGKGVVSIRHLMELQYFFTPYVYSLLILFI"
FT   CDS_pept        644263..645159
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437755"
FT                   /gene_name="MCR1"
FT                   /locus_tag="CAGL0E06424g"
FT                   /product="NADH-cytochrome b5 reductase 2 "
FT                   /EC_number="1.6.2.2"
FT                   /function="cytochrome-b5 reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG58888.1"
FT                   /db_xref="GO:0004128"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG477179"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="HSSP:1QX4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00003B62D4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUX5"
FT                   /transl_table=1
FT                   /translation="MAFARFARPTQRFLPFAIGAVAVTAGALYLNGWNTIKNENPKVFI
FT                   GDRKWIDLELEKIIEESHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYT
FT                   PVSDLSEKGYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLG
FT                   GGTGITPLYQLVHHITQNKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYF
FT                   VDKDDTGKFDGNKGFITKDFLAKNAPGPKEKTQVFVCGPPPFMDSLSGQKKSPMEQGDL
FT                   TGALKDLGYSQDQVFKF"
FT   CDS_pept        complement(645329..646546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437756"
FT                   /locus_tag="CAGL0E06446g"
FT                   /product="Similar to uniprot|P24309 Saccharomyces
FT                   cerevisiae YKL149c DBR1"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="mRNA processing"
FT                   /protein_id="CAG58889.1"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG202411"
FT                   /db_xref="HOGENOM:HBG435021"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="UniParc:UPI00003B62D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX4"
FT                   /transl_table=1
FT                   /translation="MNERKLRIAVQGCCHGELNKVFATVADMHKRTPIDLLIILGDFQS
FT                   IRDNSDFQSISIPPKYQKLGDFHAYYENDYYRAPVFTIVIGGNHESMRHLMQLPYGGYL
FT                   ANNIYYMGYSGVVWFKGFRIAALSGIWKEWDFEKKRPSWKFLEENNKWKDSVRQLYHIR
FT                   KDDVAPLFALSDNIDICLSHDWPSGVVHYGNVKQLLKYKPFFEKDIKSGKLGNPIAWKL
FT                   LTNLKPRWWFSAHLHVKYEAEITHNKRRLADSKGAKKLKSNSDEIELNLDDESSLDLSC
FT                   HDDSLDSAEHTRFLSLDKCMPRRKWLEIVEIEKRYDSIPQGLDCDKMYWDPSYIIALQN
FT                   LEKQSRLVADTPFNEIIWSRFSSGHIDDINWHKYEIPKYESGLQRDEASQTNYFLSKHM
FT                   LSKGSR"
FT   CDS_pept        647086..649131
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348963"
FT                   /locus_tag="CAGL0E06468g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58890.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124519"
FT                   /db_xref="HOGENOM:HBG324256"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00003B62D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX3"
FT                   /transl_table=1
FT                   /translation="MTSSNECGSNSPTRTADINKRIIRKHSGSQKKSPSIEASFSRDDF
FT                   ASRRSSTTAALLKDPSENYGTKGIPPVSIDIDIRNPAPKVIDAVTRHLSSTPNHLQMQG
FT                   ADMTRDLYKWAKEHPSSPPPASSENMLASSGNQFTNISTPNEFTNPNAFKRKRSMSFSA
FT                   VSAHSSAMNSISNYNTNNDFRQVRNELPEIMMSHEDIRAPGGFRRSYLIQKHIEENGEE
FT                   PPNNFITRNFIEFLTLYGHFAGEDLSESEEESDIEGEYDEEALETESTRLLSTHRSRKH
FT                   RPAVHGHKSSTTKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSSSVLLICALISYWCFVL
FT                   LIDTKNHVGLDGYGDMGNHLYGSSMKLAILWSIALSQIGFSSAYTVFTATNLQVFTNNV
FT                   FKQEYGITIFIIIQVLFFLPLALTRNIAKLSGTALIADLFILLGLVYVYWFSISHVSTH
FT                   GVASETMLMFNKADWSLFIGTAIFTFEGIGLLIPIQESMKKPEHFHASLSGVMCVVTVV
FT                   FISCGLICYCAFGADVETVVLLNFPQESIYTRAVQLLYALAILLSTPLQLFPAIKILEN
FT                   WTFSPHSSGKHNPKVKWLKNYFRAAIVCFSALIAWAGANDLDKFVSLVGSFACIPLIYI
FT                   YPPMLHFKAFKKDKSKLFMASDIFLLFFGIIVMIYTSLQTIGMWLN"
FT   CDS_pept        649826..651244
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044597"
FT                   /locus_tag="CAGL0E06490g"
FT                   /product="Similar to uniprot|P33299 Saccharomyces
FT                   cerevisiae YKL145w YTA3"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58891.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI00003B62D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX2"
FT                   /transl_table=1
FT                   /translation="MAPKEDWEKYKAPVESDDDNKLKDDKSIPLTEGDIQVLKTYGAAP
FT                   YAAKLKETEKDLKEIEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCT
FT                   KIIKSSASNEVSDESAVNGANTTNSATTGSGNDGDAEGDDDEDAKYVINLKQIAKFVVG
FT                   LGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQ
FT                   IEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG
FT                   SELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLE
FT                   LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK
FT                   SMSVERNIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVING
FT                   YKKFSSTSRYMQYN"
FT   CDS_pept        651936..652574
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437757"
FT                   /locus_tag="CAGL0E06512g"
FT                   /product="Similar to uniprot|P35719 Saccharomyces
FT                   cerevisiae YKL142w MRP8"
FT                   /protein_id="CAG58892.1"
FT                   /db_xref="HOGENOM:HBG058392"
FT                   /db_xref="HOGENOM:HBG396993"
FT                   /db_xref="InterPro:IPR012917"
FT                   /db_xref="UniParc:UPI00003B62D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX1"
FT                   /transl_table=1
FT                   /translation="MSSELEVLKKKVSDLQELVQKQNLLISKTGKNVLELQIAKQKSDV
FT                   DNFGPSRAQVTAQFDSTDFATNDDLVQLVAELQGELNVIEERSIRRLVNSTKTDQDATL
FT                   APIPNADGEAPSLTDEMFPHTLKEFEEMDDIRLYRLAKFYEKLPLTMKEQEDFDKVLEG
FT                   KVEDLHISKLSDEDITKELKKLSKDELDDAFNDIARYLGLRSRRGTGIW"
FT   CDS_pept        complement(652842..654839)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248568" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501124"
FT                   /locus_tag="CAGL0E06534g"
FT                   /product="Similar to uniprot|P47077 Saccharomyces
FT                   cerevisiae YJL010c"
FT                   /function="RNA binding"
FT                   /protein_id="CAG58893.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG058391"
FT                   /db_xref="HOGENOM:HBG396031"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B62D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUX0"
FT                   /transl_table=1
FT                   /translation="MGKPRGRKLEKKIKDQEFHPEQDSEKISENYNYDGHPESDTSNPQ
FT                   MFFGVLDRDELEYFKQTEATLSLDTFETEEEKAQFVTNVIQEAEGKELKLVTSQICSKL
FT                   MERLILNCNDIQLKKLFQAFNGNFYNISCHKYASHVVETLLVRSASLVEKELITPHFDN
FT                   MDASVDGSDVFAPMESLFLFMLNEIKPHLKSMINHQYASHVLRLIILILSSKTLPSTTQ
FT                   NNSIVRSKKSKIARKMIDLKDNEDFNKVYQTPESFKSELKMMLNDLYSDLTGHAKPKAE
FT                   INPTVITKFREFCVDKVASPVIQLIIQVEGIFDRDRSFWRLAFNTNDEKDAKEQSFMEY
FT                   LLSDPVGSHFLENVISFAKTKYVERLYRVYIKDQIVRLAKRDTTGAFVIQSLLKNMKDK
FT                   EVKEILDALLPDLSILLNSNMDFGTTIINACIKQNNYKRDEVIGQLMKKYYPDGSSEKN
FT                   ILESCLLLASSTLGNTKDDWPTAEERRRSIFLEELIDFDDKFLEVAIESMLNLPEERLL
FT                   QMCYHGVFSHVVEHVLQVQRVDIIKRKLLLNILIKDIVKLACNAYGSHIVDKLWDFTAK
FT                   LTLYKERIAAALVENSEMVKNSVYGRQVWKNWQLEKYIRKRWEWKKIIKESDLETFPNM
FT                   RVLQPNMQERAAIKRKNDDKAFDSMKKSRK"
FT   CDS_pept        655328..656638
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437758"
FT                   /locus_tag="CAGL0E06556g"
FT                   /product="Similar to uniprot|P40015 Saccharomyces
FT                   cerevisiae YER019w ISC1"
FT                   /protein_id="CAG58894.1"
FT                   /db_xref="HOGENOM:HBG059694"
FT                   /db_xref="HOGENOM:HBG398065"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003B62DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW9"
FT                   /transl_table=1
FT                   /translation="MMHSEPQRIKFLTFNTWGLKYVSKHRRARLRALAEKLAGHQNSNI
FT                   KSLPNSEDLYADNDFEDYDIVALQEIWCKEDWDYIVEQCGKIFPYYRWFYSGILSGPGL
FT                   AILSKIPIESTFLYRYPINGRPSAIHRGDWYVGKSIAITTLRNRENPTTPIVIMNSHMH
FT                   APYSLTGDAAYSCHRSCQAWDFAKLAKIYREAGYAVVIVGDLNSRPGSLPHNILTKEAG
FT                   LIDSWEQLHGKQDLEKIRTMNAMDQLVYACTTCDSTLNTWRANRRPDEACRLDYALVDP
FT                   RRLTTIKTGIKFTELIDGVGSFSDHFAYSCTLEVLRDNNVKKLQTELSDRIKIHEDLEL
FT                   CIEDYLITARKQKFLRGLHFWMSVFLMISCAVVTTFTSNVAGWSSIFWVLFAIVVAVTG
FT                   VIDGMISFLFGRSEIRALWEVQHEVKDSKRYLEEMSA"
FT   CDS_pept        658435..661332
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348964"
FT                   /locus_tag="CAGL0E06600g"
FT                   /product="Similarities with uniprot|P38894 Saccharomyces
FT                   cerevisiae YHR211w FLO5"
FT                   /biological_process="flocculation"
FT                   /protein_id="CAG58896.1"
FT                   /db_xref="GO:0000128"
FT                   /db_xref="HOGENOM:HBG124521"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniParc:UPI00003B62DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW7"
FT                   /transl_table=1
FT                   /translation="MKAIDIRNIVVAALTIFIDQARAATIKENTYYSGELPSEGFTVNS
FT                   NQFLALVNTKTVNFAGPLTINKDASVFIGNENAANGAISSTFSINGDINNYGTIVLDNR
FT                   NSSDAASVSWTAKTFNNYGSMFFNGASAVVQNSFVLTGQTELVNKGLIQFTQQPTNWDA
FT                   VGSVSSPSLVNEGTICLKNMKTQTISSISGSGCIVIGENSIYDMLSISHGTVGSQMIYL
FT                   SSTSSELYAESDAKTDNIVVAGFGNGNVITFRTSIDPFRGKWSYDGKTGILTVKVWPSM
FT                   THIFNIGLGYDSSKFDWKQIDNHCTPTLVNNAIYYKGPIPDGANKPDKCLPCVDHIPWI
FT                   PKIEETTQYEGYDGSQTTTASTKVETKTGNDGSVTEQFTYYVKTPATRLASTQFSLGKG
FT                   SKTTTVETQLNTFTGKDGKETIETIFIVETPVISTATTKYTLGKGSATTTVNTEYTTDI
FT                   DSDGKETVKAIYFVETPAVYISSTMITNGTNSHTTTINTEIRSFVGVDGKQTIETIYLV
FT                   ETPTKSLLEPTSSEFLFSSSFEKKSSSYPTSSSSTPAAHSSSIAHNSTFTTSASESFSY
FT                   PILESTYTTHYSSDDWFVEKIVSYYGSTGPDGNIVQATGTAYFRERVDAQPVFQGASSS
FT                   SFVNHSSSTEQNTISGSGILSSSNPSLSVLPSDGSDSRTSSKINTSSTSSKYKSNYQNL
FT                   TASESSSDFTTTKTLTTFTTKTTTHCSENKCSIFTTTIEIVDTITTTDCPLSHATTSTT
FT                   LIDTISSNDFTTYSSFFQPKDSDNLVNSSRYLNDTGFNKPEQGKIDSQSIEQETIANII
FT                   TTTTTTTTDAISTAIHDYIDRTVTEKVLKTIYEQGTEAEPTNTSSKLSTIVKTEPTSTT
FT                   TRTTLDNKSGKLVPPASSSRSVTATSSLPVKQSGKISISLSSVITSQVEVEQLPTYRNH
FT                   SQAETQILEQQSNMGSSVILPYWTLAIFFIFHHII"
FT   CDS_pept        665110..668214
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044598"
FT                   /locus_tag="CAGL0E06644g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58898.1"
FT                   /db_xref="HOGENOM:HBG124523"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00003B62DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW5"
FT                   /transl_table=1
FT                   /translation="MILNPALFLNKCVCIYTTLILLLLTNGGYATSSNDISLASKDPTT
FT                   FPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDG
FT                   VTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISA
FT                   DDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLF
FT                   YNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLISYDSSCASVKTSKII
FT                   GIDYHTETPNENLVPITKTIYHLGIPCTGTTTTPLCGSGFYDPLANKCVTINTSSTSSV
FT                   TKTTSHTTSKEVSFHSSISSQKTLIPKSIPSPYGPIKSQSIPTEMETSSEISSSEYAFS
FT                   DVISTPSHSPYTKKHSSLNSSSYTSTVIHSLTSYSISQGIFSTSLSEQNITSKSSTDKF
FT                   STATSMSNSITQSSIIISQSSTNNENYTTTSMHTSSDKISTETLNNSISTTTSILFSNS
FT                   STILKNNTTIISSDKDTHYHPVNPTIVCSTNKTEIICASITQPSISNSNNHWSSSVLRF
FT                   NSTTVRSTLPSSAGSNETSINVPFSSSTESNASTSSTSTSNSKTVRSTLPSSAGSNETS
FT                   INVPFSSSTESNTSTSSTSTSNSKTVRSTLPSSAGSNETSINVPFSSSTESNASTSSTS
FT                   TSNSKTVRSTPFSSAGIIMTSLSQRNNKSASSYASSNSKCYNTADSCRKVHSTPSYLLT
FT                   SSYTSEGVDYDCSLVSTKLKINDTNCLNNKHTTKSCLKTSVTTTIPTLEIKTARKSSSN
FT                   TIGLHSYPTSSPNKSISSAPIIGYISSFKTIKTASPSYQTSDLTTITTITSLNNPGSTA
FT                   VENTHESNDKSRKTSSNDISSKHSVIKETKDAVESSNKSHQTNTLKCSSIIIASSSHNS
FT                   YESLGGTTLTLTLSKVYSPQNNDTLPFLEISEVNPSRTVLPESSKMMQYLTSTEERNKT
FT                   ARNTIATNIVSISTFHFEGEGNAIRMGYTQLLLMLIGIIVMNIGT"
FT   CDS_pept        complement(670430..674692)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044599"
FT                   /locus_tag="CAGL0E06666g"
FT                   /product="Similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /protein_id="CAG58899.1"
FT                   /db_xref="HOGENOM:HBG124524"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00003B62DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW4"
FT                   /transl_table=1
FT                   /translation="MEIFSYNYKKKYHTRNILFEPNMNWKIALFCWTFFLQALNAQNLG
FT                   AMQSDKYFPKSKDPTSFPMGCSPQVLKTQPGLAVKLYSYGHPVPGCAYNTYQYPDFPRS
FT                   GYKKERKLADITGVNGRIDIDLKPNDPCRVLSGNLPSNYNYQNTLTYTNFTMILYGYFQ
FT                   PKVTGYHTFNLEADDLLFMNLGAGNAFDCCRAESTLDNFGNYQSYSIWGTDKATADLTV
FT                   FLVSGIYYPIRLFYVNRDNNAVLDFSFSTEFNKEIIHDFTSYFFSASDEEQCPGNINYN
FT                   YHCADVKSSTILTSSTTVDKQEGNIVPITKTIYEIGVPCDPEQPTQKCEGEFYNPIRDV
FT                   CEPLPTPSQENKSSSSSSSSSSSSSSSSSSSSSPSVNPSSVNPSSVNPSSKPVDPSPAD
FT                   PSHNPSSVNPSSVNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSKPVDPS
FT                   PADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSKPV
FT                   DPSPADPSSVNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPS
FT                   SVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSV
FT                   NPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSVNPSSVIPSSVNPSSVNPSSVNPS
FT                   SKPVDPSPADPSHNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSVNPSSK
FT                   PADPSPADPSSVNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSVNPSSKP
FT                   ADPSPADPSHNPSSVNPSSVNPSSVNPSPSIVSPSISTRTVTLSNGSTTTVTVTVTPPS
FT                   PNGGSSNSNTDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSK
FT                   PGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSKPGN
FT                   NGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSKPGNNGD
FT                   SDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSKPGNNGDSDS
FT                   FSLPPPYTTTVSKSTTTITLTGSKPSNNGNVGTSSVPPVGNIAITPSVSTRTVTFTNGI
FT                   ISTITTTIRPPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGG
FT                   SGNNGNTPSPNGGGSGNTGNTPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGGSGN
FT                   NGNTPSPNGGGSGNNGNTPSPNGGGSGNTGNTPSPNGGGSGNNGNTPSPNGGGSGNNGN
FT                   TPSPNGGGSGNNGNTPSPNGSGSGNNGNGNLSPSISTSITSVQSVPSIFKGEGFRAAHL
FT                   SSIFIWTIITVLVAPILV"
FT   CDS_pept        complement(680404..683331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437759"
FT                   /locus_tag="CAGL0E06688g"
FT                   /product="Strain CBS138 chromosome E complete sequence "
FT                   /protein_id="CAG58900.1"
FT                   /db_xref="HOGENOM:HBG124359"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00003B62E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW3"
FT                   /transl_table=1
FT                   /translation="MFNWIIVCCLLIVQLAHANDLGFSLFEKRELSSQNPFGYPIGCSP
FT                   QDVAIIPGLTMELYSYPIVSGTPPNCYDASYVDPEYPRTGYLKRKMVGKSTGVTGNLNY
FT                   KYSVEKACMVKYGNLPAGYNYNEPLTVSNFTMILYGYFKAQTTGLHTFFVNADDLLYIN
FT                   FGAGNAFDCCKREDSKTKLGEYVAYDIWHVDSSKNKVSLFLEKDLYYPIRMFFNNIGKD
FT                   SSLDLSFSVNGATDQISDFSGYLYSVPDQPDTCPAHIGYDTTCRSIDSTTTYSTNFITT
FT                   KPAENVVPVTSTIYYIATPCSKSQSQTPSCQGGFLDPLKNTCYYPKPEDPKPEDPSHNP
FT                   SSVNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPS
FT                   PADPSHNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSVNPSSKPADPSPA
FT                   DPSHNPSSVNPSSVNPSSVNPSSKPADPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSS
FT                   KPADPSPADPSHNPSSVNPSSVNPSSVNPSSVIPSSVNPSSVNPSSVNPSSKPVDPSPA
FT                   DPSHNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSKPADPSPADPSHNPS
FT                   SVNPSSVNPSSVNPSPSIVSPSISTRMVTLSNGSTTTVTVTVTPPSPNGGSSNSNTDSF
FT                   SLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSKPSNNGNVGTSSVP
FT                   PVGNIAITPSVSTRTVTFTNGIISTITTTIRPPSPNGGGSGNNGNTPSPNGGGSGNNGN
FT                   TPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGGSGNNGNTPS
FT                   PNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPSK
FT                   TTFPISSSSVFNIPNFSEYKGKASKPIEVAPAKLLILVLCTFFLI"
XX
SQ   Sequence 687738 BP; 209092 A; 133487 C; 134735 G; 210424 T; 0 other;
     aacatttcag aaatgacaat tgttctagaa cagagtggat tcttgtactt caacaactca        60
     tcgttaaaca caacatctcg cgtttttcgc aactctcaac caggctgggt aaatcaaatt       120
     gctttgtcga ctgtctcgta gaacgcaagg tctcgcgttt ttcgcaactt agatatctgg       180
     atttgcagga ctgagctggg tcccctgtca aaacaatagc atttcagaac agagacatgc       240
     tactgtgatt ccaccctctc agacaaggct ctttttgtag gagaaaatgg taaataaaag       300
     agactagctg catgtatgag gcacatatta gatacatatt tgattatgtt gcttgtaaat       360
     aagaataaac aacccttgtt gtttatttat tgtagatagt gtacatttct gtgttcaatt       420
     tgtgtatatt tttttatcat ttaagaactg taatcttata atggccaaca ctatactctc       480
     tcaagtattt ataacaatat cttaaatcat ttcagtttag tttacgccac tgcttcaaat       540
     atggatttac aatacaagct attacgcaca taaaaagcaa tatcatcagt ataaactcac       600
     caataagttt tgactggtaa aaccatgtac tgtaactaat atttactatt tctattctgg       660
     cactcatata cgtttaaaca attgaagaat cacaaaattt gaaattcatg tttgggtgct       720
     gaagtgcgta attatgaaaa ctttgccatc acctcccttc aacctaattg ccaacccttt       780
     gaaaccttcc ctggatgttg gtgaaaaagt cagtactcgt tcatcgatat atcaaaggtc       840
     atgtgaacat atatcgtatg atgtactgtt gtggaaatgc tggcagggta acttcgattg       900
     gtcacgatat ttttcgtcaa ataactaaag gaaattgttg atcagggtaa cttaatctgt       960
     cagatgacta ccgtgcacta tcacatctcg cgtttttcgc agcatttgaa gttcaatctt      1020
     aaacccacag gttcaaatcc atggttagcc aagatattat aagaaacatc gacaacagtg      1080
     agacgcacac aatacaataa caaagacata aaataacata aaacttttta gaagagaaaa      1140
     gtgcttaaat tgttaactaa taataaataa tatatacaaa aactcttgag aataatactg      1200
     ctcacattat taatatgaga tatagaaaac agtacctgaa acaaaaataa tagccccaaa      1260
     ttacgaacaa taaatatata tagggaagct tcagtttttt tttgtttttt gttggacaat      1320
     aatcaatcca ttttatcatt atcgataata aaagaaacag cctatctaaa aatcatggct      1380
     ggacgaacgt ttgtaatatt gtacatgttg ggcttgggca ttcacagaac aaatacactt      1440
     tagatcatac cgacaactat tactgcaata atggagaata taatactgga agaagcaact      1500
     ctaattgaag cacccttacc ctgtaggaca gatgctgttt gcgtgctgct gaacccactg      1560
     ccgttgttgt taacagagga accagaaggt aatagaacag tcgtggccgc ctgttgacgt      1620
     gatgatggag tttgtccttg gccttgtcct tgcccttgtt gttgagcttg taaaggtaca      1680
     gagtttggtg tttggctacc atgaatacca ctgactggag atgcagtgtc cattggactc      1740
     tgaacagatg gagatccaga tggtacaata ttgcctaccg attggtgaac tggcccagag      1800
     ccagagccag agccagagcc actaccaccg gctgtgccag cagcttgtgt tggcttttcg      1860
     ttgccagacc cttggccagc cacattttgt gactgaggtt tctgagagtt gacaatacca      1920
     cctacacctg ctgttccagg agcattagat ccagcaccgg atactgttga gactggtgct      1980
     gcacttgaaa cagtgctgcc atgactctgg ccacccacgg tttgcgttac tgtagaaaca      2040
     attgtgtgac cgtgctcatc agtacctgtg ctatgggata ccacctcggt gaacgtgtga      2100
     acgtccgaaa cgacagtgct ggtgtagtca gacccaatat ttgctttaga attcgaaggt      2160
     gcgggtgcat gggtgatcgt ggtggttatt gttgtaggat taccatggga gtcgatagtg      2220
     gtgatatgcg aaatgacatc agtttcggta ctgccattgc ccctgtcgac tgttgtaatg      2280
     tattcggtct cacctccgac agagacagtg gaaatggtag ttgtacctgt cccggtgact      2340
     ccatcatcac caatatatgg gaagtacgaa attacgacag tggctgtacc agtattgcac      2400
     tcacagttgt cgtagtgact ggaggctgcg cgtaagcagg agcagaagtg tatacaccct      2460
     cacccacttg atcatatgac ataacggtca cagtagtggt gaccgtctga ccgatatcat      2520
     tggtcgttgt aacatgagaa acaacagctg taatcgtgtg accatcagaa acaaacacag      2580
     atgtgtaatc tggttgttct gttagagtca cagttgtcat gatcgtggta agcttgccgt      2640
     cggagtccgt ggtggtgatg tgcgaaacaa ggtctgtctc gaagtcaccg ttgcccttgt      2700
     cgatcgtcgt cgtgtagtcg gcctcgccgg catcacttgg cttcaatggg atggtggtga      2760
     cgatggtggt agggttgccg ttggagtcct tggtggtgat gtgggagacg aggtctgtct      2820
     cgaagtcacc gttgcccttg tcgatcgtcg tcgtgtagtc ggcctcgccg gcatcacttg      2880
     gcttcaatgg gatggtggtg acgatggtgg tagggttgcc gttggagtcc ttggtggtga      2940
     tgtgggagac gaggtctgtc tcgaagtcac cgttgccctt gtcgatcgtc gtcgtgtagt      3000
     cggcctcgcc ggcatcactt ggcttcaatg ggatggtggt gacgatggtg gtagggttgc      3060
     cgttggagtc cttggtggtg atgtgcgaaa caaggtctgt ctcgaagtca ccgttgccct      3120
     tgtcgatcgt cgtcgtgtag tcggcctcgc cggcatcact tggcttcaat gggatggtgg      3180
     tggtgatcgt ggtaggcttg ccgtcagagt ccttggtcgt gatgtgcgaa acaaggtctg      3240
     tctcgaagtc accgttgccc ttgtcgatcg tcgtggtgta gtcggcctcg ccggcatcac      3300
     ttggcttcaa tgggatggtg gtggtgatcg tggtaggctt gccgtcagag tccttggtcg      3360
     tgatgtgcga aacaaggtct gtctcgaagt caccgttgcc cttgtcgatc gtcgtcgtgt      3420
     agtcggactc ttcaactttc gattttgaat aacttgtaga tgacgtatat ggggcttgtg      3480
     catctatata gtcacgcgtg gcgttgaaca gagtgctgct cgtaacaata tcgcccttct      3540
     catcagtggt gatgaagaac gagatccagt ccgactcaat gtagtccgac gcagtggtgg      3600
     ctgtcacagt caccggtgga ggactgtagg tggccgtcga gtttgtcgtg atcagacccc      3660
     cgaattcatt ggtggtcgtc cagtagctga tgaccagata ctcagtcact tcgttgccca      3720
     gatcaactgt cttcgtcaca gctggaggtg caggcccgaa cgacgtgtgg ggggcctccg      3780
     gcaagttgta gtcacgcgtg gcgttgaaca gagtgctgct cgtaacaata tcgcccttct      3840
     catcagtggt gatgaagaac gagatccagt ccgactcaat gtagtccgac gcagtggtgg      3900
     ctgtcacagt caccggtgga ggactgtagg tggccgtcga gtttgtcgtg atcagacccc      3960
     cgaattcatt ggtggtcgtc cagtagctga tgaccagata ctcagtcact tcgttgccca      4020
     gatcaactgt cttcgtcaca gctggaggtg caggcccgaa cgacgtgtgg ggggcctccg      4080
     gcaagttgta gtcacgcgtg gcgttgaaca gagtgctgct cgtaacaata tcgcccttct      4140
     catcagtggt gatgaagaac gagatccagt ccgactcaat gtagtcgacg catggtggct      4200
     gtcacagtca ccggtggagg actgtaggtg gccgtcgagt ttgtcgtgat cagacccccg      4260
     aattcattgg tgcgtcgtcc agtagctgat gaccagatac tcagtcactt cgttgcccag      4320
     atcaactgtc ttcgtcacag ctggaggtgc aggcccgaac gacgtgtggg gggcctccgg      4380
     caagttgtag tcacgcgtgg cgttgaacag agtgctgctc gtaacaatat cgcccttctc      4440
     atcagtggtg atgaagaacg agatccagtc cgactcaatg tagtccgacg cagtggtggc      4500
     tgtcacagtc accgttgagg actgtaggtg gccgtcgagt ttgtcgtgat cagacccccg      4560
     aattcattgg tggtcgtcca gtagctgatg accagatact cagtcacttc gttgcccaga      4620
     tcaactgtct tcggtcacag ctggaggtgc aggcccatgc aatgggatgg tggtggtgat      4680
     cgtggtaggc ttgccgtcag agtcctgggt cgtgatgtgc gaaacaaggt ctgtctcgaa      4740
     gtcaccgttg cccttgtcta tcgtcgtcgt gtaatcagcc tcactgcttg gtttaagtgg      4800
     agcagtagag gtaatggttg tagttcctgt tattattact ccattgacat cagttgttat      4860
     gaagaatgag ataatatctt cttcaaggta attcggttgt gtaatagtag tggttgttac      4920
     aggtggcggg ctataaacta tactgtgtgt aagtgtacca aatgagactc cccatggttt      4980
     gggcgtatct cccggtattg gatcataaga cctcactaca tattctgtaa tgccgttccc      5040
     caaatcaata gtttgtgtat cttctttagg ttggatccat gctatgtagt aggtgtcaga      5100
     ataagccggt accccatatt cattagtata aggagattgg gatacaacat aaatatcagt      5160
     ttcttcaggt cctgggatag ttaaggtggt caccactgga ggaggtaatg gatcgtagcc      5220
     tactacggta atctgctttt gatacgtcac aggatatcga tgtggtattt tcttaaccgt      5280
     ttccagattt ggagcaggtc tcgatacaaa tatgtattca cgtcctccat ctatgtttgg      5340
     aacattaagt ttagtcttct tcccactatc ttgatttaaa atttcaaaac gatcaagtcc      5400
     tacatttgaa acattaaaac tatcggtatc atcgtaaagt atttgaaaca aataagtacc      5460
     gcagggaggt gggttttgaa tcaaaagatt gggaagtgta atagtacctg aaccttccgc      5520
     taatattata ttgtttatac gagtattgca actattggag gtgcctgggt caacatcagg      5580
     gtcttgaaat gattcataat gataacgtgt gtttattgta caggttgata ttggtgcata      5640
     accatgaaac ccgtctaatg caattattgt ggcattatct gtgccttcga aaatatctgc      5700
     ataaacttga actaccgttg aaaagtctag tttaccggat aataaattct gctttttcca      5760
     caaaccatcg gggactattt tgtcaggtcc caaatcaact gcgggtaaat attgtcgaga      5820
     atgagggtaa taatggggat ataccacctc taatgttccc tctatgtgca tgaaggaatt      5880
     gtatggtgcc tcgtaatgtc ctccaacatg aaacgaagct ctagttctgg gccaactgtc      5940
     atcaaagcca gataattctg gaggagcaat agatatttta ctggttgcat caacaaaaat      6000
     accatctgct ccagcatcaa tatcaaaatc ccaattatcg ggtataactg aatcagtacc      6060
     atcaggaata gaatttgcag atccaaaatc cctggcatta tatataaagg ttgaaccttc      6120
     tgttagggtt actttaccac caacatgaaa tcggtggttt actgttgcgc caggactagg      6180
     ggttacaggg gggtagacag tcaacgtaga tgagccagaa agatcaattc cagctacaaa      6240
     atcgatatta gtgtagtttt ggatagtaag gtgagaattt tttaaaacca gcaagtcatt      6300
     ttcagttaag gtttttgtcg cagcagttgc accatcgaga gttaacgttt gatcttggta      6360
     agtaatagct atggctgtat gccacaatat caaagttagg taaatatttc gcaatagcat      6420
     attgcacgca ctgaaatagt aacactgccc taaaagctag aaggggaaaa aagaactttc      6480
     tttcaacaat cttaggtcaa tagatttttt tttcaaattt ctattattta ttttgtcttc      6540
     caaaagcaaa aaaaacaaca taaagtaaca agctttgttg ttataactcc ttatatgtac      6600
     ttacgtgaag gaagatattt tgtactatat aacgaaagca tatattaaaa cgtgagcaca      6660
     aggaaaaact ttttgacgaa aaatcacccc caaggaaagc gaatatttca aagctgaaca      6720
     aatgaaaatt tcagttcttt atataattcc aggaaatctt tcatatccat gttgtcatag      6780
     tatgtaatat ggatctggtg aaactacagt agctaacaaa ggagtcaatc ctattccttc      6840
     aggttggggg tttggctgct gcactctcct cttgtagtag tttataatcg accattcaaa      6900
     atcaaggaaa gcttccgggc cttcttcatc cctttcaaaa taaaggaatt gaactatcag      6960
     aaaaataaag ctagttgaaa cagcaatgct taggcaagca cacatacgat gcggtagcac      7020
     ccggattaca tcaattgaga agtttcttcg ggatttgggt aaattagaca attcgcaatt      7080
     tttcagttca ttagtgcttt gtaaggtttt gctcgttgaa acctaccaaa aaaggtggtc      7140
     agttaccatt ctctttgtac ttttttccgt tagaatcctc ccaaataata ggacagcaca      7200
     ctatcagcaa ggccatatat aaattcagtg tatcaaatct tgttgtctat attggacaaa      7260
     tccgtaggat aagatgcttt tatggatcag ccaatgagag gggagcataa aaaagtctct      7320
     gaatcagtat tttgtacgct tgtttctatc gagacagaaa aagtgggatg aaacgggaaa      7380
     tttcaacaga cttaataaga aatgtcctcc cgagaaacag aagggagtcc atatttctgc      7440
     aagagaagca gttaagtgta atgattacag atgtaaagat attcccggtc gtgattttcc      7500
     cggtcgtgat ttatgcccga tcttgatttt cccgatcaat atttatgccc gatcttggtt      7560
     ttcccggtcg tgattttcga tgcgcgagat tagaaggcaa atcacagttc gttcgcttgc      7620
     agcagcatgt tctgtgggtt gtgcaaaaga tcgtgggata ttttgcttct acggtctctg      7680
     acaaaggttt catttcttat ttccgtcaaa ttgcaaaaga gttccttccg ctttaccaag      7740
     agatatagtg cggtccgggt ttgtctgtgc agaattgctt tcaaaaaaag aaagaagcgg      7800
     atgaagtcat ttttttcagg gatggaagtc ctgaccaaat taccggtggt gtatgggtgt      7860
     attcctgact tcttttctgt ggttgtcttg gtatcgcggg agttgagtgg aacgagtaag      7920
     taagctgagt aagggttgcg tgagcggtgg ggggttggtt cttagaattc cagaacaatc      7980
     cctagcatac gggtattttg ccattttgct ttcctgtttg ctcagagtaa gtcttcaact      8040
     gggcattaag tgccgagttg gtaagcacgt ctgcaactgt ttcaatgtac tagctccacc      8100
     agattcgaag aacgaactac tcaagtgttg tgcatttaga attttctgta ctacgcatat      8160
     actacagaga aatggttatt acgtaaagac agggaccctc atctagtgta tcagtaatct      8220
     ttacagagaa ggcaataaat aaatcagttg tttagcataa ctatatcaac agttgttata      8280
     tttttgcttg tgtactcctt ggcactccct tgagttgaga gctattattt ctcttcaaat      8340
     aatctcgtca cacaatttgt tcaaaccaag attgggtata ataggatagt actaagcaag      8400
     gtctctataa tcataagggc agcattatgt tcctgtctgt atatttgatt tctgagaagt      8460
     attctgtaag cagcgcatag aaaaataact atcgggcttt aggagaactg catgggtttg      8520
     aaaaatacaa actactgatt atcgttcaaa gaaaactctg taattgttta ataacgaaag      8580
     attatttagc aatatcaatg ttttagtagt tgtcgttgtt tcaggtaaat cccaaaaggg      8640
     gtatctcttt caagtatcct tctatattct aatttcctta tttactattt ctttctacag      8700
     cctagtaaaa attcatatac agtagtttgg gcaaagcagt tgagtaaccc ctttaatcgt      8760
     tattagcgta ttgcagttat atacagctaa caagcaagaa attggcttaa tgagtgactt      8820
     tgtgactaca ttgtagattt atgccaccct attatcctaa tccacttaat attattaatc      8880
     ttatgagaaa agaactccat gtttgtctag taatattagt attattttgc cttgttggtt      8940
     ttcctataag ttagcaaacc tgtcccttgt atactgctac attgcaaaaa tggaagctat      9000
     ttgcatgtgt tagcttatca attatataca ttgatagaga gtaatattat ttacatagtg      9060
     atattagtat atagttcttc ctcctcgtac taatcaattg aaggcagtca ttttttagtg      9120
     taacagtatg caaatactga tcttgatgta acgatgcagc aggggactct tttatattct      9180
     tctcgtcgta ttactttcat ccgaggtgat ttatctgaaa tacttttacc cggctattat      9240
     ttattctgct attctagaca tcattgatgt tgaaaagaaa aataagattc tattctgttc      9300
     agtattctct tgttatccat ttagatagta ccttggtgac tccagaggaa tcactctcaa      9360
     tttgaccaat caatatagta ttatggtggc acaaataaat acaccgaaaa tggtatgaga      9420
     tagaatggtc atgggttact ggcagtcctc cagctaactt taggtaatat tggaagtgca      9480
     atagagttga aggaagcaca acaaatagta ggaaaaacat agtatgaaca ctaataagta      9540
     gcctacggat gataatcagt cgaagtatag agaaaaatga tattagtgaa tagtattata      9600
     aatcttatag agagattaat ggcatcatca atacatgaaa gggtaactgg tctgacgcat      9660
     tgaaaaggga ctgttattga agaatttctt gagtttagat tattttggtc ttgtctattg      9720
     attcatcttt ttactaatta aaatgggacg gaaaaaataa ggctatacag aagctggtgt      9780
     attcgaacct acctattgaa tggttgtttt aagtgtttgc attagatgga cattattgac      9840
     caacaactct actcagttgt tactgcaaat tgtggtaaga tatttggctt tataaaacac      9900
     atggtagcaa catatcacat aagagcaagg aatagtcatg gtatgccaag gttcattcac      9960
     cttgtataca ggaaataagg ggtccaccat tattatcccg acctttgata gttaatgtaa     10020
     aatattaagc cttagccatg atgacacata cttgtaaact aaacgtttat ttgtggacaa     10080
     acattagttt ctatgttgtt taccgtggtg tggacagcac cggtatttca tttaatatat     10140
     tgaaaaacaa acaggttcat catatgttct aagtccgtct atactatctg tgtatccagg     10200
     tatcatattc aaattgtggc caaagaactt aaaacaataa aaattaagag ttcagacttt     10260
     aattaccaca tgagatgatt gtaatgataa gaccctcaga ggtatagatc gccttgccca     10320
     accactcagg tcaatgtaag gaaaatttat cctttagctt ggctcctagt tgatataatt     10380
     aattttagtg cactagatta gctactatgc catatgtaga tttgttgttg cttaatgatt     10440
     aaagcaatag atccagcact ttgctgtgtc cctcaataag cagggctagt tattgaaaca     10500
     gtttggagat tggcagtaat ttctccattg ctgatgtcta ataactcata aactaatgag     10560
     gctactcgaa taaagtgata ctaattgggc tgggtgtagg gagaaagtct tcccctagat     10620
     gaaattcaag cattaagcat acgttggaca gtatagaatg aatgaatttc gtaagatcaa     10680
     tggtatttat agacttagtg gttaagaaaa acgactctac catttcattc gtattattga     10740
     agctatatat ttggatcttc actgaacact tggtctctcc aactatagat ttaatattgc     10800
     acagatagtt gatatgtttt ggtaagtcct aagttgtgtg aaataaaaca atttctatat     10860
     atttgtgaac gtcattcact ggttttagac attattcaac cccacacatg aagcttttac     10920
     aagcgacatt tttaataaaa cttcatgaga aaaggtgaat gaatttagct ttttagacac     10980
     aaagtcatat gttttccttg ttattttaag attcttttta gtaaaaaata ctcagtactt     11040
     tctgttgcta atttatgaat aatacataat ggcgacgatt attttaaatg gtagcaacct     11100
     caaaattcgt cgaaagaata gattttggaa tgcagatata tcacagatct gatttgcacc     11160
     tagctttcag taattcgcaa ataaagggaa acagaattct ttgttatatg tttgtatttt     11220
     gcacatacct taatatgcgg atggattaca agaccaacaa aataaagtgc attttaaggt     11280
     ttatatattg gcagtttcta aagttttaaa acaactttaa tcctaccgat actggcaata     11340
     ttctttgctc gtgtgatagt ctccaagtat aactatatat atgctatggc ctatatgtct     11400
     gtacactgtc atttccaatt tttggtgtat ttctgaaatt tttattgcat cttgtaggag     11460
     tttatcagta gtagaggtat agtttcacac atgtatcgtt ttcaatttcc aaagaaatag     11520
     gcttgtattt tattctctgt gtggtttcgc tacagataga taagtaaaat gattctcata     11580
     ctcatatgaa ttttaaaact ggaaagaatt catcataact agcaagctat ggtttgacta     11640
     tattcattga agtatgggtt caacatgaag ctacaaaagc gactaaaaat agaggtgaga     11700
     atacgtaaac cactaacaaa tacaatggtt caggtaaccg gttttcagat ttactgaact     11760
     tgaaggtgaa ttaatgtaag gattgttcgg tctaattaca attggtacga ttgtcaaact     11820
     caatgttgat ctttgccaaa tgaacatctg tgtccgttgt aacacttctt tgatactaaa     11880
     tagtgatgag tatttctatg gaagcgttga agttaaatga gtatgatata tcatgactac     11940
     gacaaaacta cagccagtat tttaaaagta gtaacaggaa gcctgtaaat attttttagc     12000
     cacctaagta ttttgaacca tgcataacca tctaattcaa caaaggcttt ttgcaagaaa     12060
     ataaatctca tatactgctc ttttacggtt gataataggc ttatcacaaa gcattgatat     12120
     ttaacattta tgtaatggaa gttaacatat agcagttgtg gaggaagaaa gtgggagtta     12180
     cccagacact aacttatcta ctaatcttta cagtcctgtt tggtaatcgt ctgctctaaa     12240
     aaccatagta tgtcagggta attcatggga tattttgtag gtttctactg aaataaaaga     12300
     acaaatacaa tccatacaat tcactgctat atcaaaggga aataacatta tatagctgtc     12360
     agcaattcta attcaccgaa aaggtgaaaa tcaaagtatt tatatgttta cacaacacat     12420
     agaagatgaa aaggatttgc gatgcttcga ttttggtgat ttgatacaat cggaaagaaa     12480
     atgaggtata gtactgaaat attttgttca ttagcttagc aacaataaag ctaacaaggt     12540
     agctaaagct ccaattctac tcaaacaact taaattggca gcagaacctg catattgaga     12600
     aattacagcg ctcgaatgta gctcaactac agaaacagaa gatgttaggg aatgagattt     12660
     gcctgtgatg gcctcactag catcttgacg ccgtgacttt gttgtagttt cacgtgatac     12720
     aactaaagat cctgtagcgt caagatttgc atttgaagcg tcaatagtgt aacttgaagt     12780
     cctggtacct acattacctt gattgtcggt ttctgagcaa tatgtgataa ccttagttat     12840
     agttttaccg acagtgtcag tgaatatact ggttgatggt gaaggaattg atactgtctt     12900
     gtttgcaaaa gcagaattct gagaactggt ttgttttgat gtcaaagcca cagaagaact     12960
     cgatatggta actgaagagc tcaaagaagc ctcttgatga gatgtaacgc tttctgttga     13020
     gctgacagta ctcattaatg tagggaatga ggatgagttg cttgcaacta ctgaactagt     13080
     atgtgagtag ggactactcg aagctgaaac agaagacaaa gctgacacat ataatgagga     13140
     agaggaacca gaagtggaag aagaaccaga agacgcagca gaatatgatg aactaataga     13200
     tgttggtgat gaatttggtg tactcatgag agttgtagtc gtggtgctct atatatcatg     13260
     attttgtgtt ataatctatt tgttgatcag tgtgtaagac taatttgagt ttgagttaag     13320
     aaagactgaa gtaaagtatg caaaacaaat aaatcttttg aaattgtagg tatggttaaa     13380
     gtctttgatt atattattct taaattagtt aacgagcagc agctaatctg actgttaaaa     13440
     ataatgtgtg tttacaaagc tactggatca tacagtgtat atgatcttta ttggaatata     13500
     ttctattcat ttatagttaa agaaataaga cggtcatata ttctaacaag atatgatgta     13560
     aattcaatat attactcaca atagtgttgg atgtttattg tgttgatttt atttttcaat     13620
     ttatggaaaa tcatctgtat ctggtttgtc tacttaacca aaaatttgaa tggctatttt     13680
     gataaaagca ttctaaactt tgcatttatc gattaatgaa attaatgttc tcgaatacta     13740
     tataatatca aactgagtgc taataatatt agcatggttt attaaataat gttttactat     13800
     atatttgaga ctgttaaccc attagtttct gactattaca tttggtttga aaagaaaaag     13860
     cataataaaa ttacgtactg tgcatagtag aaaatgttta actgatagca gatctgttga     13920
     ttactttcaa actaaaatag ggtgtgttat gtatcccttg ttgatattct gatggaatgc     13980
     tattagagtt ttggtcctgc atcttttctg tcagaatact cactgaattt tataacgata     14040
     aatgtaattg taaatgctca cataggcatc aacaatgtag agtttcatat catgtaaatt     14100
     aaataaagta acatcaaact tatggtgata taatgtgtta tcaaatgagt ggtacccgcg     14160
     ttaaaggttt aggacacaac attaaagggc tttctgataa tgaaatgaca agtgctcgat     14220
     gaaagataaa tagggaaatc tgcagttaga acatacaatt gacacggaaa ggacattgat     14280
     attgctaagt ttctgctggg aggtttgtaa tatggagatt tgaccaagtt tttaagattg     14340
     attcctccgg aatttttcta gtcaagtata tgaatataaa tagattgtat ccgtgtgtaa     14400
     aactggtgag tcaaatctat tggtaatttt ctttttgtta gccagaaata aaattgcaag     14460
     aagttaaaaa gtctccggta actttttctg gttgaaattc atttcagcta attaaaattg     14520
     tagattttgc atcttaaatg aataacataa agagaaattt ggttagtgta gcagtagtaa     14580
     ttggaccaaa tatattaaag attgcaattt aaatgatagg atcaatatac ccattcacct     14640
     gtgtggtagt agcaactttt agaatttgta aaattgtcac taatgtatgg gaatgcaagg     14700
     ccttagaata tattctcaaa tttgcgctcc aaaccttcaa acgcgtgaga tcttgctttc     14760
     tctcacatag gtagtatgaa ttaatcacta aataattgta agtttatgac gttatatatt     14820
     ggtcactaag attggttata cccaaaaaaa aaattaccag taaggagcat tattgggacg     14880
     gatgataaca tgtaattata aaaaaaattg tattctgaat atgaaggatg atgctacttt     14940
     taaaaggatg accaactatg tgcagtttag catttgttct ttttcgatat cgataagttt     15000
     gcaaatatat ttttactagt tacatagtca ttacttaatg agagaaaagc ttttgcagga     15060
     ttttaaaaac tgggaatgag agtactagta attaccagac atgaatgctt tccatatctt     15120
     ctttgacatt ttcagttttg aaatttgatt ttaataatta ataatactct tatatttcat     15180
     tcatagacta attggcaaat atcactatta cgaataacag ttggacaact ttgaagttat     15240
     taaattaaac gacacattcg ggacagtatt agcgatacag gcaataaata catttaaaag     15300
     ataaccaatt agctcaaatc aatatcctct tctatttact attatgatct tattcatttc     15360
     ttatagtcac tgttgtattt aatagtatga aggatgagct ttaaatagat atctgattaa     15420
     tatttgttat tccattatcg tcacaaattg gctaggtcaa tcctaagaaa aatagaatga     15480
     tcagcacgag tattgcagtg ttagaggtag cctttattgt cgcagcggaa cctggtaaag     15540
     cagaagctgt ttgtgtgcta ctgaatctac tgccgttgtt gttaccagag gaaccagaag     15600
     gtgatagaac agtcgtggct gcctgttgac gtgatgatgg tgcttgtcct tgtccttgtc     15660
     cttgttgttg agcttgtgaa ggtacagagt gaggagtttg gctactatga ataccactga     15720
     ctggagatgc agtgtccatt ggactctgaa cagatggaga tccagatggt acaatattgc     15780
     ctaccgattg gtgaactggc ccagagccag agccagagcc agagccagag ccactaccac     15840
     cggctgtgcc agcagcttgt gttggctttt cgttgcccga cccttggcca gccacatttc     15900
     ctgactgagg tttctgagag ttaacaatac cacctacacc tgctgttcca ggagcattag     15960
     atcctgcacc ggatactgtt gagactggtg ctgcacttga gacagtgctt ccatgactct     16020
     ggacacccac ggtttgcgtt actgtggaaa ctattgtgtg accgtgctca tcagtacctg     16080
     tgctatggga tacaacctcg gtgaacgtgt gaccgtccga aaccacagtg gtggtgtaat     16140
     cagaccccac atttgcttta gaaatcgaag gtgcaggtgc attggtgatc gtggtggtta     16200
     ttgttgtagg attaccattg gagtcggtag tggtgatatg cgaaatgaca tcagtttcga     16260
     tactgccatt gcccctgtcg actgttgtag tgtagtcggc ttcacctccg acagagacag     16320
     tggaaatggt agttgttcct gtcctggtga ctccatcgtc gccaatagat gggaagtacg     16380
     acattacaac agtggcagta gcagtgtctg cactcacagt tgtcgtagtt actgggggct     16440
     cagagtaagc aagagcagaa gtgtatacac cctcacctac ttgatcatat gacataacgg     16500
     tcacagtagt ggtgaccgtc tgaccgatat cattggtcgt tgtaacatga gaaacaacag     16560
     ctgtaatcgt atgaccatca gaaacaaaca cagatgtgta atctggttct tctgttagag     16620
     tcacagttct tatgatcgtg gtaggcttgc cgtcagagtc cttggtcgtg atgtgcgaaa     16680
     caaggtctgt ctcgaagtca ccgttgccct tgtcgatcgt cgtcgtgtag tcggcctcgc     16740
     cggcatcact tggcttcaat gggatggtgg tggtgatcgt ggtaggcttg ccgtcagagt     16800
     ccttggtcgt gatgtgcgaa acaaggtctg tctcgaagtc accgttgccc ttgtcgatcg     16860
     tcgtcgtgta gtcggcctcg ccgctagcag tgatggtgga gatagtggtc gtacctgtac     16920
     gggtaacccc atcctcgccc tcagatggcg agtaagagat cacaactgtc ttgctactac     16980
     cgtcgtcctc cgtcacagtc gtcgtcacaa ctggtggctg tgagtaaggt ggagctgacg     17040
     tgtacacgcc gtcgtctacc tgatcgaagg aggccatcgt ggtggtgtat gtaacagtgt     17100
     taccgtctga atcagtggtg gtgatgtggg agactacttc tgtgatggtg tgaccgtcgg     17160
     aagtaatggt ggtggtgtag tcggcctcgc cggcatcact tggcttcaat gggatggtgg     17220
     tggtgatcgt ggtaggcttg ccgtcagagt ccttggtcgt gatgtgcgaa acaaggtctg     17280
     tctcgaagtc accgttgccc ttgtcgatcg tcgtggtgta gtcggcctcg ccggcatcac     17340
     ttggcttcaa tgggatggtg gtggtgatcg tggtaggctt gccgtcagag tccttggtgg     17400
     tgatgtgcga aacaacatcg gtctcgaact cgccgttgcc cttgtcgatc gtcgtggtgt     17460
     agtcagcttc ttcgcttggc ttccatggaa tcgtggtcac aatcgtggta ggcttgccgt     17520
     cggagtcctt ggtggtgatg tgcgaaacaa catcggtctc gaactcgccg ttgcccttgt     17580
     cgatcgtcgt ggtgtagtca gcttcttcgc ttggcttcca tggaatcgtg gtcacaatcg     17640
     tggtaggctt gccgtcggag tccttggtgg tgatgtgcga aacaacatcg gtctcgaact     17700
     cgccgttgcc cttgtcgatc gtcgtggtgt agtcagcttc ttcgcttggc ttccatggaa     17760
     tcgtggtcac aatcgtggta ggcttgccgt cggagtcctt ggtggtgatg tgcgaaacaa     17820
     catcggtctc gaactcgccg ttgcccttgt cgatcgtcgt ggtgtagtca gcttcttcgc     17880
     ttggcttcca tggaatcgtg gtcacaatcg tggtaggctt gccgtcggag tccttggtgg     17940
     tgatgtgcga aacaacatcg gtctcgaact cgccgttgcc cttgtcgatc gtcgtggtgt     18000
     agtcagcttc ttcgcttggc ttccatggaa tcgtggtcac aatcgtggta ggcttgccgt     18060
     cggagtcctt ggtggtgatg tgcgaaacaa catcggtctc gaactcgccg ttgcccttgt     18120
     cgatcgtcgt ggtgtagtca gcttcattat ttgaagcttg tgaagaatcg tcggataaca     18180
     tgaacagtgc ttcagcatcg acatattccc gtgtagcatt aaatagagta ctgctggtaa     18240
     caatgtctcc cttctcatca acagtgatga agaacgagat ccagtccgac tcgatgtagt     18300
     cagacgcagt agtggccgtc actgtcaaag gtggagcgct gtacgtgctg gtgctgctcg     18360
     tcgtgatcaa ccctccaaac tcgttggtgg tggtccagta agatacaacc tcgtagttcg     18420
     tcatgttgtt ctcaagaaca acagtgtgcg tctccactgg gggcgcaggg ccaaacgaag     18480
     tgtgtggggc ctcaggcaag ttgtagtcac gagtcgcatt gaacagagtg ctgctcgtaa     18540
     caatatcgcc cttctcatca acagtgatga agaacgagat ccagtccgac tcgatgtagt     18600
     cagacgcagt agtggccgtc actgtcaaag gtggagcgct gtacgtgctg gtgctgctcg     18660
     tcgtgatcaa ccctccaaac tcgttggtgg tggtccagta agatacaacc tcgtagttcg     18720
     tcatgttgtt ctcaagaaca acagtgtgcg tctccactgg gggcgcaggg ccaaacgaag     18780
     tgtgtggggc ctcaggcaag ttgtagtcac gagtcgcatt gaacagagtg ctgctcgtaa     18840
     caatatcgcc cttctcatca acagtgatga agaacgagat ccagtccgac tcgatgtagt     18900
     cagacgcagt agtggccgtc actgtcaaag gtggagcgct gtacgtgctg gtgctgctcg     18960
     tcgtgatcaa ccctccaaac tcgttggtgg tggtccagta agatacaacc tcgtagttcg     19020
     tcatgttgtt ctcaagaaca acagtgtgcg tctccactgg gggcgcaggg ccaaacgaag     19080
     tgtgtggggc ctcaggcaag ttgtagtcac gagtcgcatt gaacagagtg ctgctcgtaa     19140
     caatatcgcc cttctcatca acagtgatga agaacgagat ccagtccgac tcaatgtagt     19200
     ccgacgcagt ggtggctgtc acagtcaccg gtggaggact gtaggtggcc gtcgagtttg     19260
     tcgtgatcag acccccaaat tcattggtgg tcgtccagta gctgataacc aaatactcag     19320
     tcacttcgtt gcctaaatcc acagtttttg taattgcagg aggtgccgga ccaaaagtca     19380
     acttgatagt ggttctaaca gtgtttgtag gctcgccatt ttcgtctctt tcagttatat     19440
     gagatatcag atcagtttcg aatacaccat ttcctaaatc tacggtggtg gtgtaatcat     19500
     tctctaacct taatgttgaa actgtttgac tactggttat tatcctatgc tgatcatcgg     19560
     tagtgataaa gaaggatatc cagtaggatt ctatgtaata atctgttgta gttgcagtta     19620
     ctgatggggg aggtgggctg taagtgacga ttttagtact tgttccaaat ggatgattta     19680
     tgtcatttag tgaagaaaga taataatcca atacttgata ttcagtcaca ccattcccca     19740
     ggtcaataat ttttgtctct tctcgaagtt gattataaat tgtagttgtt atggttgttt     19800
     gagtattctc attaaaagga aagccacgag gctttgcagt tgctatcagc tcaattattt     19860
     cggtggtata ttcattgata ttggtagttg ttatagtagt ataagtgatt ggttcaaata     19920
     aaatcatttc tagaacattg gcgtaattat gtactggata tctgtaggga atttcatcaa     19980
     ttcttttgcc cttaaaataa ccagcgttta agcttgggtc aactttcatt gttattgttt     20040
     taactggatt cgtatgtcta atttggatac cattaatacc tgaagttaac gctacattat     20100
     ctccagcatc ataaagatat agcaacccaa ttgtacgagc tgcaggagcg ttggggtcgt     20160
     aatgatatag ataaccatca attttaaaac catcctgacc actaggaaga accaagttat     20220
     aaataaaatc agaagtacct ttataaggcc ccttacttag gtcaatggtt atcggtgtaa     20280
     ccacaacaaa tccggtgtat cctaaagtat gtaaaacagc attattagta cccttgaata     20340
     tatcaccgta gacagcaatt aaacactcac agtctatatc accagacata ttattgggca     20400
     tagaaaacgt accagtatta tcaattttgt ctgggcctag atccagatac cacagacgat     20460
     cagtgaagta ggttgatgat ttcgctcctg tagatagtac ttgtaatttt cctaatattt     20520
     gaataggaga attgtttggt gcttgatacg taccaccaat gtgaatacgg gcagtattag     20580
     tagttgcaac acctttcaat aatgccggca atgttattat catgctgcta tctgaagaaa     20640
     cataaacacc atcagccccg gtattaatgt caaagttata attggttacg gcatctggtc     20700
     cactagcata agttaatttg ctaccatcat aaacaaaact cgacccacta tcaattttga     20760
     ccttaccatt aatcaacagc tcattcctga cactttggcc accaggtgtt attattgtta     20820
     gtgtagagcc accagtcaac gatataccag caggtaattt aattgaggag tagtttttta     20880
     gagtaacttt agcgttattt aacaccatga gttcatcatc ctcaaaagta ggagagccag     20940
     aagaggtgct atccagaaca acttcctgat tctcataggt tttagctacg gcattggtcc     21000
     atgtcagggc caaaataaag gccttaaaaa cctctttgta tttcattagg acttagttca     21060
     aaaagtaaac tatctgtaat attatactct cacttaatat agattgtttg gtaatttgtc     21120
     aatattttta aatttttcgt aacctttttg agtagcttgt attataaaaa ggtactcacc     21180
     tttagatgtt gtaaaacaaa ccatatccat aaaaccagat attcaatttt gaaaggaagg     21240
     gagattatat aaaaaaaaaa actctgacta ctgaaagttt gatttgagga atggtttttt     21300
     caattaattg aactctttca agtgaatcta aaaaagttga atacagtaaa aaaatactgt     21360
     agaaaccaac tttaatcttc agctttttgt agttcaggga cttggcagtt aaactgtatg     21420
     ttttctgtga acatattcaa ttgaggtcta aagcgagggg ctttcaactt caagtaaatc     21480
     ttgtgctatt cttatccatg gttggctttc gataaaatat ctataaggtt cataacactt     21540
     tgctgtcaga atatcccatt cattcctttg gttatgcaga acataagcag tcaagaactg     21600
     aaaattttac tagtaggcat agttcttaaa gacttgctta catattcctc ggttgttgct     21660
     cgggatcaga gcttttgctt agacaacaca aaactccctg ttcaccctta caccacagcc     21720
     ctcccttttt tctgtttcgg ttgctggtat attgctctac ccagcacaca atgcagtgaa     21780
     ggatctctgt ggtcatctcg atggttccgc gctgtttata acattactcg gctgatacat     21840
     ggttgcatga ggttctctgc aaaagtacgg gatctcgcga ttatatcatg ctaattcgtc     21900
     ttactaattt ttattttgac tgggaagtta acggcaccgt cgatatcttg ttcccacccc     21960
     ccttcccaac ccacaacata ctttcttctt gcaactgtat cctctctgct atagtgtgtg     22020
     tcgtagagaa aaagttgagg ccatatgaga aaaattcccg aagcccttta ttttttgaag     22080
     tgtacgaaat attctctggg atttgcggga attcaaggga tgtgcacttt ctagcacgaa     22140
     gagatcctcc cgggtactct attttccgag ttccgttgtt ccattctgat cggggacgtt     22200
     acttcctgtt tgcagagtgg attcggaaag ttgtagaaaa tggcttatta aaatttgtgt     22260
     gggggggttg gcaggcagac taggctacca atcataggtc taaagtgtaa gagaactatt     22320
     tagcaaccaa gattgtattc tcgcattcca aggactatga ttggtccatc aaacatattg     22380
     tctgtgtgtt agaacggctg atatattccg catgccttga agaacgcatt tcggtcgcgg     22440
     aataaaaacc gaacgttacc atggctcttt tagagcttcg gtgctacttt atgtgtggat     22500
     tataaaagtg tttgtatttt ttttgattga taccgggaga aaataagatg gagaccggat     22560
     caaaaaaccg aagtaaagac caagtagcaa agctgtatgc aaatgtaatc tgacaaggtc     22620
     aaaatacatt caacccaatt ggcttgatct agcatgtagt cgattcaatg attctatggt     22680
     gaaactagtt gtctatctta tccactatta gcgtgggcag ttgatctgca tttgagtttc     22740
     tctattcatt tcattgtctc tgtgtttttt tctttttgct gtgggtcatt tttcgattgt     22800
     ttcatctcgt atagacaagg tctagatgat agcagttcga gtagtaatat ttacttaaaa     22860
     tgagaccctt aacttattct tagcgttagt tcaacgaaga gactcgttat tctaacaata     22920
     tcttgttatg taaaaccctt tagttgaaag atactctctc catttgctag tggtcaatca     22980
     gtagcttgat ttaatctcta aaatgctcta cttccaggtt tttgtgatca cagctggtta     23040
     ccaaatacag caaaaataat aacatatcac agaatcgatt cttgtactgt ggtaggtttg     23100
     acttctctat gtactgattt accgtctcct tagtattgcg acggatgagt ttgcagcaaa     23160
     tttgttgttt ttttttcgtc gcaacggcaa aatgaccaat aaggaatcag taactgaaaa     23220
     cgttctctta tgatattttc gaggttagat aaactagcat gtgtagggtc acataagatg     23280
     ggtattccaa ttgttattta tctgtaaatg tttcttaaga tgtactagct aatgttgtgg     23340
     taaaccctaa taggatcgta tgttcttttt ttattattat tgagcgcact acagactaag     23400
     catatgtgag ctacctacta atataccagg agagaaagtg attcaagatt gtctaactta     23460
     atttctaggg gggaataagc tattcacgtt ggatataaat acttaacgat gattcatgat     23520
     tctatgataa aaccgtataa ttacttttag agaaggtatc tacaaaattt tattatacta     23580
     atgaaagaag aaaaaaaaac taaaagaaag gattataatt ccaagtagtt ctatagagtt     23640
     atatatgttg aggttctgga ataaaatttt atgttgaaca attatttgga agttgaataa     23700
     gcaacttaga tattaaggtt taaccaaaat attgtatttt ttctaaggtt gttaaccact     23760
     cgcttcttta aaccaacagc aattgcatac tatcaacatt tacatatggt gtaatcagtt     23820
     tcgttttcaa gctttttatt atggttaaat atatcagata cttattgtgc atttagtgta     23880
     gagcaagccc ttggagatac ttattggtac aaatttcact atttggagat ataagtcgga     23940
     tgttcggcaa gttctgtata taaaaaagag tttctcgagt aaaaatttat gttaattggt     24000
     tgagattaag aagattccaa cgctcccctt attatatatt ggagttggtg ctaattctag     24060
     tatagttttt atgagtttat ttctgtcttt tgaatatatt cttgaatata gtacggtaat     24120
     ggttagactt gtatttgaaa agataattcg tactttaatt atccgcataa ataagaattt     24180
     cgtttttgta tccagttata gaaattgcca taaggtttta gtttctatga taattacttt     24240
     taaaataggg ctgttacatc aggggtgact gctgaaaaag aggttacgaa gtaacgaatg     24300
     ggcaatttca tttcagagta ttacatttga atggcattaa tttgctggtt aaccctgtta     24360
     acaaaagcgg tatttcaaag gaatttctat cctagagctt gaaaatagaa gacatagcat     24420
     gaaacaaata taaatcctaa tataaattta cttccatcaa cgttgaaaat ataataacac     24480
     ttccaaaaag tcatatttga taattgatac agaatgttct tactccacct ggttgtcgca     24540
     acttctgcac atgatcagta attattttgc gaataatttg gtattgtttt acaatactaa     24600
     agcttgcaaa cggtacgcat catagttaat ttcaatcgac aaaaattgtg gctattgatt     24660
     gattatggta taattgaata aaatacgtag ccaccggtaa ttcattttcc ctctttggaa     24720
     tctaattaaa tttaatatct ggtattgcaa aaaacctcaa aatcaggtga aataaaatga     24780
     aatgtcatga ttcaaaaaag gaagaaagaa ttcattcagc actaatttta ggaccctaaa     24840
     agatgtggtt atatatttaa taccacgagg agactgtttt aaaatcattc tcttcagtat     24900
     tatagtcaag gtactaaagg tatatccagg tttttcttag cagcagattc acggaattac     24960
     tgaaatgagc ttctgtatgc agttcaccta atttaacagc gtactactgt ttgcatgagt     25020
     acttgtatac aaagataagt tggtcacaaa gcctccccca tactcagaat gtcttataga     25080
     attcattttt tcaattcttt tgagtaagat agaattgtat acttccatac ctattagatt     25140
     atgaaaagtg tgatagttca aattcattat agtgctgtct attgatgagc agatatatca     25200
     attttacttc tctctatcta tctacctatt taatagcaaa tacttttaat tcaacctgat     25260
     tatttggcta aagaataaat ttgatgattg gactgtgata taatcgtcaa cattacatca     25320
     gatagcagtc ataagaaagt aatatgtcac taaatattct ttttcaactt gaattaaata     25380
     gtcaacgtaa tagtgggaat ttgacagtaa taatctcagt agattattgc aaaacataga     25440
     tcatccttaa atactgaata attagcattc tgtacttgca aataagcatt ttatggataa     25500
     cagaacggta gaggtgaaat gaaattattt atgttatccc tggttaaagg aacagtgaaa     25560
     aaatagaatc gaacaaatat tcgttacata aatgaagact atatttatca aaatgtcata     25620
     ttagtctaat atagttacac catattcctt gtcttcacca aaatagtcct aatagataag     25680
     tagaggtttt caacctctat ttgaagccgg ctgtattcaa gtgtagagag tcaaatgaaa     25740
     gtaaattttt cattcaatta aaatacatat atatagagtc ttatgtatat tgatgtgaat     25800
     tggaacaatt agcatcaaaa ctaggtccca gtaaatattt tctaatctat tataataaca     25860
     ggcaaacatt tggtctaagg atgtcatggg cgttgattta tgcaatatta cactccttag     25920
     cggttgtgtg cgaaggtttt attagcacag aaggagatat aagtattgtt agggattcta     25980
     acattccaaa taattatccc ttaggatgtt caaataaata tagtggccat ttacctggat     26040
     tgaagatgga actgtatagt tacaattatg tgaatccgag acatccagat ccacaaaatc     26100
     caggaaaact ggatcagcta tatgacccca accttttggg tacatatgaa tgctttgact     26160
     cctcatataa agacataaac tatccaaggg ttggatataa atcaaaaacg ttgatcggta     26220
     gatctgatgg ggtatctggt attttaaatt tcaatttcgt cccaccatgg ggttgtatgc     26280
     cacagaaagg ccaactgcca ccggcatata actttaagtc caatattact ttgtccaatt     26340
     ttactatgat attgtttggc tattttaagc caaagatttc aggcaaccat atattctctc     26400
     tgcatggtga tgatctaata tatcttaatt ttggtgccgg caatgccttc gactgttgca     26460
     gacaagagag tagtgcagat aattttggta attatcaagc tttcagtcta tggggtataa     26520
     actgggaaaa gaaaacgctt actgtgtacc ttgacatgaa tacatactat cccatacgga     26580
     ttttctacaa caaccgggac tatcaagcaa tttttaattt ttctttcaaa acagaatttg     26640
     atagtagccc cgtcatagac ttccaggatt attttttctt ccttcgagat attgatgggg     26700
     gttgcccagg agaagttagc tttcaaacaa catgtgggaa ttttcctaga acaataacaa     26760
     aaacagtaga ctatgaagtt gtgtcaagcc atccagttca gttaccatat acaaaaacga     26820
     tatatcatgt gcttgtacca tgtaccagta gtgtgggtgc aacgatatgt acagacggtt     26880
     attacgatcc catatcaaac atatgtcatt cttatagctc tatgataatc aaaaaattat     26940
     catcagtttt accttcaagc tctatctcat ctgggctaag gctaagctct tcgagcacat     27000
     tttcatcgat tccaatgcca tcagtgacaa catcaaagat aatgtctagc agatttgaag     27060
     cacctttcgg acctaggata ggaacttggg atctcgagga caaaccagaa cctgcttcta     27120
     aacagcttgg agatttcata gtagatataa atgggatgag caggtctcat ttagctcagt     27180
     tttcggttaa tctgccgtct aatgacaccc agcgcccata ttctaaacga aattcaagct     27240
     tctttccttc aaatctctct gatagagaac cagcaacacc gacatcatgg atatatatgg     27300
     aaaccacagt tgatccatta gttacttcct tgagcccaca acaagaaaat aaaacacatc     27360
     agaagcaact atcatcgcca tattttttcg cctctagtgt tgatcgatca ttaaattctt     27420
     catataaatc tagctcgcta tacttagatc acattcttcg atcctctttt tcttcatcca     27480
     tgaagctgca ccaatcgcgg gattatgcat ctgaaaaaca gaaactttca tttagcgagc     27540
     aacaatcatc tacatcatca aaagttcttg cttctaaact gaaagacatg agtgatagat     27600
     cttccacgaa ttacagtatt gtcaggcatg caactcccca tccaaatttt tcccaaatac     27660
     aaagatcaca gccaaaatct aaatatagtt acttgaactc aactgaaagc attgatggaa     27720
     ttcctactgc acataagttt atgtcaaagt taccggaatt aaggtcacag ttcactaact     27780
     ctccattgtt tacaaagatg ggtgccatag gcaatcactc accacaattt gtgtctgaat     27840
     attcacacta ctcatcatca atggataatt tgagcattgg atcggatact ctagaatcat     27900
     ctaacttaag ccgttcctca atcgcgagta acccagttaa ttcgagttat tttactaatg     27960
     atgtgtttga aataactcaa ctaaataata aaaccgacag cagatcaata ctctatggag     28020
     acgatacaag cacacagact gcaatctctg aaagtacacc agcgtctgga atttcagttc     28080
     ctacactaat caacatcacg aggaacttag tgcatgttat aaatgtcaca gcagaagaac     28140
     ttaactggaa cactccaccg gctgtggaca aaaatgatgg cagctcaaat ttgattacta     28200
     ttaagtggtt ctcagatgta tcaactttgt tttcatacgt tataggtatg gctgatgatc     28260
     aggataatat atacacgact aattgttgtg gttcatgtca tcatcattat catattcata     28320
     gtatcaatct acccactttc acagatttct attcaagagt agacaccaat aatgaaaatt     28380
     caaatcttgg aattcaaaca ttaaatgaca cgtttaactt aattagttct ctaacacata     28440
     atggaggatc tacattttta aaagcctcaa tatcatattt gagccttaca gaactaataa     28500
     taggagtaat tctcttatgt tgatcttgga aggtaacaaa ttttgattaa actctaggat     28560
     tgtatcttga gaactctttg gctaccttaa tagtgaagtt atatcatata gaatttaaca     28620
     tctgttctaa tattgacgtc gataatggtt atgccttact ggaaaacttt aacgtcgtaa     28680
     ggttagtgtg gcacctaaat gaaactcaat atttgtggat gattactggg tggaatttct     28740
     caagttatgt aaatattgac cttttaagtc gtttttttgt ataaccattt ttgtgataaa     28800
     agaaggcatg atttcaataa tgtattcaca ttatagtaat gggttaacat ggtcttcttt     28860
     ggacatccgt atttaatgac tccgtggcca agctggttaa ggcgtgcgac tgttaatcgc     28920
     aagatcgtga gttcaatcct caccggggtc gcgcttgtgt tttatttttt tggatgttta     28980
     tcgttataca aacttgtcct caagggtttg atatctagtt tcattctttt gctcttcact     29040
     caacgtactc cttgatctat gtaatagtta ctattctaat tgagatccga aacaatatat     29100
     agactttggt aaggttttga ttgtcccgga aaatcaaaat gaacagtgtg ggcccttttc     29160
     tttacaaatt tgttttcttc ttctgtttgc tacccagttt ttgatctgta tttttgagag     29220
     gtttgtcttc tgtgctagat attgctggct gttgtggtcg aggtatgggt tgtcgatatg     29280
     gttgcggtac caggtctcta gtatctgtac gttttccctt gtgaagcggt ggcctcgata     29340
     ggaagcggca tagtgattgg ggacgccttt tttaagcaga tggtctttgg taaccacatt     29400
     gaatacgatc tcatgctccc gtagttttga cagaagagta gacagtcgat aggttgtctt     29460
     gatcaaccct atctcttgtg ggtccaagtt gtttctcgat aggaacctta ggatatcgga     29520
     cgacggcccc gggagcgact gtcttttggg taaactggaa cacaatgata taagttggtt     29580
     attaatctct tgcaattttt cctttaaatt ttcttcttgt tataacttgt gtcattacta     29640
     ttcaaaatct ttagacaaat caataatatg atgacagtag acccaataca agatctacgc     29700
     aatatctgtt tacagatatt gcaatcggtt aattctaata ctctattgga agaagaaaca     29760
     tgggattaca acacggtaag tttacgataa tattatcatt tcaaatattg agataagcac     29820
     tactaacacc gacaataagt tgatcaacaa catagattta cccaaacaga ctagagaagc     29880
     acttcgcaga agtgcttctc aatacctgct gtattgtcaa agaaaaaata aaacatatac     29940
     aactaggaag cctctaccag caaaggccaa gctacaatta gttgaaacat tttccaagaa     30000
     acggtacctg actagatgtg aaaaacatca gttggcggtt caatgtggga tcaccaccaa     30060
     tcaagttcaa atttgggtat gttttctaaa ttgagtgaaa ccaattcaac ctctgtagta     30120
     aatactaact tagaacatac agtttgcaaa taggcgcaag agatcgaaag atctaaacaa     30180
     tcgtgactag ctatagttcc tccttactct tttatagttt tctccccgta caattcaata     30240
     caaaacaatt ctttaaattt cgcttacttt gcaatccaaa ctatctgctt ttcgcaacag     30300
     tttaattttg cgagtcctcg gtgtgggttt gtaaattata taatggccca tgcgtcctca     30360
     gcgccatgac agaacttgga gcaggcgacg gaggcggaga gcgggtagtt agatatagct     30420
     attttgtcat ctacatattc atcagcaaag gagtcgtggc ctctcgccat cgcccccaca     30480
     aatacacata ctgattgctt atccccaagg tactcctgcg gcctcatcac ctcagcgtca     30540
     aaagaaagag tgaccttcca acagtatgag aaagcttgca atcaaagtgt tctgataaat     30600
     ataagatcaa aatgaacagt tccatatctt acctctcaat taaaaatact tcaatatcca     30660
     aatcatatca gcacaatgct gttaactcca gtcagcatta taacttgcaa tccatattta     30720
     ttcattggta cgactattat aatataatca taaaacacgt atatttacct agaaacggta     30780
     aagtataata tacgattgtt tatcaaacct cactatctat tttagtttca ttttggcatt     30840
     cgatagtgat cagcacataa tcgtatgtta gtagtacagc caatatttgt actgacttgg     30900
     atacaaatga atcactaagg tctctatatt agccttaacc gattaggcaa tattacgtcc     30960
     tgaaaacacg cattatccat tataaggcaa aatcgcttag atgttcctgt catgtacagt     31020
     aaatctaatg caacacaaaa attaagaaca gttttcttag tttatttgaa gcatgagtat     31080
     taccatggga gaattgcagt attttcttga aagtgcggca cctaattacc attttgattg     31140
     gctatacgct agcttttgtg ctgcccatcg agcaattggt gatttttgca tattaattgt     31200
     agattatcaa atgctgctta aattattttg tatcttattt agcgaatcgc tgttcaaact     31260
     cctgtgccct gagcagaatt tgaaaatgta actattggat gcgaaatgcc caatcagatg     31320
     catttcctat agtcacgaac tcatttgtag tggctccagt gcaatatatg ttattatcaa     31380
     tcagtcagtg caatctagga tccatatatc acttaagttt aatggaattg atattccaac     31440
     agaaagcaag ttcgatatgg cgctaataca gattcaggtt ttgttgttct gtgtcagcgt     31500
     ttcaatcatc tgatataaca cttttgacat tcatttccgt tactttcatg catgttgcgt     31560
     attattgacc acttatttgt gcctatgtgt tatttgccaa tccaggcact gccttttcta     31620
     atctttaaaa ggcttcacga attctgaaaa taatccatcg tttcgtgaga gcctgggcat     31680
     ttgatgggct taacgaaagc ccgtgaacga gttgcgaagc aaagctagtg catgttatac     31740
     agtagatcaa tgctgcacaa gattgatgaa atgctttgat ctggtttaaa acagagggtg     31800
     gaagtggata agataagagg cctattggat ttacataaag actcggtgtc accgtattct     31860
     tcgagatttc aaaggacaaa ataaaaacgg cagcttctat acagactggt aaggaattac     31920
     agaaatccga agtttacatg ggacttgatt ggatataaga tgtttgctag aggatcgaga     31980
     ttatttttat acaggcctgt tatacatagg aattcctcca caaaaaccga tctaaagaag     32040
     acacagacat ggactcaagt gaagcagtta ttgcgattag ctaagccgga gagaaagtac     32100
     atagcaggag ctgtagggct tatagcggtt tcaagtgcag ttagtatgag tcttccttct     32160
     gtgattggaa cgttgataga tcatgcatcc acgccagatg cgcctattta tggcttgact     32220
     aggaatcagt ttctgctggc actgggatcg gtttttgttg ttggagccat tgcaaattcg     32280
     ggtcgaataa ttatactaaa gattacaggt gagaagttag ttgctcgatt gaggacaaag     32340
     acaatgaaat ccatgctttc acaggatgct acctttttag ataaacatag agtgggcgac     32400
     ttgatctccc gactctcatc tgatgcatca attgtctcaa aaagtgtaac ttccaatttg     32460
     tctgacggtt gtagagcaac gttacaaggt gttgtaggca ttggtatgat gacatatata     32520
     tcattgaaac taactactgt aatgacaatg atggtaccac ctctgggaat tctggccatg     32580
     ctatatggtg gcaagatcaa gaaaatatcc aggcaattac aggataaagt gggtcaacta     32640
     tcaaaaacaa gtgaggaaca attgaactcc ctaaaaactg tgcaagcgta tgcaggtgaa     32700
     aggaaagaac tacaaagata ttcgaatgag gttaggagtg ttttcaacat tggagtgaaa     32760
     gaagcagtgg cctctgcttt gttttttgga agcacaggtc taattggtaa tattgctatg     32820
     ataggcctac ttctcgtggg gacggcagat agttcgatta cccttggcga gctgtctagt     32880
     ttcatgatgt atggtgttta tacgggttca tcagtgtttg ggttaactgg attttattcg     32940
     gagctaatga aaggttgtgg tgctgcagaa cgtgtattgg aattacaaaa tatgaaaact     33000
     aaaatctctc caacaaaagg tatctctcct ccaaaaactt tgaaggggtt acctatcaca     33060
     ttcaacaatg tgtcatttgc gtattcgaat ggaaaatcgg tactgtcaga gatgaacttt     33120
     caaatacatc ccggtgaaca tgtttgtttt gtaggtggtt cgggttgtgg taagtctact     33180
     atcagttcat tgctactacg ttattatagg actgggtcag ggaatattag cattggtaac     33240
     tatgatatat cagcgtttaa tttaagaaaa taccgtcgta tgctaggtgt tgttcaacag     33300
     gagccattac ttttcaatgg tactatactg gataatatta cctacgggct tcatgacaaa     33360
     tccttaactg acctaaacat ggcgttaaaa gcagccaatt gtgatcaatt tattaaagag     33420
     tctcacatgg gactagatac cttggtaggt cctagaggtg ctcaattgtc tggggggcaa     33480
     agacagcgta tagcccttgc gagagtgttc ctgcaaaatc cagatatctt gatcctggat     33540
     gaagcaacta gtgcattaga tacaaaaagc gaggatatca taaataagga actacagagg     33600
     agacaagagg ctgggatgac taccatttcc attgcacaca gattgtcgac cattcgtcat     33660
     agttctagag tcatcgttat cgaggatggt agagttgtcg aaagtggctc attcgatcaa     33720
     ctaaggtcta caagagatag tgagttaaat aaactgttaa aagagggtct ggaacatcat     33780
     aaataggatc ctcaatagct ggatatgcat aaagaagaat tgtcgaaagg gaaccagaac     33840
     tgtcaaaaat cactctatta cattaatggc atgcattctt gatgacccgc taatttcaaa     33900
     ggttattttt attatctcga atattagtta tgtctatcac agacttcagt ttgtaaatat     33960
     ttaatgattc caattaatat ctattctttc gcaaatgtaa tattacattg tacgacatta     34020
     tagaaagaaa tcagtgatga actgtaggat ttgatgggct cacaatcaaa atgaaatcat     34080
     aatagtcact tcgatctagc ttctatcaac tgattatgag atagtagttc ggttttcttg     34140
     attgtgtgag cgttttaagg aagcagatcc atgttacaac agtgacggtt gcttacccat     34200
     agcgtgcaat ttgaaaaaag caagtctcct tagggcgatc attattaaat cgagtcctta     34260
     aaagagaggt aactagatat tgggggtaag gagtttgttg gcaacgaata aaacggatag     34320
     ttattattaa ttaatagaca atcatgcttg ttccaccagc tagctttggt attgccgaag     34380
     agggcatata taggtgttcg aaagtggaaa cattaaactt gtcattctta gagggtttga     34440
     acttaaagac agtaatattt gttggtggta cggagccatc aaaattcttt aaggaatttt     34500
     tcactagatc atcaattgaa tggactgcaa ttagaacagc agatttttcc actgtgggct     34560
     cgcctttgaa gaatgattta agccttgtat ccccacactc ttaccaaaaa atgcattcag     34620
     atgaagatac acaatctaga gaatccctag gggaagatgg agaatccatt catagcggga     34680
     caagtttaac tataggaatg aacaaggtaa tttctcccca gaagatggca tatcatttct     34740
     ctgatagtga tgatctcatg ctaataaaaa gtaagagcct gcaaagaatt tttgaaaagt     34800
     tactagatag aaagaactac aatacactgc ttgtggacaa aacttctttg gtaattggca     34860
     tcctgcggaa aatacaaaaa tggaatataa gttcaattat taatgaatat agattatttg     34920
     ctggaaagaa tagaggatac tttgctgaaa cttttcttga aatgattcaa atcaaaatag     34980
     aacaaacaat cgaagagcgc agtttggatg aacaacaaat agacacaatt gttagtgaag     35040
     agcagcaact cccgtgcgtc gaacacaagt cgaatcccgt tgaactagtt gatgaagact     35100
     tactttgcga cgaaccagag gtaccagaga gacagctaca tattgttgag gaagctgaaa     35160
     gaaaaaatag aattaaagac atcccaaggg taaataacat attaataagt gatacgtcaa     35220
     catcttcatc agatctgggt atatttggtc accgttatag actcgctttc actcaaaagg     35280
     agcagggcca atatgagtat tataagtcac aagacggtaa tgatgatata gagacagtct     35340
     gtctcaaaat tcccaaagaa aacgacttgc cgggctggtt taagttccaa agagatttat     35400
     gggaacaaga aaatattcct caaatacatc atttttataa agaacagata tatatataac     35460
     tgtgcatagc attcacgaaa gacttcatga cctgagaatt aagctgcttt ttctagcaca     35520
     atgactctgt aggctgagcc agatactaag acgaaaagaa ttaggataga attctccagt     35580
     aaaaatatga tcctgttgaa ttactacaga atctcccgca gtgccaagtc gttattatct     35640
     ctagaatcag tctcttcatc aaatttcaaa aatgcgtggt cacccattgc tctaggctga     35700
     aagaataatt tgataataaa gattaatgcc aataagcctg acaaacaaga aacgattaag     35760
     taaacaacac caagggacat atttctgcca ccaatgacac tatttgttgt tagtacaaag     35820
     gactttgatc ctccaaagta cgatatggga taatgtaagc caatagccat gctgtatgta     35880
     cctttcggca atggtgccgt ttcatttttt aaagcgagtt tataaaactt cggtaaagct     35940
     gcagtacgca tccagacttg aaattcctcc cactcatgta tattaggaat attatcctca     36000
     gtgtatccat caggaaatct ctcacgccaa ttaggaggtg gtataatttg agaagcattg     36060
     tatgtagttt tcttgaacct ttttctatcg atgctccatg atattttttt gtttgtaagc     36120
     tcatagtctg agttagagtc accaactgcc ttcaattgtt ggtcaaaggt atcattgaac     36180
     atagaatttg caatcatacc acaagggtaa actatcttat caccctccgc gcgaagaggt     36240
     ctacaagccg tggttaattc atctttggat aaggccttcc ccaggagctg cttatagtca     36300
     aatgactcaa catatcttct atggttctgg tagaaattgg ttaatttgta gtatatataa     36360
     acagaatcct tgatatcatc cggtatctcg aattcaagaa tacacttgga ttcgtcatct     36420
     tcattctcta acttccatct ggccttgcta gctaccttgt gtttaaagtt gtgatgaaca     36480
     tactttttcg gtatatctgt aaaatcgcct gtgtttgcct tggtcgagca gtggctatag     36540
     tcaattgtga ggtcctgaac acctttggca ctcaatatta gacctacgcc aattggtgtg     36600
     aatatgcaag catagaatat tagcaatgga agtacactct gcggtgatag tattggctgc     36660
     catgatttca atctctgttg tctaaaggct gtattggggg gtttattgga tttgtgttcg     36720
     gtgcccataa gcgaatcctc cggttcagca gcctttttga agaaccacat ttcaggccaa     36780
     ttcttctctc ttgttacaaa aagctttcaa atttcagtta acacctgatg ctggtggtaa     36840
     ttgtaagtta ctatattaac cataaacatt tctaattttt taggccatca gttgtgactt     36900
     attattgaaa tttggtggag caggaatgat ttaaaactaa aaacccgaaa tgatcgagtt     36960
     tgacggtgaa tatttggtat cgatgatgga agctctcaga cttgtagtca ataccggaat     37020
     aagttcttga caagccataa tggttatgag gacgcttttg gcagctgcgt tagatgatct     37080
     gtgttgctgc gagcagcatg gtcttaaagt cttttcttta ctgacatttg atatgtcaaa     37140
     ttcttttatg tttggcagtg aatataatgg cgattcttta taatattgtt tatcgacaag     37200
     atctatttct atttagaata attacattca actatttaag cattaattgg ttgtggttga     37260
     gtttgtgaat tcaagtccac atcattaagt ggggtggcaa ctgacattgc atttgcgtgt     37320
     ttaataagtt gcttgaagat gagctggacc tccgattggg atttcacgca ctcaagttcc     37380
     aatatttcaa cgtctttgtt cgtaatcaaa gtgtgcatca tcatggttac accccaggtg     37440
     tgaggtttgt tgacaattag tctttctaat agtactctta ggatgagttc cctcacaata     37500
     tccaattgat catcccattc cttcgagatg aacatttcct tgattacaaa actaaaccaa     37560
     tacgtgtgga tgttaggata tcttaattgt tcaataatgg attgtatcat ttgatatttg     37620
     atttcagctt taccttcctt gataatctca aataatagag tatagtaaga cgattttgtg     37680
     ttgaagatgg cattcgatga agttttttca ttctccaagc cagcctcgat accagtgtga     37740
     aggacaatag ccctaattag cttttggtta actgatactg cctcgtaacc aaggcaattt     37800
     ttcctgtgtt tttcatcaga gtataaacca tttacaacag tcctcaacaa ggaactcgaa     37860
     gggatacgga gatagttgtc aacaggcttc tttaagttcc tcaagtcagc tacagggtcg     37920
     tagtaaacat ttggaacagt ttgacattct ggcatatcct tcatatgaac attctgatca     37980
     aacggattag ggatggagat gccacgagga atggctgata agatgacatt ctttagttgg     38040
     aaatacgttt gcggcaaggc gttcattaat tcgtaatgat tctcgatcaa aaattcagga     38100
     tagtcatttg atattgccag cattatacgg agtgcccctt tataaatgac tgatacagca     38160
     tccgaaacag aattcttttt ggtatacttg tccagaaata agaacaaatc catcattaaa     38220
     atcattaaat ttttccaacc ctttttatca gaaagtctca acatttctgg taagaacatc     38280
     ctatgagaca acaaagtcac ccatgcaaat gaaaagccag taaaagcaaa tggctgtaat     38340
     gaatgtagat atagggcaaa agtgttataa aattcagcat caaattgttg taggtcttta     38400
     cgattgtcag aatttttaac attaacaaat ttgtgggttc taatctgtga ccattcgtac     38460
     aataaattag ataataatct gaagtaaggt ctttcattga aggttgtgtt agtttcacca     38520
     tgatctttag caaacactag caatatcact gaaagaatca tattgaaata gtcccctcta     38580
     gagcaatcat tccaattctg atggattagc agtttgataa tcatcttgct taacgcatca     38640
     atagatacaa atacatctcc agttgggtca ctcttcttaa atgagtaaat tgacaactct     38700
     aaggctgatt tgaaaaatac tatgacatta tcactttcag ataaaattcc tgcatccatc     38760
     atttgagaga tgaaggccaa agtaatggca tcatcagatt caaccctttg tagaagtttc     38820
     acccattctg taaaaatcaa gaaatagtgc tccttcttgg tgatttcaat gtcttcctta     38880
     attgggagaa tcgctttatt ttcatactta gagataaatt cttgagagtc tttagaattt     38940
     aattttgata ggtaaataac ggagtttatc aaatccattc tcataagaat aggatcttca     39000
     gataaaatgc tttcttctat cagctttata gtgaaatcca cggagttctc cattccagaa     39060
     gccatcgctt tcaccaagac gttgtctaat tcatagggat caattagatt aacttcaatc     39120
     agcgacttaa tgacagccag gttaaacttc ctgctatcta atgcatatac taaccaccat     39180
     acaacatctt tcctagctac caatgaaaga gagcagagtt tttctagtag caaagataat     39240
     acctctctac aaagagggct ttcactagtc gcaaacaagc tattgactac agcttgagag     39300
     actttcaatg ccagttgatc tttctggacg ctctttgcaa tgaatgtcaa aatttggaag     39360
     ataattccat ctatctggtt cttctcccct aattctttta gtgaattctt atcggcattt     39420
     tctttgatta atgcaactaa ggaatccatt aaatgcacca ggatcctgtg gttttgttct     39480
     agttctgatt ggacattatt aacaagatgt ggatttctta ttggcatttg agcttgggcg     39540
     ggacccaaag gttgtctgtt cgcagtagtt tgaatgtttt gtgggatatt ttgaacaggt     39600
     tctgcaggaa tagattgtgg tgtgttaacc gactgatttt ggttggctat agtcatcgca     39660
     tgattatcag gaaagaagtt gccaaattct tcgtacagct tgaattgttg tggggttaca     39720
     ccattatttt tgatacctag cggatcgggt aacgcaagtg agtatggatt agtgttggga     39780
     gttataaatg gttggtccga tctcctttct ttatgatagc ggcgtatggc tatggcctgt     39840
     atcaattgtt cacgaagctc ttgtacagct ttatcaaccg cagctaattc gactaaattc     39900
     aacgctaagc cgatgttgtc atttatggcg gtatctagtt cctctagcgg attactagac     39960
     aaccccatca tgttaggaag cagtgactga gtggttgaac gtaagctttc tttcaacgga     40020
     tcataggctg ttgcccttga taaactcttt gccagttgac gaaccatcgt gattgcagct     40080
     gcctttagtt tattctcatc aggctcggtg gcaaaatctt tggacacaat tttagttgta     40140
     gttataacag caatattcgc agatttttca actactgggc ccaatacttc tctcactgct     40200
     tttgctaaag caatttggaa tacacgttta atttcgggac gtgtggtgaa taatgttgag     40260
     cctgataatg atacgaatgg gccgtcattt gtttgattct gggcctccat gtaatttccc     40320
     tgttctttag aacttgggtt gttgttcaaa atgtgttgct gtctttgctg ataaatcaga     40380
     agttgttgtt gatgttgttg catcattaac atttgccttt gatgttcaac ttgttgttgt     40440
     tccaaagtta cagagccaat attccctgac aggttttcaa taatatcagt tgaatcaaga     40500
     taatttgtgg aatctaagct gtccattggt atatctaaag ccttgaatag cacttcgacc     40560
     tcaaatgtca aacttagctt ccagtttgct ttttcgttca actctttcag tgttctcaat     40620
     attccaatag tccaagggtt tggtggcttg aaaatcttcg aatttgctgc atgttgtata     40680
     atttttgttg taaatggcac aacaatttcc agtctgtttt ccttgtgtgc atcaagaaga     40740
     agctctctga atgcaatatt tctatgcttg attggtttat caactccaat agtgatgcaa     40800
     cctagccatg cagccagatt tttcaaatgc ttcttatcga tagctttaac atcttttatg     40860
     gacattagca aaaacagctg ctttaatgtc atattgataa catactggtg gagtgattct     40920
     gattcaacat taacaagcac atctttatat agattttggt agtttggttc tgtttttgct     40980
     ctttgattta ctaagtaatt agaaaaccat gcgtaataat ttgaggttaa aacagattta     41040
     agatccaaaa ctttattctt taagttttct gtagaaatat tattcagaat gaaaagaacc     41100
     ttttctgtaa catctttagg aggagtatct tgttgaaatt gatatttcag ttcatcaata     41160
     acaaaaaatt tcattggata gagttcaagg ggctgttttg taattggtgt gctttgattt     41220
     tttgcaacat caattccatg tgcagcttct gacaacgatt gatacacttg aggttgggtt     41280
     ttcaaatcag gaacctcttg taataaatct ttgcagtatt gaggaaaatc tggtaatcta     41340
     attctaaatg cgtaaatagc ttgcacagca aacttaaaca ttttagattc gacaccctcc     41400
     ttagcaaagt tcataataat cttgaaagca acgtcaagca caaacccacg taataattgg     41460
     aataaaatca tagaaccgaa tagaacagag gtggtagcta aagcatctaa tggataatcc     41520
     ttgtagaaat ttgattctga tagaacagca tgggtaatgc aagcaaatag atcttggtcg     41580
     tgtgaggagt tgctatctct taacttgatt aaaaggtcga taacatcttt gatcgcaatt     41640
     tcaccactat acattttttg cagttgcatt tgcatctcct tttcaatatc gctctccaca     41700
     ggaccagtat cttcgctagc taagatgacg ttatcatggt catatccaaa gtttaataat     41760
     cttgggacag ctattagaag ggcaaattgt agcttttcga acatcaattg gtcattagca     41820
     ttcagaggga ttgtgcgtaa gaagttaata agagtatgca gtgattttaa gtcaaaactt     41880
     tgagactttt ttagtggcat atcattgtca ggaatcttga tttgagcatc tagataggat     41940
     atagcggaat gtgaattgtt agaatcaaga tgcttatgta tataatcttc aaatccattc     42000
     cagcccacac gaatagctct aggtaaaaac ttaaatatgt cctcaaaagg cgtatgatca     42060
     atgacaaact ccaattttcc ttcatccttt aaaacctttg caaattcaat taacctgaat     42120
     ttgttggtat taataattgc agtgcaaact tccaaaagca gcttattgtc gtttcctaac     42180
     gctctaatta tatcagttac tgattgaaag gacttttcga atgtttgaac aactaatgca     42240
     attagtattt catctactgt tgtcgtgttt tcaattaaaa gactaaaatg tttcatattg     42300
     ttgattagtg ctaatgctag atattcggga gctgcgttga agtcttgaaa aaagcattcc     42360
     tgaaaaacgg gtaacattgg gttatctaca agttcatctc tttgtaaaaa tagctctagg     42420
     tccagactag aaacacacat caagtacagc atggacatct ttgtattttc aattttattt     42480
     gacacttttc ttatattttg agagtttaga atatcaaaac agccttcaga aacagaccat     42540
     ttatgaagca ataccactaa ttgaagtttc acagatacat gccagtcaca gctgaaaaac     42600
     tcatcaatta tgctacctga gtctagtatt gcaaataaag aacttagaga agctaatgac     42660
     gcatgtacag gagtgctcaa aaaatatttt gtggacatca aattgaatat acgattccaa     42720
     ttggtagcat cttttttcat tgcatacaat gtttcgtgta attgatggcc tatatgagtt     42780
     gcagcatcga cagcgtatgg agtaaaccat ggtgaagcat taccactttc gatatctgtc     42840
     ttactagcat tttgcagatt ttgagatcct ggggaaagaa tttccgataa aagtaatgcc     42900
     acacaatcat tgagactctc accttcaagg gaaaagacaa tgtctcttat ttgctctatg     42960
     taattgtcag ggggattatc tgccgatagt acactttgta atgattcttg gtagttcatt     43020
     tcttcgatgt ttattgttaa gcttttgatg tatttttcta tatcaatgca atctagtaaa     43080
     tcaggttcag tgtttaaatg atcttgcagg taatgatcta acttttttat tttgtaatct     43140
     tgaataaatt cggtgttttc aaaaactgct tttctaatta gtgaaacgta actttcgtct     43200
     ttcttagata gacgcttgat ggaatgatag agaagattgt ataactcttt tggattaccg     43260
     tcaatgttct ctgcctgtac taaaagtctc ttcagatatt ctatttctac ttcggctgca     43320
     gagtattcta agatttcaaa tatgtctctt ttggatattt caaaatttat ttcacttaga     43380
     tttacaagga tttgaacaac gcgagtaatc gcagtcctgt gtttgctcct gttgttgcca     43440
     ctattaatta tgtcagaact gtctttcttg gtccctagct tcgattcgtc agtggggcca     43500
     gagggcatag acttcagtaa ttatatgtac ggtcctgttt tgtaaacggt aaagggtgca     43560
     ggaatcaatt ctaattctct attaaaactc gggttcaaag agaaggaaat gaattcgtat     43620
     agcttattat tcagataacg ttacccttac aaatttcgtg tttcttattt tgaatgtttt     43680
     tgcttcttat atcaaaacac ttctcttcag caaactgctt tatagatctt attgaagagg     43740
     aaggtggggt tatcaaaaat tgcttcgctc gttcgtttcg ctatatctta aacaaaaaac     43800
     tcagaaagca agcggaaaag tatagtattg taattgggta attgagctct tattgtttca     43860
     agcttcaggc ttcaaacatt atctattcta atacaccaaa agtggcaaac tgatgttcga     43920
     acttgtatct gtctgagaat ctgaactttg ttgtttccat tgccaagttt ggcactcgaa     43980
     gagaaaaaaa agtttgaaaa aatatacagc gtatgttgtg atattagctt tccatagtaa     44040
     taaggttcct ctttgagatg ctcatatatg ggaaagtctt gatgcattac agtatttcat     44100
     gattttaagg atttattatt ggcctgttga ccaattgtgg tttaaagtct tgaagactta     44160
     ttggcatacc gttgtattca tttggagttg tatttagtta gacgaagaat ttggatagcg     44220
     atgcagcata tgataaaatg aagcaagcat ctattagcag gttttttaaa aaggtttccg     44280
     cagtcaacaa ggagaaagtt gaccaagtga aggaagttga gaaagaagct gaagtggatg     44340
     aggtgctgga cttgactttg gattcggaga acgatgagga gcaacagcaa gagacgccag     44400
     ttctagaacc aatagatggt gaagagcatc caactgtcag taaagtacct gatcttaacg     44460
     attcacgatt attacaaaaa cagaaaatct taaacgcatc taaggatatt acaaactctg     44520
     tggatgtaag tgcctttaat gagaagctta aggatatcat gaataaaaga aaactgggca     44580
     ggataaaagg ttcccttata gatgaatcag atgaaattgc tgaacaaagt gaagctgatg     44640
     agcataatat aaagaagaag agaaagaaaa gtgaccaatt gacaccatta gaccgccaag     44700
     tgaaagattt gaaactaggt aacatggata aagtattggt tattagggtt gggtataaat     44760
     ataagatctt cgcgcaggac gctatcattg caagtacgat tttacacctt caactaattc     44820
     caggaaaagt tactattgat gactcaaatc ctaatgacag taaatataaa caatttgcct     44880
     actgctcatt tcctgatgtg agattgaagg tacatttaga gagactagtg agaagcggtt     44940
     tgaaagtagc tgttgtggaa caaagtgaaa ctgccaccac taaaaaattt gataatagca     45000
     aggccaaaac ttcggtattt gaaagaaaaa ttactggtac atattctaaa gcgacatacg     45060
     caacaaactg tgaatttgaa gtaaatcatg aaaacatact tggcacaaat aatagtatat     45120
     gggcgttaga tattgaggtc tctgattcta tctataaata ttacttatgg tccatccagt     45180
     tgtcaaatgg tgaagttatc tatgatagtt ttgaagaatc aaaggacaac ttctctaaag     45240
     ttgaaacaag gatgaagtat ttgaatccta gcgaaatagt ctccccagtt gttgatagtt     45300
     ttccaataaa gctaaaaaag agatttcttg acttacagct ttgtcagaaa aattatgata     45360
     tactagctga agatttgaac atacccaaaa aggagcttct aaacaatagg ttaattgagc     45420
     tgtggcatat tttatatcgt tatcttaagg agtactctaa tgagaaactc cttaatatag     45480
     gtagcaatta taggcatttt tcacaaaaaa tttcaattca gttacaagct caaacaatta     45540
     ataatctcga tttgatctcg aacgatgaca gtaaaggaac cttattttgg atacttgatc     45600
     atacaaggac accgtttggt aaacgtttat tgaaagaatg gttgctaagg cctttactat     45660
     caaaagacgc tattgtagat agactcaatg caatcgattg tattctagaa tctgcaaatt     45720
     cgattttctt tgaatcacta aatcaaatga tgaaaggtat acctgactta ttacgtacga     45780
     ttaatagagt atcatttggc aagacttctc aacgagaagt gtactttctt ctaaagcagt     45840
     tgacaggcgt aattaaacac ttcgaagctc acaaagacta tatcgaggta gaaatcaata     45900
     gtaactctgg agcgattaaa acaaaatcta caaaattagc ctcaatcatg actcaaatgt     45960
     ttgagttttc tttaagtagt gtgattccgc aattgctttt aatgattaat gtttccgctg     46020
     ttatggaaaa ggaccaaaag aaacagctct tggggttctt tcatttgaac aattatgata     46080
     attcagaaaa tataatcaaa atgcaacgag acatcgattc tgttaaggca caattgcatg     46140
     atgaacttca aaatattaaa aaaatcttaa aaaggccgca ccttgcttat aaggatgaag     46200
     ttgatttctt aattgaggtt cgtaatacac aggtcaaagg tatcccatct gattgggtca     46260
     aagtcaataa cacgaaaatg ataagcagat ttcttacccc acggacgaaa gaattggtgg     46320
     agttactaga atatcagaat gatctcttat acaatgaaat ctctaaggaa tatgaccaat     46380
     ttctgaatag aattgcttca tattataatg aagtgaaaac attcataatg aatctcgcgg     46440
     agtatgattg tttattatct ctagcagctg tgtcttgtaa tgttgggtac acaaggccag     46500
     ttttcacaga tagcaatgag caattgataa tagccaagca agcgcggaac cctattatag     46560
     aatcgcttgg ggtggattat gttcctaatg atattgagat ggaaaaagat agtggccgtg     46620
     tacttgttat tacaggacct aatatgggtg gtaaatcgtc gtacataagg caaattgctc     46680
     tgatggtaat tatggctcaa attggttcct atgttcctgc tgaatcactt aaattgagtg     46740
     tatttgataa tgttttgaca agaattgggt cgcaagataa tatattacag ggacaatcta     46800
     cattcaaagt tgaactatct gagacagtgg agataataaa ttcctgtact tcaaagactc     46860
     ttcttctact agatgaagtc ggtaggggaa caagcaccag agatgggaat gccattgcat     46920
     gggccttgat taaatatttt gttgaagaag aacagtgccc tttcatcttg tttactacac     46980
     atttcactat agttacgact gtaaaatcac cattgttgaa gagctatcat atgaattacg     47040
     tgcagcataa aaacgaaaat gaaaattgga ctacagtggt ctttctgtat caattgaaag     47100
     ccggggtcac agatagcagt tatgggctga atgttgcgaa attggcaggt attgacacac     47160
     atattatcaa tcgcgcacat gatgttgcta tcagttataa gaacgacaca gaatttgaca     47220
     ccaacatgat cttgtttcaa aaagttagaa atatcctggc caatagaacc acggcaaggg     47280
     agacattaaa agtactatta gaattagatg tttgatagaa tctatagcta ccattacata     47340
     tttatatttc ttaacattat tttattggca tctttgtaac gaatgttttc tggaaattcc     47400
     aattttttat gttttgggag tggatccatg cggactggat gctaaatgtt aagggaaagt     47460
     cgatttgtcg aaagagcgat tgaaatctat tcaagcatac taaacttata aattgaatac     47520
     tacaaaatat agaatgcaag cgacatatag acgattgccc tcaaatcact gacctagaga     47580
     tcatgttgta cctttctatg agtggaactc tctctgagaa cattgtcaga gtttatccaa     47640
     gggacacaga gcaatctatt gctgaatatt cctttgacat tacatgcacg cattgtagag     47700
     aggcccatgg gtcaccagta ttcatcaatg cctatgagaa acatgagatg gctggcagca     47760
     gaggagaaac ctcctttact atgaagtgta agttctgtgg caatgaaatg tctatcaact     47820
     tgtcgcattt tgaagaagca ctatggaaca gtgaagctga aagttacgac agtggctcaa     47880
     tcaccacatc gagaaagaag cacggtatca agaatgttag tggcaatgcc ggtttgctat     47940
     tgcagctaga ctgccgtggc tgtgatatct ccaagttcaa tcctcagaac atcacatttg     48000
     tcgtcgagct acaacagggc aagatggaat gcattatcga agaaggcgag gacgagtggt     48060
     acgactatga cgacaaccaa ggcgaggaag tctcgatcac cgagatcaaa ttcgatatca     48120
     taaagggtaa ataggtgata tctacctggt acacgtaatc taacgaacat agcatgttga     48180
     acaaaccatt aggtctacat gtgcaatttg agaatggttt ccctcattct tatttatgtg     48240
     tttttaatat ttttttttct ctttcaaagc attttttcag caattttgcg atgagctgaa     48300
     aaatttcact tatataagct gagttagtct ttagtcttag tagttgattg tcttcccgtt     48360
     atatacaaac caagacattc tatacaatca atactttgag gatggttacc tttaactgtg     48420
     aagtttgcaa cgataccgtt cccaagaaga acaccgagaa gcattactac cgttgcccca     48480
     atgcttacta cacatgcatt gactgttcaa agacatttga cgacggtgtg agttacaagc     48540
     aacatactca gtgtatcagt gaggatgaga agtaccagaa ggctttatac aagggtaaaa     48600
     agaatcagaa tcaaaatcaa aaccaaaacc aaaaccagaa gaaacagaaa caaactactg     48660
     tgacagaaga gaagaaacca gccgaaaagg aaaccaagaa agaggtcaag aaatctttgc     48720
     caaatttcaa gaaaggtgac aacttgtaca agattttgaa atcctataag gacaaggacg     48780
     acaagaagaa attgctgaaa tcgctagttg tcgacagtga aggtcgcata gtactaaaga     48840
     actaatatta agtcatatat aaattttgta gaatagaaaa tgaataataa gtgcattttt     48900
     atcaaaataa taaattttga tttactccgg aataaattgc aactggtaat gaacgattac     48960
     acaacttaat gcaactaaca acaaagaaaa aacaagtcag tcaaaaagat aaacagttga     49020
     aacatctttt aaactttctt gttcagggat tttgacattt tgatgtagaa ctggttcaag     49080
     gatcggagtg ggaaactcaa tgtctcgaac agatagtccg gcagtttctt ctgtaactct     49140
     tgcaactcct ctgcagtacg ctgtttcaac aacggcacgt atatcacctc cgtatcaact     49200
     tccgtggtgt tctcagcttg agatttcaca aaccctagct tgtaatccat aatgccattc     49260
     ttggacccct ggctagtatc aaaccacaga ccagtatcgt cctcatacgt gcggtgcaca     49320
     cgtaccccac acaagtgctc aaacagatcc ttgataatct ctatagtctc cttatccttc     49380
     tgggatctct catcgagttc atcccgcttg ctacgcaaca cagccaattg ctccttcaca     49440
     ctctccagct ccacatctcg agaatccagc ttctgccgca acagagtgtt ctcctgcact     49500
     acccgctcca ccaggagatc agcagcatcc aaccgcttct gcacagactt tttatactca     49560
     cttagtggat ccatcaacct tgtaatttta gccttgcctc ttgacgtact ttactgccaa     49620
     tccgtgagcc aactgctgaa gtcccacaaa cttacagctc ttcttgaacc ttatattcat     49680
     cactcataac gtcagtgcgt ttttctgcca aaaaatggtt cccgagcaat tggaagtcct     49740
     ttcagcaaag tttggaaact tgacaacaac cataacaact tgcaaataga aaccgctatg     49800
     gtgttctagt acaagtaccc ttccgcaatt gattaccacc acatcgtcct atagcaaata     49860
     ctgcttactg tcaattacgc atccccagtg aaacaatttt gataggaaca tatttgaact     49920
     cccccccttc tccggtagat ggctttttga gaatactgat aaacttgttt gaacttagag     49980
     aaaccaatga ccgctaacgc ttcactaggt aagctgaatg atctcctgga gggcataaga     50040
     caggagtttg cccagctttc ccatgaggca aactcctaca gactgcacca gaaggactac     50100
     gattacaaga ttaaacaaca attggctgaa atgcagcaga taagaaacac tgtgtatgaa     50160
     ctagagatgt cgcatagaaa gatgaaagat gcctacgatg aagaaatcga gaggttaaaa     50220
     attgaactgg acactagaga tcgtcaattg gcaaccttga gtgctcaaca acaacagcaa     50280
     caacaacaac aacaacaaca acaacaacaa cagcaacagc agcaacaaca acaacagcaa     50340
     caacaacaac aacagcagca acaacaacaa caacaacaac aacaacaaca acagcttcac     50400
     cagcaacaac ttcaggcgtc accaactggc cagggtcatg tccaggtcga ccaaaacggt     50460
     gcttaccagc tctatcgccc agtacaagca gctactattg aaactaatgg tgggctacca     50520
     gctggtggcc aatctactct tccccaacct tacaatgcta tagcggcaag ccaagccgat     50580
     cacgtgcaac aaaggcaccg gatggctcct gctgttggca acctgacaag cacaccaact     50640
     gttaattccc aacactcaac tcatccacct actcctgcat tagcttcttc ttccaagatg     50700
     caacctacag cattggcgac tcaacctgtt actatgccag caacacaatt accaacattt     50760
     cagcagccgc aggttgagac accacaaatt aagcacgaag ctccccaatc tgctactcaa     50820
     ataactcaaa cacctacttt acaaagcgct actgtagctg cgaatacccc aaaagttcag     50880
     acaccatctg tagctacacc tggaatccaa gccactccaa gttcagctaa tcaggttgaa     50940
     gttgctacag ctccaacaat tgcaaaatct ccagctaaca aacaaccagc tatattgaat     51000
     caaacttctc cagtaaacac agcagcaaat gcagcaccca ttctatctga gaaaataaaa     51060
     tcacctcttc aggaatcaca agcacctggg acaactgttt cagaggtcac aacatctaat     51120
     gctgatgcga cacaatcacc tggtcaaaca tcttccgctt tagatagcaa taggccagaa     51180
     ataaacgaga aagtggacga aaaggctacc caaacagtgc aagaaacagc gggaaaaaaa     51240
     caagatactg cggataaatc agatgaatcc aacaactatc tagtaccact agaacaaagg     51300
     gcagaccatg tgaagcccat tccaccattt ttattagatt tagatgcttc ctctgttcct     51360
     gaaaatatga aaaagcaaac taatgattat tatgttttgt ttaacccagc tctaccacgc     51420
     tcgattgact tagacttaca taagactcta gaacatacta gtgtggtatg ttgtgtaaag     51480
     tttagtaatg atggggagtt tttggccaca ggttgtaata agacaactca aatttatcgt     51540
     gtatccgacg gtgagctagt agctagattt tctgacgaaa atgctcatac tgacaaggct     51600
     gatggtaatg acaatgccga agctgagaca tcagccggcg caaccaccga cttatacatc     51660
     agatctgttt gtttctcacc tgatggcaaa tttttagcaa ctggtgctga agataagtta     51720
     ataagaattt gggatataga acaaaagaag attgtaatgg tcttaaaggg ccacgagcaa     51780
     gatatctact ctttagatta tttcccttca ggagataaac tagtttcagg atccggtgat     51840
     agaactgtaa ggatatggga cttgaaaact ggccaatgca ccttaactct atccatagag     51900
     gatggtgtaa ctactgttgc agtatctcct ggagatggta agttcatagc agctggttct     51960
     ttagacagag ctgtcagagt ttgggactct gatacaggct ttttagtaga gagactagat     52020
     tctgaaaacg agttgggtac tggtcataaa gattcagtat atagcgtcgt cttcactagg     52080
     gatggtaatg gtgttgtttc tggttcattg gaccgttccg taaagctttg gaacttgcgt     52140
     aatgtaaacc acaataatgc tgacggtaag cctacctctg gaacttgtga agtcacatat     52200
     actggtcata aggatttcgt tctttcagtt gctaccacag aagacgatga atatattttg     52260
     tctggttcta aggatagagg tgtcttgttt tgggacaagg tttccggaaa cccattatta     52320
     atgttacagg gccatcgtaa ctctgttata tctgttgcag taaaccatgg acatccattg     52380
     ggaccaaact atcacatatt tgcaacaggg agtggtgact gtaaagccag aatctggaaa     52440
     tacattaaga ccactacaga agtcaattca aatggaaaga tccaaccaat ttcataaacc     52500
     gaacagaaga caataatatt ttaatatttg ttgtttatta ttattgggcg acaaagttgt     52560
     attatttaca taagcggcag gttttctagc aaaacaacag gtaaattttg gtcgaaggat     52620
     gtcaaggacc taatctgttg gtcaataacg tcaacagacg atggagattt ctattgcaca     52680
     aatatcgaat taaagtgtgc gcagtatcac ctctttctga ggtgaatata tgagatctag     52740
     acgagtgtta cgagtatttc tttagttagg aagacaattt tttttgttgt attatatata     52800
     tatatgtata ctttaaagtt tatgaatagt tcttaaaaga attgtataat tttttttggg     52860
     ttttatacac cagacaagtg ttattcatgc agagataaat tatatatact tcattagtca     52920
     gggataatgt gctagaatat ataggaaaaa tggcattact gcatatattt tgtatgcaat     52980
     atcatttaaa ctcttcgatg gctttggcca accctttagg gtttgcacct cttatcttat     53040
     gcaagatgtc atcatcctta gtgaacacaa aagttggcat tgccgataca ccatagtatt     53100
     cagcaacatc gggactttca tcgacgtcga ccttgtagaa cttgacgtct ttgtactggt     53160
     ccacaaactt ggacaagaat ggcaccatag ccttacatgg accacaccag gtggcgtaga     53220
     agtcgatgac cgacaagtta gagtccttca tcagcttctg gacttcttct agcgtcttga     53280
     cctgcttaat agaagcatat ccgccactgg actggaacct catcgcaatc gatggggcaa     53340
     ttcttgggtg tgtggcaaaa cggcctaatg ttggtacttg gcatctagcg gtacggaaaa     53400
     gaagcatgtt gtcgagataa tattcgggta tgttcttatt tacatatctt tgtcaaagtg     53460
     cattctgcag ttaggggcaa ttaactcatc atttaagtaa ttttccactt tcaccaggct     53520
     cggagtccag aaggaagtga ctatagcaac tttctggaac taaaagtgag tcccacagtt     53580
     cgaaaatcat gtagatcact attgttaaca tgtgaaataa aatatcaaag ccaaagggtc     53640
     ttgctttgct ataatatcga tttctatatt tttaagtaat ctttgatatt gaattttccg     53700
     gtataaacat gtataaagtc acagatgggt ttcttatata gaaaaacaga gacgttaaaa     53760
     aatatggctt ggtgttgaag gttggcacca cttttaaact atttgcatga gtgagttctc     53820
     ttctgtgtgg agctgcatac ctttaactgg gaaatgagga gggagtttgg tgataacaat     53880
     aggaaaatga tatagtaaac atgatgaaat gaaatggaaa taaaacaaaa agcgtaacaa     53940
     aacattaata aagaacatct gaatgtggaa aaaaaatata atataatcat aactgaaatg     54000
     aagaaaagaa aataaaaacc atccactaat gaatggaaaa cacacacgct ctggactgaa     54060
     aaatactttt atgccattac aagttaagcc atctctatcc gtggaagtgc ctcaaaattc     54120
     tttctctttc tctcttacct tggtatttgg tttgtggaag gggatgcaaa agttgtttct     54180
     gtaaggggag gaatatatgt aagcgtgaga gagacagccc tcacaagcaa ccgtctgtgt     54240
     acaacgccag cagcctggag tcgctggcta tatactccgc taggtccacc ccgtacttgc     54300
     tccagtcgat atccggctgc ccgtccacct gcgccacaga ccgccgcaaa tggccctcca     54360
     gcgtaaacac ctcccgcagc aggttctggt tattcatcag cgtgtccgta aactcctggt     54420
     agttccgcgt cttgtccagc aggttgtaca gaacctgcaa ctgcttctgc aagtactgct     54480
     gctccaccag cttccgttcc aggaaccgcc gccgctgcgc aagaacctca tagtccgcac     54540
     tctcctccac ccgccgctct tgaaactcgt caacgctcat cgccacactc aacttacctg     54600
     gatgtatggc tccatttcaa ctattcacta tacccaccag ccaaaataaa tattttttca     54660
     gttcataatg cgctgctctt ttcacaaaaa caagaaattt cagtgctgca accccccttg     54720
     gcccatccgt gcggcacttt ctaagcattt cggttgctaa gtggtggcaa tcgagacaaa     54780
     tcgtgtagaa cggtagtgtg ttgtcgtaca agggtacgat aataccacgc cccagctgga     54840
     gtcctttact tatccgctgg ttaccccgct atccagttat cccactatct gctggttatc     54900
     cgctggttat cccgttgtcc cactatctgc tggttatccc actatctgct ggttatccca     54960
     ctatctgctg gttatcccac tatctgatgg ttatccacaa tccccgactc accttgggtt     55020
     attgcgctcg tagcgggcgt cgaagaggct gaggtttaag gagcagttgt ttatgtcctc     55080
     cgtgtcctgg tagttcttga tgcagtagta gggcttgcgc tgcagctcgc ccgtgtactt     55140
     gtggaggcgc ttgtcccaga tggcgcaccg cttcttgtgt gtgccttcgc tcggtgtggt     55200
     gctggatgtg gagttggcac tcgcagtgcc taggtcgaga cccagggaca acgccgggtc     55260
     gcgtgtgcag tcggtgtcgt cctcctcggg gaagaaagag gacacttgga atggtgggag     55320
     gcacatgagc ttgtgcatga gcttcgtgcg ggactgctcg tcactgatac cggcctcgta     55380
     agtgcagtac gacttcaacg aggaaaggac ctcatagaac atcagtttca ggcgcagact     55440
     gaagttcaca cgctcaaaca acgcgaacag gctctcgatc atggcactgg aagactcggt     55500
     gtccctcagt atttcctgga atacactgtt ctggtgcaca gtgaatatct tcatgaatac     55560
     atcgagctct atttccttcg cagaaagctc ggagtctgag agctgttgga agtgcgccat     55620
     cacttgcaca cagagctcat acgatgtgtg cgattgctca ccactccgat cgttagtctt     55680
     gcccttatgc atcgataagt ggttgataat ctcgatgagc atttgcaaga actccgcctt     55740
     gaactcttcc ccactaatga tcttcttaaa gaaatcttgc tcaaataact caattactaa     55800
     gtctgtaaca cgatggtctc tgatatcttc aaatatctta gcacacaaga cgttgtattt     55860
     ggtggtctct ataatcgaaa agattacatc cccaactttg accttgtcct cgttagtgtt     55920
     ttggaaggtc tcgtgaatat agaacttcgt aaatgactgg aagagccata gattggtaaa     55980
     gtctagatac gagtatagct tctgtggtga attgtttacg gcaaactctt gtaactcttc     56040
     actacttaag aactccaggt tattttggta gtagaccagc tgatagaaca attgaatagc     56100
     cttgtcctta tttgcctcta ggttcttggt taacaatgct gatgctgtct cctttagttt     56160
     tgcagatgta ctatggttga caattttaaa gataaacctg ttcatttcgt gatgactcac     56220
     aacgttatac tcagaaagaa ctgatttgta gttaagctcg atgtaacatc tcttttggta     56280
     ctcataaaac acgcagttac tttcagattc tatatcaaat aattcaagga catattttaa     56340
     gccatacgtg ttcttgatct gatcaagtgt cagtaattta gaagatagta aattaactag     56400
     atccgatgtc ttaaagtcct tcctcttcaa ataaattgaa ataaatttag aataatccct     56460
     attctttgcc tgcatcaata acaacaaatt atacctagcc ttctttttgg cttgcttgtc     56520
     ctgttttgag ctcaagaatg tcttcaagtt ggtcaaaaac aactcagaaa aacctgtatg     56580
     attctgatct aatgatgtgg agtctggatg aatgttttga taaagtccca tccaggaatc     56640
     tttttcacct tcagtaatct ctttctttgc cttctcttcc tcataaacag cagacatctc     56700
     tgacctcaaa tctgtgtctg ctctaatttc tagactgtag cttttcatga tgaacttcca     56760
     aaaatccatg aatgaagtta gagaataagc aatggaatct ctttctttca agattcttct     56820
     aataatgaaa atgaaggttt taatgaatag cacatgatcg ttaatatatt gagagaagag     56880
     tttcttatac cgtaacaaca cctccatcaa gtactctagc gtctcaatat cttctatcaa     56940
     ttgatgatat acaatgaact caatccattt gaagtaaagg tgattagtgt ttaattggtg     57000
     tgcaaacaaa acatactttt ctgttaaaga ttctcttgtt tcattgacta gcttaccatt     57060
     gcatagatat gttagatacc attctcctag tgatatctta acactcattg ggtaattgct     57120
     atattcaata gcgtcaccgt tgggtaattt gaccttaaga tcttcgacaa tagaaactat     57180
     ctgatcaaag ttgtagttat tgtagtattc tggatcctga tccataacat ttttaaggac     57240
     catattatac tgacttttca ttaaaggtga catcttgaga ttaatcaata ggcggcaatg     57300
     tatgtatttg tcatttgatt ccgtcagata aagaatacca gaactaatca acttccttat     57360
     gtatgtggat actttgatca agccatatac tataagtgtg ttcagtagtg agtataaagc     57420
     ctctaaaacg gcaggcaagg ctttgctttt atccgacagt tttgccagtt taaatacaag     57480
     tgaccatatc tcatcctcaa tttcgtattc tgggaatcca tccatagtat ttatctttag     57540
     tagcaaaagt ttcgcagcta gctgcccagc ttcatagtgg gagtgccttg aagggtgaat     57600
     agcccatagt attatttgaa ttatttgtat ttttgttgat atttcttgat ctgaataact     57660
     tgtccagtca aaatcagtag cattatcgtc tagagctccg gtaagtcctg tgtcaacttg     57720
     gcttaactcg accactgtta tagaacctga attttctgta aatgtcgtta gtatcaaatc     57780
     atctttaact ttattctcag atatcggagg tgtgtatttt agtgtctcat ttcggtagct     57840
     tatgagctca agtttccttt taatctcggc tacttcatct gacttacggt acagcgcgct     57900
     agtaatttga atcaaacaag gcttgtattt ctcccaactc gttggcggga atagaaaaac     57960
     ctccaaagat tgctgtttga aaagaataca aatcaacttt tgaatgcttg ccagcaaaga     58020
     ttctttgata ctgttattct tcttaatgtc gttaataata tatttgtcat cattaatcat     58080
     tgatttgcta tgcaatatga tatagtactg attcagtaga atatcagtca acttcgtaac     58140
     catgtacaaa ggattgcttt cggattcatt gactttagta gaattagtat tgcagatgcc     58200
     actccaaaac aattccaaga tatgtagcgg tagaggtagg tattcaaagt tctccacttt     58260
     agatacaaat tgtaatatcc agaaatgaaa agtgtttttg tctataagtt ctagtgtata     58320
     gcaattgcca accaatttga ggaagtacga aacttcggtt ttccatgcct ctaatttgac     58380
     ggaatcattg taatgttgag tcatttcaaa gatcaatttc tccagaatat gaacgaagtt     58440
     atcagtccat tctttgagaa gatgggcatt gaatttatct ttttcctgag gactattagc     58500
     gtattttgca attcctgttt tccactctat cgagtagcaa catttgatga gccagactgc     58560
     tctttttaat ggtatttgct tgatgtagca ttgttctaat acttgtctcc tcttcaaacc     58620
     atgtggtatg aagcttgtaa tcttgtgtag tggtgtatat ggggaactta gttcttgtaa     58680
     ccacagttct tttctgtgat cagtcaaagt gagtcttgat ggcaatttga agtcaggtcc     58740
     acatagatca gtaaacttcg aggcagccat gccatctttt gaattgcctt tgatcgtatt     58800
     gatctctctt tcacggatac gaactacttc agaaaatttc tcagacagtg ttgaggatag     58860
     ttttggtaat gagtcctgta aggaagatct cgccgatata ctctcaaaat tgacctttga     58920
     ggtagaataa taacccttag aaacaaaatt taataatatc tcatcttctt ctttagtatg     58980
     cttccatgga tcaaaatctg ggtatatctt atgcttagct ctctccgatt cggaatacgg     59040
     gtgtaagtca tctggagggg ccagtttgta tttacttggt atcatctcct ttgaattttg     59100
     atgcttgtct caactgttat atcttcataa agttttagaa tatctagcaa ctgcagctca     59160
     atttataaca gaagtcaaat agttcagcac actctttcag gctgtttttt caactatgcg     59220
     agcttaaagt atttctcaaa tttagaataa ttggaatcaa ttagtaacca gataatgtct     59280
     atactatcag ggattttcaa aataaaaaaa ctgtaacaac tgaagtttgt aatatttact     59340
     taattgctaa cgggtttatt gtaataatag ctcaacagcg ttatcgagcc tgtattctta     59400
     gtttttattt ttggcaattg aaagcaaaat tgggttattc gctctgagaa agtgatgagt     59460
     cggattttga aaaactactt gacgatcaat tgatgatggc tgaaatgaag ttcagcagac     59520
     aaattttgga taatattctc tccaagagtc tatggaaaaa taacgagatg ttgcattctg     59580
     ttcaatactt tgcgttagat agttatttag ccatataaag tggcaggatt tataacataa     59640
     caaaatcccc ggaatctata aaacaaaata aaatgaagga aaataaaaaa aaccatacta     59700
     ataggataca aaagtagtaa tgatatcggg gattgaatta gcaaaacact aggaatatga     59760
     tttaattaat atgaatattg gcttctaaat taatacaact gttgaggtcg ttactatgtt     59820
     ttttcttgga gaactttgac aaataccgga atatgatttc aataaagttc gaaagtaaga     59880
     gtactacgct ctttctccct ttgaagatcc cattagcttt tcttctctct ccgcaccagt     59940
     ccgatcgatt gtgggccagc ttccccagtt cggaagcctt aagataatgc atgtcgcatt     60000
     atcagcgtgt ctgtcgccga ctgcctctat aaatttcacc acttcctctg ccaagtattg     60060
     tggattggcc gtctttaggc ctctcatatt gacggtcgaa gtgattaaat ctacaatctc     60120
     ttgatccgag agaatatcgg agactccatc ggtaaccatg caaatgaagc attcatctcc     60180
     accaaattgc agtttcgatc tttcagagtg cggcaactgt tctgtgtttc cgaccaaata     60240
     ggaataaata tctggttcac tagagagacc ctctttctta ccgaccagat caccgaacga     60300
     tctagtattc gcaaacttgt ttaaaaacct cttttcacca aaagaatctg cctcttcttc     60360
     ttctttctta acatccatat ttagtctctt ggattctcta gaggatgttg gatgatgcaa     60420
     ccttgtcaat gggtgtgcga ttccgttctt gtcacatata ataatcttgg tgtcgcctac     60480
     ttgggtgact acgagcttaa agaggccatt aggatagatg aaaaatgagt cgtctgtctt     60540
     caagttgtta ttataagacg acaggaagat agaggatgca gtagatccac ctgagtacct     60600
     ttttaaatgc tcctctgcgg aaaaattctc aggtaaggat tccatatcat cgaacccaca     60660
     gcatttctct agatcgaact taaggaaaga gtaatacaga cgtaatcttt cgagatctgt     60720
     taacaggctc gttttatcta tgatgttccc ccatttgtca aaaatcatcc gcgaaccctt     60780
     ctggtctgcg ccgaataaca caagctcctg cttggtgtta caattcttta tgaacttgtc     60840
     gtagaactgc tctctgctct ggtataggtc gttccagtac ttcccaccga tcaatttcct     60900
     gtatctgtcc agcagatgaa agaaatcttg ctcactgggg tagcccgcaa caatatcctt     60960
     gtaaaactcc cgcgcaagaa gtttcgacac cctgccttca ccgccatgac cgtcaaatat     61020
     cgacacattc agcacagacc tgctgttctt gctcagcaag tccttattct tatacgccag     61080
     caactgctcc gtgcgggagg gcatccgcag catgttgatc gagtacgagt cctcattgtg     61140
     cagccggttc acccgcgaag tggcatgccc gatcgaactg gggaacttct ccaaatgtat     61200
     cttcaaagaa actgacttct gcacaccagt gccactgcca ctaccagcac tgccaacacg     61260
     accagcaccg ccagcacgcc ccgcagcccg aagcgacttc gcagcggcct ccttcacatt     61320
     ggaaggtatc aggtggatat acgactgagc acacgacatc gccaattgca gtagtgtagt     61380
     ctcaagtccg ctgagatgca ccactgcaga ggtacccaga agcactacgg tcctgttcct     61440
     tttatatact tggactatta gctgtggtaa ggaaggagtg cgatgagggg cagcgatgtc     61500
     gcatattgaa atccgattat ttgggtgggg ggacggggaa agtgaaagtg aaggatttgt     61560
     gcgagcgttt ctgagtgaaa ctggtgcccc cctcacttct gctatgttta gctaataatg     61620
     ggcgtgttag gtgatgatga gctatatggg agttggtatt gttgaagttc ttggtagtgg     61680
     tacttaatct atatatctac ttcaacagtt cctcgatgat cttgttgact gtggcgttgt     61740
     cgttagggtc gagggacttg actccgaggc gtctgagggc ctcgacgatc ttgttcttct     61800
     cgaatccctg ggactcgaac tccttgacga tctctgggtc gataccgtag agttgtgctt     61860
     cgtccacgct gtcgcctgag ccctcggcgg atgcgtacag ctttgtccag agtgcggcgg     61920
     tcttgtcgaa ggattgccta tctcgtaggt agtgttgggc gacttctgcg tcttgtgggt     61980
     cgttgggctc cggggactgc agcagtgcct gtagcgagat cagcgccgac ttcaatgtga     62040
     tcactgggga ccatgcgttc ttcaagatgt ccagacagat ggcgcctgtg accgacgaga     62100
     tgtttgggtg gtacaccttg ctgtcgaact tcatctttgg aggcttgaac gggtactcca     62160
     tgggcacctc gatgtccaca atgaacttac caccctcgta tggtgtcccc ggtggaccta     62220
     gaaacgaacc tttcaaatgg tggatgtcag actcgctgac gaactccaga ctgatgttgg     62280
     cctcagggtc atccttgacc gcttgcagct ctttcataat tctcttggct ctagacatcg     62340
     tgactttttt atcttaacgt taccagattt aaaacttcta ttactccaaa attactatcc     62400
     aggtatatcc aaaattaacg tgaaactttg atcccgcaac aaatgcacta aattgctcgg     62460
     tgctcagata agggaaaaca gtaacttctt ttatatccac aagtcgaatg tatcctcact     62520
     tctaatactc tcaaggcgtc ttcgaattgc aatggcagcc actattgtag ttgaagaggg     62580
     tgagggggag agtagttata acagatctag tgtcttctac ctgtcaaagg gcttttctgc     62640
     gtcttgaacg ctccacaaca ggggaaatat atgtcgttgt atgtgatatt tactactaag     62700
     aaactgtatt atgtgtatag tgaaaggttg gtgctgttag tatagtcgtt ttttatcatt     62760
     gatatataat gatgtattgg tgcttatgta ggctgtgcta gctagtcttc cagtccttct     62820
     tctttgttca tgttgttctg cgcgaacacg tcgatgtcgt cgtcgtcgtc gtcctgagcg     62880
     tccaggttgg ggaacacgct gtccttgggg attctgagca tcaggtcggg gctgtcgaac     62940
     aagggtccta tctttgtaat ccatctctgt ctcttgtcca acaatgcttt caagctggag     63000
     ttggcagcct tctgctgagc cagttgcgat gcggagcctg aagtggcact gccatggtgt     63060
     ttccgtctct tcttcggtac tctgatacgt ttgatgtatg cttggtctag ttgtttgttc     63120
     aagtcatcta ggatggatga gtactcttgc catgccagtt gcctctctac gagtggtatc     63180
     agattcttct ttcgcaactg gttgcgcttt gtgacttgtt ttagagtggc ctgaagttga     63240
     cgcagctccg cgctgacttc atcgtcttct ctaccgttta accaatctgg atcttctcca     63300
     tttgggttgt tctcgtcttt gggcaagttc atatatatac ccacgtattt caactctctt     63360
     ttcaatctct cttcaaacgt tggataatct atgttgacat tttcgatttt ccatccgttt     63420
     cctgcaggca acgtactcgt tgtgctgcgt gaaagagggt tgacatccca actattatgg     63480
     tcatcgttat ccactgtgtc accattggtc atcacagagt ccgcatttgc agctaagcta     63540
     gagtttccct ctacagagta agcattgtca ttatcctttg agatgtcctt gtcgtcagct     63600
     ggtaggccat ggtccggttc gcttttgatc tcgtcaagac cgtgaccagg tgtgccggat     63660
     tccatgttag aatctatatt ctgtgtactt tctttcatta tagctgaaat tagtcttgaa     63720
     actagaggcc cgcacgacac gtcctcggtc tctaatatgg tatcattaat gttggcggcc     63780
     ccttttttgg gtaaaatact tgaaggatca gtaactgatg gaggtgatgt gttgccaata     63840
     tttttctcct gatcttcctt tgcccatatc tcagtgtata gttgtccaag ctttggtata     63900
     atataaggtg taacttccgg gtcataagtg ctatcgactt gaaggttctg tggtagaata     63960
     tacttacctt ctaggaatcc gatatcatta tccgagaatt ctctataaaa cttttcaact     64020
     gatgctaaga aagtattgaa ctggatttga tttgtaggtt tagggcatga gaagtccata     64080
     tcgggcagtt caccaggtag tttatctgac agatcagttg ttgggtaact ggcaacacta     64140
     tacttcttct tcaagaactc ctcacctgta cattcaagcc cttcttcatt gaacagacct     64200
     aatgcttttg ccgcaagagg aagtgtttgc gacactacaa actcggactt agggttctta     64260
     acagttggat cgttttccat cttatctata tcaacatcct ttgacacttc tgtgccttcg     64320
     ttttcttccg gtttgccaaa ttgtgcatca ttcgtttctt ctgtaaggtt tagttttatc     64380
     ttctttggag gtgcttcccc ttcaactggc tcttcctgtc catcctcgac tttcagttca     64440
     ccaacatttt caacatcgct tgatatttct gaatgtgttc gtttcagaac cgtgtcaggc     64500
     ttctctgtct cgtctatctg ttcctctgct ttagtttcat cagtggcttc agggtccttc     64560
     acttcggcgt ctttctcctc tgatggctct acttcatcct tcccagactc taccttcgtt     64620
     tcttcaactt gtgtatttat ctctactgtt tcaacgtcgt cgggttttgg cctacttagt     64680
     gtgtcttctt ctgcctccac gggaccttcc ttggcctcgg gactttcagc ttttgcactc     64740
     tcctcagtaa gttctggttt gtcatctgtg gcactggcgt cctttttcgt gacatccttc     64800
     agcttcagct tcaatttgag tttgtgtttc tgctgttgtt cctgctcttc ctcctctttg     64860
     atccgcacct gcttgcgctt ctccctgatc tgccgtacaa ggtctatact ggcctgatcg     64920
     gactgcgata tgtgctcaaa caggtggtgg agcttctgaa gctcatcccg cagcttcacc     64980
     agcgtaccat agtcaggtac cttccgcacg caattgccgt tcagcatccc tatgtcccgc     65040
     tcaaacgtga ggtccagtac gcttagaatt ctgttcagca ccgtcgaggg cgtgctgctc     65100
     agcgccagta cccgccgctc ctcctcgcgg tcgcgaccga catccacacc tttgcccatg     65160
     gccacacgcg gcgcaccttt cccgcctttc ccgcctttcc caccttttcc gccctccggc     65220
     gcctttccac cagcagcttt cttccacgca ggtggctccc gcttcttacc tcgcctagaa     65280
     ctcctcggca ttgctgtctt ataccctctt tagcccattc accacgccca aatagccacc     65340
     agaacccgcc cagctcttat aatacttgct cacttcgcca gagtcgtgtt gttcaccgag     65400
     cagattctac gtggtaagtg atatacttct ggtcttgctt ggaatttgca tcgaataaga     65460
     agttataaga gctatagtac tagttgcgac tggggggtct ggctttggga aggcagtaca     65520
     agctggacag attgagtaga tgttgcgtat tattcggagt ataggtaccg cggctggtgc     65580
     cgctggttct ggtgctgctg gagctgctgg tgctgttgca gggttgtacc gggaacctgc     65640
     taagtggaaa gggttgaagc ccgagactgt gatatctctg tactgggagc gtgttgcgaa     65700
     gatggggaag gagtacaagc agagtcccga ggagttagag gcgctgctgg gcacgtcgga     65760
     gtacactggt gttcccgagg cgcatatcag gaagctgtac aagtacggtg agaaaggtgc     65820
     tatggagatt ggtgctggag ctggacctgg tgctggggcc aaggctcggg atgtcgtcgg     65880
     tgggtttagc aggtttcagt tcgatgagtt gccctcgcag gcgctggatc tggtggatca     65940
     gcaccgtgag cagcggtttt acaacagact ggctgcgtac gagctgcctt tgctcgctaa     66000
     gtacaggcag gagtacaagc ctccgtcagc gtcagatgtg gtgacttaca agtacttcac     66060
     gtatgtgggt gaagagcacc ctaactcgag gaaagtagtc ctgagcttaa agactgagtc     66120
     acttggtttg gagcctcgcg cactgcacaa gttcagggta ctggcaagga ctcgctacga     66180
     ccacgagaca gacctgttca agatgtccag cgacaagttc ccagaagcac agcagaatgc     66240
     caagtacttg ggagatatcc tgaagaggct actgcaagag gccaaggact taagcaaaga     66300
     cgacttcagt gatatcccct tggacacaag acacaccatt gctaagaatc tgcggaagaa     66360
     gcactcgagg cgtctaagga caattgaatt cccagaggag tggaagagac ctgaagatgc     66420
     gcctgtgaag aaggtcaaca tcaccgagga attgatgaaa ctcttgtaat taacattgtt     66480
     cgagcacata catttgctaa tggacaaagg cgcagatagc catctatttg acgacggaaa     66540
     gtagtcattc aaatagctgt aaatactaaa aatgaataaa aacttacata tattcgcgat     66600
     gcccgtatca cggctatgga tacaagcacg attgggatat aagtatgact ggatattaag     66660
     attactataa ctttatataa tacaaatcgt cttacactga tgtatatcgt ttatatgaat     66720
     gtctccaaat ttatgtgtct ctatgtttaa aaatccaggt cgtggattgc aaaaatacag     66780
     ttttgcatac gagatcatta gtctaaaacc aatgaaatca tatatgaagt gggtgaatac     66840
     atcaaagcat tcttagaaat gagaaagaaa aataatacaa gatcaggaac ggtggtagtt     66900
     cactgataga gaaagaaata ttatgaaggg cgattcttga taaagaatga gtaatgagat     66960
     cagcacgctg ttttggctta gttattgtct ctgttggcgt ctctgttctt atccttcttc     67020
     ttatccttct tcttcttctt cttcttcttt tcgctggagc cggtgttctc accgttaccg     67080
     ctgctggaga ccttgtggcc atcgctaccg ccgtagatct catcgattga tctcttttgc     67140
     aagttggcgg gcaatggcac tggggcgtgg ttggtgcttg ggtccatgaa ctcaggcaga     67200
     gtgccgttct tcttggcctc caagtacttt tgcttctcga cctggtagtt ctcgagctcg     67260
     acgttatagg cctgcttcca cttctccttc tcctcgtcgc tgaggttctt ccacttcttg     67320
     gagatctcct gggtgatctc ggtggatgac agagggggca agccggcttg tgctctagcg     67380
     tcacgcagct cctggcgcac atacgcagag tacgcaaaga agacggtcaa cggcttcttt     67440
     ggggcgttag ggtcacggac gggcttcttc ttctgaggtg gctggtcgtc ggcaccatcg     67500
     gcatcatcgt cgccggactt ggacttctta cctttgccca tcagcaaaga ggacgcatcc     67560
     tcgtccatgg ggttgacaag atcagagctt ataccatgca gctggttcga cgcagacgtc     67620
     agggtctgca aagactcggt cagcgtggtg aacgcctcta gcctctcttc atcatcctcg     67680
     ccaatggtat tgtagaaatc aacaatggca gaagcagtat tgttagcgga cttggacaac     67740
     tcgaacaacg ctgacaccag cgagtcctta gcagacttca acttcaaccc tgcagcatcc     67800
     atctttttgt ttttatttac ttacgtggtt tgtatgttaa ggagaaaagc cacttacagt     67860
     ttcagcttaa tggagtgagc gtagcccttg agcgtagcct tcgaagctta ccattaggcc     67920
     tccattagag aggtccatta ggcttacatt aggcttacat taggactcca ttagagggta     67980
     ccagttccct agcctgagcc cgtccagcct agagaagaaa aattttctac cagagagagg     68040
     gagtgacaag agtcgtgatt gttgttttag ccttactctg gatcatccgg tattgacctt     68100
     ttggtcagag aactgggaaa ctaaatatat ccatgctatg agactggctt cgctcccggg     68160
     cagaggttcc aagggctcat actcagaagg ctcaggctat caagtactgg ctcccgctgg     68220
     gaggtgtgtg cagggagata gccgggtaaa cacatgtccg tacagcgcta ctagtatacc     68280
     ggcttatgct ctgccaaaac tcatcggaag tggcatatat ctgtctctcc tgtgctagtt     68340
     ttgtagttgc acagaggggg agaggagcag gggcccaggc agtattggct atttgcgtcg     68400
     aggatgcgtg cgtttcaaca cagggctgct gggcacgacg ggttgctcac agagggcgaa     68460
     ggtgcgctgg tgttcaagcc gtaccatgcg aaggaagctg cgttctatat ggaggtgcag     68520
     cggcggaggg ttgacgagcc tggagctgcg caggatgtgc cgctgcacct gtggatgccc     68580
     tgcttcatgg gcgtgctgga gcaaggcgat gtcaggaagc ccggggcttc cggcaataca     68640
     cccgctggga gcaagtatat tgtgttgaac aacctgctgc atgggtactc gagaccgaac     68700
     gtgatggata ttaagctggg gtctgtgctc tacgatgagg atgctccgct ggagaagagg     68760
     cagcggttgc aggaggtgag caggaccacg acgtcggggt ctctggcgtt tcggatatgc     68820
     gggatgaaga tagaacgggg gaaagctagc tgtaccgcac tagatgaggc acactacgat     68880
     gtggagactc accatggtgt ggaatacctg tcggtgaaca agttctacgg aagaactaga     68940
     actaaggatg atatcagcga ggccattgaa ctgttcttta ataatgaaag gctgtctaag     69000
     ccacggaaaa agcaacttta cgacactttc tggcagcggt tgcaattgtt ctacaacact     69060
     ctacttgaca caaaggcgag atttatatct agtagcttgc tattcgtata tgagagtgac     69120
     cctgcagcat gggaagagct cgatgatgtt gatgagctgg tacacgacta cgaagttgaa     69180
     ctcatagata ctgacgagga agacgacgag ctcgctggcg ggtttgtaca acaaactaca     69240
     caagccagca tggttataga tacgagagat gacgatgagc tgcccaatcc aacgattatg     69300
     aacgagaagg tggagccccg aaataagaaa ctgagctcga tgacttttat agactttgct     69360
     cactcacagt ttacagatac agacgactac gatgagaatg tcatattggg tgtggaaaac     69420
     ttaatcgata tatttaatga gttacgaatc tgaatttgaa aatgcttttt aattgatatg     69480
     ataattgata tgataagtgg tatttctttg gcatgcggtc aaatatataa ataaaatata     69540
     ttcaaaatga aagctatttc gaaattgcat tggaaataaa caaaatactg tacagaaaac     69600
     tatgattaga tgttatatgg tgttcatact gattacgaaa actactgatt ggttccatga     69660
     cttcattacc cgcagaagtc acacttaatt attaagataa atttctaaaa caaacaaagt     69720
     tactctatct gatgtaacgc cgtttactca agaatcttaa cgatcttacc aatagcaatg     69780
     gtagtacctt gatctctcaa tgtgaatcta cccaattgtg ggtagtcgtc gtaggtttca     69840
     acacagactg gagcttcagt ttccagcaat gcaataatct tcataccctt cttggcaaat     69900
     gcaggtggtt tcttagactt acggttagta cctctttcta atttgtgcaa tagtctagtg     69960
     atgtggactt cctcaatggc agtatggacg tgcataacac aggagaaacc agcagacatg     70020
     atagacttca attcaacaat ggcgatttga gcaacaaatc tggtgacgtt cttgattggg     70080
     ttctttgggg aggttaatac gaaaccagca gagatatctt cttcttcgat acccttgatt     70140
     ctcagcttaa cttgttcacc acaaacagcc atatcaactt cattttcagt ttcgttgtaa     70200
     atattttgaa tttcaactgg tatcttgtta ggcattagta gtgtggattg acccttcttg     70260
     atgtgacctg attcaatctt accttctaca acggtaccta gatccttcat cttagaagca     70320
     ataggtagca taaatggagc attgacgtga cggtcgacat gcttcatctc gtccaggtat     70380
     tccaatagag ctggaccatc gtaccatgga cattcttcct tcttgacacg ttcctttaga     70440
     ccagcaccac tgtaaccaga aacaggcatg aaaacaacat cttgcttaac attgtagcca     70500
     attgccttca aatagttgct caagttgctg acacattggt cgtaacgttc ttgagaccag     70560
     ttgacagttg ggtcatccat tttgttaata acaacaatca tcttgttaac accttgggtc     70620
     ttagccaaca aagcatgctc acgggtttga ccaccctttt caaaaccggt ttcatattca     70680
     ccctttcttg cagaaataac tagaataccg acatcagctt gagaggcacc accgatcatt     70740
     tcagaaacat acattttgtg acctggagca tccaagatgg tgtaacgtct cttttcggtt     70800
     tcgaagtaag ccttaccgac ttcaatggtc ttaccatcat ttctttcttc cttgttagtg     70860
     tccataaccc aggacaagta ccaaccttgt ctaccagcgt ccttggcttc tctttcgtat     70920
     ttttcaatgg ttctcttatc cacggaacca gtcaagtaca ataagttacc acccatggta     70980
     gatttaccgg catcgacgtg acccataaaa ataatggaga catgatcctt accaccaaac     71040
     atatcgttaa caatctcttc atcgacttca tcttcttgtt ccttgatcaa ggcgtccgca     71100
     ctgctaacct cttgggatgg agtagcttcc ttttcctttg tatctttgac atcaagcttt     71160
     tccatcttct tagagacatc ctcagtagct tctggcttgg attcggtgga ggtagtttct     71220
     tccttcttgg tttcttcatc cttcttagct tccttggctg gctcttcttg tttattttct     71280
     tccttctttg gttcttcagt ctttggttct tccttcttag tagcattagc caacttgata     71340
     ccagagcttg acaccaactt tagagtcttc tttggctttg gagctggctc actcttttgc     71400
     tcttgttgtt gttggaaact gtctaaggtc ataccttgag caggttgttg ctgttgttgg     71460
     tagttttggt atccgctgtt ttggttgttg tagttgtttc tattgttgta gttcttgtaa     71520
     ccaccacggc cacggccacc ttggtatcca ccacgaccac cctggtatcc accttgttga     71580
     tagttctggt atccgccttg ttggtagttc tggtagccac cttgctgata gttttggtat     71640
     tgctggtagc cctgttgtgg ctggtagttt tgaaactgct ggtactgctg gtagccctgt     71700
     tgtggctgga agttttgttg accatagttt tggtagtact gttggtagtt accttgttgc     71760
     tgttgctgtt gctgctgttg ctgctgctgc tgttggttag gatcagacat ggctctcaat     71820
     tgatcagtaa gtgctagcgg cttttgctat cctcaatgct tgatgtatgc aaacctcaga     71880
     tcaacgcaaa cccagataaa tatcgaatag ctaactggga ctataactac taccaactag     71940
     tgaagctcat cgattctttg ccaaatttgg gaaaaatttt caatcacaaa atacgtatat     72000
     gtcacatgat aatataacat accatgccaa ctgccaagta gtgtatatag tattggcaag     72060
     tttctcatgc acgtttggta agccattgtt ctattcgtga gtacttcgtt gctgtatata     72120
     gtctatacat ttatatattt gagagatttc tttttatggt cttttttgat ctatttacta     72180
     atgtgctgtg gcagtgctgt ggcagtgctg tatgccattt gggtctttca tgcctggaca     72240
     gggtttgggt tctcttcgaa ctcgagctct tcatctggga catcctcgat ggtgattctc     72300
     ttctttggag ctggtttctc ggtgccgtcg aggatctttg ggaccttgat gtgcaacagg     72360
     ccgttcgagt aactggcctt gatgctctcg tccttgatac gtggtagcac agggaacttc     72420
     acggttctct caaaggcacc gtatttcagc tcggtgatct ttaggtactt ctcatcgatt     72480
     ccgatcttgt cctcgatatt acccttgatg agcaactcgt gagaggatgg gtggtagtcg     72540
     atgcggaatg ccttggaaca ggcacctggc aaggccaaca caacatggta tgtgtcctcg     72600
     gtgtcataca ggttgacctc gggggagaat gggaggtcta gtcgggtctc cggcttggag     72660
     atctgcaaag gatcagggac aggggatgga gcctgttggt gcacgaacgc agaagacgag     72720
     gctcttttct tcaactttgg ttgctgcgca ggtttcgact cgctatgtgg cttgctttct     72780
     tgtggagttt cctgagcttg tggctctggt tgttgcactg cggcaggctt ctgtttaggt     72840
     tcctgtggct cctcgacttc tggctcctct tgttgctgtt gttgttgctg cctttgctgt     72900
     tgcccttgtg gccctagctg cactgtgctg cccattggtg ggtatccacc cagcaacgcg     72960
     ttcaggatgt ccacaaggcc gttgtcagcc tggtactgtt gttcgtgctc ctgcgcattc     73020
     ctagcggctt tgcctgagtt atcgtggtag taagagggct tctcgcccat ctcgacgtcc     73080
     tcgtcaccgt cctgcacgtc atcaccttcg tcctcgtcct cgtcttcgta gtactcggga     73140
     ctgtagtagt aagggttgcc aaacctgtag tacggggtgc tccttacgtg gtgcaatggg     73200
     tggcgctgac cgtaggggta ggaagagcca tgcgtgccat gcgtgccata agtgccatag     73260
     ggggcatagg agccatagga gccgtaggcc cgtggctggc gttggcgtgg tgcctgtagt     73320
     gcatctagca catcatatag cgacagcgaa ggttggtaga aactcattgt gtagttgtag     73380
     tattgttagt atcgttagtg ttgttattgt tcttggtgta gtgttgtaca accaggaaag     73440
     ttggaaagta cgcagtagtt tatatacttt taaggtgggg gcaccccctt gtaaccccta     73500
     agacgtgcaa agaaacttct agaacactct acaagccagg ctgaattgcc agataaagca     73560
     cagagtacag ctatacactt caatgctcga cattcctgtg cattccaaga tagcaactag     73620
     tggtataagt gagctattat atgcagttat cgacacaagt gctttcatcg gtatgattcc     73680
     actttaacgc cgcgtacccg gtgatagagc catatccaaa ccaaggggca aaaccgctag     73740
     tctccagttc agacaccaag aacttcttat ggttctatag tgtagtggtt atcactttcg     73800
     gttttgatcc gaacaacccc ggttcgaatc cgggtaggac ctcttttttt cttggtagct     73860
     ttcccaaatt ttttttttgc ggaaatcctc cgttcattca gccctttcgc atctgaacaa     73920
     gtaattcgtg tgcagttctt gtcgatcccc actcataaag agagccaacc ttttatcata     73980
     ccaggactcg agcactaacc agcaacccac aagcaatggc tgatatagag gatcccgtgg     74040
     tagcgcccgg tgtctctgcg gagccggatg ttgtcgctgc cgatgctaac ggtgacggag     74100
     aagtacaaga acaagaacaa caacaggaac aagaacaagt acatgaggaa atacaagaag     74160
     aacaggatgg agacgtatcg cgtctgggta ctggcaagat gcactctagg aatccgtcgt     74220
     ctgtgtcggc tggttctgtg aatgtgcagt cgtcgtcgcc gctgtcgaag acgatattgg     74280
     agactatcct gcaggagaga gacatcaaga aataccccaa tgtgcagaag tctatcgagc     74340
     gggcgctgga caagctgaag gagacgggag ccacgaaccc aattgactcg atactcgtgt     74400
     tcgaagcgtt gaggtcgacg tgcaggacgg ggtcatccag gatccagtcg aaggcgctgg     74460
     acgggctgtc caagctgttc tccttccacg cgctggacga gaccgtgctt gtgaacccgc     74520
     cagactccaa cgcctccaac gaccagacca ctgcgcagca ggagggcgtc accccgccgc     74580
     ccaagcagaa actgatagac gccgccatcg acaccatcgc cgactgcttc caaggcgaga     74640
     gcacagacga gagagtagag ctgcagattg tgagagccct gtcaggttgc atactggtcg     74700
     aggacgcaca ctcaaactgc cacggtgcct ccttgctgaa agcaatcaga acaatataca     74760
     acattttcat cttctctttg aacccttcca accaaggtat cgcccaggct actctgaccc     74820
     agctggtagg cgcagtgttt gataagatcg aggtcaaaca catcgaccct tcgtcctccg     74880
     cactaaacgt ttctaactgg gacgactcaa agtcgccagc ccctccgcta acactagcga     74940
     acttggaaaa tatagataag gaaaccgata agaaactagt ctcgggagag aacaacggag     75000
     acgacaacga caaagaggta aatgaaacag taggggagga agctcaaacc aaccaggagc     75060
     tgaacattaa ggacgctttc ttggtgttcc gtaccatggc caaaatatgt gccaaaccat     75120
     tggacgctga actagatatg agatcccacg ccgttagatc caagctattg tcactacaat     75180
     tgatttattc aatgctaaga gatcacatcg acgttttcct ttcacatcac atatacctcc     75240
     caggtaagga gaaagtcaca ttgctagatt ctataagaca atacctatgt ctatcgctat     75300
     cgcgtaatgc agcttctcct ttatctgctg tctttgaaac cacattggag attatgtggc     75360
     tgatgattgc caatttgaga gctgatttca agagagaaat acctgtattc ttaactgaga     75420
     tttacttccc aattacagag ttaaaaactt caacggcaca acagaagaga tatttcttgc     75480
     acataattca aagattatgt accgaccctc gtgcattaat cgaattttat ttaaattatg     75540
     attgtgatcc aggcatgcct aatattactg aaatgcttgt tgactactta tcaaagctag     75600
     ctctaacaag agtagagatc tcacaaaccc agagatcata ctatgaagat caactgtcaa     75660
     aacctttggc tacttataat tttgatcaat tcccactact gaccacatct actttatcat     75720
     ctggtccaga ctcttctcaa acaccgctgc cattcccatt agaatatgca ctaaaaatga     75780
     catccttgaa ttgtgttgtt gccgttttga gatcattgag tctatgggcc cacaaggcac     75840
     taaattcaaa tagtggatta caaggtcaaa tatcatcatt ttcagatatg aacagatcag     75900
     aatctaacac tagtttgtct aacgctggaa gatcttcaat gactagaata gacgagagtg     75960
     ttggcgaaga ctctgaagca caatcattga acaaacagct cgaggcggat gatccaacac     76020
     aattcgaaaa tttgaaaatt cgtaaaacca agctttcaaa ttgtgttaat gctttcaatt     76080
     tgaaacctaa gagagctatt cctcttttgc tccaaaacgg ttttattaat gacgaatctc     76140
     cagagagtat agctaagtgg ctattggaaa ccgatggatt agatttagcc atggtaggag     76200
     attatctagg tgaaggtgat gagaagaata tcgcagtaat gcatgctttt gtggaccaat     76260
     ttgattttac tggccaatcg attgtcgatg cactacgtga cttcttacag aagtttaggc     76320
     ttcctggtga aggtcaaaaa attgacagat tcatgcttaa gttcgcagaa cgttttgttg     76380
     atcaaaaccc cggtgttttt tcgaaagctg atactgctta tgtattatct tattctctaa     76440
     tcatgttaaa cacagactta cactcgtcac aaattaaaaa taagatgact ctacaggagt     76500
     ttttggagaa taatgaaggc attgacaatg gtaatgatct tccaaaagag tttatggtta     76560
     atctattcaa tgagattgca aacaatgaaa tcaagttatt atctgaacaa caccaagcta     76620
     tgttgaacga tgaaacaacc atgaccgcac ctccaacacc ttccgctttt aatttcttca     76680
     gcagcagaga tttggcgaga gaagcataca tgcaagtttc caaagaaatc tcctccaaaa     76740
     cagaactggt tttcaagaat ttaaacaaga ctaagggtaa gaatggggat gtattttatg     76800
     ctgcctctca tgttgagcat gttaaatcca tatttgtaac attgtggatg tcgtttttgg     76860
     cagcactaac tcctcctttt aaagactacg atgatcttga gacaactgaa aagtgtcttg     76920
     agggtatcaa aacatctatc aagattgcct caatatttgg tatcgatgat gcacgcacat     76980
     cctttatcgg agccttggtc caattttgta atctacaaaa tctagaagag ataaaaatta     77040
     agaatgtcaa tgccatgatc gttcttttag aagttgctct atcagatggt aactttttca     77100
     agaaatcctg gaaagatgtt ttgcttgttg tatcacaaat tgaaagattg cagttgattt     77160
     ccaaaggtat tgaccgcaat actgttcctg atgttgctca agctcgtgtt gctaacccac     77220
     gtccttctta tgagtcaacg aggtctgcaa acacgtcata catatttgac atatggagta     77280
     agaaagccac tccaatggag ttagcccaag aaaagcatca caaccagcaa ctttctccag     77340
     agatatcaaa atttatttct tctagtcaac ttgtcgtttt aatggataat attttcacca     77400
     agagtgctga attatcaggt aatgctatca ttgattttat taaggctctt actgaggtgt     77460
     ctctagaaga aattgaatct tcccagtatg catctactcc tagaatgttt tctctacaaa     77520
     aaatggtgga tgtatgttat tacaatatgg accgtatcaa attagaatgg tctccagtat     77580
     gggctgtgat gggaaatgct ttcaacagaa tagccacgaa cccaaacctt gctgttgttt     77640
     tctttgctgt tgattcgcta cgtcaactat caatgagatt tttagatatc gaagaattgt     77700
     ctggttttga gttccaacat gatttcttaa agccatttga atacactatc caaaattctg     77760
     gtaatgtcga ggttcaagag atgattatcg catgcttcag aaattttatt ttaaccaaat     77820
     ctagtaagat caaatctggt tggaagacta ttctagaatc tttgcaatat accgcccaat     77880
     ctggtaacga atcgcttgta gttaaaacac aatctttgat tagcgatgat atcgttgatg     77940
     ctcattttga gagtattttt gttcaagagg attcatttgc cgaattagtt ggtgtattca     78000
     gggagattac aaagaacaaa aagttccaaa aacaagctct acatgccctg gaatcactaa     78060
     ggaaaataac tcagagaatt gcaaaaatat gcttcgatga aaatggcgaa agtaaggaaa     78120
     agaacctact acaaggaaaa gatattttcc aagatatctg gttcccgctg ttatattgtt     78180
     tcaatactac aataatgaca gcagaagact tagaagtaag atctagagcg ttaaactaca     78240
     tgtttgattc acttgtggca tatggtaacc aattcgatga gcagttctgg gaaaatattt     78300
     gtaagaaatt gttattcccc atcttcggtg tgttgtccaa gcattgggaa gttaatcagt     78360
     tcaacagcca tgatgacctg agtgtttggc tatcgaccac cttgattcag gcattgagaa     78420
     atttaattgc attgtttacc cattactttg attcgttaaa caacatgtta gaaggtttct     78480
     tagaccttct agtttcctgc atatgccaag aaaatgatac tattgctaga attggtagat     78540
     catgtctaca gcaattaatt ctgcaaaatg tgtctaaatt caatgaaaag cactgggaac     78600
     aaatcggaaa tgtttttgaa aagctattcg aattaactac cgctagtgaa ctgtttgaat     78660
     atgatcctct acatcaaggt agacaaaact cttcaaagac aaacgatcct aaaaatgctg     78720
     cagatgacgg taatgttcat gaaacagtgc agagagcaca acaggaggaa tcaagtgaag     78780
     atgtaggtaa cgaaaccatg gactcggtta agaaagaaga tggtactact agcccatctg     78840
     cggtgcgttc tgctaagaca tttgaagatc ttcgtccaaa gatcagtatt aagaattcca     78900
     tcgttgtgaa atgtgttctg caattactaa tgattgaact tctaagtgaa ctattccaga     78960
     atgaggagct agaacaccat attccataca agcaatatat ccaaatcacc aagttattgg     79020
     agaaatcgta cgaattttca cgagacttca atgcagacta cggtctaaga acgagattag     79080
     ttgaagcaag agtggttgac aagattccaa acttgctaaa acaagaaacc agtgctgccg     79140
     cggtgctgat tgacatcatg tttaagttgt acctaaatga tgacaacaag aaagatgaac     79200
     tagctagcag attgatcaag atatgcactg gcgttgttca gggctatgtt acattagatg     79260
     atagaactat ggagcgtagc attatttcat ggaggccagt cattgttgag attctacaag     79320
     gatactacga atttgatgac gacgatttca agaagttctg tgctccaatg tatggtttca     79380
     tcatccagat cctggacaag agtgtaccaa cagagttgag acacgccatc aagttattcc     79440
     taggcagggt cggtgaactg tacctccaaa tcgaggacta gccgcttctc gtaccaaaga     79500
     ctctctagat atagataatt attgtttact tgtatattag aacatttgaa aataaaaccc     79560
     agcagcttag tgtggtatac accattgcaa actccaatgg tttatttttt gggcgacatt     79620
     ttgttcctga aacaagacta aaataaaaat tttcttgaca agataatatt attatatata     79680
     ttcataattt atgtttatga tacatttctc atctgaagca attgacattg gcaacagaac     79740
     atccaagcaa tctgagctac aaaagagaaa ctttttttag aaatttttta gaattcgtta     79800
     tggatttaaa aaggatatat gggccatgcg aaatataatc atcgacaaat tttaagaaaa     79860
     aacttgaata aacaaaatga caatttttta aaaaattgaa gcaggagata gaaatggtaa     79920
     atatagttat gggagatgga atgaatgggt cattgacttg aaatattctg acatcagatg     79980
     aaaaaaataa aagataaaga gaaccacaca tatgggttta gcaaatgatg tggctcttct     80040
     ctaaacttat atttcatgat agcagaaatg acaacactat ttatagtttt cttgaattga     80100
     attgtaacaa cgtaagcttc gaagaaaagg aacaataaaa ataaaaaggg gaaacacaat     80160
     ctaagaggaa tcattaaatg caagcaagta acaaaacaac aactaattat tttctacaat     80220
     caaatcagtt caggcaccaa taaataaaag tggcattgac aggaatgagg agaaagcgta     80280
     cgcttctctc acatgaactt tgaatttcgt agtggagatg gtttagattg caaagaattt     80340
     tggttgagta tagggattga ctttatttgg tcatagaaat gattgcaaac gcagattggt     80400
     attcatactt ttcattttaa atatttcttt atttcgatta gaggggaaag gaaagataga     80460
     aaaaaaagag caattctttt ttttcttata gatatgtttc acctattagt tgtttagatc     80520
     aaagatggca aggaagaagt gtcgatcttc ttgttgactt cagcggtgtt cttaccacca     80580
     cgggagctgt tgctcttacc accacggtta ccgccacggt taccaccacg gccaccacgg     80640
     gagttacctc tgaaaccgcc tcttctgttg ctgtctctgt tgtctctgtt gttgtcagag     80700
     aaggtggcgt cgaattgcaa gaactccttg gtcttcaatt gcttggactt gacggccttg     80760
     gtcttggtgg ctggggcgta gtctgggacg tcgctctttg cctcggcttg caaagtctcc     80820
     tcgacctttc tggcctctgg gaccttgttc aagtcgttgt tgtcgacctg gttcatgtag     80880
     tcggcaaggg acatcttctg tgggccggct ggctgggtct ctggggcctc ggcgtcctcg     80940
     gccaactcgg actcggcgtc gcgcttggct tgctcctcga cagtcaactc gcggtcgttg     81000
     tcaccccagg cctggttgat cttcttctgg gagtcggtct tgccggttct ggagtgacgg     81060
     tcggtcatct ttctgtcgtt gtttcttctg gcagtggcag aggagccaac gtcgcgggcc     81120
     ctgttgttgt cacggccagc cttcttgtct ctgatagcac cctcgttgcc actcaacttg     81180
     cccttgttct ttctagcctt ggctgggtcg gcacttggtg gtggaacatc cgccttcttg     81240
     gaggaagtgc tcttcttcac aacttccttg gtggccagag gaatagcggc ctgtgggtcc     81300
     tcaacgtcgt tacctagaag atcaaatgga ttggacatct gtgtctcttg ctcttatttc     81360
     tttgttttag aattctagtc tgagtagcaa gtttaaagtt caaattcaag taccactcca     81420
     agttatagtt gaaattaaaa agttttaact atttcaatta ttttgtcaaa attttttcac     81480
     caaaagctgc aattgctctt ctctcaaagc agaaaagcag aaaaattttc aggtaccgat     81540
     atacgtgatc atgtggttac gtgatgaggg atataatgta tattctatac ggcagtcaga     81600
     tgactgccgt atatatgtat atgagatctc atcacacgac gagtcagctg atggatactg     81660
     atgtacgtgg atgtcacgtt accttcacgt acatcaccag acacgttaat tctaaccatt     81720
     tccaggaaca ccagacactc tatagcataa tcgggctggg attaggtaca agttattaat     81780
     ccgggtacta attcccttgg tttggaaggg ggagggaggg agaaagggtt aacaggaaca     81840
     ggaagaagtg ttaagaagag agaactacaa gaaaaatgac cactgacaag ccgctgtcga     81900
     cgtcgtcgcc ggaggctgtt gttgctgcgg cgatggtgac gccgcagctg ctgtcggagc     81960
     tgctggcgcg gtcgggcccg ctcgcgataa gacacatcac gcacgcgctc acggaccaga     82020
     tcccggactt cagcaagctg tcgtcctcga agcagcggcg gctgatcatg ggggccatgg     82080
     acgcggggga ccgccgcaac agcgtcgtgt tcgagaagat cgggtggggc cagtggaccg     82140
     tgaagcccgt gctcccggac caggacttcg acctggtgct cagggagaca aacataagca     82200
     acgctaaggt caaggatatc gtgtcccagg agtcccagcg ccgccgcaac agcaagaaac     82260
     tcgccaccac aggaaccact ggaaccactg gaaccacagg aacagcagct gccaccgccg     82320
     ttacccctgg cgccgcaccg gcacccgcaa aacactcaga aactacaaac ataaactctg     82380
     caaatgtatc gccaaaggca caacacgcac agcctgcaca gccgagagct acagtgtacc     82440
     tcgacgagaa cgcagtggac tccgatgacg acgaggaccc acacgccgac ctgctcctat     82500
     cagaccacaa gcaacacaaa cccacagcga cgacgttctt gaaccccgag cgcagaaggt     82560
     ccaccgtgct gatggcagag cactctccgg aaacaagcct cgagttcgag ttgctagcac     82620
     agaaggtgag acccataatc aagggcaggc ggaggtcgag cgtgaaagcc cactcgccct     82680
     tcgtgatcaa accctctgct gcccagacgc accaggacgc aacctcggtg ttccgccaca     82740
     acaataactc cacttcggca attgcctacc aaacttccgt ttcggggcca ggggccgccg     82800
     taccaacggg aaacaacacg ggcaacggca agatagacct ggacactacg ccaaacagcg     82860
     aacccacctc tagaagagcg tcacgtttgt cctcttcaaa ggagtcaagc attagatcaa     82920
     ccctgttccc aaacaaaaac tatagatgga ttgctaaaaa tccagggctg gcccactcta     82980
     ccaatagtat aaacaaacaa ccacaggatc acttcaaaat aaatcactat gatatcgcta     83040
     cagtggacaa tgtcctaaac gaccaccatt ccgaaacgga tgaagaagat tgggcatcga     83100
     ttggcgcagc atccttgcga agaagcagcg ctatctcgtc atctgttaac ctggttaaca     83160
     actcaccgtc tccacaatct gatgactcaa ttaaacatga gtctttacac tctaatgacc     83220
     caagaattac gccgacaaaa cccgctgagg ataaaagcgc ggcctatttg ctaatgagct     83280
     tgaaatccta attcattttg tttttatctt ttcatctatt tccttttttt tactaactat     83340
     attactgtac actcagtatc gctcataatg gtaaactttt taacgtattt ttttttcctg     83400
     acccatattt ttcttcatag aatgcctaca ccagccttta tttcacttac atttttttgt     83460
     ttattcgatt ttttttttat tgctaccaca tattgtttta tccatacatt ctatctaaca     83520
     tctctattca aaagtatcta ctcactactt cattcatctc caggagacaa tgagattatt     83580
     ttttccaata acttacttta tagattaatt cctaaaagca tacccttgta tttatatgtt     83640
     ttactcagta cttgtttctc tttaatattg gtttagacag taatattagt tttacttgtt     83700
     acttaaatct attattttcg caaaaactca acactatatg agatagataa caattatatg     83760
     tatatcagta ctgatatgaa attggacaag taaattgact gcaactctag cacgacagac     83820
     ccggggaccc attacaatta gtcgacaata tcagcagtgt tctgaggctc gtcttcttct     83880
     gcaacatcat tacttttagc ctcttcctcg atatttaagc tctccatggc atgctcgttc     83940
     ttgtattcct cctgcagatg cttgaactcc tcttcattct ctagcagagc agcaaccttt     84000
     atgatctctg cttcaccgag aagatctaag gcatgttctg caatgtcaat tggtaaatca     84060
     gcaaaggctt cattaacggt atccaaatct ttggtcttca aggcctcttg taagttcttt     84120
     ggaagttggc caaatatctt cactctttca atctcatttg gatcagacga ttcaaaatct     84180
     ggaagctcaa actcgatttg tgtagattca tcaaccgtct ttaactgaat agtctcaact     84240
     ccttgccctt cattatttct ttcttcttct tctaggataa cacacctctt cttgacatgt     84300
     tcaaactttg tattcacaga atccaaaaat tgtgctttag cagcttcgat tctagactct     84360
     aggaatactc tcttgaagaa tacttcaata gagttcttca agcgttggac gtccaatgtt     84420
     ggacttcttt gcacattgta aatggaatca ataaaagcta gtatttctgc ttggtgaaga     84480
     atttggtaag tcctcttttc gtcatgcttt agttgtgatt caaaggcttt catcattaga     84540
     gcatccttct gttgctcagt aataatttgg tagttttcca tcaagaaact ggctgacttc     84600
     ttgtagtcac cagttggaat ctttgagaac tgttcagttt cagggaacaa gtgtaacata     84660
     tcttcgtcat ctgtagtgga ttgtgtttga acagcctgtt gtgattcttg agcttcttcg     84720
     ttgatgatct gagtacctgt ggaagcctct gcgatggatt ttggaggtaa cgcagtctcg     84780
     ctagtccttg taacaccagc cttttcagca gatttctcca gctccctggc tttcctttct     84840
     tcctccttct tgtatttgtt catgaaactg ctgtcaaacc cggtatggat gtcatcgcta     84900
     gagatgtgtg cctgcttctc cttgtataac tgcttcaact tctcgttagc ctccttcgtg     84960
     acgtcgtcga tcttctttct gtgcttcagc atcagctccc tcaggactgc cccgttgcgt     85020
     ggatcctgcc catccttgat ggcgtctctt ctcaactgat cgaagaggtc ctccaccatc     85080
     tcattgtaag tggcaatctg cgggtcgacg ttctccccaa cagacttctc gttcttgtca     85140
     aagttctcat tcagaaactt ggtaaccttg tcttgctcag caaggtcctc atccgccaga     85200
     gaccccagca gcttgtccac cctcttgttc aggaacgagt acatgcccac ctgcgcctcc     85260
     aggttcttga tgtcctggtt ccgcttgaac cgctgctcgt ggatgctctg ctgcttccac     85320
     ttgatgaacg acttcttgtc cacattcgga tgcacctcca catcagagtc gtcactcagc     85380
     tcgatcttgt cccacttaga gtaatcaata gccatctctc aacgcccgct tagccaatgc     85440
     acccagacca gtacaattac agtcagtaca actatttaat gctcaataca actattatag     85500
     ccaacattcc tttgagctga agggaacttg aaccctaggg gaaccctaaa caaaacccta     85560
     gggtttctca ctctatacaa gatgctcatc gatggtattt aatggtattc aatggcattt     85620
     attggtattt attggtcttt tattggtata ttatggcatc tataatgccc ctcggtgggt     85680
     tataaaggct atatatatat aggtgcctgg gaggctacct gtagaagtcg ggccgtccga     85740
     tgttgaggcc gtactctgcc actgcgctgc tgaggtcatt caccgtgagc accactttgg     85800
     aggcgctgtt cttctccatc tgctgctgct gctgctgcgt gagctggctc tgctggccgt     85860
     tcatcagctg tctggccttg gtttgcccgt tgttggcgtt ctgcaccgcg acgttcgacc     85920
     gtatccgcga gtactcgtat gcgtcgctgg ctatgtcgct gacgaacttc tgcgtcgcca     85980
     gcgcgagcag gcgcttcacc ctgatgtctg cgcactcgaa cccgttcttc gtcaggtagt     86040
     agtctatcac cgcatcaggt atgatcggcg ggttctcctt catcatgtcc agcacttccc     86100
     cgagagtctt gtctttcctc gtgaactccg gcagctggaa cagcttgcca gtgccatcgt     86160
     ctatatacgc cttctcctcc gcgttgcccg cgttgccctc gctgggctct gcatctgcac     86220
     cagcaccagc accagcatct ccacctgtac ctgccgcagc ctctgcccgc ccaaacagcg     86280
     cagcgttgtc caccggcatc tcgtcctcgt tgtcgtcgaa ctcgtccagc acttcgtcct     86340
     ccttcatgtc cacatccttg tccacatcca tctttgtaac tgcctctgct acgtacttgg     86400
     ctctgatgct aagtacctgt aattcctcac tgtgctcttt ataacacttc aaagctctca     86460
     aattcacaga ttttttggtt tcttggagcg aagtgacaaa agacaaaggg gactttcatt     86520
     ctgggctcgg atcagctcgg atcagcacga ataacacagc aaggcagtcg ctggacggtt     86580
     aagtgaaggc gctaactaga ctctgctgct tattctgaac agttgagcgt ttcccccgtc     86640
     gaatttggcc ctaggaattg catagagcac agacatagag aatggcattc caagtggacg     86700
     agcacaagct gctcgagatg tacaacttga acgagctgaa ccctgcggac agtgtcgaca     86760
     acgactggca gcgtgtgtcg acgatacagt atgacctggg tgcgtggcag gacagcggca     86820
     agatgttgga ggagaggccc tatgcgttgc tgtctgacct gatagcgcag cagaaaggcg     86880
     cgagccaagg cagccgtggg ttgcaaggcg gcatagatgc gtctacggtg aacgatcccc     86940
     tggatggcca actggtgctg gagaagatgc ggcagttgag gatgaacccc gagcaagcac     87000
     cgcagtatct ggtcaatagc aaaaacttcg acgcgatcca gtttctgcgt gggatgcata     87060
     acagggactc cttcgacgag ttgagccagt acttggacag gttggacaga gagctacaaa     87120
     cgcaagcggg cgacttgcag cacttggtgc agaccaattt tacaaagtac gtcaagatca     87180
     agagccgcct ggatcaaata tactctaact tttcggaagg tggtgaacaa gaaaatcaaa     87240
     atataatgaa agtagagaaa ctgaaagaag aactggacga gacgataaga ttcaccacac     87300
     agaagttgaa ccctgttatc aattatgaga agaagattaa caacttcaaa ctaaccaaga     87360
     gatttattga ggagaacaaa ttcttcataa atctgccaaa acaattaaaa tcacacctaa     87420
     tacaaaacaa ttacaacaaa ttgataacag actacttgaa aggtaaggag caatacgata     87480
     agctagtgca atacttcgaa aacaaggtcg ttgctgagtt tcatgataac gaggaggaga     87540
     gcaacatcaa caaaactcca aaggtaatag aggttatatg gtccgcttgc caatcgatag     87600
     ttgaaatata taagagtcaa ttgtggagac taattaccac accatctgtt attggtaatg     87660
     ccaacaagat agctggtaaa caaagcagtg agattgacat tagtattgaa acacccgaga     87720
     tgtttctgcc caatatatct agattgctag acctaaatat tgatgaaaac cccattatca     87780
     agtggataga atccagaatc gattatctcg agacaaaact tagagacacc gctcagaata     87840
     tgattcttaa aatcaccaat gcacagcaaa acataattag aaaccaggtt tcgcacgctg     87900
     ctgaaaccga aagagatacc gatgctgtgg agttggagca ctatacaaat atagataaac     87960
     tattcagcca tggtgcattt atgaaaaagg gagaatctgg tgactcaaat aacaattcta     88020
     ataccatgat aagttctgca cccacctttg gtgatggaac aatcatctcc caaggtctaa     88080
     ctgactccat tattgtgata gagatgtggt tacttatcct caaatatgca caacagctga     88140
     atgaattatc tgctaggttt atccaattat gggaacatac tgaaaagttt ttagatggtt     88200
     catatcaaac tatcttgata aatgaaaaga gaaaggagaa tattttactg gtaggtgact     88260
     tcaatgcttg tgagaaatat caaaaacaaa ttcatttgtc tgatgatgaa gtcaaaggaa     88320
     taagactaaa aggtgagagc tttgttaaaa tgattgcgga cagaatcttt atactattcc     88380
     aatcatccca aagcagcctt tcccaattca catctgagga tgtttcaatg gatgatatga     88440
     catgggaaaa agaaattggc cttccttcca actacggatt tatcccccct aacgcaaatg     88500
     gcctgagttg cttaagatac cttcctctga tcattgaacc gattttgagg tttagtagtg     88560
     atttggctca gcttaaaata acaccaaaat caattgaaat acctaagaaa cttgcttcga     88620
     taattattgg tcgttcggtt agtgcaattt cttcaacgaa gttaagagat attgcaaatt     88680
     tccataaatt agaaaactgg gaaaaatatg agtttgtaaa cgctagaaaa gatgatctga     88740
     atgactccaa ttatgagtat gctattactc agtttcctac tatcatcaag tctttccagg     88800
     aattatcaat caaaactatc agagatattg ttttttcatt cgagaagttg ccaactattg     88860
     gtggtgtatc aataatcgaa tatccttcca agaaggtgct aacaggcatt gaaattcaac     88920
     aaattatatc tatggaagcc gttttggaat caatattgaa gaatgcagca aaagataagg     88980
     acaatccaag gaatccacac acaattctca cattgactaa tttgcaatgt attagagaga     89040
     gcacttttcc cgatattcta cagttctttg atgactgttt tgaatggaat ctaaagacaa     89100
     agaatttgga gttattcaat ttacttgcaa agatggaaca atctattttc ggtaactatt     89160
     tatctgacct gaagattagc ctacgtgaca cccttgaatc gaagtttaat gagatcgatt     89220
     gggctactta cacttctact tcgtttagag ctggtgatta catcattgaa tctttgatgg     89280
     tactagtgtc tgtccacagt gagtgttccc gggatggtcc tcagttaatt gatagaatac     89340
     tacgagagag tcacatcttc atcgctagat atctcttcga gtctttcaag ccatttattg     89400
     gtaatatatc agcagatggc ctgctacaag ttaccgtgga tatccaattc ttccaaagag     89460
     tcctaggaag gctgcttgat aaggatactg aatctacatt gggcgcaaca ttgcagaact     89520
     gtttccaaaa caatgccgag agattgaaga tgtgcataaa agaaacggaa ccaatcgtca     89580
     atgctaattt gaagagaaca agtattcaat tttcagcatt caaataagta cataaccata     89640
     tattgaatga aatagattta atgattgcca aaaatatctc aaccgatgag agctttattt     89700
     ttctattata caattttatt atcaacaatg ctattaagat gagtactttt atgagatgta     89760
     gaattacgta cccaatagcg actcatgaga aatgttcacc atgcttcttc aaggatgcga     89820
     tgttatataa aggataaacc gagtctgcgt ctgcaagtag ttcatccttt tgcttgaatg     89880
     tgcttatcca tgacgagttt agtttattca agttctcgtc cacagaaaat ggtttattgg     89940
     agtcaccaga atacgttagg aacgcaatta attgttctgc attttcatcc ctgttatcaa     90000
     aagtaacaag gtattcactc ttaccattgc tcgaaataga tacaacgtta tgcttgaatt     90060
     ccacttgttg tgctagggac aactcaccag tttcggtatt acagtgtaag ataaacagca     90120
     caggtgtggc ttctacaaag aaggcaacat atggctgttg accgcatgac ttgatggaag     90180
     caacggcata ctcgatgaca ttgttctctt cattctgaaa tcttgctgga gccaaatgct     90240
     gatcattgat gaaaggcttc accgcgtcct caaaggagta ctgtgacagc aactcacctg     90300
     attgccagtt ccatgcaaat atctccttgt caccaccagc actaaataag aacttcgttt     90360
     gccattttgg aaggtccacc gacgagacga actccttgtg gccgaacagc catttgtcga     90420
     caataaaagt ctgtggataa tgcgaaatct tgatatgctc gtctctgtca gtagtgataa     90480
     tatagctctt gttgttagca tcctttgcaa ctgccacatc cgtcagcatt gagacgtgac     90540
     ccaggatagg ctcgctctgg tcatcgatct ttcgtattgg ctcctcgtcg atttttagct     90600
     tataaacgtc accaaacttg tctgcgacta tgatagtagt gtcttcatcg gccaatgcca     90660
     gcgcattggg tctctttgga aactgctgtc tcttcatcac ttgcaggaac ttctccggat     90720
     cttcagctga ggtatcgatc ttaaatatca caaccgactt atcagagtcc acgcatgcaa     90780
     taagcttccc ttcatcagag gtcagcctta agttcctgat gtacgagtac accgctggag     90840
     caccaatacc ttggctgccc ttcggcttcg catcaccggc attgctcttc aacttcttgt     90900
     aggaattgtg cgagtcccgc tgatccgtgt ctacccagta gcccaccagc ttctcaccag     90960
     caaacacgct gatagtgtgc ttgcaaacca catactggta cttgttctgc gaatcactga     91020
     tcgcaacgtt caatggatgc acaaacattc gcaaaaaaat tatactcctc ttctggtccg     91080
     tttccacttc cagaatcaaa gccagaataa tggaagcaaa gtaaaaagta ccaccccaga     91140
     aacctacaag taataccaca agttccaact actattgcaa ttttagcgat gagctcatcg     91200
     caaaaatttt cagtgacgtg cggcggtact tcctcgccgt tcccctttaa ctctgccaaa     91260
     cctcgaaatt gcaggctaat aagtagtata aacatgtcaa tgttggctgt aaatggctgg     91320
     ataatggcag gactggagcc tagtgtctag taattggtgt gtgtgtgggc tgaagacgag     91380
     gtttttcttt tggcgatgtc taatttgatc aggttgcagc gggagtatgt gttgagcacg     91440
     atagactcta tagagactga tcatgggctg aagtttcttg ttattgatgc ggaggtgaag     91500
     cggttctttg atatgctgaa cctgactgag cgggagctgt tgagccatgt gacttctgtg     91560
     gatttcattg attccaagtc gcggaagggg cagcctggag tgtccgctgt gtacatgttg     91620
     aaagcgacgc agttcaacat caattgcatg gatgtggact tccagaacag gccccccaag     91680
     tataagaacg cccatgtgct ctttctcgtt ggtattggcg ggactttgtc cgagttttac     91740
     aggagcaagc gatttgtcac ccagttcacc aggtctgtga agatgcttaa tatgaacttc     91800
     atggttaagg aatcgcagta ctttcaggcg tatgatatag acaagccctt gcagctattg     91860
     tttaacccca attgtaggga cctgattgac gatgtggtcg agagaacggt acgagcatta     91920
     ctgaccatgt gtgtcatgac gggagagtac ccaattgtca gatattacaa cactggtctc     91980
     tgcagaagga tcgccaccga tttccaggag tctctagatg atcacgccag aaacaacgag     92040
     gatttcttta cagataactc gagaccaagg tcagttatgg taatcgcaga cagaacagtg     92100
     gacatgtttg caccattctt acacgagttt acataccagg caatggctta tgacctttcg     92160
     gataacatca ctgcctctga cgacatatac acgtacgaag ttgaaaatga agccggggag     92220
     aaacaggtaa agaagacacc gctgcttgac atatatgatg aagactgggc gcagacaaag     92280
     catcaacata tcaccgatgt gcttaaatat gtagacggta aaattaatga actgattgcc     92340
     cagaacccca aactggtaga caggtcgaag gccaagaatg ctgctgattt gggtctgatc     92400
     cttgcacacc taagtgggtt tgacgaagag agaagaagat atgcagcgca caaggagctg     92460
     gtcaccgaat tgttgcagat caattcccag cggaaacttg ccgaatgggc gcatattgag     92520
     caaaacatcg ccggtttcgg tctagatgct caagggcata agtgcaaaca tttaacagat     92580
     gaacttatag aggtattagc taggaaagaa cccgacactt tggacaagat ccgttgtatt     92640
     atattatatg ctatattcag gggtggtttg atagagcttg attttatcaa gttgttaacg     92700
     tttatcggtg taaacgagga gcatgaattc ttccatagct ttatgatcct tttcaagaac     92760
     attggcatgc tgggcattaa catcatcaaa gaagatccta agaccaaacc attcaagaaa     92820
     gtttggttta gcgacacaat tatagacgac cctaatgtgt ttgacacttc taggtatatt     92880
     cccgctgtcg gtaacatctt atctaagatc atcacaaatc cgttactgct agatgaagag     92940
     tccttcccat atgtgaagga caagcctatc gaacttcttg atgaggaaga gttaggagaa     93000
     ggtccacatt tggccacaca gaattctact tcgctgagaa aaacgcggca cagagctaac     93060
     tggaccaaga gaaatgagcc tgtcgacagg tctccacgcc aacgtttctt cttttacatg     93120
     gctggtggta ttacctataa tgaaataaaa tctgcatatg atcagtcctt actgaagaat     93180
     aaggatgtct tcattggtag tgacggtatt ttcacgccca gatcatttat gagaagtata     93240
     gagaagttgg atgccccaag ggaagagctt caccttaacg acgacaagaa ggtaaatgac     93300
     aggccaccgg agttcttatt ccaggacatt gcccctacta ttgagaggcc aacgcatgtg     93360
     cagagagttc cgatccatcc cgaccagtcc aaacagcaac tgacacctga aaaaccccag     93420
     gagccgtcca gtcctaagaa gaagaaacgc agtaaattca accttttcaa gaaaaaggat     93480
     aaatagagac tataatttct gtaagtaaca actcaaagtg tatcccagta aatcgcattg     93540
     ttatctaaaa ctacttgacg aacctgttca agaactcctt gtgcttctgt gacctcacgg     93600
     tatcgttagt aaacttctca ggcttcacca ctttcttcct tcggctaaat gcggtcttcc     93660
     cccaggacac actatcgtct tctttcttca ccagtttgat atccttctta tcctcgacct     93720
     caagcggttg tatcatcttc tgtacctgac tcggtccgag agtcgcactt ccagtaccaa     93780
     tatttgtacc agcactagta ctatcatcaa cagaacctgc atctgaacta gtctgtatct     93840
     gagaggtagt cttattcttg ggcttcctgg ccttcaactc cgtgtgtccc ggaagcaaac     93900
     gagcatgctc tgtgcccgta ggaaccagcg cacctttcgc accgttacga gcctccagct     93960
     gtggcctatg cgcagttgtc attgtcttac tagtatctta cttatgtagt tcggaagcac     94020
     tagactaacc agcttcacct gttcctattt ataactttcc agattcgaag gagctcatcg     94080
     caaaatttgg ctcaagaggg ctgtccaact gaaaaaaaaa agttggaata gactatacat     94140
     gaaggttgtg gaagcaagta ctggtcggta acaggggttt acaaggcagc tatacggtca     94200
     gagtaggtag gctggatagt tatttgaagt atacattgat aaaagttaat ttgaagcgca     94260
     gagaatggtg gagaatacag attcaacgca tggtgacgct gtgaatccag gtcccgaagg     94320
     ggaggcagtg gaggtggtgg atgatctgca cagctatata tcgatcaagg actatgcgta     94380
     tgatgaatcc aatgcgctgc attatgggta tctggaggaa gaagtgccgg gggaagctgt     94440
     acaagaacat gacaactatg cggggagcga tgccgaggat ggagaagaca tagatggaaa     94500
     tcatacagac aagagagcta gtgtggtgat gcctcaggac tacgttgtta atcagaaagc     94560
     agttgcattg tatgattttg agcccgagaa tgacaacgag ctgggactaa aagaaggcga     94620
     tgtaatattt ataagctata gacactgcca agggtggtta gtggcgcaga acgatacaca     94680
     gacaaaaacg ggacttgtac cggaagagtt cgtttcatat ctagactctg aggaaagtga     94740
     ctctgtgcga cctttctatt tgacagagat gctaactcat ggcttacagg cagaaccgga     94800
     acaggatgcc aaagctggta aaaaagatga cgatgaggac gaatgggagg atatagatca     94860
     gcttgaatct gatatggata gcaagcttaa catatctgta agttaacatc tatatcattt     94920
     attcatctta ttctatcgtg catatattca aaactttaga tgatcaaata gattatctat     94980
     caacaattgc attttattca ccaataacaa aaaatatacc tcacaatgat tttggtatta     95040
     tccagaagcc tcaatttact ctctagcttt caatagaggc atcaaaatct cttatgtggg     95100
     gtgttacttc catatttttc tctcaaaaca ctctcttagt tactattaaa tactttcctt     95160
     aacgttaacg atatattaaa atacttgttt aaataatcta caaaatatct gctttattaa     95220
     aatatacctc taactgatat aacaaaagca tttatgcgct attttggctc ttgactatag     95280
     taaagagatg ttgttcttat ggttccctgc tccgacttca tatatcgttg tcactttcaa     95340
     attcatcatc aaggttagct tcgatgtcct ccagaggttc acctttcttg atcttcatca     95400
     gtattttagc atcgacttct ccgcctattt cctgcaatac gctatttgca ccagcaacaa     95460
     tctcactaac aacttcatca tttggatcgc tagcttcacc aatttttact gcaaaagata     95520
     gagatatacg agcatcttgt attagaccat tgactacctc atcttcgagg tttaatgcta     95580
     tctcttgaat gtgctggtta aactcataaa ttgtttcagg tttcatctca acagttggat     95640
     tctgctgctg gaatgtacca actttagcta tcatgtaagt tgtgaaacct tctaaatagt     95700
     atccttctat gttgtcctca tcaatatctc tgacagcacc gataactttt agagcgattt     95760
     catataaccc tacctcaatg cacatttttg ctagtgaaag taatggttgc aaaagttcta     95820
     caagttcatt agcccccgag ctttcagagt ccaagttgtt actaatttcg tctttcttct     95880
     tctcaaacag ttcccaggct agactgaaag cttcacacgc ttcattaaac ttttgctgag     95940
     agattctaat agaacccaat gtagccaaca catctggact acctctttca gttatttcaa     96000
     gagctttatt gataagttcc tcacattgag actcagcttc aggttccata caaagatctg     96060
     tcatccaaat ttcaatcatt gaaagcagac caccaactat cttgttcact tgctcaccgt     96120
     tcaagttatc gcctccttcg ttggagacat tctcaatacc ctggctgata agttgtatac     96180
     cgtcaggacc accaacaact tgccccagtg tgaagaattg gtcagtgccg gtcttggtcc     96240
     cttgaggatc gagctcacaa gacttcacca ggcacggata cgccttgtct agctgaccat     96300
     cctctaaata tgcatcggca aacactttgt atagctcagg atccgagcaa ctaccattgt     96360
     caacctgtga cttgtacaac tttaacagtt tcaacgcctt cttgcaatca ttctccccaa     96420
     gcgcctcttt ggcctgaaca attacagctt ccatcctttg accaatacac acaacctcct     96480
     gttacaccaa caaattgcca cttatctgtg ctccgccaga gactaaagtc aaatattaaa     96540
     tcaatgaact agacctatat attatgcgat gagcttcact ttattttgta ttttttatca     96600
     aagctcatcg caaaattttt attcttttta tacacaccat ttcttagaaa atcccgtaga     96660
     agggcccagt cgattccatt taattataat agacacacta tcaacttgga attagaatat     96720
     tatcaataga ggtacggacc aatgctatgt aagtatatat acaatcgtat tagtacttga     96780
     aattcagggg gtttgcgctt ttcaagagca tctacgcatc agattagcca gttgtacagc     96840
     ttctttagtc tttcggagta aggtcctctg tactggcggt gttccgtcca aaggatccgg     96900
     tcaatttcac gacggccggt gtccaggtct agttgatcca gtctctgtat cttagatgta     96960
     ctgattaact tgtagcccaa gtagcagact ccaaagagga tcaacccacc gtaggatgag     97020
     aagaaggact tggtgttcca gtatccatgt atgaagttta tgaaacccat aaacagaaca     97080
     aagatggaac accccaacag accaaacatg gacaggtaag gctggaacgg tgatctgtag     97140
     gggtagaaca catcgtctct tgatattatg tccctccgtt tcttcaaggc atagtaaaat     97200
     cttaagaagg cgacgttcaa tccgagccaa atgattgacg tggctgcact tgaaatattc     97260
     atcaacacat caaagttgga tatagcagcg tcatccacag ccaggtatgc tacaatggca     97320
     aacaaacttg agaacccgat ggcaacataa ggaacgcctc ttctatcaca caatctaaac     97380
     actgctggcg cttttctttg aatagacata gcatacaaag ttctggaaga agcatataat     97440
     gaagaagctg tagcagacga tgtaaagaaa attaaaacag cattaaaacc agctgcaaac     97500
     gaacaaaaac caaaattttc caaagccaaa acccaaggac tggaaaaccc agcctgaaca     97560
     tctccaggat tcactccatg aagaacttcc tcgcacctat aactaacttg ccattcatta     97620
     gaaaccttat tctcaatatt atgatatcta ctttctaatg ctcctgtata gtacgataac     97680
     aatcttggat caccagtata aatatttata ctgaccgaga atatcaaaaa gaagtatatc     97740
     gtgaaaatga aaatgaatgt ccttttcatt gctgaaggta tagtctttct gggattcttg     97800
     gcttctccac tagctacaaa ggtcatttct actccactaa aagcaaatgt agaaacaagc     97860
     attactgaaa caaccgcaat gaaacggcct ctgtttccac caataccgtt tatactacct     97920
     aggccagcgt cagataaatc aaatgtcggc ctaaataaac cataagtgat atccttcaag     97980
     tttctagatt tctccgcatc ccaataacga aaactgactc taccgtgtac gtcaaaccca     98040
     tgaccagcat taagaacaag cattacaata acaatcataa tcgttatcag gacttttgat     98100
     agaccaacaa tgtaaacaaa ttctcccaaa aacctgacat caaacaaatt cagtactaaa     98160
     ggaaataagg agaatagtgt aacgaatcca gctgtaccac ctctagtgag tttcaggtga     98220
     tcatagtgac tgaagtaaaa agtacttgaa acaacttgtg caggtaacgc aaccattgat     98280
     gaaaaccagt aggtccaacc taaagcaaat ccaaaagcgt cctcgacaaa ccttgacgct     98340
     aacccagaaa atcctgaaga aacaggaatt aatgtggcaa gctcagcaaa ggacatcata     98400
     gtagcaatta caactgtacc agttattatg aaccccaata aacatccaaa agggcctgca     98460
     attgaaaatg ctttacctga agtcatgaaa atccctgcac tcaaacatgc acttatcgct     98520
     agcatttgaa tatgcctcac ttttaagttt ctctgcaatt gatttcgcct tcttgtacta     98580
     tcatgtagat atttattgat cttttcatgg atatagcgct tgcctttctt ctcctgatct     98640
     gaatcgtaaa agtttgaatg aacatttcca tcgatgctga cactacgttt cattgtttca     98700
     tagtctatgt tttcatcaat agcaacattt ccatcacttg cgttatcgat aacataggtt     98760
     cgtgacgaca tattgtcgaa gttatttctg atgtcattat tcgtatgagc attctttgat     98820
     ctggaaggat tggctgactt ggaataggct ccttgaaatg ctgatttcaa tacatttaaa     98880
     cgtagcctag cacagctgtt cttcttatta ttagtctcag tgttaggact tgtgtatttt     98940
     tcatgtaaaa tagaatcctc gaccacttgc aatccatcat tattctgctt ttttaatata     99000
     tcctctaaaa catctctaag ttcagcttcc ttccttactt tcttatcata tctttcaaaa     99060
     tcattcatcg agtggttatc atagttcaga gacagtatac tagaactgtt gagcatatca     99120
     gccagcccta ttttcctctt gtccatatac ctctcagtaa cataaaaacg atgattccgg     99180
     acttcatcgt aataccgacc ggtatcgtac cagccttctt cctctattat acttcttaaa     99240
     acaccagtat caatagaatt tgcaggtttg atggatatac catcaccgtc atctatatag     99300
     tcatcatcaa ggtcatcatc ggagataaca acttcgatgt tgtttcgacc agggaataga     99360
     ttgcttcgtt cctcacccat ttcatccttt atatatgttc aaatagcact ctttgtatcg     99420
     gtcagtgctt cagttatcca tcagaaacct acagcaaagg ataggaaact acttataaga     99480
     tgcacctatg ctaacctctg taagttgttg cgatgagcaa gatattcgtg cgactaaaca     99540
     cgtttgccag taactgaata atgacagtaa attaaatgct attataactt atatatattg     99600
     acagaatgca aactaatgcc aaataagatt acaagaaaga tcaagtatat agtacagtta     99660
     tcatgccatt acgtggtagt acgttgaaac gctgtcaaca tttgcaatgg ccactaatta     99720
     atttcagcta tcagttcaaa agtggactgc tcaggtattt atttaaactt tttcttaact     99780
     gaagatatta gatttttcaa ttcttccaga ttagataagt tggatggtgt ctctatacca     99840
     ctttgatcat tggagttgat ggtactgccg ttcattgggg ttctatacaa gacactatcg     99900
     tgaatgttct cgtctaaatt cccatttcca atgactgtga taacaggtgt tttatctgtt     99960
     gatgacgatg aaggcattac atgcagagat gctggccttt tcttctgaat aggtgtacta    100020
     agaataatct gcttctgtct cttagcgttc ccttgattag atggaggtat aacagtaggg    100080
     gtcgaaggat aatcaccagg tgtggttgaa actatacgtc tcttgagagt cataggtgta    100140
     cggtactttc tctctcccga agctgatgat aaaacaggca atttcgcttt tagtctcttc    100200
     ggggaagcca gaatatgaga ctccaaatgt gcatatgtgt tctgttttct cttcttagtt    100260
     tcctctattt gttgaagata cctcttctct tcgagttcca agactctttt tagtttggca    100320
     tcaatacgct gagaatttat cgtatcaaca tctgaagatg cgactctttt ttcaaccttt    100380
     aacctctggt agtattcacc acgcccagtc aatttatagg taaacaaatc cccacatgtc    100440
     tcaatagaat attccaaagc tttatggggg tccttgcctc ctatgttcac aattattatg    100500
     tcttgcaata aactgctgaa atgcttagtg attcgcttca attttaaata ttgagagatc    100560
     aaatcttcgg agaatggtgt ttcttgagaa tcccaataca atactaaaat ggtgaactta    100620
     atattggcct ttgcagcaat atcgctaatc attttaacca gcacctctcc atctgatttc    100680
     aatttcattt ccaaatcaaa aatatcaaag tcagtaacac ctgtgttgaa agcaattaaa    100740
     caggtatctt taatatcttc atccttagaa tttaaactat aaggaataat atttaaattc    100800
     ttatcatcca cagatattgt ggattttttg gaatccttaa ttgagaattt ttccaatacc    100860
     caattatttg gtattgtatt ttggttatct aaaataacca gaatgctgat attttggctg    100920
     gggggaatct ttttcagtac tttttgaaag tagagagatt ttatgtccat tggctgccag    100980
     aatttcatct gcttaaccat tgagtgagaa acattacatt tttcgagttg taaaggtgag    101040
     aagtctctgc ctttagattg aaatgataca tttgaagtct tattgacgaa agatgaattg    101100
     acttcattcg ggacaattga gtagtttggt attcctaact gtttgctaac gattcgtata    101160
     ctttcagatc tttgttttat ttctttcttt ttatttattt tcttttttgt ttttgataac    101220
     catgtcaata ggtatttttt acccattgat ttttctaaca aaatgtcagc atggctttga    101280
     agataaatca tgtacaactg ttcatgaata aatgcacgaa aaaggtcacc agagaaatct    101340
     gaaataatct ggcttttgtg acttctttgt ttcagagaga cctcaacaat atttgacaca    101400
     ttcttatgta tgacctcatt tttcacttga ttatagatat ccaaaataag cgactctttt    101460
     tgaactttac taatagatat cttaccactg tttgattttt caggttcctt tggtatgttt    101520
     tttaatttag cagtggtctg cggattcaac gtattcttat tggaatttgt agtttttgat    101580
     tgattgaatt caaaatttgc tttcatcgga acttggtgtg gctctatctt agataattca    101640
     atatctttag atggacttct agattccgtg cgctggaata ctgaagatgt ggttggtagc    101700
     gtagaaacat ctgatgacat tgtttgagaa acaaggggat tacctttttt ctcaatcttg    101760
     agagttgctg atgtaggctt taagagggcc ggcgttttca cttgaagtgg actgttatcc    101820
     tttctctttt ccggtttgcc aaaagtgaaa ggattctgag gctttgtggg atttgttggt    101880
     tgctgtactg ctgctttcaa tacagataag tttttgactt tagattgagg aattgcattg    101940
     ccaaagaatt cgccagagtt cggtttacct gaattcacaa ttgagatttt acttgagagt    102000
     tgtagtttct cctcgacaca ttgcaaatag ctttgattca acggcttttt ttctgggatt    102060
     ttgtgtgaat gatgaggtaa tgtctttaga tcaacgccat catcagtaat cgtaattgaa    102120
     taatattcac aaaagtagag tagttcttcc ctatcattga atagaaacat atcctccaca    102180
     tatttaaaat cgagcggttt gtgctttttg tttagtgaat gagacaaggc tttcatgcca    102240
     taaaatctaa cttcccctaa atatgtctct agaaaagaag ccatcagaaa aggaatgctg    102300
     tcacttttaa taagcttgaa aaaccgctga taatagttca agcaattttc agttttaatg    102360
     aaacctcttt caataaatcc ggagtttgat atgatagttc taaaagagat tgctaactgt    102420
     accaaatcat cttggaatat gtagtcaggt agatcttgga tagttttgtc atactgagga    102480
     tctcttattt tactcagtaa ggcatatgct ctaaattcag cttcatttgg acacgttccg    102540
     ccagcggcac gtacatcatc gtatatttct gataaggtaa ttaaggattt atgcagttgt    102600
     tccagctctt gttgcatgga gtattttacc tttgacttgg ccatgacatg caagatcaaa    102660
     agatgaatac gtacaattct ttcgttacaa tcgactgctt caggaccaca gtaattttga    102720
     tatgtgaaat cttgacggat tgaccgcatt ctatcccaca gaaaaccttc actctcgggt    102780
     aaagtgtcaa gtaagttatc cacaatatag tccaatgtct taaccagaat atggggtggt    102840
     ctaacatctg aaggtaaagg aggtgcagca gcggcagcag gtcttgcaaa cactttcaag    102900
     gcctttgatc gagccgcctt tttatcgtcc ggacttaact tctcgtaact gtaaaccgtg    102960
     tattcaacat tacgtcgcga tctctcaaaa atggggcaca tatctagaca tgtaccttgg    103020
     aaaacaattg catcgttcag atccttggca tggtctgctt tatctacaag acctttgttt    103080
     tccatcattt tcctctccat ttccctcatc ttccttagtc tttcgtataa atctgtcaag    103140
     tcatcaatag attcttccaa ttgcaacatc ttctgctgat tactcttgtc ccatgagtcc    103200
     tgcttgaagg gctttgtcct caattggggc tgctgggcaa tgagaaactt gggcatctgt    103260
     ctgggtccat ggctccgacg ttgaaaccca aatttctcag gtgaatccac caatggcccc    103320
     aagaactgcc ccttaccgtt atccatatgt taagatttaa agctagcaga aggcggtaac    103380
     cacactctaa tttttgcaat atgcaactgt ctcaaaatga agaacaaggg caattttcct    103440
     attcgaagca caaactaaaa agggcaacag cggttcaact gctcagaggc tgaattgagg    103500
     attctgaaac ctgtgtccaa ctcaatatat ggcttcttaa gagtaacttc atcggcttca    103560
     agtcccaatt gattgacagc cttttgactc tttgctaacg ttggaaagct ggaaaagttt    103620
     atgtgacgtc ataagtgatg agtataagcg gaggaacgtg tagtgttgcc agtatagttt    103680
     ctatttggca tataggcagg gaaaagactg tataattgta ctttcgattt ggtgtgatta    103740
     tgtactatgg ggaagttata taaattgtat tatgtgttca ttgctcatgc tgagtataca    103800
     ttatctgatt tgggaagaaa ttggaaggga aaatagacgg aaaaaaatgc gaagttcatt    103860
     acgggtctat ttcttaaatc aagttcttag ccaacaggat ttcagcgatc aagatacctg    103920
     aaccggcagc accgatgatg gtgttgtggg acaggacgac catcttgaag tccaggactg    103980
     ggtcggctct gactctaccg acggagacac cgtaaccgtt gtctctgttt ctgtctagtc    104040
     ttggttgagg tctgtcgttt tgctctagga cgtggatagt ttgctttggg gcggaatgac    104100
     agcccaactt gtaagcgtca cagacgtagt cagacaaggt cttcttcaac tcttcgacgg    104160
     atgggacgtt tctgttcttg aatctgaagg agatgcactc ggtgtgaccg tcggaaacgg    104220
     cgactctgtt acattgagcg gagaccttta gatcatcctc ggagatcagt tcgacggtgg    104280
     aattgtctgg ggacaactta cccaagattt tcttagtttc ccattccatc ttgtcttctt    104340
     cacctccgat gtatgggatg atgttgtcta ggatgtcgat acctggcaca cctggggaga    104400
     aaccggcacc ggagatggct tgcaaagtgg tagtggtcaa agcatcaatt gggccgtact    104460
     tttcaaccag aggctttagt ggggcgacca gaccggcggt ggaacagtta gagatacaga    104520
     tgatgaaacc ggcctttggg ttctgcttct tcttttgtgc gacgatgtcc aagtgttctg    104580
     ggttcacgat agggaccacc agtgggacgt cttcctctct tctgtagttc ttggcgttgg    104640
     agatgacggc aagaccagcc tccatgaact ccttctcgat agggccagcg tagtctgcgt    104700
     ctagaccgga gaagacgacg tcacagtcct tgaactcctc tgctttacac tcgacgacaa    104760
     cgatgtcctt ggcggactca ggcagcaggt cagtctgctt ccagttgaca gcatcgacgt    104820
     acttcttgcc ggcagacctt ggagaagcac ccaacacctt cagctcaaag tccgggtggt    104880
     cagccaacag caggataaat ctttggccca cggaaccagt agcacctaat acaccagcag    104940
     tcttcatgtc tagtagtttt tcgtctatat ttgtttttct gtaacttaca gctgtacttg    105000
     tcaacgctac ttgtaataac ttaagtactc ttaatgatag cttcgatgtg tctgcagtaa    105060
     tggcgatcag ttatatatga acacaaattt tttggtggtg aaagaaatga gtcagtcttg    105120
     cagtgacata cacgtgagat gatctattgt aaattcaatg tattagaaag gttatgtaac    105180
     tatatattac tctgtctgag gcggcaggcc cttgaagtca cgctggatac gcttcaacag    105240
     cgccagcgag ccaccggtgg catcctcctt ctgctgcaca aacttgtcca ggaacgccag    105300
     catctcctcg cgcgacacat gctgcggaac tccgcgctgc ttaaccacca caggaccgct    105360
     caacattatc tttggttccc ttccccccga catggaacca actacaaaag ttcagaagta    105420
     cacagtcatt gctactttat aaagctcatc gcatcgcttt ccgccaaatt tttcagtttt    105480
     ggcagtttca gtaaaatgta atagtatacg gccttgcggg taacacccaa cagcgttgta    105540
     tagcatgctg tattatagta tactgtattg tattatatta tagtattctg tattgtattg    105600
     tattgtagtg tattgtattg tattgtattg tagtgtattg tattctattg tattgtattc    105660
     tgtattgtat tatattattc tgtattgtat tctgtattgt attatattat tctgtattgt    105720
     attattgtat actgtattgt attatattat attattttgt attttattat agcatactgt    105780
     agtatactgt atagtatagt atgctgtatt gtattgtatt gtattgtatt gtattgtact    105840
     atattatatt atagtatact gtattatatt atattctact atactatatt gtaaagtatt    105900
     ttattgtatt acagtatagt ttagcatact gtattgaatt gtaatgtata ttttgatatt    105960
     ttactttaaa gtattatatt gtgtgctagc ttattcagct ctaaattgta ttatattcca    106020
     tttttatatc cctatacaag attctcttgt atagctcata gcagtgcatt gtattttata    106080
     tcaaaatata tactcctctt atatgaaact tttgttttac acggtatttc acaatgttcc    106140
     actgcatatt atagaatccc attcctgagc tagttttgta ctatatacac tctctgcatc    106200
     attttgttca ccagctatat acaccgctct ctcgtctctt actgtagatt tgtatatgtt    106260
     actgtgaaat tgcatactat attgtataat ataatactat attaccctat ggacaacagt    106320
     gccaacccgt aatacacatt cacataccat aagttggatt actgtcccaa aatataaaat    106380
     tcagtcacat atatttaaca tcatttatta ttattaaact actccggaac actactagac    106440
     attaaattat attttgggca tagtggccca ctttatgctt gagtgtgtga tattccattg    106500
     tactccccat acgctgagta gcaccaaatt gtatatgtac tgtctctaaa agcaagaaga    106560
     tgcttctact gcggatactg taccttgtat accaccaacc atgtctactc tgttcactgg    106620
     gcataccagt tccttgcata cccaagttat gtacattact gaatgctttt tcccaccatc    106680
     ccaatacatt ggtggactag tgcttcattg cattccacac tttattacac aaggtctgct    106740
     tctcaactct gttttacaca taacagcatt gactagtgtt acaagttaca tattcatcta    106800
     cattgaagcc cagtggtacc atcaatagcg gtgattcagt ggactgccgt tctacctcga    106860
     cagtagattt ggctcagctc catttgcgca cgttggtagt ctcttctccc ccatggatgg    106920
     tgtctcctat agaagcccag cgactggaac agcgcacctg ggatggaagg gagcacatat    106980
     agctgttgat atagctattg gatgggggga ggaaccattg tgtccattgt tcctacgtca    107040
     tttccccagt cgcaagttat cactggccca gttacaattc gtcatcgcaa gtcctcatca    107100
     ctggcaagca cacaagcaca caagcacaca agcacacaag caaaagtact agggctcacc    107160
     agaccaagca tcgattgcaa ttctagaatt tgccactttg gaaacccctt ccaattggga    107220
     agaggggggg tttacagagg gttgcggtcg aagttttact ataaatatgg gtggtccaat    107280
     tgggagttgg gttgtgtgct ttagttcttt tgggtcaatt gagtagataa aacaccacca    107340
     cacatacaca ttaaatacaa tatgtccaag gtttatttcg atattgaagc tgatggccaa    107400
     cctctaggta gagttgtctt ccaattgtac gacgacgtcg tcccaaagac cgctgctaac    107460
     ttcagagctc tatgtactgg tgagaagggt ttcggctacg ccggctcccc attccacaga    107520
     gtcatcccag acttcatgtt gcaaggtggt gacttcactg ctggtaacgg taccggtggt    107580
     aagtccatct acggtggtaa gttcccagac gagaactttg tcaagagaca tgaaagacct    107640
     ggtctattgt ccatggccaa cgccggtcca aacaccaacg gctcccaatt cttcatcacc    107700
     accgtgccat gcccatggtt ggacggcaag cacgtagtct tcggtgaagt ctccgaaggt    107760
     tacgacgtcg tcaagaaggt cgagtccatg ggttcttcct ccggtgccac cagagccaga    107820
     atcatcgtct ccaagtctgg tgaattgtaa gtaatctctc atatagctcc tataaaaact    107880
     atataactga ataaacttat aactattcta ttcctacagt ttgcttccaa attttgaaaa    107940
     atttttcaaa acgggcgaag agggccctta taagaagcca gctttgggac caacttgttg    108000
     aaaaggagca acttgtgaag aggccaaaaa gcagtgtacg atggattcgc tgtctaagaa    108060
     gatccagaac ttgggtatcc atgatctgag gaatgctgcg cggtttgcgc agaacgttat    108120
     agtgcagtat gagccttatc aggtggatgt gaggcgtgcg accaacacgg actcctgggg    108180
     acctacgccg aagcacctgg ccaaggtgtt gcggaacagg taccaggtgc cgctgtatct    108240
     gatcacggag tatatcctga agcggttgat cgaccacatt gcgcagcggc ccaagaacct    108300
     gtatgagaag gcccgtaagg actatgtgaa ctatgggtct gagtggcgtg tggtgctgaa    108360
     gtgtcttgtt gtgatcgagt acctgctgat gaatgtagac gacggggacg agatcaacca    108420
     ggtgcggtcc tgtctgctga cccacaagca tctgatcagc aaagaagtgc tgaacttcaa    108480
     gatcaagttc tccaacgacg gtaagatgga agtgcacgag cgtggtatca ggaagaaagg    108540
     tgagttgatc atgcagttca tcgaggactc caagttcttg aaacaggaga gactgaagaa    108600
     caagaagaat gctctgaaga tcaaacagca aggggagtct gacatgctgt acaacgccga    108660
     tgccatggca tcggtatcaa catatggttc atcctctatg agaggcagca acaacttcga    108720
     ctacggcgaa gacctcgatt tcgatgacga cgacgacgac gacattccag tggacaacag    108780
     acctcgcaga cgcccatccc atgccgatca gcaaagaaag caaagaagag agatactaag    108840
     agaacaaatc agaaacaaag aacaacaacg aagagattat taccaaaaga agaaggaaga    108900
     agaagaagct gctaatgtgc cagatttgat cagcttcgat gacttagagc ctaagggtac    108960
     aacaaacacc agcaccaagt ccttataccc atctgacagc aggttgccta gcaaatcagc    109020
     taccatcggt gaagtcgatg acgaagatga agaggatgag tttggggact tccaaagtga    109080
     agttgcccct ggctcttcca agccagccgc aacaactgcc aatgcttcaa ccaccaagcc    109140
     agcggcagct actgctgcag ccaacgacga tctaatggat ttgtttggcc cttcaaagac    109200
     accagtagag gaagtcaaga agcctgcaaa gaaggatgcg ttttcagatc tgtttgctag    109260
     ctcgaagtct ttgatataga tctgctagca ttacgggaat atattaatcg aatcggtata    109320
     aagtcgttaa gagagaaacg gcaggcttcc agatggttta tgtcttggaa caggattttc    109380
     gagactactg tgcataacat accgtgttgc ctaatcgatt ctgtgccttt actcacattt    109440
     taaattgctt caaaagtggt ccagaaaatc cctatatctc tgtttaaaat ctttttgtat    109500
     tggtatgtaa agtaaataag taatattgag aatgtacaaa ggaaatgcaa tagttgcgtg    109560
     aaactatgag tacgatgcta attgttcttg tatttatggg ggcagacatt tgtatatatg    109620
     gctgaactag acctacaaat cgtcttgcaa tttagtagcg acctcctgga catccgtgtc    109680
     gtcgatgtca tccagagtac cttcgatacc ttgctcgaac atctgtttac ccgtgagtct    109740
     gccatggtgt gcttgcaatc ttctctcctc atcacgctta tccaagccgt gctcctgtct    109800
     gaacttggtt ctccagccga ggaaggactc tctagtgact tttgtaccgt ggaacttggc    109860
     ctgctcttct ttctcacgct cctgcagctc ctggtcgtgc tgtttctgct tcaaggtcag    109920
     ttgctccagg aagtagtgct cggctttctc cttgatggag gatatcagcg cgaaacacat    109980
     ctgcataccg gagagcatgt ccgtctcgat ctgctcttcc agctccgcga ccagcggacc    110040
     gctcacgtag tcagcaatgg agatcgtgtc ggggatattc tcgtacttgc tcatcagcct    110100
     gttaccgtgc tcatcgtact gttgctcgtc ctcgtcctcg tcctctcctt ccccttcatc    110160
     gtcgctgtta agcaacgtct cttcgacttc tatgctgatc acagggttca catcagggta    110220
     ctcctctggc agctgaaacg tacagtgcaa agtgtggtcc ttagacaaat gcgacgtgtc    110280
     tatcagctcc tgcaactcca gcttcaactg caactcaaac ttcaccccag ggtactcctt    110340
     caccacttcg agctcatccg ggtatataga ccgcagaact tccagctcct gctcttgctc    110400
     ctctttgtaa tccatcgtcc cgcacacagt tcctcctgct tgggccatac acatcaaact    110460
     acaactactt cctacttacc actataacta ctttctatgc gatttcagct gaaaaatttt    110520
     ttggcgataa gcgggcaaaa tcacatgacc tatacaaccc ccccgagttg aaagagccag    110580
     ggaacaagtc gatgagctaa agacttctgc cctgcgatgg gaagtgccca tgcgatctgc    110640
     gattcacctc caagagcata tatgtgaggt ggttatatgc tcagcgatgc gttatcggct    110700
     gggtgaagtg gtgcccaggg tcagggtgct ctttgccttg attagcaatg ggcttgcgga    110760
     tgggggaata gtgcaatgct aagatggtgt ggttgcgagg tagcaacttt gatggttgtg    110820
     agatggtgga cagcctagag cccttatcat gggtagtgca cccacgtagg tcatgattgt    110880
     gagctttgtg cacccaaata atcggaaatt gtgtaaaagc tgggtgtagt aaaatatagg    110940
     tgatgagctc atatatatat atggggggtt ttgtgctcga aactttgtag tatttcgaac    111000
     cttgtcttgc caggacttag cacaagcata agtatcaacc aagtgtagcg atgagtgata    111060
     tttatacgga gttcagcgag agtgtcttct cggagagaca tggacagcac cagtacctga    111120
     agatggccca tgccaacatg tatgggaatg gtggtgcatc tgaggtgcag aatgtggaga    111180
     tccagcccga ggccgatgac tacgaggccc ggatcaaaga aattgaggag tactacttga    111240
     agactttgtt gaacgaagaa ccttcgaaga ggaactccgg gtatgttggt gcgtctggga    111300
     tcaagagcgt gccctcctta gagctcgacg accaggccaa cccaagcagc agctctagtg    111360
     atgttagtat acaggatata tctacatcac caggcatgat gtactcgaaa tttaacacac    111420
     atctggtcgg taacagtcct gcagtgtatg gtgcagcagc taacaatgcc ctgtttaaca    111480
     acctgaacag cctgaacgaa tctcaatata tttatggtaa gtctataaac aatgagagtt    111540
     tatacttcag gcaacaacag caattacagc aacagcaaca gcagcaacaa cagcagcagc    111600
     aactattgca acaacagcag ctacagcagc aactgcaact tcaacagcag cagccaacat    111660
     tccttgatag caatgtacag acaaactatg ctaaccagga attcgtgaac tcacaggcca    111720
     atgtaacacc attgaactac actaatatct ttaacaatga aatctctgca aagcctgcca    111780
     agacacataa aatcaaccca tttttgcaag acaagcaagt ttcacgtaag tctaacctag    111840
     aagttgacat aaagcatcat taccaggcta atgcgcttcc actaacttcc gaaaatctac    111900
     agaagatgca ggacctgagt attgacgaca tgcctattga aagtataaac cgcaagaagt    111960
     tccacatcca aaaaactact gtggacccta ctaagcagat caacagcgag cctaaggtga    112020
     aagagcatca gcaacaacaa caacaacaac agattaataa gggtttgtac aagacagaat    112080
     tatgtgagac ttttaccacc aagggcttct gtaagtatgg gaacaagtgt caatttgctc    112140
     atggccttca agaactgaaa ttgaaaaaga cctcaaataa tttcagaaca aagccatgca    112200
     ttaactggga taagcttggt tactgcccat acggtaagag atgttgcttc aaacatggtg    112260
     acgacagaga tattcaaatt tataaaaaag caggcaccta tactgcaaac cctgatggaa    112320
     gtgatgcatc agaaagaaaa ttaacagaag tacagataaa gcagaaaaac ttacatgcaa    112380
     acattaagaa acttcaaaag atgacctggt aatgtgctga ttatcagttc taatctgaag    112440
     tcgtgattag aaaaatcgaa ctcttctgtg gaactccgcc aaattttaat tttattatca    112500
     tttactcatt ctttttttgt tagtttttgt tatttttttg tcttttccga taaacataat    112560
     ggtatttgat ccatttccaa ttgtatttta agtctctttc ctataagagg ttttttcagt    112620
     catattcaag agtagtgcaa ggtactttta cttccatttt gtttgacatt gacttttatt    112680
     gttttgaaaa gctattgccc atcattagtg acaattccac acacattcat tctcctctgg    112740
     tagtgtttga atggcttccc tttcttttgt tgtttcataa aagttatgga gcaaaaactg    112800
     aaaaaatatt tgaaaccgtt ctttagtctg atcgtgtggt tatttatatt tattacccac    112860
     tttaatattt attataacta ttattattaa tatagtacaa gttttatgtt atgagcgttg    112920
     ttaatgtatt tttgaaatat atatacagtt gttattcgaa tttttgaatt ttgatatatt    112980
     attatcaaga gtccgcatgt tcgtggtact tagtgtatac atgatgatat gaaaattaaa    113040
     tagtacaaat ttggatatag tggtaaagta cactttgcca atctaaatat ggtcaggccc    113100
     tcgtcatcga cttatattaa taactaataa ttttatacct tttcgcataa gtaaactctc    113160
     atatctttat tttttcaccc tatctctcaa cgaagagata gatggagatc tcatagtagt    113220
     ccttgtacct aggcggccag gtacatgttg tccttgtctt cctagaggga agactttacc    113280
     ggcgtacata tcattatcag aatcttcaac aatctcatca taaggaatac catcgatgct    113340
     tctttgaagt aagtagcgca aagaattata ccacaccata tgacgttctc tagttgggca    113400
     tgtaaaaatg acatttctgt catcagtggt aactactata ctcttgtaat atagaccact    113460
     tgggtgactg ctattgtcag gaattacaga aacgttcaaa atagaaacac ctttagtctt    113520
     actctgagca gcattttcca tcactggatt ggtttcggac cagtatagag tcatactgta    113580
     tggatggatc cagaaatatc ttctgtgtct accttcacca ccgatatgtc ctagttttgg    113640
     gtagtatttg tacaaatatt caccgataac tgtctgagtc aatgcgggta tcattgtctt    113700
     ttcgttcata gaagcaatag aattcaaagt gcctaatgtg tcaacagatg tagaacggtt    113760
     cattggcggt ttctttgctg tacgtttcga tggtgtgtgt aatggtgatt gagttgggga    113820
     aaatgaaagt ggagtgctct ctgattttac agtactactc tcattaaatg aagttccacc    113880
     gtatagcgct gatgaaattg tatttggagg cacttcagat gctggacttg aaggtgcagt    113940
     tttacttttc aaaggtaatt cactagcttc agataccagt gtggaatcga gattgcttgt    114000
     gttgttgcga gatgacaatg ttgttctttt gattggtctt gggttactgc gagccaatag    114060
     tgtcatatag tacattctag gcagaacaac aaccttcttc gtggttgggg tcttggcata    114120
     agctgtagaa atgaaacatg tagatggaac cactaggaat ccctggctac ttaattcttg    114180
     cttcatttgt tcaacatcag ttatattaga agatttagca ttggtctcga tttcagctgt    114240
     tgacgatggt gactccgttg attttgcgtt tgtaatttgt gacttcaatt tcgaatattc    114300
     tgctcttggt atagctacca aattgtaacg tatttgaagt aatttgatta gctctagctt    114360
     tgtctttggc tttgataccc tttccatatg tgaggcatca ttcttgtcca tgacaactag    114420
     acccaattct ttagctctcg tgcgtaacat gttttcgtca accttaccaa tatctatttt    114480
     cttgttgtca gtctttaagc tattatactc tctttgatct atggcgatta agccatgaac    114540
     tggtgccttt ttgacaattt ctagacgtgt tatctttggt attggtttgc ttgcctgtct    114600
     ttccttcgat aacaatgctt tgtatgactt tagagaaagg actatcaaac ttctcttgga    114660
     ggcttctttc ttcaggtcat catcagagag ctttgcagga tcttcaaggt ctttcaattg    114720
     ctcttgtgtc agcagggata aaccaagtgt tgaagctatt ttttgtagtt ctttttctgt    114780
     tggttttgtt ggttttgatg gcttcctaac agacttcaac tcctttaact gctttttgtt    114840
     aatcagttcg tattctgtct ccttcagtaa ctcctgcacg gtattaatat caagtttatt    114900
     aggtatagtt ttgctctgtg ctttatgatt gtcttgtgta atttttgaga ggtctagtga    114960
     tgagtggttt tcatgagtat tagttaaagt ggagtttgtg gcagtgctct ctgaagtcaa    115020
     atctggtata tcagataatg gtgatgcact ttttctcata ggagacaaga tataaccgag    115080
     ttctttggct ttatttgtaa gttcctctaa agtcaatgaa gaagtatttg aagtcaagaa    115140
     tggtgattta ttttgagtaa ggttctccga tttttctcct gtactactac tactactatc    115200
     ttcagcggat tcctccttct caacaaagtt tagtcttgta ccactagaat tgcttcttag    115260
     atcaggtgtt ctctttatca aatccatatc cattttagtt gctagacttt gtaattcttc    115320
     ataagtcagt ttcacaggtg atgatctctg ttgaataaat ttggagtatg attctttgtc    115380
     aattacggtc atattcatct ctcttgcagc acgataaatt tcctctttct ttaatgcaga    115440
     gtccttttga ttcttgatca aattttcgta ttcatcagta ggtagtgtaa cgaaacccaa    115500
     tgcctgagca tgttctttga ttttacccgg ttgttgtttc tgttccttaa tgagttgttc    115560
     aaaatattgt ttgctggctt taactttgga agaaggagat gtattgtttc tttcttgaag    115620
     tttgatctga gcaatgaaat cattcaattc atcactggta aaaactttca gattgtagtt    115680
     atgagcatag gatttcaatt cttcttctgt tggattttca gccttttgct tgacactctc    115740
     ccatttctct tgacgaacaa taacatagtt catgctatgg atcttagatt gtaagaattc    115800
     gaatgaaggt gtttctgagt tattgacaag ttctctgtac cgagccaatt ccactatttc    115860
     ataaccaagt tcttttgcac tggctttcaa ataatccaaa tcaggttgcg aaagcattgc    115920
     ttgcattgtt tctgcttcat tctttgccat caaaaccata gactcctttc ttgccatgtt    115980
     tcttaagaaa tcaatggttg gattttctaa ttgtctcaat ttacattgat agtctgtttt    116040
     gtcaaccaaa gttttatttt gaagctcagc atgctcaatt agatagtctt ctgtagggtt    116100
     tcttagttta tctctcaaat catttagttc atctttgtcg attatttgtt tgttgatatt    116160
     atttgccttt gactctaaaa actctaagga tggattttca aaaatatcaa gtttatactg    116220
     gaactcttcc ttatctatta caattttcct gaatgcctta gctttttctt ccaaatatgc    116280
     taactcaggg ttatcaacgg ataataacaa attttgatat tcattattgt tgaccataat    116340
     cataccatta tcagctaatt tctcggataa ataatcatta gatgggttgt tatatctatc    116400
     cacactatgt tcatattctt cctttggaat tgccacataa ttgaacttct ccaatgacga    116460
     aactaggtaa tctaaagttg gatattcaat ctgtttttgt aaatcgttat attcatcatt    116520
     taataaaaca acagattgta atgagttagc gtactgtttg atctcatcac ctgtaggatt    116580
     agtagttttt ctaatcagct ctctaaattc aacaagatcc acaagctctt ttctttgtct    116640
     tctggccttt tctttcaagt aatccaatgg aggctttgcc atgtgctcgt ctagcttagt    116700
     tttctcctca gaggtcatta caatacaatc gatcttttca gctgtttcct ttagcatctc    116760
     gatagtaggt tgttctattt gtgtttgcat ttcttctaat ttcttagttt caatgatact    116820
     acaatcatgt aaagctgctt tttctctaac gaagcttaat ggtgtattct ttataagttc    116880
     ttcgtttcta gagttttcat tagaatcaat caacacaaca ttgtacttct gagccttttc    116940
     gatcaagtag tttatatctg gttcctcgaa ttttttctgt aattctttgt gttcttctaa    117000
     tgaatgaacc atgaaaccat gagatttcac acgttcaatc aattcatcaa tagatagtac    117060
     tggtgaggag gcacttttct ctaattcttc aaactcttct tttgaaactg cacgtagaga    117120
     gaatttttca catagtttca tggtatcatc caatgatcct ctttcaaata cgggtaaaga    117180
     tagtttattg taaatatctc tttcaaccat cacataccct tcactatcaa gacgttttct    117240
     tagatcttcc aatgacgaat tctctaacgt tgaatcgatc aattcgttat actcagataa    117300
     tggaactgct ttgaaaccaa aggaggcaat gttttcaatg gctgcatttt tgtcattgga    117360
     tttcattttc atatcttcgt attcattttt atcgataaca acatggttat atgcttcggc    117420
     tttttctctt aatatgccca ttgaaggatt ttctgaaatt tcttttagtg ttaaatactc    117480
     tgaatctggg attgccacat atcctacacc ggaggcgata gcagctaatt cttttgctgt    117540
     aggttcgtta gtctttctta atagatcatc gtattgttta gtctttagca tttcataccc    117600
     cttggcactt gctctagctg ataagaaatc gataggtggg tcttgagaaa tttgcatcaa    117660
     ttcttcgaat tcatcagaag agattaatct ttgatcgtaa tcctcggctt tctccgtgat    117720
     aaaatctaat gagggttgtt ccacagatct cttgagttgg tcataatccg atacagatac    117780
     aactttatag ccagcttcaa atgccttttg atttaagaat tccatgcttg gatgtttact    117840
     tgtattttca agatcttcga agacttcggc aggtattatt ttctgtttca tttgttctgc    117900
     tttagaggtt aagaactcta aagaggggtt ctccaagcat ctcatcatct cttcatattc    117960
     tgctgtagat attatctttt cattaaactt ctttgcagct tctttgataa aggatatatc    118020
     tgggttttca atcgattctc tcatatcatt taaggatttc ttgtcaatca atgtatgatt    118080
     cagatcattg gctctttctt ctaaaaattc ttttgtgggt gtgttataac tggattctag    118140
     catttcataa cgctcggttg gaatggcggt catattatta ttcctcgcga agatcttgat    118200
     taaatctaca gatgggttca gagccttttc ctttagattt tccagatcat tcttctcaat    118260
     gacattaaga cctatcttct cagcagtctc cgatagctga gctctgttgg ggttaaagat    118320
     tctattattc atctcgttgt atttatcttc tgttaaaata attcgactat tcaactgagc    118380
     aatccatttc atcaacttga tctgttgatc tttgttatca cttgatagcg agtccttaac    118440
     tctttcgata gtgatctctg gatttttgac ttgttctctt aaagtctcta attcttttct    118500
     agaaatgact tcaaaatctt cagaatcatt gattttgttt attatagatt ccaagggtaa    118560
     cgagttcagt ttgtaactct cggtgtcttg atcaatgggt atcaatttgc aattgtgact    118620
     ttgagccatt gtttccaatt tttcaattgg caaatcgtta ttgatctcag ttgccatggt    118680
     atctattgac ctagtatcaa agaaatcatc ttcaaggtca cttgtgtcct cttctaccaa    118740
     tttttgcttc ttcaagaatc tcagcaaccc atttttcaaa gttgacaaag aagtttctaa    118800
     agaattaact ttcgaactca attcatcgtt ttcatcgtta agatttgata atctttgtct    118860
     catggatttt gattcttggt caatatttgc gacgtgggaa cttagttgtg attgtaattt    118920
     ttggttttcc agtttcaata cttcggactc ggttcttatg gcatccagtt gttctcttgt    118980
     agttttgtaa ttctcgtcaa gatcgttctt ttcgtttctt atcaatcgaa gtgcgttgtt    119040
     gcaactgtcc aagttagcct ctaggtccca attgagatgt ttcaagtcgt ctagttcctg    119100
     ttgcaacttc tctgtgcctg tagtgtgttt ctgttggtct tctacgagat catggttctc    119160
     ttgtttcagc tgctcgatct tcttcttaaa cttctcgttc atcgcttgca accttctgca    119220
     ctccatgagc aagttctcgc tcaggtccat ggtgaagttg atatccttgg agttattggt    119280
     ggctctcatc atggactcgt aagagttcga ggccatgaac atcggcagct cgtccgtgtt    119340
     gtccttagtg gcgagcacat ccgtcactga ttctgatccc tccggcacgt ctttcatctg    119400
     ttctttcaac ttctccaacc catcttccag ttcatggtca gatgtatgag acatttgtta    119460
     atagagttta aaggttgtcc ttttgttatt cttccagtta aaaatatcaa aaaaaaaact    119520
     aagtaaaaag atacttaccc tcaaagaaaa aaataaagaa ctgtgctcac aaaccaatcc    119580
     tttatgttgt ttcaaacacc tgtactttga atgaactact tcttatagca ataacagcag    119640
     aaacgggtat taaaaaaatt agccgccgaa gataaagaga aagaaagagg acgagatctg    119700
     aggccgagaa gtgtgtggta tttatagtct gccagaaaag tgccgcccaa actgttgagg    119760
     aaggaagaat gagaaaaaaa aaaaaaagaa aactttgttg gttgtgtggt gttggagagg    119820
     aaagccctga cacaaaaaca aaaacaaagc aaaatcaaaa aaaaacaaaa agccgggtaa    119880
     cgtttagcga caattaaacg caaaactacg gagtacgtcc gcagagagag acaacggaaa    119940
     gccatttatc atattatttt tgatagcttt tgttccccta cccctacaat ccctctggac    120000
     aaccgggaaa gtttgttgtg tgtgctccac agagatctcg cggggaatgc ggaaaagtaa    120060
     catttgcatc agagaagagg cacagcctta ttcttcggcc tttgtctgtt agccaatgaa    120120
     agacaaaaaa aaatcgaagt acatggagat atatcgtgtg ctacgtgttg tttatatacc    120180
     tatgtacgtt tgtttacaat tggttatgta ttggtatacg atttgtttat ctaatttatc    120240
     agtggtgggc aacggctctc acgtatcacg atatgtagcg ataacgtata tattgtgatg    120300
     tacggatgtt ttgtaaaccc agcatttcta acctccctac accacactta atctcctctc    120360
     tctcagcacc gttttaccct ttttctcatc gcttgaggga gggcaagccg ttagttggtg    120420
     aaagagcgaa tcagaaggcg agaattggtg attacgcaga taatcccgca ccgagcaaag    120480
     gcagttaaga gagaaaggag gagagggact ccgagatcgc ggttcgctgt gcgtgaggac    120540
     ggggagcgac ggggagctac ggggagctac ggggagatac ggggggaggc cttttcggcc    120600
     tcccactcgc actaatccaa atcctgtgaa ggcgaattgt gtgtgggagg ggagatgggc    120660
     gttatatata agagcaaagc gcattgcaat cgtatttggt accgccttgg tggaaggaga    120720
     aaatagtagc accaaaaata cacgattaag aaaaggtgtg ctttattgta cttgggagag    120780
     gaaaactact acagaacgaa acaatgttgt cgaggtcggc tgtttgcgca aaaagataca    120840
     ttacaccacg ccatgtggct gcatggaaat tgccggtgca gaaggttgtt cctgcgtact    120900
     tgtcgcagta ccgttgggcg tctacgtctg ttaaggtgcc ctccatggca gagtccctga    120960
     ctgagggttc tttgaaggag ttcacaaaga aagtcggtga gtttgttgag caagatgagc    121020
     ttttggccac cattgagacc gataagattg atatcgaggt taactcgcca gtatctggta    121080
     cagtcaccaa gctaaatttc gaaccagagg acactgtcac tgttggtgac gagctggcac    121140
     agattgaaga aggtggtgca ccagctgatg gtggagccaa gcctgctgcc gaagaatcga    121200
     aacctgctga ggaatcgaaa ccagcagagc aagctaagcc agctgcacca gctgcggaga    121260
     aaaaatcagc tccagtgaag aagccagaat ctccaaagca agaggcatcc aacgctgcac    121320
     aacaagcccc atccactgca gccttctccc gtaatgagaa cagagtgaag atgaaccgta    121380
     tgagaatgag aattgctgaa agattaaagg aatctcaaaa caccgcagca tctctaacca    121440
     cattcaacga agtcgatatg tccgcattga tggaaatgag aaagctatat aaggatgaaa    121500
     tcatcaagaa gaccggtacc aagtttggct tcatgggtct attctctaag gcttgtacac    121560
     tggctgccaa ggatattcca gctgttaacg gtgccattga aggtgaccaa attgtatacc    121620
     gtgactacac agatatctcg attgctgttg ccactcctaa gggtttggtt accccagttg    121680
     tccgtaatgc agagtctcta tccgtgatag agattgaaca agagatcgtc agattgggtc    121740
     aaaaggccag agatggtaag ttgactttag aagatatggc tggtggtact tttaccatat    121800
     ccaacggtgg tgttttcggt tctttgtacg gtacaccaat tatcaacatg ccacaaaccg    121860
     ctgtgttggg tctgcatggt gtgaaggaga gaccagttac tgttaacggc caaattgtct    121920
     ctagaccaat gatgtatcta gctctaactt acgaccacag attgctagat ggtagagaag    121980
     cagtcacatt cttgaagaca gtcaaggaat tgattgagga tccaaagaag atgttattat    122040
     ggtaatttaa ttcatcattt ttgaagggga ctttacaaga caaggagtaa aaaacaaaca    122100
     aaccaaaaaa aagcacgctg aaacagagaa caattacaaa tattcatcaa tttttctgca    122160
     actcggtatt caaagtcgat aagacactat ttataattta aatattcttt cccagatgaa    122220
     ttcgtcattc tatttcaagt aaataataaa tatatattgt gatctagatc acgttattgc    122280
     tatgcttttt gtatttgcta aaaaatataa gtgattttta gctcgtataa tggactaggt    122340
     aactaagata gtaatgccaa aaaagttgta taaaatgcga ttatgtatat taaagcggta    122400
     gataattaac agactctgcg attaagcggt tatcgttctt gtcgaccaag ttaaattgta    122460
     tcagatcacc ccagaaacag gataattttt ctttgcaaaa gaggaggtat tgaaattctg    122520
     gttcgtcatt aaatttcccg ttaacttccg gagtggcgtc tcgagaattg acagtagtgg    122580
     tattaattgt gccactctgc aggatggccc acacagacca aaatagttga gcgcagggtc    122640
     tccaaagctc tatatcatgt tttagtttct gcttgtcgag catggttcta ggtgtgtgtg    122700
     agtggtgtag gtagcaatct atgaattcgt cgattttgtc ctttgaaggg tacctgtcgt    122760
     aatctgactt gtaagagtcc aatctgtcgt agtcgtgcat ccattcactc atgtggttag    122820
     atatatcgaa ggctactggg tttggtccgg catactcaaa gtctataagc attaggtttt    122880
     tgttcttttc gttatccttg tctatcaaaa gcacgtttcc gtgttgtaaa tcgttgtggc    122940
     agaagacgaa gttgtcttgt gaactgtaat gagtgtttgc aaaacaccag tctctataag    123000
     ttgcgacaga atctttgaaa aactgccaat cgttaacatg caagtacttc tccagatttt    123060
     tcttatcaga gatccattgt tcgccgacgg tctctaatat ggagaaccag tcggataatt    123120
     tttggaagca agaaccgtac aggtattgct catcactggt gagttctacc tctgtgtgta    123180
     acttgttcat gcgcatggca atattttgca tgacccaagg gtcagcgagg tcatttcgag    123240
     ccactgaggc tgatcccctt acgtatgctt cgaatctgcc attggcgaag caacccaata    123300
     tcactgggcc ccttagttgt gattcccgga gtctttgtag gactttaatc tcgtaagacc    123360
     ttgcgacaat ggcttctagt tttgcaccga acactcttag aagcaaagat gacgagtcat    123420
     cgtatatggc ctcgtagatg atattggtaa gtgcgccttt gatctttctt agtttgaact    123480
     tgttaatatc tgagcattcg tggtcccata gcttcaactc tctaattact tcgaaaacct    123540
     gttgtttgaa ctggttttcc tcggtcaatg ggttgagtaa cttctcggtg aaggggattg    123600
     agtccagcga tatgaggtct ttatccttcc ctgacccata aactttcctc ttcaggtaag    123660
     acatgcttaa tcttttctgg tgccagtttt caaaaagtat gttagcatct gatgattact    123720
     caaaatttaa atttatggca gttggttgaa atgcacactg cagattatac gttgagcaag    123780
     agaaagccaa gaaagacata catagagaca aagagagtca ctgttcaaat cgctggcaac    123840
     gtgtaaatca gatgatcgcc aatttctgtt gtataactgt aataagatac agtaaggtga    123900
     tgtgggtgat ccttgtagtg gggatgtgat catgaaattt ttgcaactgc ttttcttgat    123960
     gcaggtgaag gggggtagag aaaaaaaaaa aggctcaata atgaaatgaa ataggtgagg    124020
     gagattcagt gaaaggccag atgtccggat ccgttacatt gtgcttgcag aatcaagcag    124080
     ctatttagca aatagaacac ttgctctgat aaggtaaaag gtcccccccc ccatacagat    124140
     agatcctcct tgcagctctc actttgttgt tttgtattgg ccggtatgga gcagaaaaaa    124200
     attgatgatt taactcaatt aggaaagacg taaacacgcg agccgagaaa aagcactgaa    124260
     aaaaaaaaat ggatgttgat actggaacaa gtcgatagga ctagtggtga gcagtgcttt    124320
     gttttccata taggcttgat tgcagggggg agagggagag ggcgaaggag aaggagaagg    124380
     agaaggaggc ataggacgat cttgagaaat tgtttatata tatttgaatt gcaatgagag    124440
     cgttagttcc caggcgatgt acataggctc tttaaccaca ccagacgccc aagagacggt    124500
     ataactaagg aagctggtat ttctttcact tacagactag agaagttgtt gatttttttt    124560
     ttgtctattg ggtttcgagt ttcagtaata catatacaat ggacggcgac tggggcacga    124620
     aggttgacag ccaggaggat tttttgaaag agggcaggag tttcaatata tttggaggcg    124680
     acgatattgg gctcaatttt gatctgggcg attttgaaag tggtgagccc gatctcggtg    124740
     tgatgagcaa tgattttgat acttatattc tggataattt tttgaacgat ggaggagatg    124800
     ctgggcatgt aggtaaggtg gcagaagtag aggatctaga gatagcagat atttgtggaa    124860
     ccaataacga taagggagca catatacagc cacaatcgca gtcgcactcg caaacgttat    124920
     cgcactcgca atcacagcaa caagcacaaa tacagccgca gccgcaactg tttaatgata    124980
     gggcgtcgct tgatctgtta tcgtctccgc tgggcgaggc tctgtggaag cagcaggagg    125040
     agctgcggga ggcgctacgt atacagcagg agctcaatgc ccaggtagtt cagaagcttg    125100
     ataaaactgt tgagcagcag gagcaactgc agcgcgtgct gcagcagcaa aaacagcgcg    125160
     catcgagggc ggactactcc ttatcgcctg cgctgagcga tgctggagcg gataaaggca    125220
     actacatgga ttacctaatg gccgatggtg ttgatcgtgc tgatcgtgct gatagtggtg    125280
     atagtggtga aaatgctggt ggatctggat ctggatctag tagccattgt cgggacaaca    125340
     agcacaatgg ctcgccagtg aagcgtggga agtacgggac gaacgggaag tacgggacga    125400
     acgtacgagt gaagctagat ttcgaggatg tagttagtaa tggtgctgtg aacggcggcc    125460
     agcacttatc ggtgctgtcc ccacagagca gcaacaagct gaatattaag aaggctgcgc    125520
     accgggcagt tccgtacacg cccaagtctc gagtgagctc gatgacgtat acgccgtcga    125580
     cgttattgac acctcagccg aacaatggcg cggggaagtt tgacaatgtg acgatctcgc    125640
     ctgagtctgt gacaatgtct ccagtgatag ggcttgggat acacagtggt gccgatgcgg    125700
     gattttcgtt gaagccaccg ccaatggata tactgcccac gattcccggg tccacgagtg    125760
     ctacgcctgc gaagcaaggc aatgggcaag cccgagggta ctctgggcct tctgtcggac    125820
     tatcagcggg gccaacccgt gccaacgatg ggtttgataa gctgggatcg gcggaggatc    125880
     ttctgttgga atacccggta aatccctcgc tgtccccgga agagctggcg cctgaagtag    125940
     gcggagcggg agacgagtac tcgcagggcc agtttcagct ggagcgcact gagaccacgc    126000
     tgttaccgcc ggagatgtcc agtcccgttc ggtacagcgg tgcgagttcg ttgaatgtct    126060
     cacctgtgct gaagagccgg catgtgaaga tgtcgcagcc ggggtcgcca gtccggctga    126120
     cattgggccg cagctacctt gacactgacg aggcgagcga cgaagacgag attctcagca    126180
     gtcctacgaa gattacgagg aagctgacga cgcttccgcg cgggagcatt gatgtctatg    126240
     tcaaggagct tcccgaccgg atgtacgagt gtttgtatcc gcagtgtggg aagacgttca    126300
     agcgtcggta caacatccgg tcgcatattc agacgcacct ggaggacagg ccctacaggt    126360
     gcgactatga tggctgcgac aaggcctttg ttcggaacca cgatctggta cggcacaaga    126420
     agacgcacca ggagaagagc tacgcgtgcc cctgtggcaa gatgttcaac cgtgaggatg    126480
     cgctggcggt acaccggagt cggatgatct gcatcggagg caagaagtac gcgaacgttg    126540
     tgatcaagcg ctcgcccaga aagcgcggca ggcccagaaa ggaagaaggc agccctgtca    126600
     aggagagcat acgccgagac agtcagggcc agctcatcac ccgcatggag aggcaattgg    126660
     cccaatagac agttgagcag agacaagttg aacagacaat tgatcctcgg agaaacgggg    126720
     gggcatagaa gaaggggcgg agcatgattt acatatttct gaaaatagcc aagatacatt    126780
     attcctgtat acgactatgt actaaatttt gtttaaatct tcgagaattg tttctgaggg    126840
     aaaatgtttc tccgagaaag aagagaaaga agcgaacaga aatatgtttc tcaccgagaa    126900
     agaagaaaaa gaaggatgtt tctcaccgag aaagaagaaa aaaaagaatg cttctcagaa    126960
     agaagcgaac agaaagatct caggagagtt cgatgacaag gacacgtcag attctgagtg    127020
     taaagcccgc atgactcaga ttacatcttc catttttaat tttcaatttg ccatttttcc    127080
     tcggtgtcgg tgagaacatc cagcacagaa ggaacacaag aaaaagaaac gcaaccgtct    127140
     tgcacgtttg tctgagtaga gaatatcgaa aacatttccc ctttcgggta agacaggaaa    127200
     gaagcgaagc gaagagggtg acaggcacag ctatcttcct tttaatgcta agatacggac    127260
     gcaggggtga agggaataac cttcaaggtg tcaaattgat aagcagcagc tttattgtta    127320
     gaatatcccg cagaatgcaa tctcatatgt gggggggaaa cattcaaaaa cggaaaaact    127380
     gaaaaaactg aggagttgaa agcaagctga aagcaagtcg aaagcaagtt gaagggaaac    127440
     tgaaaaaatt tgtttggaat gtacccggag ggttattttt tggaacctga atggataagg    127500
     aaagtgctgc cctaggggag tttctgtgtg gtgggggtag tgggaaagcc atttggcaat    127560
     ttgacaatgg atttgctaca acccggaagg ttatctgtcc atgataagag tatttctgat    127620
     aaggactgtg ggagtgcagg ccaaagggta ctgtaacggt tactttgtga tggacacgat    127680
     aacggaattt taaaaacatt agtatataaa ggtggtatgt tattagcttg gctggggatt    127740
     tggaccactc aagcaccact gagcacacag aacaggcgcg acaacgcata agctacaatt    127800
     aaaagcaata taaaataaaa aacagacgct acaaaattat aatcatggat attgtgcagc    127860
     tattgttcaa gagagacgat gacgatggtc caccaccggc ctgtgctgtt gacaacgact    127920
     tcaacggtca cacgaacctg agaattcttt cggtgttcat ggtcctgatc tcctctgcca    127980
     tcggtgtgta cttcccgctg ctggcctccc gctactcctt tatcaacttg ccctcgtggg    128040
     tgttctttat cgccaagttc ttcggttctg gtgttatcgt cgctactgct ttcatccact    128100
     tgttggagcc tgcctcggac agcttgggta acccatgtct gggcggcact tttgctaact    128160
     acccatgggc cttcggtatc tgtctgatgg cactgttcgc tttgttcctg atcgagattg    128220
     tctcccacca ctacgtcggc aagaccatgg gcggcggcca caaccactcc cacaatatgc    128280
     caaccacttt tggacaaact cacatgcacg gcgttgagga cgatatggtt gacgaggacg    128340
     gtagctcctc cactcactcc cacagccacg tcgccatgga tgacaagtac ggtgatgttg    128400
     tcaagaacaa caactacaac tacgacgacg gctctgacga cattgagtct cagaaacgtc    128460
     ctgctttcaa cgtggcccaa cagaaggtcc gcaacgacag caatgagaat gactctctgg    128520
     tgggtcatgt tcacaacact accgttgacc cattggagca catgccaggt cacaaccact    128580
     tctctcacga tgaagtccac caggacatca ctcaaattgg atctaaggct aacgaccagc    128640
     aaaaggagca atacttgaac cagttgacct ctttgttcat cttggaattc ggtatcttgt    128700
     tccactctgt cttcgttggt ctatcccttt ctgtctccgg tgatgaattc aagactcttt    128760
     tcgttgtcat tgtcttccac caaatgtttg aaggtatggg tctgggtgcc agaatcactg    128820
     agtgttactg gccacatagt aagagatggt tgccatactt gctaggtttt ggttacacta    128880
     tcaccactcc aatcgctatc gctatcggta tcggtgtcag acacagtttt gttcctggtt    128940
     ctagaagatc tttgatcgtt aacggtgtct ttgatgctat ctctgctggt attttggtct    129000
     acgctggtct agttgagctg atggctcatg aattcttgtt cactaaccaa ttcaagggtg    129060
     aacacggttt gaggaatatg ttggctgctt atttcgttat ggctctgggt gccggtctta    129120
     tggcactttt gggtagatgg gcttaatgcg agcgctaaat tttaaacttg ctttcgtttt    129180
     tttgtcttta tacccaactt accgcagttc cttcgtctta attattcgtt ttaattttcc    129240
     ttattcctag tttttgagtt caataatgat gttttcgaac ctttcccgtt aaccaagaaa    129300
     ccctctaatc taaagccaat gattaaggtt cgtttctatt tgctgtttgc taacaccacc    129360
     ttcatgtttc aatgtattcg tattctaggt ttcttaaaca tcatcatcac taatgttaaa    129420
     tgtccagaaa gatcaaaaat acacaaaaat accgagactt tttttagact tcacgttgat    129480
     cattcaacaa ggaatttctt tctgagacag aagatcttgc ttgttaattc ttttacagtt    129540
     tcaaatattt tttgtttgca tctcaaattt ttccaaataa ttatttggaa tttcattaga    129600
     ccgcatctca tatcctgacg ttgttttgtt ttttcctctt tctatttatt ttccagtacc    129660
     acataccttt aatacgcaca ttacatttaa ttccctttta tagagtttca ttgacgcagt    129720
     aaatagtaat attgaatttt gttttcttcc tgttctaatt tacaaatttt tgaataccgt    129780
     tacttgaata tctcttgaac taaacttgat tgagtaagag ctctattgca cctccatgga    129840
     tccttcgctg ggggatttga ctcgccactg ctttagctat acagtacttt gcaaaatatt    129900
     tattatagta aacgttatga tggatttcag tgtttaatga tatttataat gtatattaat    129960
     ttcatttttg aaagtttgcc ggcttcttct tgttggatac agcgtttgca gatgctgtgg    130020
     agattgcctg cttgtcagca tttatgctgg tcagtttttg agcatatgcc ggtgaagcat    130080
     tccacttatg tacacttctg atctcatctg cagagtatcc cggaattcta atgttccagt    130140
     ttctttctaa gtgaagttgt atatctgttg gctccaggtt atctgacttt ctgtgcttgg    130200
     ctaatctgca tgcgaatcca gtcacattgg taacaaagtc atcagcgagg tcaagtaata    130260
     gctcttcaac gtcaccatct atcactgtct caccatcacc ttcgtcaatg ccgatagact    130320
     tcaccaattc ccgtagctta cgcttcgaca tcactctgtc cgtatcaatc tcatatggcg    130380
     gtagggttgt cataacagga gtattaagag cagcagcatt catggccgaa ccatctgata    130440
     tcgttggtct gtttgatctg aatgctatag gctcaggtgg tttgactgac acagtatcag    130500
     caatgggtac tgtagggtct gaaggcttga aaattgatga ttttgtcact gtgctagagc    130560
     ctgctgatga agctgcagca ttgacacctg tgacaggtga ttgttgactt gctgtttggc    130620
     ctctgccaga tggcgtttgt tgtggttgtg caggtcttcc acccttttga gacccaggcg    130680
     ctggtgtgcc aacttcagtt tttatctgtg tttttggatc ttgtgtgtta ccttgcacag    130740
     gttgttgacc tgaaggagtg cttatattcg caccagttgc agttgtaggc atctgctgct    130800
     gtcccatatt agtaggtggt gcttcaccaa cactttgggg tatggctgct tgtccgttag    130860
     cattggcttg tgattgtgct cctggcatag cttgtgactg aacttgaggc tgagctggtt    130920
     gtggttgttt cttctgttgc atcattctct gttgttgggt gcttctctgt aataaacgtt    130980
     gtaaagccgg attttgtctt gcgcattcta gataaaaatt ctttttacca ttttgtaatt    131040
     cttgttgtag agcttggtgt tccaatctga ttgccttaat atttctcagc agttcagttt    131100
     tcttttcgtt taattgtttt ttggcttcct catccgtttg tttgttaatt tcaactacca    131160
     gccggtcaat gttttgctta atgaaagtgt gtttgtcctt tattgcgctt gctctgactt    131220
     ggaaattttg cagtagttgt tcgtattgct ggttttgttc tggtgtaagt acttgtttaa    131280
     tgatattagc caattgtgcg ctgctgttac tactattatt acccgatgta gaggcgctac    131340
     cacttgagtt cgcagttcca gtggtacctg ttgtgctaga accagaagat gcggcggcat    131400
     tggtattgga accttgttgt tgcagttgtt gcgctctggc taacgcttgt tgtctccttg    131460
     tgtagttttc atatacagcc ttcaatttag cagcttggag taaaagttct ttacctcttg    131520
     gagtggtttc accaactttc ttggcctctg tcaccagttg cttgaaccgg gctgttagct    131580
     cctgtatctg tttctgttga atagcactct tgctaggtgg gccaccagaa ccgcttggtg    131640
     cagaggtgtt gtcgttcttt gagtcctgag cactgttctg actagacatc ctgtttcccg    131700
     taagacctct ttctttctaa taaaaaataa gtatgtgctt tccagtatga atgtttcact    131760
     aataaggttg ttacagtgga cccaaaactg tgttgtgaga ttgcgtaata gttactaaat    131820
     taacaaattt tatctggaaa aagcacaaag agcgggctca aaaaggtaac aattatttaa    131880
     ttgtttatcc tgacgggttc tgatctttag cactacagta acaactccga aaatgaccga    131940
     aatgagtcca attttgagtg ctcattaggc cttatactac ttgtttagat aaactccctc    132000
     agaattttga aaaaattatg ggaaaatgta tacgtttata gtgatttgat acccgacgcg    132060
     tataatggct catctcatcg cgatggatat caaaatagag aaagtatagt agtttagcaa    132120
     cgaagagtga gctggtagct atcaatacag tgaataagtg atattagcca gttgtaatcg    132180
     ttaagtgcca cttgttcttg gctagtctta tctccctccc ctttttactt gcagaaagca    132240
     agatttgata gatattgatc actaaaattg gagttgaagg ggggtttgta agagtgggtt    132300
     ctatagctac tgcctcgctt atgttttctt taggtttaga ttgatgaggg gttctaaaat    132360
     cgtaactgtt gtgcatccct cttctcccct tcattgtgat aaggatattc acatatcagg    132420
     ataagaagcc gacactccat ggttgagaaa ttagaaacga gagttaagca aaagttgtgg    132480
     gctttgacta cgttgcaagt ggctggtgta gttacacgca tacgtgaccg cttggtgatt    132540
     tgattacttt ttttttatct gatctacgtg atctttggct ggtgagtgca gtgataatca    132600
     ttgcttggtg atccatgatt ctgacgaaat tgaaaagtac aaactgcaac tgtgcaggtc    132660
     actcttggtg tggacattgg gtaaatcccc ctttatgatt gcttttttct gcaaaatacc    132720
     atggtgatat aatcaatgat ttcctcacaa gtgccgtttc tcaattaaaa cacccagaac    132780
     ccttacgcgt atatataaaa aggcaattct ccaaccatca gtaaagaagt ttgctcttgc    132840
     agcgaaccca ggaagtttat tcaagcccca taccagaaat ataaaactgt gagctgtgat    132900
     aagatgaaat tgaaaaacgt tgctctggtg gcaggttgtg ttaatgcagt tgctgctgaa    132960
     aagtatttga agttagactt tgaaaagcat agagccgata tagatgaaga acttccattg    133020
     acacactctg ctgctagaca gctaagaaaa agagctagtg atgattccgt agcattccca    133080
     cttgttgctc aagaaaacta ctactctatt aacttagagg ttggtacacc accacaaaat    133140
     gtgtctttgc tattagatac tggttcttca gatatgtggg tgattggctc taataacggt    133200
     tactgtaaga actctgacaa taagtccagg aatctagacg cgctaggaag caacaggttt    133260
     gccaagcgtg caagttccgt tgcatcggct tccccttcct cagccactga ctctgatggt    133320
     ggagatgatg gagacgatag tggagatgcg gaacaatttt acccaacagc tgcctccgaa    133380
     attccggctg ctgctaaaac acttgattgt caatcactgt cattatttga tctcgagaaa    133440
     tcttcttcct tcaaatccaa ctccactcct ttcttcacaa gttatggtga caacagttat    133500
     gcatctggtt tgtggggtac tgatgacgtt cgtctaggta acttgagcat agcagatgta    133560
     ttctttgcgg tagcaaactt ttctaatagt agcacaggtg tgttaggtgt aggtttacct    133620
     gcactggagt cctacaatcc tgcattgagt gacaacttca atgtcagtga ttacctacca    133680
     gttaatgcta gtgatgctga tatcgacaat attagcaaac caacatatgc aaatttccca    133740
     caaatactga aacaaaaaaa tgtcattgag aaagttgcgt attctctgtt cttgaatgac    133800
     accaatgcta ctaatggtca aattttattt ggtgccgttg atcacagtaa atacacgggt    133860
     tcattgagta cgctaccttt agtcaactct ctatatgttg aaggtatcaa tgacacaact    133920
     cagctagaga taactttgga tggtatgggt ttgaagaact cgcagggaca atttacaatt    133980
     tataaccaaa agatgccagc tttgttagat tctggtacca cagtgtccta ccttccaatt    134040
     gatcttcata gtctagttgc aaagcaacta aagggtattg ttgatccaca gaccggattc    134100
     atcgagctga agaactgtcc agctaagaac gacaatactc aacttgtttt taacttcggt    134160
     ggtgctttta tctccatcaa gtatactgaa tttatcgaaa aaagtgacga tgataattgt    134220
     tatgttacat ttatgccaca aggtgagcca ggaatcctac tgggtgacaa ctttctaaga    134280
     aatgcataca tcgtttatga tcttgaagac atggagatat ctatcgcaca ggcaaacttc    134340
     aacggcggag cagaaaatat tgaagccatt gttaagaatg ttccaagtgc tgtaaaggca    134400
     cctggttact ctgcaagttt cactgagttc ccatcttctt atgccactac aggcaatata    134460
     ttctctgggt acaactctac aaacagcact ggatcggcgg gttccaaaac cacaatgact    134520
     tcttctagga caagcagaaa cacaaacacg gcatctgcag caggcaattc ttcgtcatca    134580
     actagagcca agaagaatgc cggttttgct cacgaagtac ccgtgtccgc catctctgtc    134640
     atcatggtgt ttaacatcct actctccatg ctattataag atgttagttt ggcctacaag    134700
     gagtgaatgc ggcacaaact atactgtact attaacttgg tatgctggta tgtaggaagg    134760
     ctcaaatcat attcatctgt tgttttatat ataatctaca aatctataca tatgttatat    134820
     ttaggttaca actaataagt tctggtttca cgtgacatag ctattactct cgtaatatca    134880
     aatttacgta atttgtacgt attttatgat tttgaatttc aaatcagctt gggctgtgca    134940
     aatgcagctt catttgcaac ttgaaggtag tagtttttat cttgatcctg ttgtatttag    135000
     cggttatttc tgctttccag agcgttgaat agttagtagt tgagtccagg tcaggcccta    135060
     acgtacaaat tcctggtatt ttaaaaaagg tgccgaggtc tcgaagttga caactgcaaa    135120
     agcattttcg gagtccagaa aggatttttt agtgtttatg ataagattgc attactgctt    135180
     gctcaaaaag aattattaga tagtcaagag catatacctg tgcttatgcg taagcgatat    135240
     tgtgtaagaa taagtgtggc agatctgtta aacattaaaa aaaaataata gaaactttgt    135300
     gatattgaaa aatggagaac caacagcagc aagataatag cccgcctaat gacggtagtc    135360
     ggtccaataa cgacgatggt agaaatgcta ctgctggcaa cactgaaaat agtgacaata    135420
     atgttccaag aagtaatgta acggttcgta ttcagtacca atacttcaca ccacagggtc    135480
     ttgcagacgc cagtaatggt actgtcgacc ctgcggctac tcaagatggt ggtaatggta    135540
     gtcaggctca tgttcaaggg agtaatacac ttcctttacc agcaggtgtt aatggcctac    135600
     cggctgccat gccgtttggt aatgccgtag atagtcctga tctaatatta tcatttcaag    135660
     atgtgccttt gacatctccc gatagactaa attcatttat cacaattgct gcagagcttg    135720
     ctatgcggag atttcagaat atgttgaata gaccgaaagg cattactaat gaggcattca    135780
     aagaactacc ggtgataaag attgaagagt tgccagacaa gactgagaca acttgtagta    135840
     tatgctatga taaatttgtg gatgaaccgg aagatacagc agaaaactct aagaaaagaa    135900
     aacacgaatc gaatagtaat gaggatagta tggatgatat tacaggggaa ggcaaattac    135960
     cgagaactgg ctctaataca ccctcttcat tgatggctgc gacaggaata agtgacaata    136020
     ataatgaacg tacaactata tcttcaatat tgaatcccca gtcggaatca gatagttctc    136080
     aaagccatga aagtacccat aatgccttta ttgagaatac tgaaggacaa gatcaagcgc    136140
     aagccactca agaacaaaac ccggagtact tacattcacc agtaaaaata ccttgtggac    136200
     atatttttgg cagaagctgt ctttatgaat ggactaggtt agaaaactca tgtccacttt    136260
     gtagaaaaaa aattgccgag cagactgaag aagaagagca aagggaaaat aacgaaaata    136320
     caagtaatat ggaagcattt gaagctatcc gtcgtatgct atataataca acaggtcaag    136380
     gcaatgccac agaaggtcag aataataata acccaaacga ggcaaatgga caggtgggtg    136440
     tcaatagtga tgctacttcg gatggagctg ctaatcagaa taatatttca caagctacgg    136500
     aaaactcaac gcaaggtggt gttaatttac aaacgggtga acttaatgac gccaattcca    136560
     caaactccac cacaaactcc ccaaacaata ataatgtaac tgtttctaga acaagcataa    136620
     tttttttgag gccaatgaat ccaggtgaag caccccaagg aagtcaaaat gtgaacactc    136680
     aagcgttagg aaatagcatt ccatttcctc catcgccagg gctgggtaca actgatccag    136740
     cccaaaacgc aaatggtgca caaccaccac gtccactcac atttagaaca ccgatgcaaa    136800
     tacaatggtt acctatcaca ttcataaacc cgggcttagc taatggtgag caaggtccac    136860
     cagagcaaaa cagcagactt agatcactgt ttgatcaaat tttcagcaca tccggcagtg    136920
     caggtacagt tgatgatgct ccaaatagta gaagcaattc tagttccgaa aataatgatg    136980
     cctctggctc tagtacggcg gggtctaacg aggtcgatca atccacagct aacccagacc    137040
     gtgtcacctc tcctagacgt tcctttttca atgctatgag caggtttgca gatcgtttga    137100
     gaccttcagg gagatccaat gccaatcaag cttttacagg ttcatccaat gcagagcatg    137160
     ctaacgataa ccagtctggt aatggtacgt ctggctcaag attaagggat accatagctc    137220
     gtgcattgaa ggaaagaaga caaagacaag agacagagag acagcaagct ggtgaactgt    137280
     ttgctagtgg tgtgggtagt tatagaaacc caactggtaa tgttgtcact ttccctataa    137340
     attcagaagc aagtttcaac cagggcgctt caacttcaaa tgaaccgatt gaaggttcca    137400
     caaaccaaac agaaaatgat caagatagta atggcaacaa tgacagagac gatcaagcaa    137460
     attgaataga actatttggc cagagacgaa tttgatgttc gcttttcatc gtccccccaa    137520
     ccacaacttt tctattaaac acacttgatt ttaattcttt gagcatattg ggttaatgag    137580
     attatcattt tacctgcctt cacgtttagt ctaatggttc agctcttttt cattaaaagt    137640
     tacaccaata tgattaattt gttacgatta attgatagat ttaattgtag tacgttcata    137700
     tgattttttt ttagttccat cattgcatat ctatagacaa taaaatacat ataccatgaa    137760
     gataagaaat aggcttctcg tgaatgttag tatgatattt cttaagttta ttgtttctcg    137820
     ttgttttact tcgttataat gtttgattgt ttaatcattt tgtattgttt tattttgaat    137880
     gtcatgtttt tttatgtttt tttataagat taaacgcaaa tagtacttat gggagcaaaa    137940
     tattatacta cgtttctaaa aaaaactata atattactta ataaaaattt cttaatatac    138000
     ttgtgtgtca aatgcgtgag cacactgtgc atgttaaaat ggtaattaac tgatgcagcg    138060
     gttgatgtga ggttgtaaag cagagaggta tttttgggtt gagctatctt acaaagtgat    138120
     ggttggttgg gagtgtctat cgttggcggt ggagtgtggg aagaactcta gagtgtcctc    138180
     gtcggcgagc ttcaagactt gcttgaatct ggcaccgatg ttggatagag gttccttgtc    138240
     gcaggacttg gtccacaatg caaatctgtt accacctttt ctaacgttta ggacaacacc    138300
     gttaatctgg gagtcttctt catcgatggt ctcaccgatg accgctagca atgttctcaa    138360
     ccacaactcg tcgatctctg cacctctgcc tctgacttgg aaggaccact taccaccttt    138420
     agcgttagca gagtcttccc actctggtct gatatcgtta cggaacacat ggtagtctga    138480
     ttttagtggg agctcgtgtg gctctggaat attctgaaca atcgcccaga actcctccac    138540
     cgattggaaa gatgtaaccg gacgcagcaa gtcggaccag gactcagatt tatcaacagc    138600
     tggctttgtg taccacaacg tccacttggt gttcaatggg tgcttcacct caaaatcctt    138660
     ggcatccgaa agcacagtct ttggtccatc aacagaaaca gtctcttcaa acttcttggt    138720
     aacttcatcc acagacatta tggcttcact cggtcgttta ttcttttttt cgttgggata    138780
     tccttggagc actccttgcc gcagctaaac tgttacccac cagcccgcca ccaaccaata    138840
     tataccaaca cgcccagccc gacagtacag ctcatcgact tgcaattgcc cattcgtagc    138900
     tttcctgcca aaatcgcaac ttcccagttg ttccaccaaa tttttcactt ttggctgcga    138960
     aaaaatttgc aatcatataa tacgttcacg tgatgaggat gggttttacc tatataagcc    139020
     cagcggtatg ctaggatggg tatacgttgg tgtatatatc gtgtggctat aggagtgctg    139080
     cggtgcagcc tgctgggcat tctgacatgc cttctgtgat gaaccactgg gtgaagcact    139140
     cgaagtggcc ctcgtggccg cacttgagtg cggccatagt gagtttgcgc agtggggtgt    139200
     tgcacaccac gcacaaggtg ttcgttctgc tgcaggcctg gcagtaccag tatccgtgtg    139260
     ggaggtcttt gccctgttcg ttggtgatca gctcgccgca gcgctcgcag aatatctcca    139320
     cggtggactg gtcgccctcg ggacccagga ggtcgtccca gggacagtac ttgagtatcg    139380
     cggcggcgat ctcgaacagt tcgtactggt gcagtaggcg cacgaaatgc acaacactct    139440
     ccttcacgat gcttatcggg gcgatgttgt agacgtcttg gaacaagatc agtacgttga    139500
     ccgcgagtat cacgttgccc atctctaagg cgttcgcatg aatttggcgc aagagcttag    139560
     tcgtgttcca gggcggtaag ttgtctgggg cacctttctt ctcaggtggc gggacctgta    139620
     acgtaggatc gtgctccaca tgccagtccg atgatggagc acgcgtaacc gaatgcgagg    139680
     acatggtccg tggcgataat ttcttcaaga acgctagctt tgagggtgtg ttggcaaaac    139740
     tgtgtgacgg accattctta ttcttaggac tagagtaacc ataccctggt gattgatttt    139800
     tatttaggta tggaacatta tggaacgcat ctggtgagtt ttcattagtc ataaaagtgt    139860
     caataaatga agtcctggct tctctcttat tgaggatcgg tatgctgtgg atagtattgt    139920
     ccttggtcgt agcagggcct ttgaaatcct catcgtcatt aaacttgtca tcatcttcct    139980
     cctcatcttc ctcctcttcc tcaattgcgc tggactcaat ctcgctttct cggttattct    140040
     cattgcgttg cctatgaatc tttaatgcag cagctaactt tggtatatca ggtgatcttt    140100
     taggactcat gcttgaaagc ctacgtccta atacaaactt gttagattct tcacctttga    140160
     gttgttcacc tagcttcgag acaggcgatt ttataccttc agaagcgtca ctagagtagt    140220
     ctgattttcc atgataagca tgtggatgct cggcataatc agaacttagt tcactagtgc    140280
     cgagtctgct gaggtcagat accaatgatt gctttctggt attagttagt gggtattcta    140340
     attgccctcc agttaactct tccggtgttt cattttcact aaaagaagaa tacattttta    140400
     tatcccatag aagagaatca cggataagca tccatatctt gaagttcggt aagtcatcta    140460
     tgatggagta cactgaggca ttgtggttac tggattcgac gagttctaaa agtagattga    140520
     ttcggtattc tggattaaaa ttcttggttt tctcctgttg gatttccttt gtaatattcg    140580
     attcatattt aacattatta tcaccggatt ccagtttttg aattgttggt gattttattt    140640
     cgctttcatc agatagaaca attggtgatt gtttaataga aattgagtta gctctttctc    140700
     tggtcttgtt cgatttatcc tttactatat ttgcccatgt cgcattttct gagatatcaa    140760
     atcttttcat gagatctgac cttatattct cttcattaac actttgctgc ctacttaatt    140820
     cagcatcatc ttcattattc ttgtcctgtc tgaaagagaa ttccaactct cttgctaaga    140880
     atttgaaaac ttcaatgttc gatcctctaa cagatgagac ttttggtata tagcttctct    140940
     tattcagttc cattatttta gactctctac tatactgata agcctctggc aattcaaatg    141000
     gtattactaa aggagacttt aagaatttat tttccagcag ttcatcttga gtagccaagg    141060
     tggataatga tgttgatgac ttattaaccg atgattgagt tgacgaagaa attggtacct    141120
     tggaaatatt tgagaaagca gaacgttttg gaataggtct ctctgtcgga aaatggctaa    141180
     cattgttgtg acttaaacca cgctttatat tagccataag tccaatccct ggggtagctg    141240
     tatctccctt tacagttgat gatgattgct tttggaaagt gtgtaaatca attagctcgt    141300
     cttggtcaga aacttcataa gaaccagtat cttggttcaa aaataagaga ccacttccat    141360
     caacatctct ccatcttacg atattcttag ggagttcatc tagtacagtg ggttcatttg    141420
     tgatatccca accgttgatg tatcctgcac tatcaacatt gaatattaaa tttgaattcc    141480
     accataccaa acctagtgaa ggtttaccgg ttgttaatag atgttttgga atgtattttc    141540
     tagcgagaga atatatattc acttcagctt catcacccat tgaggaaagt gcaatcaacg    141600
     agttcaatgc aattttatcg taatttggtc tgaattttag tttcgttatt ggagaacctg    141660
     tatttatagt tgtctcggga ataaatgtcg aggcaactgg attacctgga taccctatac    141720
     caatgctgct agtgttggtt gtagcattag atgaaaggaa agtagtcgaa taagggcttt    141780
     gatcggtgga tcgccgatca ccaacgtacc ataaagagca cttaccatca cgaccaccag    141840
     ttgctatata gtcctgatga ggatgccagt tgaggcaaag gccaggcccg ctatgtgcgt    141900
     tgattttttt atccacctgt gtagtttgtc taagatcgta tttcagtaat acacccgtat    141960
     catgtattga tgcaaatgta taccctggac tactgatatt taggcttttt ccatctgcag    142020
     aactaggtag tgaagcaaaa ttatgagatg gcatccattt tacatctctt atggagtcat    142080
     tagctgtctt gatatttaaa tcacttcttc cttgtctttt catggaatca cttcttatat    142140
     cccacacttt aacacaaccg tcttgtcctc cactaattat taaatttgtc tgtgacatat    142200
     taaagtcaaa actatttata gctcttgtat gtccggatag tatttgtatc attggatctt    142260
     ctgctggtgt tgtcctattg agatcataca atgagatgtc tgttgagttg ttgcaaatgg    142320
     caatcacgtt gctataatta tgaaatccac atttcacatc tgcaatgtta ctgatcttgg    142380
     cacctttggt cctttttgag agatttggta atatccatga gttacccttt ggtgtgttcc    142440
     tattatttga ggtgatgaag tcgtgcacac aagtcatgga attatcaaca gtagagaact    142500
     tgtaataccc caagtgtgtc ttaccagcac atatcaaccc ttgcatagat gggtcgttga    142560
     ctttatctat gcttgatatc tcattattcg tcctatgatg aaactttata gttgacttct    142620
     tggcgtcact tttctgtgag ctcttgcttc tgcttgaaga gatgtgtgga ctacttgaat    142680
     attgtgagtg actatgagca tggttatgtg ttccgtgaaa ctgattacct tgatatggag    142740
     ttcctgtcct ccgcctatta gcattcccca taataaattt gtcttcgtaa gatgacccat    142800
     aagaattaga cggtccccgg ttagagctac tgaaatcata ccattgtgat cccactgcat    142860
     aagtggagcc atacgagtac tttgctgtaa gcttgggcct cactgcagag tcatgtatgt    142920
     acatatgcgt agaagagttc gcaccactta aatgcggctg actaaacaca cctttcattg    142980
     cattcttacc cgctgacgaa cttgtcctat gtagcaccct atcctgccca ttaccacccg    143040
     aaccagcagg catattctta ttgggagaga aattcataga gcctcaatat tacaatgctt    143100
     gaaaacttcc agtcggattc ctgtgatcct tcctggtcat aaactagcca acaactgatg    143160
     taatgcaccg agtttagggc aaccccagtt ggcaattaat agatgttgct ttacttacaa    143220
     ctgttccaat tagagtttaa ttgttttcat ccaataacat cccatcaatc tacccatagc    143280
     aattgagact ttctaggctc atcgctgcca aagttgaaaa agttgaaatt tcaaggcgaa    143340
     gcctttcgag gattcctata aaaagtcgat gagcttgatc atatcacaag tcaggatcag    143400
     taattcaaag actatcgagc ttcttttaga ttgagagatg agtaaagtgt caggcgagga    143460
     agagtatgag cttggcgggc tgcatgaggt caacgcggat gctagtgcta cttcatactt    143520
     tatgaaggat ggtgagaggc gagagattga ggaagtggaa ggcagagctg tggtacgtga    143580
     ggttaattgg aaaggccatg atatactatt atatgattta gattatgaaa agcttcccat    143640
     ggttagatat caagttgcat tctgtttggt gatgtttctt gttttcggac ttaacgacca    143700
     gaccaccggt tcactacttc cgacattaac tgagcattac aacatatcta catttacagt    143760
     ttcaaatatc tttcttatcc aactatctgg gtacacctgt gcgtcattac taaatgaaaa    143820
     ggtgcacagg atggggggtg tgcgtggtgc tatggtcatc gtgtgtatgc tttgtatagt    143880
     accgcttctg gtcatggcta tgaaaccttc ccatttctac atctacatga tatgttgttt    143940
     cccgttgggc ttgggtctgg gtgtgatgga ctcagcagca aacgtgctta tcggcaactt    144000
     gacgcagaac aaaaacgaat ggatgggcat cctgcatgca ctttatggtg ccgcagccat    144060
     gataacacca ccaacagtgt cctattttgt caaatgggga cattggaact tattcttttt    144120
     aattcctttg atatgctgta cagctgggtt ggtactaata taccctgcat tcaaatttga    144180
     gacaacagcc aaatataatt acttgagtac actggatggt gatggtaatg aaactgctga    144240
     taccggagtt gatgagacaa gtttattcca gatcttgaaa aatcctgtgg tggtgttata    144300
     ctctatttac atgtttctgt acctcggtgc ggagattacg acgggttctt ggttcttcac    144360
     atatcttttg aaaaccaagt ctgataatag aattgggatg tcctacgttg cagcttcatt    144420
     ttggtctggt atcactttag gaagattgtt gttagggttt gttacaaaga ggttattttc    144480
     aactgaatat aatgcaagca atgcctacag ttggctatct gtggtgttct tttctttatt    144540
     cgttgccata ggtttactca actactcatc gatcttctac tttgcttgta tgtttgtctc    144600
     gatgttcttt ggtgggtttt ttattgggcc attgttcccc aatgcaagta ttgtcgcctt    144660
     acaaaaccta cctcccaaac tgcatatcag tggtatgggt acagctgtgg caatcggagg    144720
     atgtggtggt gcaggtttgc cttatttaac tggtttgata atccacagct gtggtgaaga    144780
     gatcgtaccg ttcatgtctt ggagtatggt ggtcgctttc acaatagtgt ggtatttata    144840
     cccaagattt atccctgcgt tgaaggacaa ctgattttta tcagtttaca gctattttat    144900
     agacgggttt tggaatattt atagaaaagg atgtattaga tctgtgatat aggaacatag    144960
     gatcgaatat tcatccatgt ccctatacta tcaggactga ttatctggaa ttatttactt    145020
     gcttttaata aataaaaaat attatgcatt taacaaaaat aatatataat ataaaattcg    145080
     tggttctcat taatggcgta aaattggtgg ttgttcataa gctcgtgatt gaagaaataa    145140
     tctacaaaca aacagatttg atttgattgc ttatagcaga gtaaagtttt acaccctgtt    145200
     gagggtgcgg tagatggtta caatggcgga aggacgtctt agttgatgat ggagttcaat    145260
     tcattgaagt agtcattgtt aacaattttc ttcaatgaag ccaagtgtct caatttgtta    145320
     gagtagtccc aagttgatag cttgccagga atatagtttg cgacccagct aggtttttgg    145380
     actactgtat tgatggattc gccaaagaaa ttcttcaccc tattaatgta gctatagcca    145440
     tacagttcag agtagttcgt cacaaaatgg gatataactc tcaaagtttc tttgacgatc    145500
     atggagtgcg tttccgattc cctggtgtaa gacaattgga attgtttaga agggtccaac    145560
     ccggcgttca agatgttgta atagtagaga ctaggtttcc cagctgtttg ggatgagttg    145620
     gactcaataa tcgtgttgaa ctcagtttct gtgaagggca caaactgaga gtggtagtat    145680
     ttgagtctct ttgagaaatc ctggacggcg acttcgtaag gcttgtcaaa gtaatcctcg    145740
     ttgaaagtct tgttgtggat gttgtatctg atgaaatcct ggtttgagca cgtcacttgg    145800
     aagacgatcg gtatcaagtt gaagttagcg ccctcgcggt cgttgtactt gtatatctcc    145860
     ctgaacacaa agcttcttct ctgcacagtc gagtttgtgg cgtcgaagat tgcgaagtcg    145920
     catatatccg agtccagttc gttaatcaga ttctccaacg ttatcttggc gtagacttct    145980
     ttcctctcgg cgttagcagg gttgaacaag tcctcagagg gatcgttggc tatctgtata    146040
     gactttttct tctcgccgtt gcacagcatc ctcctcactt tgccggcgtt atacacagta    146100
     gaccttagat gcgcggtcgc cgtgttgttc tttagggact ggatcagatg cgaagagatg    146160
     gaggacttcc cagaggcggg caacccgacc aggatgacaa taaacttgtc cttcttggac    146220
     tcgcgatcca tttcccgtct aatggacgcc aacgacagga acgactggtc gttcgtactc    146280
     atggcagcac ccagcggcga gggtctcggc gtagtattcc tgctgatatc catgctggat    146340
     atagacttca tagagaaaag cgagttcgtc gagctctcgg cggaagagag ctcctgcatt    146400
     ttaaaactca tcctttgccg tattttatat actcgtgata ccagcaatac ttgctataaa    146460
     atatttaata cacacaatgg ggcgaaagct ataaaattac atctttatcc atttcacagt    146520
     tatatatgac taaaaaaaat tgacaaaaaa aaatttttga cgcaacagat cagttggaga    146580
     tgacgtcttt tagtccatct ggcttctttc ctcatctcca aataagagct gccaaaataa    146640
     aatgatttgc cttatcatga caatcacaat agtatgggca agctgttagc atagaggggt    146700
     cctttgaccc caccttcgtt gaaaaaaaat tgcacaaaat cgcaagttgg aagagacacc    146760
     agttaaatga gcgtagacgg aacaactctc aattgtcttt gatttatttt tttatttttt    146820
     acgcgactcc tacggaaatg tagtgtggaa aaatctggaa aaattgaaat tcaaaagacg    146880
     cttttatctc agatctcacc aacttcgaat aataaaagta tttctcgaag ccccctacga    146940
     cattatctgt gcattgcata ttagcacgga aaaaaatgag atagtctcac agctttaccc    147000
     ctcaccgttc ttctctccgt gcggcggttc gttagaggaa aaattattgc taatgtatta    147060
     actaagctat gaaagtgata tacgttttgt gtgtgcggta tattcttcgc caaaaacaat    147120
     gcagttagta attcctgcat tgtgcaatta ccctagtgat aaccctgcgc gaacgactat    147180
     agccaatata agagcataac tggtactatt tgtgggagta ggagtcacat tatattaata    147240
     tagaagagtg tccattgtct gaccaagtag gataggcttg taaagttctc tgactagctg    147300
     tttgatgagc gtaatgttac aatagatata tataaatgcg tactactact tattactgag    147360
     agtctgactg caattgcgac tgcgactgcg actgcgactg cgactgcgac tgcgactgcg    147420
     actgcgactg tgattccttt agcaaagtct gtacctgttt cagtttttcg gtgacttgct    147480
     ggcacaccag ttctatattg gccacttctt gcttcttgtg ttccagttgt tcctcgagga    147540
     gcattattag ggattcacgg gactggtggg gcctgtactc gttcaacaag tggtggatgt    147600
     tcaccaggat agtccttata ttctctactt tactctcata caactctggg ttcacactta    147660
     gcacgcctac taactccacg aaattgagca acaacgagta cgacagcctc ctaagctcct    147720
     tgatcttgta ctggtaatct gtcacttcag cttccccttc gcttgtcttc ttgtacagtt    147780
     gcgttatgcc catggtctcc aagtctggga gatggtcctt gatctgccac acactcccga    147840
     acgccctgta gctgccagag gacggcatgg gcggtggtat caggaaatcc agctcattct    147900
     ctgcactctc gccttcctct ctcctctcat tgtactcctt caacttctcc acattctcac    147960
     tggtgaaata cttgatgtat ggcggtggag gcgggtacaa cgacgacaca tcgtttgccc    148020
     cactcacact ctcctctctg ctcatcctca atataaaaaa agaccaaaaa aacccccttc    148080
     gcactacaaa aagccactcc cttcgtacct cacctagaga aggaaaccag caataaatat    148140
     gcgcccatct ctcaaacgct ggtcaaataa ggtgcaagcc tgaactcaat tcaattcaga    148200
     aagtttcgca aaacttcata gaacttcagt ttcgagtttc tcggggattg agtaacgtgt    148260
     cacgtgattt ttcaaaccct ttgccataaa atttcttgct tctcaggacc ttctgggacc    148320
     tcatcgattg aagttataac agcatcgagt ggttgatttg aggtaggttg tcctcgtatc    148380
     tggggtagta taggagcaag aagactagaa acagttgtac aaagatggac cagatggaag    148440
     tggactccga ggaagttccc aagaagaagt ttcagatcaa gaagtggact gctgttgctt    148500
     tctggtcgtg ggacatagct gtggataact gtgcgatctg taggaaccac atcatggaac    148560
     cgtgtataga gtgtcagccg aaggcaatga ctgatacaga taacgaatgt gtggccgcgt    148620
     ggggtacgtg taaccacgcc ttccatttac actgtataaa caagtggatt aagacgagag    148680
     atgcctgtcc gctagataac cagccttggc acttagccag gtgtgggagg taggtatgtg    148740
     caaatgcctg tcttacagat tacaaattac aattatgcat aagaattagt ctcacctggt    148800
     gtgattcaat gtgttgggtt atgcgcaatt tcgattcctc ctgggtgttt gttgaatgta    148860
     gatctctcgc ccacagattt gaacggtatt gtggcatgtc caggtgatat gcagcgataa    148920
     tctctgtccc taaacttgat agattgccta ttctttcttt taaaggtggt ttaaaaggta    148980
     tttctctatt ttatgaaagt atactgttcg gatctataag aataatatat aatattacat    149040
     ctatatgtat catttaattg aatttatacg ttaaagagat ggtttacaat tgttcacgta    149100
     attcgagtaa cttctcccag ccgtctgtat cctcccatct gctcttacct ctgctcatca    149160
     atgccttgat tgtggaccta catttatact tccaatcttt gcagactaaa ctgccctcgc    149220
     catgtttgcc ttccatctcg cccagagact catacgcagc aactagatcg ctacaaacct    149280
     cgacaacttc gttccatact ctctcgtcga cgtccatgtc tgggttatgg ctgacagcac    149340
     gatatgcctt ctcttcgcat tctagggaag cccaaggtct cttacgccac agctctaccc    149400
     ttgcagctaa cttccaacat cttgcgtcag ttgtaataac ggatggaagt gtattgcaaa    149460
     taaaatccat gcaactcctt tgaaaatatg taaacttaac ctcaccttcc tcatttggtt    149520
     tcgggtaatc tgatgtaaca aggagctcta ccaatttttc aacaacaggt agatcaatag    149580
     cctgttcccc actcttatcc ttcttgatct cgatcagttg cttacatgca gctaaaacat    149640
     cctcccattc atctaattta acagacacta acaagaaatt ctcccatatc ctccagttct    149700
     tttgagagtc actggatata gcctgcttca gacagctatg tgcttccttt agtttacctt    149760
     gttggacata ggcagcactc aggttggacc aagacatagc atgtgttgga tctaatgcag    149820
     tacatctagt gaaggcttcg gcagctattt ccattttatt gcactcaaga gcgatgcaac    149880
     catagaaata ccaagtttca aagcttaatg agtactgtct caaggaatca ttcagatgtt    149940
     tcaaagctaa accgtaattc ttttctatat tggcgtttgg tggtgggtta aaataatatc    150000
     tagccaacga gtttttggcg ttgacatatt taccgattga ccaacttttc tcccatagag    150060
     aggggtcttg tcttatgtca ccaagtatag aataggccct ggcatcatta ggtgtggatt    150120
     cgattctgtt caataacatt tgttcagctt tcttttcatc acctacagca gcataacata    150180
     acgcagcttc acagctcatt cccaaccgct catatatctc aacagccgac ttcaaaacac    150240
     caagagacat atatttttca gctaatttgg catctagttc ccatcttggt atgaatggaa    150300
     tttgatggat gtattttaat cttggcatag agctttcgta ctctggatca gttgctttag    150360
     gtaacaaagt ggttgatatt ttcaacccta gttcttctac taaagattgc atctgtaaaa    150420
     tacccctctc gatagttttg gccttagtag tttcaatcac agatctttcc catagtgctc    150480
     tagagaagat agtccagttt tttggtcctt cctggtaaat aattctaccg actagcgcac    150540
     caagctcctc ttcaacaaga ggatcaaaag ccggagaggt ttgtcttaag gtgtatagtc    150600
     gtagtaacag ttggatattg tcataatctg aaagtgtagg ttgggcattc ggatcgatct    150660
     cttgtaattc aagtggaata ttttcttgtc taatggctac aggtagtaat ttatcctcta    150720
     caattccatc gttttcaaat ttttgcttct tgaatatctg atcatctaag ggttcattgg    150780
     caatatcttc ataagtgggt ttttctagca atatttctga atttaattgt aacacatctg    150840
     gttgagttga tatattttct tttggctggt tgctgaagaa ttttgatttc gcaagaatta    150900
     atagaccaga tacggccttc tgttggtatt tggttctttt agctctagca cctgttagaa    150960
     caaaattaaa atctgttaac tttttaactt ttgttaatgc tggcaaggca tgatgttcgg    151020
     tgttaatcat aagagagcat ttaacgcttt caagatagta aatcacatat aagctttttc    151080
     ttagtttctc ctctgaaact tcttctatat ttaagtttat gttcttaacc aagtttatgt    151140
     tgtcatagat agatgccact actgctggtt ggacaccata catttccggt aaaactgaca    151200
     attgggccaa taaagctctg gctctccacc aatgagcaat gcaatcaaat ggactctggt    151260
     cctcactgat ttcaaccgtt ggtggtaatt catcatcatt ttggtagttg aacaaggact    151320
     tctggctagt tattttctcc aataacaaca gagcgagagt cagagcaatt ggatcatcca    151380
     tatattcgta agccatttga ccagctgaag agagcaatga aatgaagctc ttgtgtaaca    151440
     tctcattttc atcaatattg aagatcagtt ttgtgatgtt taggtcagct ttgggaccag    151500
     tataattgtt ctgagcgaac aactgtaatg atgcaatggc aaggatcaaa gctttgctta    151560
     ggtcttcact gataatccta tcagtgtagc tatccaatgc ggccaaaata tctccatcag    151620
     catcaaggaa tgttccaacg tttttcaata tatcctcgac aacattgtgc gaattacctt    151680
     ctaagatatt tcttgcataa gcatgtatgc attgatcctg ttcagtgtgt agtttcaagc    151740
     ggtccaactc atcaggtggc gaggctagaa gcaagtgggt gaaaagtagc gtatccattg    151800
     ttagtattac tgaagaggta tgcacggtaa cctattatat tattcatgga cagttatgtt    151860
     atactactac cttcaagtat tgctatagtt ttttgtaaag tgaaaaaaaa aatcgatgag    151920
     catcgcataa agctggaaaa tttttgcaga aagcgttgcg tagtgcggaa acttaattca    151980
     cttgagatac aagctatatt aagtgatcct taatagcttt gtaccctcct atgattgagt    152040
     agacttcgca gcagtatgtt tcttgagagc tagtaccctg tcaaggttga ttgaacacaa    152100
     agcaggcgat tcggatgccc ggttaatatg gtcctaacta tcacccagta agataatata    152160
     gcaagattcc tagggtttat tgcctaaggt agaaatttat taggtggtat tagcaggacg    152220
     ctagatgggt ggtcggtttg gttgatcaaa actctatttt tgtgtcataa aaagcagagc    152280
     agtttgattg ggaggcattg aagaacagta atactgaaag tatcgccgct tgatcagtta    152340
     ctttggggac cttatttcag aatattgagc actggtatgt ttaaacaacg gcaaaaaggt    152400
     agttaatatt agatgtcaac tacaatgcaa gtcttcattt tatgggtgct ttttctcgga    152460
     gttgggcaat gttacttgaa tccgataact atacaaaaca agcattttgt tgattctgta    152520
     actggtgagc ctttctttat aaagggtgtg gattatcaac cgggaggagc tgcgggcatt    152580
     aatggtgaat cggatcctct atcagatccc aagaaatgtg ctcgggatat tgtgttgttt    152640
     caagagctcg gcataaacac tgtacgtgtt tattcgatca accctgatct cgaccacaat    152700
     atatgcatga gtatgttgtc aatggctggt atatatctca ttttggatgt gaattcgcca    152760
     ttaccaaacc agcatctcaa tcggtatgaa ccttggaaga catataatcc attatatctt    152820
     gaacatgtat ttaaagttgt gtcacagttc tcgggataca ataatacttt aggatttttt    152880
     gctggtaatg aagttattaa tgatgaagag tcagcaacta actctcctat ttacgtcaaa    152940
     aagttaatag gtgatattaa ggagtatatt gcaatcacat gtgatagatt aatacctgtt    153000
     ggttattctg ccgcggatga cctcaactat cgggtttcat tgtctcaata cctggaatgc    153060
     tctacgaact ctaataaggt ttatgactcc gtggatttct acggtgtcaa ctcgtaccaa    153120
     tggtgtggtg agcaaacaat taggacatct ggatatgata aactaattga ggcatatagg    153180
     aactatacaa agccggtgat gctgtctgag tttggttgca atagggttct tccccgtcag    153240
     tttggcgaag ttgaagtctt gtactcaaag gaaatgtaca cagtcttcag tggagggtta    153300
     gtctatgagt atagtcaaga gcctaataat tatggtctag taaagattaa tcacgatggc    153360
     tctgtaagaa tgttacctga ttttgtgact ttacaagaga aatataagaa aatcgctttg    153420
     cccaatcgtg atcaactcca taaagagttg gaaggtcaat ccattggtct taagaggaac    153480
     gttttgtgtc tggataaata tgagaacctc gaaattagtg gcaaaactga aaatgacata    153540
     cctgcaaagg caatcaagac tggaattcaa gttaaaagag gtcatattct tgagcttcta    153600
     aattctaata ctttacaagt acaattcgaa atattcgatg tatatggtca aagatggcaa    153660
     ggacctaaaa ttgtcactcc aatcactagg aaaacaagta acaaaaaaga aaacgaggcg    153720
     aagacgaatg gagccaatgg aaccagcgag tctttgttga ttgaaagcat tttcaccatg    153780
     ttactaatgg taatagcagt tcagtgtatt attttataga tgagcatcac atagatatat    153840
     atgtttattt aatttttatt gagttcaccg tttaatgttt agttgatgaa tggaggaggg    153900
     aaaaggtgtc gtaaaattat gaaacaaagc tgatacctga gtatgtatta tgtagtgttg    153960
     aaattaatct acctgctcct atacccaaat tcattttttt atttcaattt atatatatct    154020
     attagcaggt ggaccaatat acatattttt tcagttaagc atctctatat tgttagagtt    154080
     gcacatattt tccctgccaa aaatgttttt atatatataa ctatatcacg atacatcaat    154140
     aacgatgtct gatgacctca aaaggataat agtagaacga tctgatatcg ccaaagctct    154200
     cagagagcgc agactctccc tgattcatat aaacaacatc agcgccgcac catcacccgg    154260
     aacgctagcg caattgctgt ctagcacatt tgaggacctc ccagccccac caacatcgtc    154320
     atcttcacgt atatcccaga gcccacaacc gaagacaagt tattggccaa actactaagc    154380
     tggcttcatg tatttacgta tttcaagaat aaattgcaat ataactccac aaaataacca    154440
     gcagaaatgt aaaaaagcaa aaaacaaagc ccacaaaaat atactacaaa ttaaagtaaa    154500
     aattactgcg acaatgacta tattaatcac atcctataat gaactgcaac tttggcaaga    154560
     atatagtttg gcaataggct gtatactaac aattgtgcta tagcacacaa aacgacataa    154620
     taaaattttt ccccagctta ccgggcacca cgaggctggg ggggggacct tttggcagcg    154680
     atgaggtttg gatgctcata gataaggttg gcatactttt gctgacagtt gcttgctatt    154740
     tgctggaatt tggcagtcaa gagtcttgag tgatgaaata ggtttatagc gggaccttgt    154800
     gatgcaactt gtgccggtgc taaacagata tatataaagg acaataggac agcgaaaggc    154860
     acaacgacaa ctacaggcac ggtttagaaa taataagacg gtatcaaagg atcaagtagc    154920
     tggtaaggaa cacgaaatct tgaataaatg ccaagatgtc ttcttctagt gaatcggagc    154980
     cgcactctcc gcagctttcg cacacttctg tggcagagtc tatggtttcc atgaacactg    155040
     aggatcacaa tgagttgtat gaccacaggc agcacattag tgttcctccg cggttaggcc    155100
     aggattctcc tgggagttcc aatcttaatg cgaggcatat gatgcttgat gatagagcta    155160
     atgaagattt tggttttatg aacattgaag gggcagactc tgattgcgag ccactgggga    155220
     aggaccacca caaattaagg tctacagctt tacaaaattc taatgcgaga ccttctagat    155280
     tggcccacac agttaaccac caggaagttg tccaacctgc gacaatcaca accgacaata    155340
     gtgagttgaa gaagaatgtc tcagcaattt cggcttctcc accaacaaag actcgaagac    155400
     agtccaatac attttcactt acagacaaga aaccgctaaa gaggaccatg tcaaggcata    155460
     actccgtgaa ttctgctgtg tcatcttcaa ataggcttaa cttggctgct gtttcgagaa    155520
     gcatttccca caagtcggta gatgatgata acctcaaacg taagattacg agggcatcgt    155580
     ttagtagcga caattctcag gcatccagag agtctcaaga gaccgaggaa gatgtttgct    155640
     tccctatgcc tccacagtta catagccgtg ttaatggcat agactttgac gaactagagg    155700
     aatttgcaga gcaagtcaac gaacagaaaa agctatgtga aatttccttg agtgcacaga    155760
     agagtggctc aaacggaatt caagcctctg gctcttcatc atccgctaat tcttatatgt    155820
     cagaagcagc tctcaaatat actccaaaac atttaagaaa agacctctct cctcccaaat    155880
     ctgagtccct taacagtaac tcatccaatt ctcctgattc taaccaaccc caaggtgtct    155940
     catttggtaa taacaagatt gaaggtgaag atgagccata cgaagaaaaa ccccaagctt    156000
     atacccaaac tcccgaaaac caattctacg gagacgggag ttttaaagct cctgacagat    156060
     tttctttctt ctcatcagaa atggaagaaa cgatacatgc cacagatata gcaaacttag    156120
     tgacaccagg gcagtcattc tttgacctct tcaggggcgg agagccaacg tggtggctag    156180
     attgtagcta tcctactgat gatgaaatga gatgtcttgc aaaggctttt ggcatccatc    156240
     ctttgactgc tgaagatatt agaatgcaag aaactcgtga gaaagtggag ttatttaagt    156300
     cctactattt tgtttgtttc catacatttg aaaatgataa cgaatctgaa gatttcctag    156360
     agccaatcaa tgtatatgtg gttgtattta gatcaggtgt tttgacattt cactttggac    156420
     ccatttcaca ttgtgctaat gttagaagac gtgtgagaca gctgcgagat tatgtcgacg    156480
     tgaactctga ctggctttgt tatgctctga ttgatgatat taccgatagt tttgctccag    156540
     ttattagatc gatagagcta gaagcggact caattgaaga ctccgtgttt atggcaagag    156600
     acttggattt tgctgcgatg ttacaaagga tcggtgaaag taggcgcaaa acgatgactt    156660
     taatgagatt actaagtggc aaagcagatg tcatcaaaat gttcgccaag agatgtcaag    156720
     atgaggctaa tggtatcggt cctgcattga cgtctgaggt caacatagca aatctaactt    156780
     caagcagtga ccctaatgtc aaatatatgc agaaattgca aatgaataca caaccaagag    156840
     gtgatatcgc gctgtatcta ggtgacatcc aggatcattt actgacaatg tatcaaaact    156900
     tatcagctta tgaaaagatt ttttctagat cacataccaa ctacttagca caacttcaag    156960
     tggaatcctt caactccaac aacaaagtca cagaaatgct tggtaaagtg actatgatag    157020
     gtactgtatt agtaccactg aacctaataa ctggtctttt cggtatgaac gtcaaagttc    157080
     cagggcagga caccagtatt gcatggtggt ttggcattct tggcgtgatg atcggaattg    157140
     caatttgttt atggttcctc gcatcactat ggatcaaaag tcttgtcccc ccagctacct    157200
     taaacgaggc cgctgaaagt ggagccaagt caattctctc tagtttcatc ccccggggac    157260
     ctaaaaacga gaatgaccca aaatactcgc gaggcagatc aaaatacgga ggcccctcca    157320
     accgttcgat agcaagtctg ccaagcaaat acagcagata tgattaattc gtgctattct    157380
     cacaacttca actatgagct acaccacaga cgtttttcac gcccaatcat aacatcgcca    157440
     cttttcttgt ttacaattca tttaggcata caacatcttt aatttattct aattttttgt    157500
     attttaccat ttcaactttc actcactatt cagcacatgt acttcttaat aatatacagt    157560
     aatcatttct attttgctct acatttacag agggctctcg ttatatattt gccttaatca    157620
     gtgctattca gctactttgc taaaacttag agtgtagata ttagcaattc cttttgagca    157680
     ctgagttggg gtacacaaca tcaatgcact catacacgta tcatatcaaa acgaataaat    157740
     actccttagc aaattgttat atcaaagcaa tatcttttaa tatttacgaa gctattttat    157800
     cactcgatcc tcttcgcttt cttcaccgga gtcaccgaac ctctaaaagg gaaagcgaaa    157860
     ggcttataaa agggacttca ttacaaaact ataaaagtga agcaagaact gtttatcgta    157920
     gtagaataaa ccagatacag ataatacaaa tatggacgaa gaacctcaac atttatttag    157980
     gtttcctttt cacttgccat cctttgatgg tatgcgcacg attggtgtat acttggcagg    158040
     tgtactctat gccctagggt tctgggcatt tatagactcg gtgctgtttt ccaagtataa    158100
     taatgcttca gatttacata ttacttttgt ggattgggtc ccgtttcttt gcagcacgtt    158160
     tggtatgctg atagtaaact cgattgagaa gaacaggctt ttgcaagggg ctttatctgg    158220
     tgacaatggt atgttcgggg gtatgaacat ggattcacaa ttggcatggc aagctagatc    158280
     tgtgctgttt ctggggtttg cactactagc tggtggcatt tctggttctc tagtaatttt    158340
     gattataaag tatattgtga gagactacat atcattccca acattaggga tgggtatcga    158400
     aaatgtggtc tcaaacgcat gtgtgatgct aagttgtgtt gttctatggg ttgcacaaaa    158460
     tattgaagat gaatattcat acaacctcac tttgtaactg ctgtaacgat atgttggtac    158520
     tctcaactgt atttcggaaa gccggcaatt aaaaatttct tagtctcact ttaatacaaa    158580
     gatataatta gtatacatac acaaggaagg actaaaaagc acctcttatg aaaactaaac    158640
     attgaaaaga ctgtgttctc taagttagtt gaacaatcat tatcatcgta aatacaccat    158700
     ataattgtat acaggctaga acctgtgtta tctaaggatt gttgggtctg aagaaataaa    158760
     gtaggagcta tattttcttt tttagttaca aatactactc atactttaat cttaattcat    158820
     aaagcgaaac ataatctaca tattaaaacc tctcttttca caatatgata accactttaa    158880
     gaaatattta atggatttat tattaatgac caagaactgg gataaattac ttcctctatc    158940
     ggtcgtaaag ctatagccat cgtagattaa aaggatttac caaaggtgac caagttaatt    159000
     tttttcatac cataaccaga actgtgttac gaatgaaaca agatgttttt gagtctacga    159060
     catatctggg gctagattca tgctgggatt aatgaaacat tttatgtgta ctagcaaatc    159120
     gataacgcat tttcattata cgttgtctct gtacagtagt atagcgtagc ggcctatgga    159180
     atatctctac tgataactag gaactttgct acaccgatca tcccttttgt cctaatatta    159240
     attcctgaga aatttaaatt acattgccat gactaaaatc acaaactaaa ataaataaca    159300
     tttccatggc cgtgcaacac tgtagtcatt actctgaaat ataattgaag acaactctat    159360
     taattatcag ttaattaata cattccgaaa gctgagagct aatcagagaa gaactcaaga    159420
     ccaagaccac acatcgtaac ggtgacgaaa tccgtcccaa taccaaggat gaagcttttc    159480
     gattcggcta atttatctcc gttatgaaga gtcattgtga acatagacaa tagccccttg    159540
     gagcatatgc tcttatttgt cgtcaacttg caagcagaga gcgttagcag cttggcgtac    159600
     gcgtatctag aagcacatac tcttgcgcag tgccacagcg tgggcttccc cactggggcc    159660
     attcccctcc ctcccctacg acatattcta agctgctagc gatcccttcc cccctcgtct    159720
     cccttcaact tgccgaacac ccgaggcata gaatgtgaaa atttggtaaa tcctcgggag    159780
     tttgcaaatc agcgctggtc gggcctgtct ggtaagactg ctgcgattcg ggacacttaa    159840
     ctgcacaggg aacacactgt agcaacattg attgaggggg gaatgggtat gtctggtcgg    159900
     tgttattcat ctaaatctat tacgcaagga ggcttctttg cttttctata catgcgactg    159960
     tttcagagag acttacaaca gacaatgata tctcgccgtc ctaacggtat ctctcgagtc    160020
     tcgagtctcg gcctttccag gattcggtca ctattgagct attcgagctt aacaaagttt    160080
     aacgaagttg aatagaagga gacatattta cggagtctgt ggtgactaag gggacgactt    160140
     gcatttcgtg aaccagagaa aatgcttgta cgcacttctg ttaattaatc tggccatacg    160200
     ttgaactgtt caccaagctt cttcggaagg gactgggtta tttctgatat aatcctattc    160260
     ataatgtgtt ccaaagcgcg agccatggtt gttatcacca ctagtcggat cccgatatct    160320
     ttgcttttct tttccatgtt ttcattgtat gggaaatcct aacctgtact ggagggtctg    160380
     ttgctatgtg caagggtctt agcctatatt atggtttagt caattattgg attgctcaac    160440
     aaagctaatg gcctagcttc ggtaaatcct ttaactgatg tttcgaaatt cgggcaccat    160500
     tcacttacat atttaagtgt tatgtgtatt cgccaaattc caaattattc taatatgaat    160560
     cttttatctt tttgactttc attacatgaa taaaaagtaa gataaaacaa ctgacctact    160620
     gttccaaatt cggtgtttta agaagtatta cagtttttaa gaacatacta gacacattgg    160680
     ggcacaagca accatatccc tgatgaagta tctaagtgtg tttgctacat ttgtggccat    160740
     tttatcctgg gcatgcgcta cggtgtatcc taatttctat aaagataaga cgatagtact    160800
     ggatggtatg ggcaccgagg aatttactat tcccagggat aaaatattat ctttagttaa    160860
     tacaagttta actttaaaga attttgctca tatcagcatt aaggagggtg ttcttatcca    160920
     ggaaaaatca tcagttacta ttattcctcc tattggcgct agtaggaaat ttaactttac    160980
     attgggcggt gtatttgatc tagaaaatga gtcaaaattc atatttgatg gtagcggaaa    161040
     cacctatgag gatgaggccg atgctgtgaa caattttgtt tttgatattt atgcaaatag    161100
     tagtgggatt caggtctata agggcaatac tgtaagtgtc actcttccaa ccataaaaaa    161160
     tagtatacca aactaccaag gagaatcccc acatattcgt tttgctggta gtaccttaga    161220
     tcaatttata tataaacctc catacgtgtt ggtttcactt atgatcattg ccggaaaatt    161280
     tgaagtgctg tcaccgggca gtaagacagg atctcagttt gataaagtta tttggagagt    161340
     ggactttgga gtaagtggat tagcaaaaac taacccgaat accccatcct atggcgtaga    161400
     taagttaact ggtgaaataa catgtgaggg gatactggct gtttataatg atatgtttgc    161460
     attcacaaat aatgctgtgt tgcatacatt ggggtatatt gggtattccg ttgtatcacc    161520
     aatcactttg gatctgagca tggggccaat tcgtaggcca acaaactatg aatatctagt    161580
     ggcattgcca gcggggcaag acggcatcac actgacaggc tataaataca cagcagatac    161640
     cgatataagc gatgctcatc agtacctgtt ctactatttc tacgacaatg atgctaccaa    161700
     agaagacgag attagtgtat ctactgacaa ttccgatgta aggattttgc attccaaccc    161760
     atcacaaact gtgacagtgc atggtgatag cgccctgaat attggatact acaaaggcga    161820
     cagaatcgac tcatttgtag gcttcgatgg tctagacttt agcaaataca agaaggagtt    161880
     agcggtatac ttttatgagt cctttcaata ctcatctacc acgacaacga agtctgatga    161940
     gtataccact gaaattatcg agatcattgt gtcaggaaca cttggaatag ataacaagcc    162000
     ctctccggta acgattagtt caacaattta taaccaacta cgcgaaacaa ccgagacagt    162060
     cgacttagga aatggagtga cggaatatca tgtactagat tatttcccag ttcctcaaga    162120
     tgataaagag catccatatg ggacgagtac taaaataatt acatacagtc cgccacctgt    162180
     gacgatcacc gccaccactg ccgcggacta tgttgagacc gactggatct cgttcttcat    162240
     caccacgaat gataagggtg agattattac tgacagcaca ctgttcaatg ctacgcgtga    162300
     ctacaacttg cctgaggctc cgcacacgtc gttcgggcct gcacctcctg ccgagaccaa    162360
     gactgttgat ctgggcaacg aagtgactga gtacctggtc atcagctact ggactacaac    162420
     aaatgaagtg ggttcagtga taactacaga agcaacgaaa acatacagtc cgccacctgt    162480
     gacgatcacc gccaccactg ccgcggacta tgttgagacc gactggatct cgttcttcat    162540
     caccacgaat gataagggtg agattattac tgacagcaca ctgttcaatg ctacgcgtga    162600
     ctacaacttg cctgaggctc ctcacacgtc gttcgggcct gcgcctcctg ccgagaccaa    162660
     gactgttgat ctgggcaacg aagtgactga gtacctggtc atcagctact ggacgaccac    162720
     caacgagttt ggtgggttga tcaccactag cagcaccagg acgtacagtc cgccacctgt    162780
     gacgatcacc gccaccactg ccgcggacta tgttgagacc gactggatct cgttcttcat    162840
     caccacgaat gataagggtg agattattac tgacagcaca ctgttcaatg ctacgcgtga    162900
     ctacaacttg cctgaggctc cgcacacgtc gttcgggcct gcacctcctg ccgagaccaa    162960
     gactgttgat ctgggcaacg aagtgactga gtacctggtc atcagctact ggacgaccac    163020
     caacgagttt ggtgggttga tcaccactag cagcaccagg acgtacagtc cgccacctgt    163080
     gacgatcacc gccaccactg ccgcggacta tgttgagacc gactggatct cgttcttcat    163140
     caccacgaat gataagggtg agattattac tgacagcaca ctgttcaatg ctacgcgtga    163200
     ctacaacttg cctgaggctc cgcacacgtc gttcgggcct gcacctcctg ccgagaccaa    163260
     gactgttgat ctgggcaacg aagtgactga gtacctggtc atcagctact ggacgaccac    163320
     caacgagttt ggtgggttga tcaccactag cagcaccagg acgtacagtc cgccacctgt    163380
     gacgatcacc gccaccactg ccgcggacta tgttgagacc gactggatct cgttcttcat    163440
     caccacgaat gataagggtg agattattac tgacagcaca ctgttcaatg caactaggga    163500
     atatattgac gcagaagcac ctcatttatc ttctagcatg aaagatgttt tacctgagag    163560
     tgaggctgat tacacgacga cgattgacaa gggcaacggt gagtttgaga ccgaccttgt    163620
     ttcgcacatc actacgaagg actctgacgg caagcctacg acgattacca ctacgatccc    163680
     attgaagcca agtgaagtcg gcgaggccgg cgaggccgac tacacgacga cgatcatatc    163740
     agatgggcac acgatcacgg aggtagtatc tcatgtcaca actacagact ctgatgggaa    163800
     gaccattaca tacatcacca cgatggcgtc atatgatcaa gtagatgagg gtgtgttcac    163860
     gtcagctgca ccttactcac agccaccagt cgtgacgagt acaattactg aggatgacgg    163920
     cagtagcaag actgttgtga tctcttactt cccatctgaa ggcgaggatg gagtgacccg    163980
     tactggcaca acgactgtgt cgaccatcac acctggagaa gccgactaca cgacgacgat    164040
     catatcagat gggcacacga tcacggaggt agtatctcat gtcacaacta cagactctga    164100
     tgggaagacc attacataca cgaccaccat attcagtaac gattggttgt tagtggattc    164160
     tgagttagac gttaaatcga atcaccctac ttcagttgtt tccaaggaga atccttatac    164220
     tacagtggat tcgcaaagca ctatctctag caattctgga aacacggtcg tcactacaaa    164280
     gacgccagcc aacggtaatg agaatcacgg attatcttct gttaatggaa cttcagtttc    164340
     tagtggacgc aatactatcc cttcagtgtc attgataatc acaaatactt taggattcgc    164400
     agggccgata aacaagcctt cttatagtac tacttctgca tcgagttctg tgccacagga    164460
     agttgcgagg gacagttcta aatatggcga aaatgtatca tctgtgggta ttatgctacc    164520
     tcaaatgtct aaaccacatg cctcatctgc ttcaatctca gttgttcata gttcatcacg    164580
     tccagttatc tctaggggat ctaggccatc cgatgtttct gctcgtccta ccgagaacac    164640
     gccgacattt ggatcaatgc cggttcaaag cggcgctgag aatgatgctt ccgtgagttc    164700
     gacaaatgat aaccagaata cacatacagc acagtcacgg ctgcaacagc taggaaagac    164760
     ctccagcgat ttagggacca ctgcattatt aataccgtca agctccgctg ttaacatcag    164820
     ccataccgga gggccatcgg acactcaaat agcttctgtt ttacaaggtt ctggttttaa    164880
     gatcaaggcc aacaaatcag aggttatgat tcttttagta actgtgtttc tctttttagg    164940
     aatggtgtga gtattgattg gatatgtgat tcatcagccc gtgcaaactt cctttcagat    165000
     ggtgccatgc atttattaat cactatacat gattgttact gcggaataaa agtccagtag    165060
     gcacgtcctg aaattacatc acaaaatatc gtataccaga ttgtctgcac tggataactt    165120
     ctgttaaaat tgagcccttt cttttacgtt tgatgaagaa ttgttcataa ttgctagatt    165180
     tggtgtgaaa atccaacaca agaaacaaat aatacatttg tttatattat agtatccatt    165240
     tttagcttaa taggcatctt cgataagtaa tgttctatcg ttctaaagat aattcatata    165300
     agtggcaaag ttactactaa tcaagaactg tggtgaatgt attcttactg tatcagtagt    165360
     gatcaatata acagctatat attcgaaagt gatgttttca ttgaatagtt gttgaatcca    165420
     gtacaatacc atcttcatat atggatatct atgaaacaaa tttttaacta ttgtatttca    165480
     gtaccttcta aatacataca agacacttgg ctaaatactc ttgataaaat ttagtatttt    165540
     cccaaagctg ctctttcatt gcatccccac aaacatcagt aaatttaact ttcctatttt    165600
     ttagatgtaa ttaaatataa taccttggaa ttgatattat aaaaattaca tccattagtg    165660
     gatgaaaaat ttattacaag aagcgagcgt ttttttacaa tatattttaa gccaaagcta    165720
     cctatgtttt ggaatatata tgttgatatg tcaaataaga aatatatcgt attatataaa    165780
     tgacatcttt ttgtcttgga cctatgcaaa ttttgtaata ctactgatat aataatcata    165840
     tagggaaaca atcaaggaat ttatttgagg tcaacattgg cattatcaat ttcagatcaa    165900
     ggcgaaaccg aattagatat tgtatactaa atacataata aaagagttgc taaaaaaaaa    165960
     tctactgaag agatgtttat aaatcctata aataaggaaa ttcagaaata aaattctgcg    166020
     tctaaaattt gaactgattt gatgttaaga caaacatatt acagctgaca tacttcatat    166080
     tagatttata tacattatca acagaactca agcaatgctt gcatttatgt aacctgaaac    166140
     tataaaaaat ggcatcgata aggaaaacta tttattgata gatttgtcaa gttcattaag    166200
     aatttacact gacaaatagt tttgtggcat cctttgctga ttacgattat gtgtacaaaa    166260
     atctgtcgaa cataaagtat tcttttagaa atgaaattat atcttgtcaa aagcacttta    166320
     tcaagcatta ctattctgtg gtctattcta ttaaactatg attttgtttt ttattatcag    166380
     atacactaaa ctggtaaagt caaaaaaatc aaatagtagt cattataaaa acctagaagc    166440
     agatttactt ctatctcaca ttatctcata gtttcccaat gtgaaagaga cagtttatac    166500
     ggaatacatg tttcataata taaagatcta tcaaacctgt gttaacgatt atatgctgat    166560
     gtgtcagtat gtacccagct cagagcaaac tctaataact tcgagacata gcagacttac    166620
     cttgagatac aactaaaaaa ctattgcatt tatttgcaag gtaaaagtag tgtttgggtc    166680
     gttcaacttc atatatgtga taaaaagcat aaagtagaga ctcaataaga gaaaaaaaaa    166740
     acaactgtga caacctcact agaccgtaag aataaaatat acgaaataaa ataaatttca    166800
     ccattgcctc tcaattgatt tcaatgctcc tcagaatgtg gtttaatttg ttgcaatagt    166860
     tcacctatca cttgcaattc aaactcgttg aaattaaata actccggcaa caacactggt    166920
     tgtgtctgct ctcttgggaa aaagtatttc tcgtttctca agtcatcgaa aaatggatga    166980
     gccataatcc ttcttgggga aaatcttagc tctggttcat atttcaatac cttcatcagc    167040
     aaatcaatac cgtccggtcc tgcatgaccg aagtattttt gaaatctctc caaagaggta    167100
     ccattgaaca aaggtgtcga gtataatggg cctgtgtaac gtgggttgga gaaaaaaata    167160
     aactttttat ctggtggtcc tagtagcttt gctatctccc gtaactgtag aagtggatcc    167220
     tggccttgga agatggctct accgattagc atttcaccga tgacacatcc cagaccccaa    167280
     atatcaacct gggtggtata ttgtgtggaa cccaggataa gttctggagc tctgtaaaat    167340
     ctagagcaaa tatagctgat agatggctgg ttcggttcaa gtctctttgc ggagccgaaa    167400
     tcacatatct ttagaacgcc cgtcttcgga tcaactagga tattggatgg tttaatatca    167460
     cggtgacata tacccaatgc atgcaagtat aacatacctc tagcgatctg gtaactgtat    167520
     aacttgacat gtttgatggc caactgtaag ttgttagaag tatatcgatt tatttctatt    167580
     tgcaaagtct ctggtaagca ttccatggct agatgctgat ataccttgtt gtcctttgga    167640
     gaagtatgtg taaaaaagta ttccaattta acgatgtttg ggtggtcagt caacctaaga    167700
     atctgcaact cacgggattt gtactctgtt tgtgcaggta ccttcttgat agcaaatggg    167760
     ccgtaccatg tttgctcgtc ctgagtcaaa taagcctgga ccactgtacc aaaagcacca    167820
     cgccctatct tcctatgctc acgcaccagc atgcgtctgg gagcaccgtt ctccccccgc    167880
     gtctcatctg gtctattcgg agtgacatcc tccgcgataa actcgtcgtg aacttcctcg    167940
     tggctcattt tatttattac taacttgttc aatagtagat atagaacaca ctattcctct    168000
     ttctcagtat tggaatcgag cagccaaaaa atattacttt gctatattac ttgccttcca    168060
     gttaacagat ttctcccgtt actccgcgca aaagcccaag gtctaaacca attgtactcc    168120
     tgcctataca cacaaaccaa atcgatcgat cccaatggtt cctgaccgcc ttacaaacta    168180
     acagaagtaa gccagaccct gttggcttca gctattttta tcgtaatcct tgtttacaat    168240
     ccttcctttt ggcattattt tttcatcctg ggagaaagaa acacgtatga catgatttga    168300
     gtattcgaga ggtataagag tattcgattg tagggaaggg cattcagaag aggaagaaaa    168360
     aagaagaaga gaaaataacg ctgttagaaa gaatattaac tatttagagg gtggcatgtt    168420
     tgcttaaata atctggtaag ttttttgaga acatagtttt tatttataag aatatataat    168480
     actggttttc ctgctcgatt tgtggggtga aatattgttt taattatttt ttctttaatg    168540
     ctattcgagc ttgcctgtgt gctagatggg gagctttgta ggatgggtga aattatgcag    168600
     agaagtctag gcccttagcg atgttctttt ctagttggtc tagacagatt ggcagtagtt    168660
     ccttgcgttc gtggatgttc atgttttcga tgatgtcgct gtcgacagac tggacaccgt    168720
     ccagggtcaa tgtcattggc agagcgaaga atgggacgtt gttgaccagt gggagcaaag    168780
     cgtcggcgtt cttagcgatg ggttggttgt tgaagtcttt caaggagatg tagtaagtgc    168840
     ctttgaactc cttttcgcca cctaggaaca gcttagcgaa cttgaccacg cactggaagc    168900
     cggcgtgggc catggacaaa gtagcggaac ccgcgccgtt cttggccttg acgacctcgt    168960
     caccaccgta ttggactctg tgtaccagtg ggccgagttt ctcagatggc acggccttgg    169020
     agtgagggtt ctgggagaac agtgggatga ttgtttcgcc cgagtggcca ccgatgactg    169080
     gcacgtaagg catcttttcg atcttgtcct cggagacttc tcttaggaaa gtggaggctc    169140
     tgaccaggtc caggttcgtg acaccgaaga ctctcttctc gatgcctgtg ttcttgtggt    169200
     tcaccttctg gctcattctg ttgaccataa ctgggaccaa ggagttaact gggttggaga    169260
     tcagcagcac gaccaccctg gtcaagtcac agttctcgag gatggagtcg gtcagctgtg    169320
     tgatgatctt ggcgttgatg ttgaacaggt cgtcacgggt catacctggc tttcttggca    169380
     caccggcagg gatcaccacg atgtcagcgc ctttcagaca cgagttgata ccgtcacctt    169440
     cctgtgggtt gtgcatggac acctcgacct gcgtgtcaat gtgcgacaag tctgtgccaa    169500
     caccgttgac agcgtccttg ttgacatcga aaagtgctag cttcaggttc ttgtctgcag    169560
     agccagcgag cacttgcaat tgcgtcttca ccagcagcga cagcgactgc ccgataccgc    169620
     ctgcggcacc tagaatagac actttcagat cagcttcgtt gtttccagta atatgaggca    169680
     ttgtatttgt gtttgtagtt gtgtttgtag ttgtgtttgt ttgtttgtta gttgtagttg    169740
     tagttgtagt tgtagttgtg agttattagt taatagttaa tagttgtaag gaaaagtctc    169800
     gagtcgagtc gctttatata caaagggagg aggggatgcg gatgaatgga acggagattg    169860
     cagagtcctc cattgaaccg gtaatagagt aggcaatacg cagtcaaggc agtacgaagc    169920
     acgcagccaa ggagaacacc ggtttattgg cgacatgtgg ggatcgggtg gtcggatggt    169980
     cggatggttc cggttaatta cccgtgtgcg ttgtattctg tggagatggg ggtactcgag    170040
     tgaggggtgt ctctcccctc ccctcctttc tctgctctgc ttctctactg cgctgcttct    170100
     ctactgctct gcttcgcccc tctccggaac tctccacact ctccgttcag ccgagctttt    170160
     tcatttcgac cggcgagtcc cgggtgggca gtaccgtgtt agtatagagt gatgtgggct    170220
     aacacagggt ataccgaggt ataccgaggt gtaccctgtg tatatgcttt ggctggtgtg    170280
     tgtcgcgcaa gagtattgat gatgcagtgt tataatccct gaacctttga cagctctggc    170340
     acctctctgt gtatgtgtgt acacccccct ctagaggggg agtaactcga aattattatt    170400
     ctaacagatg atcatatgat cataccgtgc ccacgaatat gagcgtctta aacgacaatg    170460
     acgccaggca ttataccgct cataccggtg cagaagatag cctataaaag ataagataag    170520
     atataggccg gtaaccgact atcatcttac aggtgaaaac caattgagtt agggcttctt    170580
     agaaccagtt tatccaaaga ctaaaggtat aaaaggagcc ctcatctcta ttcagttaaa    170640
     ccgaagttct agtatcttat tccgtataat aacaagagaa caaccagtat agtctgtata    170700
     atacccttag agtttctgaa tcgctctatc atcatgtctt ccaataactg gacacaagaa    170760
     ctcacaactc atcaagatcg tcttagacta tcgcaacaca atgcccacgt tggatcacct    170820
     acaacgcgat tctgagcaca tataacctcc tcctccaatg taaaaagact catattccag    170880
     ggacaaatgt atattagctc attgtattag ctttgtatta gctcatgatt gacatgtata    170940
     ttggcacaat ttatattagc tcataaaaaa tgagctaata taacagaagc acccgaatcc    171000
     tggtgctgca aaaatccttg gtatataaac gtatggctgc agagagtaat actcttgtca    171060
     gatgcactat gtaataacac ttcatatagc caacaagaac tgcttttaag atacaaagat    171120
     gaaattcttg ctgttcgctg ctgtcgcaca ggcctacttg caactggact tcgaacgtca    171180
     gactgcccag gacgtcgcct tggccaagag acacacctcc aacggtgtcg caaacgccat    171240
     ggacgtcccc atcgagcaga tcggtgacct gatgtacacc gtgcagctgc acgtcggtac    171300
     tccgccacag aacgtcactg tccagctgga caccgggtcc tccgacctgt ggttccctgt    171360
     cgctagcaac ccgtactgta agcgcaacgc caagcttgcg ccaaagaagg tcaaggcgct    171420
     gcccgccact ggtttcgcta ctgagaacga ccaagtcgct aagaagctga gaactttcga    171480
     ctgtgatgcc ttcggcctgt tcaacagctc catgtcctct tctttcaaga gcaacgactc    171540
     ctctgagttc ttcgtcaagt acgaagacgg tacttacgct tccggtatgt ggggcacaga    171600
     caccttcaag ctgaaccacc acaacgtctc taatatcaca tttgcgctgg ccaacatcgc    171660
     taacgccagc atgggtgtcc tcggtgtcgg tttcccagca gaggagacga ccgacgaccc    171720
     atccccaggc tctcttatcg acaaggaaca ctaccagtac gacaacttcc ctatcgcgct    171780
     aaagcgtacc aggaccatca agaaggtctc ttactccatt ttcctgaacg acactaactc    171840
     caagaaaggt gtcatcctgt tcggtggtgt cgaccacagt aaataccaag gcaccttgtg    171900
     gaccgttcct atggtcaaca acctcttgac tttgaatcag accaccactt caagacctga    171960
     aatcaccttg aatggtctag ggttccgtga cgacaagaag aacgtcacct tgtggggtga    172020
     aaagatccct gtcttgctag acaccggtac cactttggcc tacgcaccaa agcaagtcgt    172080
     cgatgtcatc gctaagagag tcaacggtac cattgactct aagacaggtg gtatcaagct    172140
     gaagaaatgc ccaaacgcca aggacaacag cgagcttatc ttcaactttg ctggtgcaga    172200
     gatccctgtt tccttgttga acatggtcga gaagcgtaag ggtaagtgct acttggaaat    172260
     tcgttaccat gaagagctaa gtaagaccgg tatgttgctt ggtgacatct tcatgagaca    172320
     cgtatactct gtcttcaaca tggaagatat ggaagtttca tttgctgtag ccaacggtaa    172380
     tgactccgct ccattgcaaa tcgaagctat cataagtgac gtccctagcg ctgtcaaggc    172440
     tccacaatac tacaatacct tcgcttcttc taacttgcca agcactgtca ccaacgacat    172500
     cttcgcaagc accgccactg cttccatgga accaccttct tctgttctag agagcttgaa    172560
     gagcaagtct tcttccactt caagtattga cactagtgtc ccatctgatg acaagaagat    172620
     tatcgatgat gaccactctg gccatgacca cgctaagaga gatgcttaca gtaacactgc    172680
     tggcatttta caaatcagca ccactttagt gttagttgca atgactttgt tattgtaaac    172740
     tttctaataa aaaactaata catttcatat attatgagtc catttggtat tttaattttg    172800
     tacatacttt aatttttgta taaacctaca tacattattc ttttaaacca atattcgatc    172860
     ttcttgtaca tgtttcatct cagtggtttt aatgtagttc tcttacggag agcaaccgaa    172920
     ttgttggaca tggacatggt tgcttccggt gtaaatacat ctccagtaac cgcagtcgca    172980
     gttggatata ccgaatatgt attataatac tggggagctt tcactgcacc aggtacagtg    173040
     ctaacaattt cttggatatc aggagtgctg tagttaaagt ttgcattagc gatcgaaatt    173100
     tcttcgtctt ccaaattgta aaccacataa acatgcctta ggaaaatatc acccaatgct    173160
     gcaaattcaa tgtcatctct ggcttgcatc tgcaaatagc atttaccttt aatttttctt    173220
     gtcaagtcac gaatatcaat actaatttca gctccgccaa agttaaagac cacggtccgc    173280
     ttttctttct tgttaggaca cttgtctaac ttaatgaagc cgttgtcatc atcaatcgta    173340
     ccatttacct ttgatgcaac aagtgctgca acctttgctg gtaacacaga agttgtaact    173400
     ccagtgtcta acaatgtcgc taatttctgg tcatataagg tgtagttctt gtctgctgtc    173460
     tgcaatccaa tgccattaag tgttatttca aattgaaatg gctttgatac ttgtttgtac    173520
     aaggaattta ccaaaggtaa ggtatacaat gttccgatat atttgctctg atcaacagca    173580
     ccaaataaaa tagacccata tttggagcgt gtatcattta gatacacaga atatgcaatc    173640
     ttcttaacaa taccttgctc cttaagtagc ataggaaagt tagaatattc gtaagagtta    173700
     ggaccaattc tagagccatt ggcagcaagt tgatttgttg tctctctagc tggcaagcta    173760
     attccaaaga ctggagtagt cgagtttgag aaagcagcca agccaaacgt gacgttatca    173820
     accttcacgc cattgaaaga taaagtatca actccccatg gaccacttgc aaaagtagtg    173880
     tcagcatagc ttagtgtaaa attggtacca ttatttttat aagtcgaaga cttacttgtg    173940
     ttgaaaaacc caaacgcctt acagtcgata tctcttaaag atttgggtat ttgattagga    174000
     gaagttggat aatcggcatc atttagtggt tctatttgtg actttttagg actgtgtttt    174060
     ctattgtttt tacagtatgg gttagcttcg cttgtgaacc acaaatccga agagcctgtg    174120
     tccaactgta cagtaatatt ttgcggtggt gttccaactg acaactgaac tgcatacaag    174180
     agaccaccgt tttcgagctc caattgcaaa cctttgtcgt ctctcttgtt caatgctaga    174240
     ttctgctctg gaactttctc aaaatcaagc ttcaacagtg cctgggcaca cgatatcaaa    174300
     ttaagtagca gtgtatattt catagcgaga tgatttattg atttcaagaa cttttgtcaa    174360
     aagtagctga aatattaact tattgactta ccataaagta ataattgaaa acaaggtgat    174420
     gtagttgacc tttatatatg tatcgcttga aatttgatat ccattccgga atgtgttgtt    174480
     tataatgtcc aattgtaatt tctttaatgc gacttggtaa gagatagaag agaaagtgga    174540
     ttggtgatgc atcaaaaata tgtatacgat gcaattacga ccagcctaaa atttcaattc    174600
     cctcatacta tgaatccact gctagtttta ctgcaactcc tataaaatct caatagactt    174660
     gattagtaaa tatttaccca ataaaaaatg gctaatggac atatgagatg tgtaacatca    174720
     atgattagaa aggggcgatg gctgcataaa tcgattccac taagaatgtg agcgaggtga    174780
     tttaaaaagc actttagatt aaactatagc agataaatgt gttcttgaaa agctatgcaa    174840
     gcacaatgta agggtttaat aaaaaacgct caatgcacat atgctgcatt tatctatata    174900
     tctttcctaa ggaacacaca atgttccaga atatattggc agttattttt accggaatgg    174960
     gtgaacccac tataattctc cccccttttc ttttatctta tcattctcat tgaaaatagg    175020
     catgctattt cccaaagacg caatgatgat caactatagt catcgaaaat ctactaatgt    175080
     ctcacaagct tatgcaagaa aaaatgcgta gaaaattaat agtgtaaatc ataatggccc    175140
     tctgcaatga tatactgaga ataatgattt acgaaaaatt tattctgcgc ataaattaaa    175200
     tcttagaatg ataaaactat atattactac aattcattgg tttgagtata aaaatgtttt    175260
     ttcaatatct cagagtgtta ttccgtaggg ttttgtgaga aactagtctt tttctttgac    175320
     aactttgtgt ttttttttga gtttaatatt agaaaatcta ggcgtgcttc aacatcaatt    175380
     caaattcctt tgaaaacatg atgttgtaca aaagaacgga agtgtgaata gtataacgct    175440
     ggtctataaa tatttgtata tctataatac tttacaaaat tcatctcgta actgtcgagt    175500
     tgaaacacta acaaacatgc ttttcaacaa cgccgtcaca cgcaatatta aaaagacaac    175560
     gctcatattt gctaacaaac ttttaaacag tactaataac attttattta aaatacagaa    175620
     agtacaaggt attcattaac gtaagtattg gttacaaaaa caaggcagta actgctgata    175680
     aagcaatcaa aaatattggc agacttgttg acaatgtagt agctctgttt tcgtaatgcc    175740
     tcctcaaaag catattttct atgtctagaa gatcttgggt gaaattggtc ttgttattgg    175800
     tgttatttgg ctttggaaca aactctgttg cctgaggggc aaatatgtca ccagtcactg    175860
     atatttcggt tgggaaatca acataggagc tatagtactg aggcgctttc accgcacttg    175920
     gaacagtact agatatctct tcgatatcct cttttgttga attgaaattg gcctgcgcaa    175980
     tagagatttc tttgtcgtcc aaatcgaaga cagtgtagac gtgtctcatg aaggagtcac    176040
     caagaaggaa aaaactgctc tcctgagaaa cacatggcaa gtaacatttg cccttatgtt    176100
     tctcaacaaa atcaaccatt tttattttga tttgagctcc actgaaattg aagacgatag    176160
     tgtcattcga ttttttactt ggacatttag ccaacttgat caaacttgtt ttcttatcaa    176220
     taacaccatt tgtttgatta gcaagatatt gcgcaacgct gcttggcata tatgtatagg    176280
     ttgtaccagt atccaggagt gcaggcagta attgatcaaa gagagtaata tttgatgttg    176340
     ctctctggag accaagacca cttaatgtaa cctccagttc atatgggttt tcaactagat    176400
     gtccaaacct attcacaatt ggtaatgtat ataaagggcc tgagtatttg ctatggtcaa    176460
     cagccccgaa taaaatcgaa ccttgtttag actttgtaga gtttagataa atcgaatacg    176520
     caaccttatc gattttacct tgttgtttta gttgtaatgg gaagttcgaa tattgagtgt    176580
     tcgtagtacc attagtatct tcagagaaca tagcgtacgt actctcatct ccaggtaaac    176640
     cgatgccaaa cactggatta gtagaatttg agaaactagc caaaccgaat gtgacatttt    176700
     ctacctttac accatttaag gaaatggtgt cagttcccca tgggccacta gcaaatgtct    176760
     cgtcaccgta gctcaatgag aagttggtgt cgttcctgct gtatgttgaa gacccgctag    176820
     cgttgaagaa cccatactta ttacaattaa tgtttctcaa agccttggga acttggttgg    176880
     gcgaagtggg gaatccatca tcacttgtga ttggcatgag atcttgtttt tttggagcga    176940
     attttttatt gttcttacag tatgggttac ttgcgctgac aaaccacaaa tcagaagagc    177000
     cagtatccag ttggacagtc aaattttgag gtggtgtgcc tactgcgatt tgaactgtat    177060
     acaactcgcc tccattcaaa aggggagcaa taaagctatc attatcagct cttttcgtta    177120
     gttcatcgct gatcttggga gtcttctcaa agtctagctt tagataagct tgtgtaaaag    177180
     ccaaaagtga aactaataca atggatctca tgttgagtaa ctgctattat gtattgcttt    177240
     tacttgttac ctagaaatat ttacaaggga tgaggacatg caaatatcga gtaattggaa    177300
     gaacagctgc tgctttttta tagttctgat tcagttaaga gaaagtaaaa cttagcaatt    177360
     ttagctcctc cataattcat ataacagaca agccacgatg ccgaaaatgt ctaagataac    177420
     tattgtgtac cacagatttg ctaatttcaa actatagcaa cctcgagaaa ctcaatagag    177480
     aaccctcatc gctgatgccc attaaaaacg tagttgataa cgaggacaat atgcaagatt    177540
     tgaactgcag ctacgtcatc acactttcat aagtttaagt cgaagggtcc aatatgtgaa    177600
     aattttgtaa ttctatgatg caccctctag ggtgatggtg aaccaggtaa gatggtgatc    177660
     tatcgccgca cctaaggcca ctcgacgtta aaattataag gtaatttgaa ctgtgttcac    177720
     ccgcactaac aagagaaact catttggcca tattcccact aagccctctt attagataat    177780
     cggtgatcca ctgaaaacta tgcgtgcctg tagctcgatg cccatgtctc attgttatcg    177840
     gagaaccgag aattttttga cataaaaaag ttttctttct ttattgccca taaaatcgtc    177900
     agacactctc gagatgccta tgtattacca atattcgatg ttaaattctt tgtttacttc    177960
     tctatctagt cactattcga tatgcaatta tatttgttct aacttgacat aaaagtacgt    178020
     atttgctcca tattggattt gcatctggcc tttgcaaagc ccagttttca aaagggcact    178080
     aattattaaa cttgaagcgt aatggaactg ctttctgagg tttttggatt acttattgtg    178140
     ccttctactc tataaaacag caagtattaa tgttactgaa aagcctctac tgtacgatat    178200
     tcatttgcac agtagttgta agttattgca cttggtcaca catgtaattg cacacaaaac    178260
     ctatctagta ttgatctcaa cttcagtaca caagaattaa tgatgagtga ttgctgaagg    178320
     aatattgtta atagttctct tacaaacgct aactgttaca tattgtatac tgtatttcat    178380
     tcggtaagaa caacctctac aaaaggggtc ttacataaaa atggtagcta atatggcagc    178440
     aacgccaatc aaaataattg aattcaatct caaaggtgtg gcagcattat catagcttct    178500
     tctctccaaa ctgaccgcag aactgttgga cgagttgctt gagttagaaa cattcgctgg    178560
     aggtgccatg tatgctgtag cctctgggcc aaaaatgtct ccagtgacag aggaaattga    178620
     tgctatagct gaaaaggtgt tgtagtattg tggtgctttt acagcacttg ggacagtact    178680
     ttttatttct tcaatctgtg caggcaaaga ggaattgaag tttgcttgag caatagatac    178740
     ctcgttagct tccagatcga agacagtgta cacgctcctc ataaaattgt caccaagaat    178800
     aacaagatcg gactctgcac cacttgggat gatttcaagg tagcacttgc ccttaacctt    178860
     cgttgtgaac tccttaatgt caacatatat taaggcacct ccaaggttga acaacaattt    178920
     tgcattgtct ttcttgctgg gacactttgc cagcctgata ccattaccat ttggatccac    178980
     tgtagcattc atctgttttg ctaccacttc aacaatctca tctggaaatt cggatatggt    179040
     cgtacccgaa tcgattaatg cagctacctt ctggtcataa agagtcatat tactactcat    179100
     actttggtaa ccaataccat ttaaggtaat atcgagctcg taaggcttat tgaccacatc    179160
     atattccgag ttcaccaatg gcagcgtata caatgttcca gtgtacttgc tgtgatcgac    179220
     agccccaaaa agaatagaac cgtacttgga ctttgtatca tttaagtaaa tggaataagt    179280
     aactttatcg atgattcctt gctctttcag ttgtaaaggc agatttgaat actggtaatt    179340
     agtagcattc gtagttccgt tagaatttat agaatatgta ctctcctcag aaggtaagct    179400
     gactcccagt acaccactgc tagaattaga tatttctgca acagcaaaat taacaccaga    179460
     gatattcaat ccacccaaac taaccacatc agtaccccat gtacctctaa caaaggacag    179520
     gtcctcataa tataagaaga tatctgtgtc attgtttttg aaggttgatg agctactcat    179580
     attgaagaaa ccgtacttct tacagtccaa atttcttgcc ttcttcccaa tttggtcagg    179640
     gtttgttgga aagccagagt tatcaacagg ttgtaaatcc ttactctttg gtgctttctt    179700
     cttgttggtc ttacagtaag gattatcagc accactgaac cacaagtcag cagagccggt    179760
     atcaagttgt acagatacca tctgtggagg agtaccgaca gctagttgaa cgatgtattg    179820
     atcaacatca tttctcaatg gcactggact caaatcgtca gctcttttct caagtacact    179880
     ggcactagga actctggtaa agtccaactt caaataggcc tgagcaccag ctagcaatgt    179940
     aaagtataat aattctttca tattatcgtg ttggtgttga tgttcatcaa tacatgaaat    180000
     ataattcgat taaaagactc cagcaagatg ttacaacaaa aacagtacaa ttgcggcccc    180060
     tttttatatg tacacgaaac tgaccgggaa ttgatctata aaggctgagc catgaacccc    180120
     caaaagcttt tattaattca aacagtgaat aaacaatgag acttattttt ttttgaaccc    180180
     tgatagtgca gaagttagtt tattatctca ctgcattgaa ctgcgaaacc gaaataggcc    180240
     tttatgttga ataaaagtcg aggttcgaga taagactaaa accccagcta cgaagaagag    180300
     tgctggaaaa ggaaacagca atactcctat ctttgttttt tatcagttgc atcagaagat    180360
     cagatacagc atgcatcaca gtgcacctgt aaaaagccat tgaggaatac tttcaaacta    180420
     catggccacc atctttagtt cttagtaaat gttagagcac cacttcatga caaagaaggg    180480
     ctgttaatac caatgtactg ccttttaaac accagtcttt catagtggct catttcacaa    180540
     cgcaatacaa aattgagagt ggtctcgtaa tgtttgctga gtgctatatc cccctcaacc    180600
     ccacaattgt ttatgtgtac tacataacct actgaagaat tgaagtcata gccctgcttc    180660
     gaattgtatg tagccaatac catcagtcat aaattgaagt ttgtactaat atcgaaagtt    180720
     aatttaattc tatatgcacg cgattcacca gtgacgtaat ttttgtgaaa gatcacgact    180780
     ggtgtaaatc aagttcaggc catttttatt agcagcactt gctgtacaag cacaattaga    180840
     aaataccacc ttactcaagc cacattcacg attgagtaaa ccatgacatt cttgataatc    180900
     gggaatagta tgcctaactc ctagcctata catttaagat gaaactctag ataaagtcaa    180960
     aggcaatgac attttttgag atattttaag caatgaaatt ggcagttgca caaattttat    181020
     tgatttgtct taatactgca gatagtagtg ataataccgt acacaagaaa ctgtaatggt    181080
     gtctagctta tcagacttat gtaaaaacaa aaaattgcat tcagagttgt atgtaccaat    181140
     atatgataat acttcataaa gctagtgcaa agagagatgc tagaaagaac gcaattagtg    181200
     atgaattttt caaggatgcc tggtttgaat aaactctttt ttgaaggtca aaacgcgatg    181260
     agtttagagt tcgatttgat gagccatttg tcttattgat cggtgccatg gacattgtag    181320
     cttctggcgc gaatatgtct ccagtaacag cagtagcagt agcatgttct gaatatgtat    181380
     tgtagtactg tggcgctctg attgcgcttg gtactgtact ttttattggt tcaatgttct    181440
     ccggtaacga tgagttaaag ttggcaggag caatagatat ctctttgtcc tcgagattat    181500
     agactaggta cacgcttctt aagaagttat caccgaaaat tatggcatca ttacttgtat    181560
     cctcatgaac tgcaaactgc aagtagcatt tgcccttatg tttattcatc atttggttta    181620
     tatcgacagc aacctctgcg ccgctaaagt taaagatcag cttcttattt tcctttttgc    181680
     ttggacattt tggtagtcta atgcattggt ctttgccagc aatggtacca ttaacctgtg    181740
     ctgcaattaa atccccaata tgttttgaca caaccgttaa agtagtacca gaatcaagta    181800
     aagctgcaga ttttttgtca tacaaagtaa tatttgcatc attaccctgt aatcccaacc    181860
     cattcattgt gatctctaat tggaaagggt ctgtgaagtt ctggaacaaa gaattggcca    181920
     gtgggagcgt atatagtgga ccgttataac ggttatggtc cacagctcca aataaaacag    181980
     aaccaaactt agatttgctg ctgttcaagt ataaagaata tgcaatctta tcaattactc    182040
     cgttctgctt taaggtaatt gggaaattag catattgatg tgaatcgctg atgtttttcc    182100
     tgctaccagc ataaggacca tcgtatgttg attcgacatc tggtaatcct acaccaagaa    182160
     caccattcga agagttggca aagctcccca aggcaaagtt cacattgcta atatttaact    182220
     cattgaaact gactacatcg gacccccaat taccagtagc aaaggacata tcagcatagg    182280
     aaagtaggaa ttccgaatca ttacgcttaa acgtggatga ttcactggag ttaaacacgc    182340
     catatttctt acaattcaaa gtcctcgatg attttggaac ctggttagat gctgatggat    182400
     atcctgaatc gtctaatggc tgaacatcct tgccctttgg tgcatacttc ttattctcct    182460
     tgcagaatgg attgtcagca cttggaaacc ataggtcaga ggatccggta tctaattgca    182520
     cagtgatatt ttgaggtggc gttccaaccg ccagttgcac caaatacaaa tcgccatcgt    182580
     tctttaaggg aacatttaca tattcgtcat ccctctttac caaatcactt gaggctttag    182640
     gtgatttctc gaaatccaac ttcaaatacg cctgagcaaa tgctagcaac gaggttacta    182700
     caattgcttt catgttgatt agcgaaccta cacttttatt ctatacttga tttactcact    182760
     aagatatatt ctcaaaaagt accacaacaa taacaattca tagataatct tatggattgc    182820
     ttggaacctg atttaaggtg cttctatata tatgggatac aaaaggacgt gctaaaacct    182880
     caagttgtaa tctagactct ttctccatct tttaaattat agggatttac taaggtgact    182940
     gaagtaaagt acgggcatca tcccttactt gatgattgat gatcacgact cattctgtgc    183000
     ttaaatcata cgcaaatgat ataatgatgt gactgtaatt aacaagccca ctagcaatga    183060
     cccaaatata aattatagtc aaccaatgat aagaagtaat tgcaaaatta tagataagat    183120
     aagaacactg ttttagtact aagtaatatg atcgttaaat tattgaatta aattagagtt    183180
     tataaaaacg agtaacttaa ataaagctat ccatagacat taacaccacc tcgtatctat    183240
     aagaacatgg cggtgatggc agctgcgatc ataatgagta tggcagagtt ggcttgcaat    183300
     gaagaactgc tgtttgggta tgttcttttc ttcatttgta ctctggagta gttagaagat    183360
     gagttgaaag tagagtttaa tgaagagttt ctagaagcat tagctggagc agccatggac    183420
     atagtggcct ctggtgcaaa gatgttacca gtgactgcag tggcagttgg gtcagctgag    183480
     aatgtgttgt agtattgtgg agccagcaca gcgctaggga cagtatcctt gatttcttca    183540
     atatctggtt tcagagatga attgtagtta gcttgagcca atgaaagttc cttgtcatcc    183600
     aagttgaaga cagtgtagac attgttcatg aagttgtcac caagaagagc gaagttaata    183660
     ccatcaaggg cagagaattg taggtaacac ttacccttgt gcttttccat gaaatcagtc    183720
     acatttacgg aaaactcagc accactaaag ttgaagatca acttttggtt gtccttcttg    183780
     cttggacatt ttggaagttt gatacagtta cccttaccat cgactgtacc attgacttgt    183840
     tgggccacaa gatcagcaac atcccttggc aacaaagaaa tagtactacc agagtcaagc    183900
     aaagttggca atttttgatc atacaaagtg atgttgtcag tcttaccaac caaacctaca    183960
     ccattcatgg tgatctcaaa ttggaaaggg tcactgcctt ccttgtattt ggagttaacc    184020
     aatgggaagg tgtacaaagg accttggtac ttgctgtggt caacagcacc gaaaagaatg    184080
     gaaccatact tagagccggt ctcattcaag taaatagagt aagcaatctt ctcaatcaaa    184140
     ccttcctcct ttaatctaat tgggaagttg gagtactggt agttgcttgg accagtgaca    184200
     ttagaagaat agttgaaagt agattcttct cctggcaaac caacacctag gataccggta    184260
     ctggtgttgg tcattggact aacaccaatg ctcaaattgc tcaagttcag gttaccgaca    184320
     ctgacagagt cggtacccca ggtacctcta acgaaaccat tgtcaccata ggtgatgaac    184380
     aagtcggtac cgttagaatt gaatgtagaa gattcgttac ggttgtagaa gccgtacttc    184440
     ttacagtcta atgttctgtc agactttgga acttggtttg gagtccttgg gtaatcgtca    184500
     cctgggcttt ccaagtcctt cttctttgga gccttgttct tgttgttctt acagtatggg    184560
     ttagattcct caatgacgaa caagtcagaa gaaccggtgt cgatttgtag caagaccttc    184620
     tgaggaggag taccaacggc aacttcgaca atgtattggt ccttgtcgaa ggttaattga    184680
     gcggcttcag ggtcgacgac atctctcttg gccaaatcac tgcctggggt cttggtgaag    184740
     tccaacttca cataagcttg agcgtaggct agcaacgata gcagaacaag tggtttcacc    184800
     attttcaaat agttttaatc ttgtagttat aataatttgc gcaagatcag atgaaaatcg    184860
     ctgtaatctg ttctacttct agaaataata accaagaaag gagctgatat agtgttatcc    184920
     aactaccact aactgcaagt catctccttt tatactggaa gaaccgaatg taggctttaa    184980
     tctcgaccca agattagatg aagttattag cgttgagaat gaaggggggc ttgatttcat    185040
     ttagaatatt gtatgcgtat gtgtgtccag gacacgagag caccattcta ggatgccctc    185100
     ttcgcatgca aatctcttca tgggcatcga gaaagggagg ttaatcgatg ctaccatttg    185160
     gagtgcgatg gatccaagct atgacttgat ctggaacatt tattaaaggg ggaagggtga    185220
     ccaatagtgt atggctccgt ggattaaaaa gcaaagttgc ttaagtgttg gctaagagaa    185280
     gtcattaata aaaatggacc catgagttag tactcaatcc ggtaaaagag ggaggaaggg    185340
     atagaagaac ggatactatc aagttcaacc cggggggggg aggggagtca aagagggtca    185400
     ataagaagaa aactgtcacc ataaagaaaa gaaagtaggc ttttgcacag tagagattga    185460
     cttctgaggg atttaccttc gaacagtcat tgataacgtt tgaaagctaa tggatgagag    185520
     ggttaatcca accgtttcgt gttttcagta gaattgcttt tggtggaacg agctttcaat    185580
     gaacgacgca gtcctatttg ctaatggttc ttgtaattaa gtcacccagc tgacgataaa    185640
     ttacacagcg aagcacaaga gttgctgagt ggagacatta ttcaaactta ctttaccaaa    185700
     tgttgttgat gtcatgaaat gtaatgtgga caaatccaac gccataagag gcagccaggg    185760
     cacgttcacg cgttgcaata ttgttacttt aagttttgta tatcttattc tatgaaatgg    185820
     gagcatgatt gaaagtagta cagaagaaca gggttataaa aatagaatat tacataaata    185880
     atgttgtaat tgctgctagt actaggacga ttgacagtgt tgaagatctt gcagaattgt    185940
     tttcgtagtt caaggctctt ctcgataagt tgctggagtt gctttggttc tttggagcca    186000
     tcgaagctgt agcagtggca tcgaagatgt taccaaccac ctgagtagcg ttatcgtacg    186060
     ccgagaatgt gttgtagtat tgaggtgctt tgattgcgct tggtacagta ctcttgatct    186120
     cttctacatc tgctggcagc gagctgttga agttagctct tgcgatagat aactcctggg    186180
     cctctagatc aaacacagtg tagacttgtc tcaagaaagt atcacccagc agtagacctg    186240
     gtccgttgtt tggtggagcg accattaagt ccaagtaaca cttgccactt ttcttctgat    186300
     agaattgttt tagaggaatg gcaatctcta caccgttgaa gttgaataca acctctctgg    186360
     tgtccttctt gcttggacat tttggcagtc tgatggcttc cgtcttatta tcaatagtac    186420
     cgttgacctg tgaggcaatc acctgggcca ttgtgtaagg aacataggag taactagtac    186480
     cagagtcgaa gagtgctggc agtttctgag tgtataaggt tgtgttcgtg ttggtagtgt    186540
     tatctctgat tcccaaacca ttcaatgtaa cttccaaatc agcaatgact ccgggcgatt    186600
     tctggtactt gctgttcacc aatggtatgg tgtatagttg ccctacatac ttgctgtgat    186660
     caacaccacc aaacaggatt tgaccatatt tggacttagt gtcgttcaag tatagagaat    186720
     aagtgacttt actgatggca cctttctgct tcaagatctg tgggaaatta gggtactgga    186780
     acctaggaga gtcatcttgc ttaatgtctg tgtcataaga ggcctccaaa ggtgttaggc    186840
     ccacaccaag cactgagttg gatgagtttg agaagtatgc tagaccgaag ttcagtccag    186900
     agatgttcaa accattgagg tacaagttat ccgtggccca cacaccttca gcgtaggatg    186960
     agtccaagta gctgatgaaa aactctgtct tatttgagtt gaaagtagtc gaggcacttg    187020
     agttgaacaa cccgaactca gcacagtcta ggtttctcaa cgatttggga acctgtgcag    187080
     gtgacgtagg tctagtacct gcatctaagg aggcaatgct ctttggtgct tgcttcttgt    187140
     tcgccttaca gtaagggtta gtagagtctg ggaaccacaa atcagacgaa cccgtgtcca    187200
     actgcgcagt gatattttga ggcggagtac cgactgagag ctgtatgttg tatagcatag    187260
     ccttttggct gttgataagc ttgacatcct gcacgtcacg tttgactaga tcatctccat    187320
     gcgacttctc gaagtcaagc gcaacatagg cctgggcaac cgatagaaaa ggaaccaaga    187380
     ataacatttt gactgtgggc cgcttatctg atcttctaaa ctaccctcgt ccccccacat    187440
     gttcagcccc gattaaatca catcacatac acatgctgta tatatattac ttccccgctg    187500
     accaaagcct actcaccatg ccaatcccta tgactactat cactttctga gcaaatgacc    187560
     aatcacaaac ggtaagtcat ttgatttacg gtattctgca catgcacaag aatgtaggac    187620
     aaatttgata aaaatgtaca taaactctca gaaaaacatg cacaactgtt gaaaagggag    187680
     gaaaaaagag atctgaaatg acgtcatttg tacatatatt atctatgaaa ggacaaatta    187740
     gcggtgtttc tacgtatgtt tctttggatt ctgtaataaa ttatgtgatg ggagttgtga    187800
     tggtcgagga aaccgtactg ctcctccatt aatagtagtt ctgttattga agatattcgc    187860
     agcaggctgc aaccaataac ggatattagc catgttgagc caaggtaaac gaggcttgcc    187920
     tcttttctat tctctgagat gtcagtttgg aggttaggca ggatcttagg aaggcagtga    187980
     agctcagaga gcatgagggt tgaagaaaag aaaaggtttg tacccaggat ttgcagcgag    188040
     cagcccctcc tcatcgcaac gaaatgacaa ataatttcgt tatgctctcc aacaaccctt    188100
     atgggtgact ttaattagtg atctattgat tcatggatca aataaatctt gggtcaacag    188160
     ttaccaacaa aaaaattcaa atatataaga ggttatattt aaacttgatc tggtttgtgt    188220
     attgcttctg ttcttgaggc ctgaaagagg acacacaccg attcacggat atagacatga    188280
     gaattgacag agcattgacc actgctgctg ctgcaggtta cttgagattg ccattcacta    188340
     agatcacgga taactctctg gctaagaggg ctgacgatga ctacttgaat gtgcaacttg    188400
     acaacgaaca aatcttctac ggtgttgaag tcagcattgg tagtgacaag cagaacatga    188460
     ctctgcttgt ggacactggt tcttctgact tctgggtcct tggtgctcag aacccttact    188520
     gtaagtcaaa cagaggtaag aagccaaaga agaaagatca gccatccagt gttgaccccg    188580
     gcaggaacgg ttacccaact aaggcggagg ctatcccata cgctgagcgt accttcgatt    188640
     gtagtgactt caaaacattt aactcttctt catctaatac attcaagtct aacgatactg    188700
     acttcttcat cacttatggt gacggttcat atgttgaagg tacctggggt actgaccagg    188760
     tggcattggc aggacagact ttggagaatg tcacttttgc tgtcgcagag ttgactaaca    188820
     acagttacgg tctgttgggt atcggtctac ctgaattaga atccagcatc actatcgata    188880
     ctgctcaatt gacaaacact tcaagtgtta agaagaaccc atacatgaat ttcccagaat    188940
     ctctaaaact aaacaagttg attaacaaag tagtatattc tatctacttg aacagaacca    189000
     atgacaagtt tggctcgatc ctattcggtg ccgttgacca caaccgttac gatggtaact    189060
     taactaccgt tccattggtc ttcagcaaca gagacttcgg tacaccaaga cctaacgaat    189120
     tgatggtcac tttgaatgga atgtcctttg aagccaccga tggtaatgtg actcagattt    189180
     tgaacgcaac ttcgaagttc ccagctttgc tggatactgg tagcactgac actcacttgc    189240
     cagttgatgt atacaacgcc ttggctgaaa gcactaatgg tacttacgat caaactcaga    189300
     acaagatccg tattccaaag tgtctatcca agaaggacaa aactatccta aacttctctc    189360
     tgggaggtgt taacattggt gtcccataca aggaaatggt caagaagatt aagggtaagt    189420
     gctacataaa tgttgctcca actggctcag actttgccat cttgggtgat gatgtcatta    189480
     gatatgctta catggtcttt gatttggaag atcgtgaaat ttctttggct caagcatctt    189540
     tcaatgacac tttgccagaa gacatcgaag ttgtcgtcag caccatccca ggtgccacta    189600
     gagcctcagc ttattctgaa acatactccc caacttttgc tgtcccaagc gcctcttcaa    189660
     gcggtaacac ctcctcaaac ggcagcacaa acttaaccag gagatttgaa aggagggaca    189720
     ttccattgga aaacaaaggt gtcccaactt ctctaaaggg ctctgtcgca gctatcctgt    189780
     tgctggtctt gtggattgca tgaatttctc atgtggtgtt tccaatacca tgaactctgc    189840
     ttataatttt ttttgttcat tcaacatgat ctttacgccc atcagctaga catttatgtc    189900
     cctttctgcg tattgacgtt taattttgct cgtttctcta attgctactt gagtatttag    189960
     tttaaagact gcactccctg ggtagcatat tcagtactac tcaatcaaaa tgataacctt    190020
     agcattttat ttaatacaag cagtttccta gttatgaata ttttttatag tttttgccat    190080
     ctaatgttac accaatatta tttaaaacat aaattatttt atctcactcg agtataaggc    190140
     cacaataatt tgactagaca tttattcaga tagtcgtagt tattttagta gacctcaaaa    190200
     tcaatggtct caatcgtaat ggccaataca cagatagaaa aggctatact tcaaggaaat    190260
     aactgccagt ttattcataa caacagtatc acatgacata agtgccaaaa aaattgcaaa    190320
     aaaatcgatg agctcatcgc atagagaatg acggaagtat attaacaatt gtcatagcta    190380
     ttactttata tctgtctgat ctggttattg ataacgttgt aaaggactat aataaattgg    190440
     aaagaatcat agaagtgtgt caagatggct accgataata caattttgcg gtgcgagtac    190500
     ataatcccac aaaagaaaag aagatgtggc atgtcccgag cagccaatac taactactgt    190560
     gttgagcatt ctcaaggtaa tgctgaagtg aaggacgata aagagagagt tagggtaccc    190620
     tgtcctctgg atccgagtca cactgtttgg aagcataatt taaaaaaaca tgtaaggata    190680
     tgtaacaagg cgaagatcac acaggccact gctgctcagc catattttat taaagatttg    190740
     aacagaggtc ctgctgaact ggtagaaaat gaattgaata atgctaactt aatcgaaagt    190800
     gtacaattgc tgctggaagc attaaatgag tatgaagagc cccaagaaca aatcaagaag    190860
     aatgagttta tggagagtaa taggcttata gaattgtcca atacaattaa gaaacatgcc    190920
     aaacagcaat cgtcattgat acagaacttg tttgatgttg aattaatacc ttctggtaag    190980
     attatggagt ttggttgcgg aagagcagaa ttttcaaggt acattaatca aacaataatc    191040
     aataatgatc cttaccaact acaagatgat ttgccaaaat atgtgttaat tgatagagga    191100
     tctaacagaa tgaaatttga taagaagttt caagatgatt tgatggcttt aagtaaaaac    191160
     cctgagaaag tcaagcaaag gattgcgatt gatagattaa aactcgatat taaagatctg    191220
     aaactatcta cggttataga agaacatgat ggctgtcttg ccatttccaa acatttgtgt    191280
     ggtgttgcaa ctgatttaac attgagatgt ctacaaaatt gcattgagga aaccaacgga    191340
     aagtttaaat tacaaggtat ttgtattgcc atgtgttgca gacatgtgtg taatgccaga    191400
     gattacataa accccgacta tatcaaatcg ttcttggaat ctaagcattc tcagatcaac    191460
     tacaaaacat tttttggtca cctgtctaaa atgtgttcct gggccacaag cggtcgaaga    191520
     ccaggcatga atgatgatga tattgtccag atagaagggg ataatcaaga acaattgtct    191580
     atctcactat tgcagagaga gaaaattggt ctatttgcta gatatttgat agataacggt    191640
     agattggaat gggtgaagca gaatttgatg aataacaaga tgaagaatgc caaaattatt    191700
     aagtatattg agccagacgt atctcgggag aataatgctt tacttgttta ctagtcacaa    191760
     taataattaa atcatgaatt atgcaaattg gatgatatat aaatgctaaa gatatgtaga    191820
     tcaactgtga atactaaact gggcggaagt tcttaaaata cctttctcta aagttatgtt    191880
     gtgatctttt gataccacca ttatcaacac catgatactc gggtccacgg ttaatgtaca    191940
     ctaatagtct tcttgaccat ttattaaagt cttgaacaag attatatttc aattccaagt    192000
     tttcatgcaa tgggataatg gtctctatgt tttcatcatt agcggtaggc atccagaatg    192060
     caagtcttcc tccaattggt aatctttcag cggagtattg tagtagatca tctaacaaag    192120
     aatcaagggc gtaaggcttc ttacttggta tgtaatcctt tcgcaggtat gctttaacac    192180
     catctatctc cacattttcc ttaccagcaa atctttctgg atctctagca cccaaaactt    192240
     taatactctc tctgatacca tatggtggat cgcaaactat tgtatctatc ttcaaacttt    192300
     tcctgaaagc attgtgagtg aagtccatag tgagaacatc taagaactta tcggcttcgt    192360
     tatatttctt gaagtttgct gatatatttt gagcggcccc atgacctctg atcattctac    192420
     cgtctatatc agagccaact acgagtgcac cgtagtgtcc ccctgcagta agaaatgatc    192480
     ctgttccagc aaaaggatca tacattatcg ttcctggttt aacttgagcg atattacaac    192540
     ttaccaaaga tagctcggct tcaaaactag ttgtgccttt atatggcctc tttttcaagt    192600
     catatttctc cattgcagct ctatcactgt aatgtatcaa tcttccaaat cttattttga    192660
     tcggaactgt agatgaaacg ttgtcagata taggtacata ttcttccagc accgtataga    192720
     cctgctgcgg cttcttcatg ttgatcttac ctttaaactc taggtaccca aaactctcaa    192780
     tctgagatac tctattagcc ttgctattac cacggtaaca ctcaaattcg aacttaaatg    192840
     tatcattttg gtaccgttgt ttcaactcat taaaatgatc gccattttgt atactattgt    192900
     gtaactcgtc gtaatcctct ccttcacccc aatactcata gatcccacga gctagaatac    192960
     acctctcgat tagtttccga gcctcatctt cgttggccaa ttccactatc agatagggac    193020
     tatcctcccg atgatggctc aaatcaaccg atataccatg taaatctgca acagattcga    193080
     gctcagccag cctgaaattt gtgtgactct gcactaggta caaaagatac ttcattgtca    193140
     attcgtgcct ggttgttaat gttgcagaaa acttactcaa ttcgccatca tgaatttgtt    193200
     aatatcgact ttattcgatg gttattatgg tagctcatcg catttttctg aaatttttca    193260
     caaatttttc tgaatttttt caaaacaagc gacggagggg ggaagagcac aatagcataa    193320
     ccttcaagct gttcttgtac tttgatgctg ctctgggtat gggtcattgg ctgctataac    193380
     ttctatatat ttgcttgaaa gtgttgtgga ctgactctgg agctaggaaa agtatcaacc    193440
     aggtggaaaa acgacgttac aatgagttca gacgaggaag attttaatga tatctatgat    193500
     accaaggatg agagcaaagt tgatgctaag gatgatgtga aagcggagga gaaggttcct    193560
     gaggctgcca caagtgcgct tgatcagctg gcggcattac aagccagttc tgctaaccct    193620
     gacagcaata aagacgatgc tgctaagatg ccatgggaga cattgcaaaa tactctcaac    193680
     caattacaga ctgtgactaa agaagagtca ccagataaga gtaaagagga aaagagtagt    193740
     aatgctagtg tagatagtgg caccaatgta cagagcggca atactggcga taggacagtc    193800
     aaagctgacc tgtcaaagga cagttgtaaa atgtttattg gtggtttgaa ctgggaaaca    193860
     acagaggatg gtctgcgcga ttattttagt aaatatggta aagttgaaga attgaagatt    193920
     atgaaagatc cagccactgg tagatctcgt ggttttggtt tcttgacttt tgaatccgca    193980
     tcttctgtgg atgaagttgt aaagacccaa catattttgg atggtaaagt tatcgatcct    194040
     aaaagagcca ttccaagaga agaacaagat aagactggta agatttttgt aggtggtatc    194100
     ggtccagatg tgagacctaa agaattcgaa gaatttttcg cacaatgggg tactatcatt    194160
     gatgcgcagc tgatgttgga taaagatact ggtagatcta gaggatttgg attcattaca    194220
     tatgatacac cagatgctgt agataaggtc tgtcagaata aattcatcga ctttaaagga    194280
     agaaaaatag aaatcaaaag ggccgctcca agacatcttc aaaaaactgg tggtgcgcgc    194340
     caaccagcac aacaaagctc taattcacaa tatggcatgg gcacaggaag taatagcagt    194400
     ggtcaatatc caggttacgg cttccaggat cctatgatgt tttcgaaccc aatgatgagt    194460
     ggttacaacc ctatgtttgc taataacaac cctcagatgc aagagtactt ccaaaaaatg    194520
     caagactact ataaacaggt tcaacaacaa ggtggtatgg attacaacca gatgtatcaa    194580
     caacagatgc agcaaatggc tatgatgatg cctggtttca acccttccac tatgggtcag    194640
     caatcgcaag gtagccctga tgccaactca actaagagcc aaagtaacga agcttcgaca    194700
     ccaacaccag atgatcaaga tagaggtaac aaagattctt caagaagatc cggtggtcca    194760
     ggtggtttcc gcggtcgtcc aaatgatagc agaagaggtt atcatccata caataggtag    194820
     tatttcggtt taggggatat atcacgtctt ttctatatat tttccggagg aacgatcatg    194880
     cagtcacttt cttttatttc atctatttgg atttcgctat tcctacggtg agtgaattct    194940
     aatttatgag ttcacttatt tgacctattg agagctagtg caagagtctt atatgactag    195000
     caactccttc ttaatatgta gttgatacaa aatctttacg atatttttca gaaaatacac    195060
     tttgattcat gaatgatatc aaatttttac aaagtagtgt cgaaatttga ttccactatc    195120
     atttattatt cctatagtat acagtgtctt acattatttg ttttatatat cctcatctgt    195180
     ataactttgt aatattttta aaataattta ctgctattaa agttaaatta agcagtgtat    195240
     atacagagat atgtgcaagt cagctttact tttgtatttt tctagctatt aactatagtt    195300
     ttaagttagg agaattataa tgaacttaaa aagtgattta ggatatttct ccatgtgtaa    195360
     tacccagctg aacaatggca taaatattta aggcagacaa gaatacccaa actacaaatg    195420
     caattatgga gacaacccaa ttatttgcca tactgacagt ctttctggtc tggccattct    195480
     ccagttgcat gtcatcattg tcagaaggat cctcttccgc atctttcaca gtaatctcag    195540
     tctccataat cttcttatta caggtgaagt agattaatgg cgcaactaag aagggtaaaa    195600
     caatagacag tacaacttga gatgcgttca aggctttgga aagagcctcc ttaccaatag    195660
     aaatagaaat agctaagcac ggaatcaagg atatggctct ggtgactagc cgtctttgcc    195720
     atggctttaa tttccaatgg atatgtccct cacaaacgat ttggccggcc atggtacaga    195780
     cgataccagc ggattgacca ctcagtagca aagctagcat gaaaatagtg cctgcaatag    195840
     gagctaaggt tttcgataat aggtcatgga tggtgtataa atcagcatct gctgcatcag    195900
     gataaccata taatgttgaa ccagcaacaa ttaggatagc acaattaaca aatagcgcta    195960
     gtgtaaatag cgtcagtcct agttctatca tagaaaactt catacagtat ttaatggctg    196020
     atctggttgg tctatagttc tggtatcttt catcaacagc tgtttctttg tttttctcat    196080
     cttcatcatc cttcagcata gaatagttac catgattgac atcatattcc aacagtcttg    196140
     gttgaaccaa tgcagatccc aagaacaatg aatgaggcat cacagtagca ccgagaatag    196200
     aaatagctgt gtagacacca ttatgttcta gcatttgacg agatggcacg aaacctctga    196260
     acaccttagc agcagaagtg cttttaggga tataagcgag ctctactgca aaacagatgc    196320
     aaacaccaac gactaacaat gccacaaata attcaaacat acgtacaact ttcatggaag    196380
     aagcgcccgg tctataagta gccataattg ctagcacatc taccaatgta atgcaaacac    196440
     cggctgggag aggaactttg ataagaatgt tcaatgcgat ggcagtacca ataacctcag    196500
     cgacatctgt agcaataatt gcacattcag caaagaagta tacagtccaa ttcgcccatc    196560
     ttggcaagtg ttttctacat gccctgctca agtccatacc agtaacggaa cccaatttta    196620
     tacacaagca ttgcaagaag atagcaatga agttggacag tagcaccaca cataacaatg    196680
     aaaactggtt agctgcacca gctgatgtag cagtagagta gttaccagga tcgatatatg    196740
     caacactgac cagcagtcct ggtccgatga atttaatata tttcttgaaa gcagccttta    196800
     tgacatcctt attgctcata ggctcctcgc atgttgacgg tgagctctca atagtctgta    196860
     agtcagtgac ttcgcttatg gtcttcacac caaccttatc ggtatcgtta gcttctgtac    196920
     aagtggactt ccgggcccgg ctggcaccaa caccattttc agctccagaa gtgctcatag    196980
     ttagaattcg ttagctatgt ttgtgagtag ctatgggagg tagtcgctgt aattgtcatg    197040
     caagtaatat caagaagctt tatactttta tatgcgtaag tgccttctcg gggtagcatt    197100
     ctcgcccact gagatgagct tatttgtcgt gggttctgag ccattttaga gagccacgaa    197160
     aggttaccac ctcacgacaa ccatgggaaa cacgataagc aagggtaggc tcaggctcga    197220
     acaactagca agaacttatc tacgtacatt actgttgggt ctcatgacaa gttggctatc    197280
     cattggtcca ctttgaatga atgcacccat atcatcacct atttatttgg cacccgagaa    197340
     agcctccgag tttgttggat aacattgcag ttccttgaag tgcatattga tgagacacga    197400
     ccttcttgtc cttattaggt ataagccaga ctcagacttg ttacatatta tttgttcata    197460
     atagctattt ttaaacagta tgcgagttta tttttattat attttaaaaa atagtttggg    197520
     gttgtgtaat ataggaacta aagaattata agataaaaaa acaaaggatt ttttatgatt    197580
     gttaatatag ttgacaagtc tcttattctt cttcttccaa agtttgagcg gcgatacggt    197640
     ccaaatctct ttgaccgttc tcagagattc ttctaccacc ctttggagac aattcgacga    197700
     caccgatctt ttccaaagct tgcaagactc ttctgttaat ggaaccagaa gcgtcagcgt    197760
     ggtgagatgg tctagcacct ctgctcttgg cgttaccgta caacttgttc aacttaccga    197820
     caccgacttc ctttctcaag tagatgtgtc tagcgacaga ggcggcacgc ttgtagaacc    197880
     aaccttcaga gtcctgtggt ggcatttcgt taccagcaga ggtcttgacg atatccacgt    197940
     aacctggaac ctctagctta ccttgtcttt gcaagaaaga agcgtaagcg ttgatgaaat    198000
     cttgagcagc aacgtctctg tatcaaattc caattgcttt caataaaaac cacagtttat    198060
     gcccaatcat ctacaatatg cactagttca ccactgtaaa tatcgtttca ttcatccaaa    198120
     tattccactg tttcatctaa acgtagtcgt tatcaatctc tggctccacc gttgcgtttt    198180
     cccacttaga ctatgcataa attcgataaa attgggtgat tcgagggtag tatcaaaagt    198240
     aataaaattg ttagtaatta tgttcagtaa tgttttgggg ttgaattcag tgtcttattt    198300
     gcaattattc gtgtgtctag gatcgtaagc atttgttcag gttataaagt ctatcataac    198360
     tttttgctag tccactattt tacctggtta catcaatttt catggaattc tttatactct    198420
     ccacactggc tcttctggtc atatttggtt ctaaagattc ctgactcagc aagtctatgc    198480
     atctttcaca ctgttcgggc ggtaaaatca cggtacgtac ctaacggaaa cacctggcat    198540
     ctttatatct agtctcttgg gatcctgtca aatgatatcc aactggaaaa acgtacctat    198600
     acccttatat aactactata ccgccgaaac tatttcatta atatctttgc agattgaaca    198660
     tggcgaacta attgcagagc cattgtggca ctggcagcga tgcaatggag accttcgtct    198720
     tgcccctcca gtgcctcagc agggagggct ggtgcgctac actcaaaggt cccttgtgga    198780
     ggacaaactg ggaagtgcct cagctgagct gcgctcgaga gctcccttct ggcgatgcag    198840
     tgagggagcc cactgcctga gcaaacagcc tcgaggacct cgtcaagctg aaagggtggg    198900
     ctgaactagc atgccattgc tagaaggata gaaggaagtt tctgcctagc tcttgcacag    198960
     ggagctggac ggtggctaga atttacgcag actgaccagc gttgtgtgag aggtctacac    199020
     ggaacaaggt tttccagatc atttccgttt ttttgcatcc cagtcctaac atgcactaat    199080
     gaaatttcct aaacaggaaa gtgatgtgga ttgtattact ttcaaagtac agatttacat    199140
     ggtgtctggg ttttagtctt agtgaagtca caattgttta ggagctttgg gggatggccg    199200
     gcaggtggcc ggctggtggt tcactttcag ccaacatagc tgagttacca gcgaaggcaa    199260
     atagaatatt catgttgtct tactcatcag atattactat attttagcta gtgtacagat    199320
     tacatatgtg gatatgttgg ggttgttcgt tacatattga atatggaggt taataaaaaa    199380
     aaggttataa ggcttttttc tctaatgctt gtatacaaaa acaattgaat gctaaactat    199440
     atataacggt gttatataca gtctttttaa taagtcaatt taattttgtt agcttagacc    199500
     ttgaaaccct tagatcttct tctacctctg gcagattcga actttctacc cttagacatg    199560
     attcttgggg ccttgttctt gtgtggaccc ataccgaagt gtctgacggc ttctctggcg    199620
     tttcttggac ctctcaagat caaagtgttt tgaccctttg gagctctgac agccaattgg    199680
     tccaaagtga tacattcacc accagccttg acgattctgg ctctggcacc agcggtgaat    199740
     ctcaaagcag caacagtggt ctttggcaag tcaaacaatc tggcgtcgtc ggtaacggta    199800
     ccaacgacaa cgacagtctt ggaagcagca ccttcttgct ttagagctct agcaattcta    199860
     gagatagaga caggtggtct gttgatcttg gacaagaaca aagacttcaa gacaaccttg    199920
     ttgaatggag catcagtacg acctgtaagt aaaactggct accaatcaaa ataacgctca    199980
     aattagatgc accagcacaa aatggtttaa tagaacagct agaatagaag tcattcgttc    200040
     aacgctaagc actagtgtct catatcggag aatttttgat caataaattt ttaatgttag    200100
     taaacctaaa cttttggatg aagggccaca gtggtaaagg aatatttctt agaaagaaca    200160
     aaagcaatga agataagcac ttacgctcaa attcagtgat gtagaaaaac ctgagtatac    200220
     actacagcga gaaacgaacc tcgtttctac aagctgcgct cgatatcagg aaacacaact    200280
     atcacttgaa gtaacaagtt gtattttttg cagttttctc ccttttgtat atctttcttt    200340
     ataatatttc cttttccaat gtgatgcaat aaatcgcatc tggaaaagaa agagattctg    200400
     ctcgctagat caccaacact cccttacagc taaagttaaa aaattagctg tagaaggaat    200460
     aagttgacat aaatcttcaa agatgaatta tccaagttcg cgcaaatcat tcatgcatca    200520
     gcttataatg aagctggcac actagtttct tcgcactcgc agaattggag aaagttattt    200580
     gttttggaaa aatgattatt caaatatcgg ttgagattat ttcaaagttt gtaatatagc    200640
     gggacggaac ccccttcaat ccatgatcag gtgtgtaatt atagaacata cgagctagga    200700
     aagtgtacaa tctgaccaac atcttcaagt agacattttc agactttgga gcagttctgt    200760
     gactgactct cttgtgttgc ttggaagtgt gatcaatacc cattttgtta ttcttgttgc    200820
     ttacttgtat aggtttaaaa agagtgaaac taaagaggaa atttgagcaa gatgacctgt    200880
     aatagcatta acgaatttgt cacttcttat atatcctgaa actttttcca gataattttt    200940
     tttcgcacag acgggccatc tgcgtcgaag aaaagaagtt ttttttctga aaattatgga    201000
     agagttccat taaatttcct aatgaagaaa tagtgttgtt acacccttgc attacatagt    201060
     aaggctgaga agcagtcaca aaggtgggat ggtctaccta atgtgtctta aaattaatga    201120
     acacgatggt tatacagttc atagtatgcc tacattttat atcgttatat atcaaatttt    201180
     atacttttga aaggcacatc atagcgttta gaatgcgatg ttaagttggc gagcctatgc    201240
     gtatcatatc taaaacttct tgatgcggat acctacacat aaatatcttg acacagcgta    201300
     gcagaaagcg ccagcagcca ttagtagggc cacgtatatg atgaaatggt tgtaatgcgt    201360
     cacagatctg tcgccaataa tagcaccacc aattggcagc atagggatgt taaatagtgc    201420
     ctctacaaag tatgcagtgg cgtacctctt tccgaaatcg gctgtctttg atatctggcc    201480
     aatgcatacc ggagttaacg acaggatgga accagtgaag aaaccgtatg tgcatgcgaa    201540
     ggcccataag gctccagttg atccaccaaa aggcagccat attaccagac ataaaagtgc    201600
     actcatggaa atagtgataa tcataacatt gaatctccct aaaaacttgt cagcaatgta    201660
     tcctggtaca tatctaccca gtatacctga tgcgttgtat gcagtaagca ttaaatacgc    201720
     aacattctcc gagtttcctc ttgcgattgc gtaggatgat aaatatgtag ccgctgtagt    201780
     taatgaactc tcagcaaatg aggcacctag agtagtgaac acgaatttca tttctgtaaa    201840
     ataacttagc ttgaatgagg atgaaaggta ccatttgatc aattctgtct tagacttgaa    201900
     tggttccacc attggtttcg atttttccct tgtcaacgca atcgagcaaa ctaaacaaga    201960
     tagacaaatg aaacctaaga ctctgatagc ccatttaaat ccaatctcga cataaagttt    202020
     acgcagcatg attgggaata tgataccgcc aacggagcca ccggtcgtag cgatgctggt    202080
     cgctgttgct ctccttctta agaaccaact tgcaactgcg ctaaccaaag gtgtcataag    202140
     aataccagta cccgttccag aaagtacgga gaaagataaa ataaactgat aaatatcctt    202200
     acagtcagca agtccaaaaa tcccacccac atagaaaagg gtccccaaga tcatgagatg    202260
     ggtactgccg tttctgtcaa aatagccacc cgcaaatatg cagctaacaa aactaatcgt    202320
     caagtatatc gaaaagatcc atgagacagt cgatgatgag acattcatca attgatgtgt    202380
     cgaaatatat gactcgatgg caccaagaga attgataaca ccaaagacag ggatcaaacc    202440
     cataaaagaa ccgaatacaa cggaccatgc tcttaatcca ccatcaggaa attcacgatc    202500
     attatccaaa atgagggaat cgtcagtatc cacctcaata agactctttt gactctcgtg    202560
     agtttgttca gttatctcag ctcccggctt cttatttaaa tcgaaaaact ctgcattact    202620
     aacatgggct tctttctgaa aaccagtgga tgccaatccc agatcttcat tggtatcttc    202680
     ttctgcctgc cgtagattct tcaatacaat atccggctcc atttccatcc cgatggctgt    202740
     accattcgca acaacagttt cgttagatga cccctcagca acatttccac tcttcttgtt    202800
     gctgaggaaa ttcctcttca aaaccacagt agctagatca atcattctct gccctagccc    202860
     ttgacggccc tggaactttt gagctactcc aactgctact tgaccctcat cgctatttat    202920
     actatttttt ttctgagttg tgagtcatga gctcatcgca ctcggagttt gtagtccgaa    202980
     gccattgtat tctactttag tttgtagtcc caagttatag aagttatagc ttcacatata    203040
     taatattctg gattcgttac attgttcatt gtgttattgc tgacgccgca atttgtagat    203100
     gcggagtgtt ggaataactt gcggtgcatt ctatattact cggaccatag aaacaaatct    203160
     aggcgaaatc ttggaccacc atgatttgta acactcactt tctttcataa actacattat    203220
     gtatctatgg atatagttgt tatagttcac actttctata gttcacactt tccttagttc    203280
     actttgcatt ccttattata ttcagctctt gctgagcata ctaggtttca gaagtggcta    203340
     aagcagtgtt gaaactagtc acattatata cctatagggt aaatataccg gtttagttgt    203400
     tataatctcg atctcagact ctctatgact ttttttgctc ttaattgaaa ttctccatga    203460
     ttaaagttgt tttaacagaa ctgaaaaaat atttgaaatt ataagtagta tttagacctt    203520
     aaagtctggc tacttggcca aggaaaagag aacactgaag gtggtgactc ggtaattatg    203580
     acggatgaga gcgataacta caatgacttt atgatgtccg atgaggacat ggactcaatt    203640
     gagatggagg atgaggagaa tgatgttgaa ggcgatgagg gccaacgagg tggccaggaa    203700
     tgggtccaaa actatgagca gggcttgagt ttatggaatg atgagaacta tgtggctgca    203760
     agacaagtgt ttttgaagac cttgagtatg ctagtaagtg aggaagagtt gatcgagatg    203820
     agatgtaaaa tacataggca agttctagaa tgttggtgta aaatattgat gtatggagag    203880
     cctgataatg aacaatctac tgagattatt gctgatttta ggaactttgt agaattagtg    203940
     aatgagttgc acgggaaggc gaattgctcc cttgatctta gctctatgtt ccatcatgta    204000
     actatggatt tcatgcccaa tatctacgat aggacgttta tccccggtat aacagatgat    204060
     gaggagtcca gtaagtgggc taagatgaca ttcaagacta ctatattgca aatattacaa    204120
     ggcagttggg tttgtcatac atttccagaa gtaggtttac tattacaaca agagctacat    204180
     gtgttgcagg cctggatcaa gacattcgat aaagagcggg atttatatgc catttcagaa    204240
     tcgttaagga aagatatcaa cactttgaat gaattacaac tgatattaca gtgttatatt    204300
     gctcgctata ttgaagatca gcatttgtta tgcaatgaag gggaggtatt cagaatgtgt    204360
     ttaaaccaac tggatcaaaa atgtaatgaa tctttagctg tcgcacaaag gtctgatatt    204420
     aatttaattt tgcatttcag caaggctttg tttctgatac tatttgagct agatcaagat    204480
     gatctaggag acgggaataa agtcactgga agtacttgtg tgcgaaggtt tgtgacaata    204540
     cacaagttct atcaaaatat tgaatgttgt aaagaggagt tttgggaatg cctcaagaac    204600
     ctggaggagc taggtactaa taagtttcgg ttcgagaggt tcatgcaaat tattgtgggt    204660
     ggctttgtgt tatgcgccat gattatgcat cgaggatccc agacacgact ggctggaacg    204720
     tcgggcaatg cagatattaa cccgttcgac tatgagcaac tgcgtattgc cccagatcat    204780
     atatttgttg acaaactacg aagaatatat gatgtgttcg tcggcttaca aatccaagaa    204840
     atgcacagtt gcttaataga actcgagtgt atacgggctc cattgtcccg tttgtttgac    204900
     caagtatgtt acttaataca aaagcggaaa ttgttcagtg aaattgctcc aatatatagc    204960
     tgcatatcca tacaagattt acgccaaaag ttacaaatcg atccctcagt accacccact    205020
     cgggatgaaa ttcttgtcca tttgatgagg tactgcatgc aggacagagg cattaatttt    205080
     aaactagact tagtggccga cacagtgacc ttttattcgg agcaacacag cgaaccactt    205140
     cacgatgctg tgttttcaga gaccaggatg ggccataagt cccataagtc atcaatctct    205200
     aaggatagag ccattgtcga agacatcaag gctgcgcatg aaatgccaga ggtagagtac    205260
     gcccacgaca taggaatcct ggagtcccaa gtggattcgc agtcgcattc taagtcgaac    205320
     acgaaatcta tgtcaaggca tgtgtctggg catgatcctg attcttttgg ccaagacacg    205380
     ataagtttct tcgacacatt gcgactcgca agagagactt atcaaggaag caacatcgac    205440
     aactcggtct acaccatcgc aaagctaacc aacgaagcac tacaggaaat aagcaacgat    205500
     gtaagataga gataaaaaaa tccggggata gatgaggggt gtggtttgta acaagcatag    205560
     aatgcttctc tgatttactt tgtgtggttt cgtaatactg gaaatttgcg catcgcaatg    205620
     agggtgaaag gcctcctata atcaaacaat agacaggcga ttctcctttg tgaagctcct    205680
     attttgttgt gtgtgtgtgt gtgtgtgtgt gtttgccctt catttatctc acagaattct    205740
     ttgcctacac aatttcacaa tcacaaaaaa aaaccggctt tgtcagttat gcgtttttaa    205800
     ccctcacagt tctgttccct cacagtttcc tcctccctct tgctttgcac agtagtaaac    205860
     attgatcaag tttagttctt tcattctgga cagcttgatt ggtagaaatt atacaatcgt    205920
     gttaaaaatc aaatcaaaaa aaaaggcatc ttgtgcggcg tgtactgtgg aatttgcggt    205980
     gataaatatt ataaatcaaa atttttggct ttgaaaaaaa aattctgatt agcttttgcc    206040
     caaacagcga tgaggtggga ggatcagaga gaggggttct ctcctgctgt gctttggatt    206100
     gtggaagaga tcggtgcttt gcttgttcct gtgtttctgc tgttttctgt gtcgatttct    206160
     gtatcttatt tgaaggtggg tattatgata agtttcattg cgagttgttg tagctctgcc    206220
     tgattaccag tgggacaaag aaaggatatc atctgggaag gattacacaa taattagaca    206280
     gagctgtgat attgtagagg gaaataagga agaaaactga tttgcgttct agtctcttgc    206340
     tgatcattac tttacagcag agagagggta aaaaagcacg agagcaggaa acagagggta    206400
     gggacaagga atttcaaagg acaacgaagg gagagaggaa tataaggaaa aaaaaaattc    206460
     attgtgaatt tgttgtgttt tctctaagta ctagggtata ttgtgaatga aagaaaactt    206520
     tttggtggta aatttttttt tgtgattagg aaatttagaa gagggaagtt ttctatacat    206580
     atcaaggagg acaggaaaga aaaccccgtt gacatctttc ttatacacgg atcaatatcc    206640
     ctaactgatt agtctaagga agaggattac acagaatttt ttttttataa aaaggaatta    206700
     aaaaaaaaat atctattgtt caagccagaa ggaagtgaat atatctttgc aaatccttta    206760
     atatcgggtt gatatttatt tgaactcaat ttcaggtaat aaaatagtct ttttgtgatt    206820
     tgacataaaa gtatcagtgg ttgacccata tttttatcgt gagtgtattg gcccactcat    206880
     aagattacag atagctggga aaggggaaag gagtactaag ctaaaaaaat actcttggat    206940
     cacttatatt tgttttgaat aaagttgatt ccatttctcc aatattcgtg ttttgctccc    207000
     ccatcatttt tgtttttgag cccactaatt ttgggtgttg gacagatcat cgattattga    207060
     aatagagaac catcataata caaaagtaaa acatttagag agaagtttta tttttttgat    207120
     attatagcac tgctttgata acttcattca tttatttttg cgatttttga cactaaaaat    207180
     ctgcatatga atagagaagg aattagtgga cctggtggtg caattataac gcacgacagt    207240
     gtgagtactg ggagtagttc caattcgaag aataacggtg gcaacaataa caatagcaat    207300
     atacctaatg gaaactccag tatgggtgac gatataatgg tactaagtag gataaatgac    207360
     atagagcgaa gaatgatgat gtttgagaac atgtttcacg cgttgagcgg gcgattggat    207420
     catcatttca agaagtatga cgttctagtg tcctcgcaac aacaacaaat aagtgaactg    207480
     aatgcagtga taacaacact actgaatgat cagtatagac atgctgagtt tgtcagagat    207540
     aagctatcac actctctaca tggcatatct tcaacatcta tttcattgaa tggtatttcg    207600
     aatcagaaca atgataatag atccaatgga tttgcaaata ataattcaag tggtgtggcc    207660
     tcgggtagct ccaatggagt taatagccaa ggaaatacca ataataatag caatagaagt    207720
     agctctacta gtcatctcaa caaccccaac atgttaggaa acaacagtag tggcacaggc    207780
     aataatcaca ataataattc agttggagct agtaactcta accagagtgt cactcacaca    207840
     atactagacg atattcttaa tgagcacgac ttgcaagaca agaaatattc cggaaatcgt    207900
     aatcctggtg atatgaattc taggaatgat gtcaatgaca agtcacaaca aagtcctagg    207960
     gaccctatgt ctttgaaaaa gacgaaattt attcaccata ggcaatacaa tgatgttaca    208020
     gatggcgact cggtgatacc gtatacaaac ccatatgtcg atcaaagtgg acatcaacag    208080
     aataatctaa cctctaatat tcttttcaat gatagtacat caggtcaaaa tgccggcaac    208140
     caaggtactc aacaggccac tcagaataga gaggaaggta tgccatcatc ccctggccgt    208200
     aaatcatact cttcaaaaag aggacctaag aaaaagaaag tgatgtatca caagccattt    208260
     caatttataa aatctcctca ttcggttatg gagatttgga aggagtatac tgaaggtatt    208320
     gatgggcaac cttccattag ggaaatggaa tcattatact caacaggttg gagacgcgat    208380
     gcagctgtaa acaaaagata ctctaggaga aaggttttgt ggaaagcaat cgaaactggt    208440
     ctttccagag gctatacatt ggattacatt attgacttgt tggaaaatta tagaattatt    208500
     gatccagaaa agaatacaaa gcaacctatt ggttggcttt gtcaagttaa caacattcca    208560
     gacctcttaa aataaactgt tgcatgttta ccatgcattt tacaatacaa ccactccagt    208620
     aagggagtaa tgacttttcc atgtttcatg gaaatccatc aataacaaga atcggaacaa    208680
     aaacaccttg taacactaaa agagaagttg gaagttggat caatgctctg gggagaataa    208740
     tgattgtctt ctgtttttcc tcgtttttga gttataattg tttgtttcat tttttttccg    208800
     ttttttccaa ttgttttata ggaggttggt atattggttg ctgtttctac attttcacca    208860
     aaattctgtt tttagctctt tgtgttatat taataagtga tcgacttcag atgcatcggg    208920
     ttacctgtat gtcgaaaaca aaaaagaaca gaactttcaa actattacct tcttttcacc    208980
     aacatttcct atgttttgta atcataattt cgctacaact ctaaccaaag catcccttcc    209040
     caggatgatt aaatgttatt tcatattcat gagtgtagca aactgtttta atataatttt    209100
     tcctgtttcg actttactga agatgaatac atgacctaca attccagcat ttcaatctcc    209160
     ggatcttcaa tatctccagc aactgaaaac tataaagaca tggaccattt attctcataa    209220
     aaaaaaaaaa gaaaaaagtc actatgtata ttcctattct agttataaac ctctatctac    209280
     tttatatcct gaacattgtt catcttctat atgtacaaaa ctatcaatat catgtttatt    209340
     tctatattac tcactctaaa tcatcgctct tggctgaaat tcttgcagaa actgaaaaaa    209400
     ttcactagtt ttgcatagaa gaggtcatcg agttataaaa gattcgataa ttagagaagt    209460
     tcttcggaaa ttaggcatct ataattcatt gttctttgat ggttaggtca tcctagatac    209520
     taattacagt cttttgttag caccataaaa gtgaatatgt cagctgctgt agatgatgtg    209580
     aagacagttg aggacgttgc tgatgtcatt gctgtggaaa gtagtgatag tcaagggttt    209640
     gacgattatg atggtcataa cgatagtcca aaggagatgc ctattataga taataatcag    209700
     atagatgaga atgatgattt catagcattt tcagagagct cgggtggaga ggatggcgat    209760
     gaagctgagg aggagcaacc gcaagccgag gaagaagagt atactgatta tccatggact    209820
     attgataggg attattctaa ggaaaaagaa ctagctgatt ggttgaatta tgaaatactg    209880
     gattttgttg cctatatatc tcctagtaaa gaagagatag aaacaagaaa tagaacaata    209940
     ggttcaatca gaagtgctgt taaagaactt tggcctgatg ctgacctgca cgtatttggt    210000
     tcgtatgcga ctgatcttta tttaccagga tctgatattg attgtgtagt caatagtaag    210060
     caaggtgata agcagagcag aaacaacttg tataagttgg ccaacttctt aaagaaaaaa    210120
     gaaattgcga cagagattga agttgttgcg aaagctagag ttcctattat caaatttgtg    210180
     gaggttgagt cccggacaca catggatata tcatttgaaa gattgaatgg tcttgaggct    210240
     gcaaagctta taagagattg gctggctagt acaccaggct tgcgtgagct tgttttagtc    210300
     gtaaaacaat ttttgcattc gagaagatta aataacgtac attctggtgg tctaggaggt    210360
     ttcagtataa tatgtctagt ctattcattt ttaagaatgc atcctagaat aatcactgct    210420
     gagatcgatc cattagagaa tctaggtgtg ttgttaattg aattttttga actttacggt    210480
     aagaattttg ggtacgatga tgttgctatt ggtgtgcaag atggctctcc tatttatatg    210540
     gcgaagaggt catggaaatc acttgaacag aacagaggat cattcaattt agcaatacaa    210600
     gatcccggtg atgttacgaa taacataagt agaggatcct ttaatctaag agatataaaa    210660
     aaggcatttg ctggtgcttt tgatcttctc actaataaat gtttcgagtt gaattctata    210720
     tcaattaagg aaagatacgg aaagacgata ttaggaaata taataaagta ccatggtaag    210780
     cgtagagact tcagagatga aagaggtttg gttcagaata aagccattgc tgagaatgag    210840
     agctaccata agaaacgtag tattattatg catggagagc tatctgccgt caatggcaaa    210900
     agaagtgcag acgatgagag taacgaacat catgacgata cacaaaataa gaaacaaaag    210960
     gttaatgatt acgatgatgc tgaagaagaa gacgattacg accctttggc atagaattga    211020
     aagtctcaca taatttcaaa attatacctt gatattagta aaaaaatttg tattatttat    211080
     catttaagta acgagttatt gcatgaacct caagaagtca tattacggta ctattgctta    211140
     acttaggcaa caaggtggta caataattta aagaatattc aagtatggga aatgaacatt    211200
     tatccttatc tttcgttctg taaatattcg gaaaacaatt gtcgtagtta gtataggtcg    211260
     agtcttggtt tcttccttgc acttttcttc tcggaaacct ggcgcttccc ttcgagtcgt    211320
     attttatttg tctgtttctt gatgctatcc catttcgata ctgttgcctc attttccaca    211380
     ccaggaaaac ggcatgtatc ctggatttct ctgaccaatt tatcgagaca aagtcttcta    211440
     ttttgttccc ttgaccgtgt ctcatcggct cttacaataa atttgtcatt agcaggatag    211500
     tagtaactgg agggtcgccc cgatagcgtg cttgctacaa tttgcttggc attcgactca    211560
     tcaggattag ccacgcatac ccctttggtg agcaaacccc gaacctcaga agggaaccac    211620
     tcacatctgg agatcccagg aatagtaagc gtacatttag tactgacttt gttcacattc    211680
     tgtcccccgg gcccgctaga cctgtcgtac cttactctgt atatactaac tggaacgtca    211740
     ctgacccgca gctcccgaac ccactgccgt gcgcttgcga accggtcagc ccggcgatat    211800
     agcactttag taaacaacat cagacctatc caagtggcct ggtatcagtg gtgaaacaca    211860
     gagatgccta tttgcttgtg gttataatta tagttgtgga tttttgacct ttgtgaagct    211920
     cattggctca ttttgcaaaa ttcgtgtttt aacccaatcg ggaaactatg ttgatccaag    211980
     tgtaaacaaa ccacctatat aggcgaaaaa tagtaataaa tcatcgataa tgattgtaag    212040
     gatagctaat aatagtaacc tagtaatggt agatccttga gattgttatt gtgccatttg    212100
     gtactgtcgg aaaaagggta tgacagaaat agaaggatca gaggcattcc caggaaataa    212160
     aaagagaaca cctaaaattt cagcttggaa tacttgaggc actctaacct aggattgcaa    212220
     ctatgatgaa ggctaagccc gggcaaccgc tggtagttcg gcgacaaggc tgggtttcat    212280
     acaaggacga tgggtttctg tcgctgttgt ggcagaaacg gtacatgata ttgaatgatt    212340
     gttatatcga tctgtacaaa ggcaataaga gaaccgatag tgccattgtc agtattccgc    212400
     tcacaaacat agtatgtgtg agcttacaca aggccaagcc cttttgtttg gaaattgtga    212460
     aagtcaattc cagaccctcc atgtcggtaa atggtggagg agtggcttca gactctatca    212520
     ataaaaataa cacaaagagt atatatgtgg cattgaagac tgagcaagag ctatatggtt    212580
     gggtagatac catatttgcc aaatgcccac ttcttagtgg agtttcttct ccgactaatt    212640
     tcatccatag tgtgcatgtt ggttttgaag cagacactgg taattttatt ggtctaccgt    212700
     ccgactggga aagaatgtta gcttataaca gatctaacac accagtagat aaaccaaata    212760
     taataaagag tagcaactct atacgcagga aattttcctt accgaaaagg tcaagttcga    212820
     tgtctagagc aagaagcgta ctaaagcctg taaaacaatc cctaagcatc aatagaaagt    212880
     cctcgttaag gaatgatacc acaaacatgg gcaagcaggc ttgtaagatc acatcacata    212940
     gaaatggggc cagatcacca gagcgggggt ctcaattgtg gacataccaa aatagaaatc    213000
     ttggcgggag ggacagcact gttttatcaa ccaggtacga caggcatggt catgatcaaa    213060
     acagagacga tgacgattat atcataaata ctaacactgc atttgtaaac agcattcaaa    213120
     caaacagtaa tgacgaaaat agtattttgc attattacga gcaatttctg gaacgataag    213180
     catctccgga atcataattt cagccagaaa gaaacatatc ttacaatgct tcttggttac    213240
     tctggtcaag gcagtagaac agagacgtat tcatgatcaa gttaagatat gaaacatgtc    213300
     tactgtcgaa cattagcata ttgacgaagt ccagtatata atttgggtta gcctctctga    213360
     taggtacgtc atattaaatt cttatttatc tttacataga aaattcacgt tgatatatgt    213420
     ttatactcga ttagtcaagt tgaggagtag agctctgctg agctagttca tacccttttt    213480
     gtaactgctc aaacattgtc ttggcttcat cagcgttagc aaccttattg ttcaacagag    213540
     cttgtatatc actccaaggt acagaggctg gagtacgggc ctcaattgtt ggtggagtag    213600
     acttgatttc ttcttccttg gcgatcatca cagttatggc ggcatttgag acacccaagt    213660
     ccttcaaaac catgttatca tgtagaactt taccctttag tagtagcttc acggattgaa    213720
     tgtggcgaca gtggccctca tcgaccactc tttgcttaac ggtaaataca gtggcatcac    213780
     taccaaactt gtcagtgaat gtgaactttg gtggtctgat actcttcaaa gttagctcta    213840
     cagaagcggt ggcatcagca cctgaaggta attgcttgct aactcgagtt ggatcgtatt    213900
     tgtacttgag agcaggtagc gcaacaccga ttgagttaac gtccttcaag ggtttctggt    213960
     aattttgcgc aaactttggc tcttgcaaag tggcaagagt gagaaacttg ctagcaaatt    214020
     caaattctgg ggtagccatc tgtctctgtt gtggtcaata aagactttat ctgttcttgt    214080
     tttcttctac atcgatacaa agctctattg cttccaatct ttgtgttttt ataagtcttt    214140
     tttcttgcaa tttgacaaaa aaattcggat ttgcaacttg tgtaaagggt ccaagaataa    214200
     aagagctcat cgcaagaagt taaaaagcca ctccagttcg atatacgggt atatcgacaa    214260
     ggattaaagc tattccgact gtattgttag gcggcaagat ggacagctct acgttgcaag    214320
     atgggatggt tagcaccatc aacagtggca cgctatcgaa gcagccaaca gatatgtata    214380
     ccgatttaga ggataatgaa aacagatttt atactaatag tgatgtgatc ctggaggaag    214440
     ggacgttagg ctcgtcgctg gggcgctcta gtcggcgaac acatgagaaa ggtgaggatg    214500
     ttcaggatcc agttttcttc aatgttcatg aggtgacaga gtcatacttt gcggatatta    214560
     ctaatcctac tgtatttagg gaccatgatg aggaccatag cttgtgtgtt acccatttca    214620
     tgaacgtgta cgcttcgcag gactccagac tgtttgagga gacccgcgtc gtaagaatac    214680
     cgaggaggtt cgatatgggt aataggtggt accctatgtt cagcgacttg ctgcctggat    214740
     cagagcccgg tgccatatta catgacaccg atgggctgca attcgtacca aggggtatta    214800
     ctcaggatgg aaatgtatac ggctattcca gtgtgtcgcc attgtctttg tacttaacac    214860
     agcaacattt ccaggagata gtcactacga taaacgacat actacttgct acgtactcca    214920
     cgtacggttt ctataacata ttaaacatta tattagaggt attcacgttg gggttgtgga    214980
     gctacgtgtg caaaaggatc aactacgcat tatccattga tcccatgaaa agactagacg    215040
     tctatgtacg tgagcttaat gcttcccctg catttgttga ggcccagatc aaattgatca    215100
     acccaagaga ctcaggtttc ctgtctttag acttccaaat accgaaacct aaaagcataa    215160
     gcacgcaata atatttccct ttgaggtaga ccagctcacc ctcgttgaat ggaggcagtg    215220
     ggcccactta tggaaggatc caccaaagct atgccccatt acgccaaatc aaatcaccaa    215280
     taacttgtcc taaaagggta agttacaagc accttttgac caatttcgtt cctggcttct    215340
     ctcatccgtc tccatggcca tggtgttccc aataagagag agaatacagt ggttgcactg    215400
     gcccccccag tacgctctag gctggacgct tttttctctt ttctggcgta ggcagagaat    215460
     tttttggcgt ttcgtggtgt cgtaggcaga aggggaaaaa tgacgttctg cctggaaggg    215520
     gaaattgcgc acgcaggcag ccagaggtgc agaaagaggg cagccatatg ttcgatgaag    215580
     ttggtataat tgcagttatc gaagttacaa tgactagtac gccaattgcc aattacccaa    215640
     ttacccaatt acccaattac acgaattcta tagtgaagga aattggtgtt ctttttattt    215700
     taaaaatgga tgaagtggct ctaactcaga cgctaaaatg ctttaacttt tggcgatcac    215760
     agctatgaaa agccataagc tatcatcatc gataacaatt ttgatcatat atataaccag    215820
     acctttttat tgcaatgatg aggatatcaa ttatggatgt ttctctctct tgtaaaacat    215880
     ataggaaaga taagacaact attcaaaact aattacatat accacttaca accatgagcg    215940
     aatacaagaa agctttgcat gttcttatga agtcgccagt cactgacgat atagtgaagt    216000
     acttgaccaa tgttacgctg aaagtgcttc cacagagcaa ctacccatcg cctccaagct    216060
     cgccatctag acactccaag gagcatttgc caagcttgat gaccttcatt accagactgg    216120
     tcagatacac aaacgtttac acgcccacat tgctggctac tgtctgctac ttgaacaagc    216180
     tgaagagaat cctgccaaag gatgctactg gtctaccatc caccatccac cgtctatttc    216240
     tagcgtgtct aattctaagc tcgaagtgcc acaacgactc ttcccctaag aacgtccatt    216300
     gggctcgtta caccgacggt ctgttcagtc tcgaagacat caacctaatg gaaagacaac    216360
     tgttacagtt gctaaactgg gacatcaatg tctccgagga tgacttgatt cttgatctaa    216420
     gaccactgct ggaaccaatc aaggaagatt tgcaaaggtc gtacttgcaa agaaagagaa    216480
     tctactcaaa caaccaacaa aaggtaagcg caggcgcata ccacagttac aactacacta    216540
     agggccacaa ttacacgaat agcaacagct acaacagtta caacagttac aacagttaca    216600
     acaagctcca gagcaaatac gtaccaaaga gtgagctata ccatcacaga aacattagtg    216660
     tttcgtctaa cctaagttca acttcaacgc tagtggatag aaactcacca ccacacaatt    216720
     acgtgtacgt ataagcattt tctacagtaa cgatattccc ataggttcac ctttcagttc    216780
     aaagcctaca aatcattaag aggcattttt ttttatttca attttttaaa cttcaattca    216840
     caatacccta gtacaagaga cttttataga attattatag acatatatcc ataggaaaaa    216900
     gaaataactt attcgtatct acttctacct tctaccttct accttctacc ttctaccttc    216960
     tatcttctat cttctctccc gtatcaatcc gacacgactt tatcgattac tagcatcttt    217020
     gttttgtttt catccagttg tggaaaagtc aaaaaagaaa agaatataga aaagctaact    217080
     taatccatac gaatccccat agcaaaggac caggatagct tcgctggagg tagtttagtt    217140
     cttccaagtt cttcgaatct tgcaacactg ccagcaattt cttgttacca cacacaaacg    217200
     ttgtccttgg acattctgtt agtgtaagct gttcgaatgt tacggagatg ccattttttt    217260
     tagtatttta gtttattcta ttttaatatg tagcaagaaa gcactcacct gtctttgcat    217320
     ccagggctgt tgctcttcca cccccactct ttggtgtgct tcttacttta ctatcgtaag    217380
     ctggtgcagg taaaacttag tacacactta tcatatgtac agtaaacaat tgtcaaagcc    217440
     cgggtttgcc gaacctctgg gcacttacgt ttaggctaac ccatgttcgt ggacccctag    217500
     caacacagta attgacgcag ctagctatat tatctgcata attccctcta tccattgtac    217560
     tgtttctggt aaaaagggtc cactgcaatg ctttaaagaa aagagctata tttttgtgtt    217620
     atgcatagca tcgattacaa aaaaaatttt attcttttgt ggaaccaatg ggaaactaca    217680
     agtaactgcc aggtaaaatg aacaaacagg aaattttttt ttcctgatat atataggaac    217740
     ccagtttgtg gccaactata gccttttctc aaactctgta attggaattc tatatttttt    217800
     acttcctaag taaaagtttc tttgtataat tattttcttt cacagttaaa agtaatacta    217860
     aaaatacact atcaaaacaa tctaaaaaaa aaacatacaa tacaatgtct gctcaagaat    217920
     taggtaagaa ggtcgatgaa accaacgaac aagtcgccgc caaggtcgaa gaatccaagg    217980
     aacaattggt cgacaaggtc gacgaagtaa agcaaggttc tgaggaagct gctgacaacg    218040
     ccaaggctca agttgaagaa gccaaggaaa acgctgctga agctgtcgaa gaagctaagg    218100
     aaaagaccgc tgaagctgtc gaagacgcca aggctaagac cgaggaagct aaggacaagg    218160
     ccgccaagaa ggtcgaagaa gttaagaagg actccaagaa ggactccaag aagtctgaaa    218220
     aggaaaacaa gaacttcttc tccaagttca ccaagaagat ctcttctttc ttcaactaag    218280
     aagctgcttc taaccttgtg ctataatact tcagtttttt tttttatttt caatcatttt    218340
     aaaataaaat aaaaaaaaag agaattactt cgatttctgt aagagttact attcttgatt    218400
     ttattttccc tatttatctt ttttaaagtt tctgtatttt gctaataact aataattaat    218460
     aattaaattt ttttcaatat attatctgtt tagaaattta tttcgcgatt atattctcgg    218520
     tgaatgttgt tggggcataa taccacagct agaatccagt aattatagta ttgtcagaag    218580
     tattttcaat gtcgattaaa gataagaaaa aaaaatcata tacttttata atatcagagt    218640
     atgatacctt caattttact gtaaaatttt ggcaaaaaaa tttgagcggt acgagaatcg    218700
     aacccgtgtc tccaccttgg aagggtggaa tgataaccac tacactaacc gcccctgaga    218760
     tgtttgttgt ctactcttgg gttttgattt gcccttattt agtgctagta tataccgaac    218820
     ctcaggaatt ttctcataca cagcggccct gaaggaactt tcgagttagg tatttgactt    218880
     taattaattt attatataat acggaactgt aaatttagtt gccagccacg atttcttact    218940
     acttcaacga aaaacattaa atctgtagtt cttttaattg attatcttta tgatagtctc    219000
     ttcaaagaca tttaataatt ataatgtaca tttcttacaa aaacattcat taaatgtaac    219060
     ttaatctgta tacataatat gccagtttag tattgaatgt tattgattta tcaatctttg    219120
     ggtttggtgt accagcaaat gtgattgtcg gtcaactaaa cataaatttc atataagaaa    219180
     acaacaaata tcgttagtgt atacgaataa acattgataa taagtacata tatttatctt    219240
     tatttttaca tgttatgcat tttttcgtta ttgtcttgtt cgggatggct tgctattatg    219300
     gattcactag gaacagagac tttattagta tgagatcttt tctttatcgt cattcttgcg    219360
     ggcagtgctc tccccgttgt agaatcttcg atttcaaatt ccaagatttc ctcgtccaca    219420
     tcgtgtgtca tctcttctga ggttcctcca agctctttac agacttcttg accaacattt    219480
     cttattgaga aaggataatc cgatgtcaat ggtatagcac tgatattatc tgttattggt    219540
     aaatcagcaa tagaagtgtc gtcctctaat tcgtcgtctg cctcatctcg ttgatctgga    219600
     ttttcaccag ggtttaaatt tgtctgtgat acattggcgg aagatggtgc tagaatctca    219660
     ccattttcat caaacacagg caatctacaa attggacatg tttgtgatct ttccatccaa    219720
     ttttttagac aagaaagatg taaaacatga ccacatggta gtttctttgg ttttttgcca    219780
     tcactttgat gatggtgagg gttctctgac acaagctcat ccatacagac aatgcaaaca    219840
     ttgtcgaagt taggatcgtt attcaaatcg tcactagtca tagttgggag ttttgtatcc    219900
     agttgtttac tatttttcca gatcgccaac aaggacttag agttcatata aaggacccat    219960
     acgtcgacga atatgtcctt cactagcatc aaaggcaaat tgagtaccat cgccatcact    220020
     acatgaacca atgtctgcaa aaaccttgtt acaacatcaa tcagtttctc atacatgaat    220080
     ttaccttcta acccattgaa ttgggagtca ccgtcttcag attctgtgtc agcatcttca    220140
     gcagatatgg agttgaatgt agggttattc tgtgagaact ttctcgacaa gtgaaattcg    220200
     taaaattgta gtccagtgtt caatatcaag ttaactaggt ctatcatcaa gtttgtgaac    220260
     tccatggctt gcatgatgta gattaatgct ctctgtgtga gaggggaacc tccgccgagg    220320
     acgatggaat tggtgccagc cgtgaagatc gaacttgcaa tgttgtaagc cgtggagaca    220380
     cagaacgaaa tcacgtaaga gtcaattacc acaagcaaca gcaagttaca aatgtaccgg    220440
     ttcactagca aatccttcca tctggtatcc tcattgattc cttgcaacaa caggtccagc    220500
     ctatccctta aaatccaatg gaacaccttc atgtatagca acaccaatgc gcatgtggcc    220560
     aatgtgaaga agtacttctc attgaaagtg gaaaacatga atatagtgtt tatcactgcg    220620
     aaaggcaatc tctcgaagat atgctcatgt tctataatgc gcagttcccc aaacagcatg    220680
     ctcgtcagga actgccacag cagtgtcgag ttcagcaacg tgaacacagt tataatcagt    220740
     atattgaacc cttcagacag cttcagagct atctgcaaga aggacacact gctctgacaa    220800
     gccgatataa cacagtatat cgtcagcaca tacgtgatgg cagtaaaaat cagaaactcc    220860
     cgcttgtgta tagccgtcaa catcttcacc ttcgccttct cttaccatca gcgttactgc    220920
     tattctggca ctactacaga agaacgacgg aacagcactc gcacccgtct cttatatatg    220980
     gtccaaggca ccagggctca taatggagtg ccatttcctc attgctcatt acaaaatata    221040
     gggacatacc catagacgac atagttaaga ggttctcaac aatggcatat tgttgaaatc    221100
     agtctaaaca taggattaca acagatatag tcctgagata ggtgaagctg ggcactgaag    221160
     tgctatgctg atttgtaccc cccccatcga tttcattacc agctgtagct ttccttcaaa    221220
     agcatttatg agatgtctta tgtttcaatt ttaagtttta ggttcatttt atattaaaat    221280
     tatagaaata aaaaagagta tacacattcc attaatatta caacttgtat tttgttaggt    221340
     ttttgggcag tattccgata gagtatgaca aatatgtaat ttccaataag agagagagaa    221400
     aaaaaatagg atcgaaagcg gaaaaaatca gtttctgttc ttcttaccca tctctacctt    221460
     caacagcaga gccttgttga tgtgtggcaa cacaccaccg gatgcgatag tggctctgat    221520
     cagagaatcc agctcgtcgt cacccctgat cgcaagttgc aaatgtctag gcgtgattct    221580
     cttcaccttc aggtccttgg cagcattacc agccagctct agcacttccg cagtcagata    221640
     ctccaacacc gcagtcagat atatagcagc cttagacccc acacgcgcct taccgctggc    221700
     gctcctcttc aaatacctct tgattcttcc cacaggaaac tgtaacccag ccctcgcaga    221760
     actagactgc gcacgcatcc catccttcgc accagactta cctttacctc catgcatctt    221820
     accagacatt gtgtttttac ttgtctttta tttgtagagg aaagtagctt gtagtttgta    221880
     gcttgtagat atagttatag ttatttgttt tgatttttga tttttgattt ttgatttttg    221940
     attttttgat ttttggcgaa agtcagaatc ccaaaaagtc gcgcgatgag cacaaagggt    222000
     tttctactgt aaggcaatgg atcccctaca acgcgttact acgggctttt ctctctttct    222060
     cctctccttc tcccccttct cccttccttc tacggctctt tctatacaaa acaaacacgt    222120
     gataatatat acatctatac gtacttgatc acatgtatta cccgttgata agtatttaat    222180
     acacgtgata tacaattgta cgtgtatcac atgattgacg tatcaaatga ttacacatac    222240
     tgatacacgg tacggcacct gatatacata tatacgggtg tacacatact gaagtacggg    222300
     atatcacatg attcagacac acatacactt actcgcaatg ctatttcatg caagcgataa    222360
     taacaacccg gttcaagaat atccagatag tacatgctgg tctgtatata ggtttactcc    222420
     ttttaactac ataaaacccc ccttgaggca tgggaaatca ttatctttgg gagttttcga    222480
     gtcctttgtg cgggcttctc tgtggggatc aacctctttt ttggcaaaaa aatcacaaaa    222540
     ctcgatgtga tgtgatgtga tgtgatgtga tgatcgcaac tgaaaaaaaa tacaaaataa    222600
     aataaaaaaa aaaatggctc agcgatgatc caaattatat aaagagctgt atataacaaa    222660
     tatttctaac tcaaaggaaa acgatcatcc gctctgacaa acatgcttcc gtctctcttc    222720
     ttggtgctgg tgctggtgct gtgctcggga tcgagcgggt actccgtcgc tgatcagtac    222780
     gccccgaagc tggcgtactg ccccagcgat gatataaacc tggtgcgaga ggcctcaggg    222840
     ctgtcccaga acgagactca gtggctgcaa agaagagacg tgcgcacaaa ggaagcgctg    222900
     cataacttct tgcagcgcgc cacgtcctct tcgcaaaact tcacgcagct gttccatcgc    222960
     atattcgacg ccgggatggt gccgaggata gggatcgcag tgtccggcgg tggctacagg    223020
     tcgatgctta ccggtgcagg tatactgtct gcattcgaca acaggacgcg cggcgccatg    223080
     gatcacggtc tcgggggcat tctgcagagc accacataca tgacaggctg ctcgggcggt    223140
     aactggctgg tcgcctcgtt gtcctggaat aactggacct cggtacagga tatcctggac    223200
     atgaactacg accgcaagac ggctaggaaa cagggcaaaa tcactaagga ccctatatgg    223260
     gacctgagcg actcgatcgt gtccccaggc ggtctcaaca tcatcaagac cgctcgtaga    223320
     tgggaccaca tcaccaatgc agtgaaggct aaacaggagg ccggcttcaa cacatcgctg    223380
     gcagacgtat ggggcagggc cctatcttac aagttcttcc ctactttgga gagaggtggt    223440
     attgattaca cttggtcctc tctgagagac tctcctatct tccaagcagg tgacatgcct    223500
     ctaccgatca cagtggccga cggccgttac ccaggctcca acgctatcgc actgaacgct    223560
     accgtcttcg agttcaaccc attcgaaatg ggctcgtggg atccctcact aaacgcattc    223620
     acagacgtca aatacctggg gacaaatgtc acgaacggta agccagtggc tcacacggcc    223680
     aaaaaatgta tcgaaggttt tgataataca gcattcatca tgggtacatc atcaaatttg    223740
     ttcaaccaat ttttactaag aatcaactcc acacatttac ctaatttcgt caccaaatgg    223800
     gcaacaaacc ttctaaaaag ttgggctcat gagttcaacg acgtagcagt ctataacccc    223860
     aaccctttca aagatacacg ctacgtgatg gagaacttca gtactagtat cgttgacagc    223920
     gaacaccttt acttggtcga cggtggtgaa gatgatgaga atgttccatt aatcccgtta    223980
     ttgcaaagag accgtgactt ggatattatc tttgctattg ataattcggc agataacaag    224040
     ctgcaatggc ctgatggatc ttctcttgtt cacacatatg aaagacaatt cgttctgcaa    224100
     ggacagaaaa tcgcattccc acatatcccc gataccaata ctttcatcaa tctcggttta    224160
     aataagagac caacgttctt tggttgcaat gctaccaata tgacaagctt aaaatatata    224220
     ccaccattgg ttgtgtacta cccaaactct gaatactcct tcaacagcaa tcaaagtgcc    224280
     tttaagctct cctattctag ggaccaaatg gctaatatga tatcgaatgg gtttgagata    224340
     gccactagga ataattttac cgacgaccca gagttcatag ggtgcatagc atgtgccatc    224400
     atgaaaagaa aacaagaagc acttgatcta gaactgccat cagagtgtga aaggtgctta    224460
     gccaggtatt gttgggacgg tactgtggat gacacaccac tagatgaatt gaaacaagat    224520
     gttcatcatt ccttcatcaa cccagaggag gataaagatg gtgatggtat tgacgactac    224580
     tcagatgaag attttacaga cgatgacgta gatgactatc acttctttca ctattcaaat    224640
     gtagacgaga ttcaccatgc ggcaacatat accggcaagc ttttaccgac aggagcaatt    224700
     gataaaggct caaacaaacc cttgataaat ttatcttcga agctaggtat tcctgcaact    224760
     tccattgcat atgcgatagt gacattcatt tgcactttat ccgcatcttt attatagaag    224820
     gaattattac ttgctttcta ctatgaggat ttatttgtgg ttgaaggctt tccctttttt    224880
     atagacattc tgtaactggt tgataactga aacattttgg aaagtcaact cccccccccc    224940
     cctcccgtag gcatatatca tgtatagact atattatatc gaacttcatt cgattcttct    225000
     caaagaatta tttacctctg cctactctgg tattcattca ataactatga cttgaatcaa    225060
     ctaccaggct atattttgct caactcaagt aattttcaca gacaagtccg tacagctttc    225120
     atttgtaagg tgaaaatttt gaaaaatttt gaaaaaaatt ttgagatgct catcgcaaaa    225180
     ttcgaatgca tagtatagaa taattgtatg aattgatcat ctatagtcag gagaggaacg    225240
     tcttattcaa aaattttcaa acccatattg tcaggagatt attctattag aactagaaag    225300
     gcaagtaatc ttttcagttt ttaccaagtg aaacaatgtc gtcccaatat gtggttttcc    225360
     agggacctga gaattttaga cataggatta tctttgcaac tttatcaggt aagccaatta    225420
     aaatagagaa gatacgttcc caggatttga atcccggttt gagggaccat gaagtgtcat    225480
     ttttaagact tatggaagct gtgaccaatg gtagtgttat agaaatatca tatactggta    225540
     ctactgtcat ctatagacct ggtattatca ttggtggccc ttatacacat acatgccctc    225600
     catctaagcc agtaggatat tttgtggagc ccatgctata tttggcgcca ttttcaaaga    225660
     agaagttttc catagtattc aaaggtatca ccgcctcaca taacgatgct ggtatagagg    225720
     ctataaaatg gggtttaatg cctgtcatgg aaaagtttgg tgtgagagaa tgtgcgttac    225780
     atacactgaa acgtgggtct ccaccacaag gtggtggtga ggttcactta gttgtagatt    225840
     ctctaattgc ccagccgata acaatgcatg agttagacag accagtgata tcatctataa    225900
     gaggtgttgc atattctacg cgtgtgagtc cgtcgatggt aaatagaatg atagatggtg    225960
     ctaaacaagt cttgaaaaat gttaaatgtg aagttaacat caccgcagat gtctggagag    226020
     gagaaaactc tggtaaaagt ccaggttggg gtattacaat tgtagctgag acaaaaaaga    226080
     agggctggtg ttactttgct gaagaaatag gtggctctgg tgatatacca gaagagatag    226140
     gttctaaggt agcctacaaa cttatagaag agatatcaaa gagtgccgca gttgacagaa    226200
     atcaactacc acttgctata acgtatatgg tcattggaaa agaagatatt ggcagactta    226260
     gaataacaag agaacaggtg gacgaaagat ttatccaaat gcttcgagat attaaaaaaa    226320
     tatttggtac cgaagtattt ttgaaaccag tagatgacat cggaagcgac gattttattg    226380
     ctacagttaa aggtatcggt ttcaccaaca caaataagaa aattgcatga acagatttca    226440
     ctaaatagca tagaatatat atcattattt aacttcacat taatacacca aatttataaa    226500
     gatcttcatg agctttcaaa acatcggaac gattgaatga atgtataaaa atcattcatg    226560
     cctggatcaa gttttgcgca aaactgtggt tagtcattaa tcattaaagt ctaaatttac    226620
     ccaactgggc caagccaact cttttcgcag aaaatctttc aatttctgaa ctataaactc    226680
     ttcaagctga ccgacactac gtagcgttga gccatcatct ttgaatctat ctccaatctc    226740
     ggtttctatt ttcatacttc taatgatgga aattctttcc aatggtttgt ttgccaaaag    226800
     tacaggtcca ttaggatcaa gaacacaatc cacatcatct agaaccgggt cactgacatc    226860
     gcacaacatg gatatgaaca cttgtttagc taggtacgat accagacaaa gcgagtgaag    226920
     accaatgtta cttatactaa tttttaaggg caatgtcatg aacctttcaa cagggtagtt    226980
     tagcaccaac tctgccgtca aagtgagcga catatcacct ttatattcaa attcgatcag    227040
     aaattgggta tctgtttctt tcttttctac taccgcctct tctccacttt caccgacgtt    227100
     ttgaccatct cttccgtgca tttctgatga tgtctcatta tcttcttcat attcctcatt    227160
     tacagcgtca taaaaatcct gaagcggact tgatatttcc cggagtgtaa tattgggtgc    227220
     tatcttacca aaaccaaaat ctactagctc aattgccctt acgtaactcg gtaactcaag    227280
     ttcttggaag tacccgttca atccttccct aatattgctt gtcagatcac tgtctgatga    227340
     aagcttctcc caattaatct caaaagacat ccttcagaaa gccaaagttc acttactgtt    227400
     cgggcagcaa aacaatagtt ttgaacttac actataaata attattgata ctgtttcttg    227460
     agttgtttaa tctatgctgt aaaccatttt taattaatga tcttgtatgt tctcacttcc    227520
     atgctcatct cttcaatttg aaaaagtaag tggaatttgg atgatttcaa gcttctacaa    227580
     agctgaggca atgactatcg actttatatg caatggtcct tcattaatca agctgactat    227640
     agcctaatat aactccattt tgaataatac ataacatcag attgctaagt tggagggaca    227700
     atgtcttacg tgggggtacg atgtcttaac cggtcgctat taagaccatt tggaacaagg    227760
     ggattttttg atcaattgaa ccctttccat gaaataaaaa ctcaaaaata tgtactgccg    227820
     aagataatcc aaggtacacc atcacaagta tatgatgtcg tctctgaagt gtcaaaatat    227880
     catgagttca taccatattg cgaagactcc tttgtaaacg agcgcgatga ctccaataaa    227940
     cctaaagtgg caggtttgag agttggtttc aaacaatatg atgaaagatt tgtatgtgat    228000
     gttgattgca agtctaaggt gagtggtaag gaggtttacg ttgtgcgagc agagtcactt    228060
     tcacacaatt tgtttgatat tttatcctcg caatggacaa taagcacgca cccgactaga    228120
     aaggatgcct ctacagttga gttattacta aaatttaaat ttaaatcacg gttatacaat    228180
     agtatatctt cgatatttgc aaaaagtgta accgaactag tcatggatgc ctttgctagg    228240
     agagtttatc acttaaagaa agccgcagta ctcgaaaacc cacaatgacg atctttatgg    228300
     atacttgtga aatttgaaca taaagtagaa actgtacctg tacataattc ggaatttatc    228360
     ctttaaatta tttgttaaac tctaatgtac atagttatat ataaatagta aaaatatcaa    228420
     atcttgactt gatcggaaat gacttttgct tattgatttt ccttcaaatt gatctataag    228480
     aggataacca tatccttagt gattttatat tattattttt tatggggaag ggtcattagt    228540
     gtatactcgc tataccttta atttgtatgt gtttcactac tacaacagca tatttcatga    228600
     ctgtgagcac cttatcaaat tttaagtata aatgtatcct ttagaagttg ctctttaaag    228660
     aacatatgca aaataagtgt attagaatgt tgaaaaaaga aataaaaatg attttaatgc    228720
     ctgttgagaa atgcagtgat tattggatgc cgtcgagaag gtcatctaaa tgagcgctcg    228780
     gaggtctacc tcttttttga ttcccattag gttttggtat tgccacacca ggtgtagacg    228840
     atatgtccat attacttagg tttttccctg tgaaaggtgg gtcacccagt ttattgagac    228900
     cattttgggg cactattata ttggcaacag attgctcacg aggagtgcta gttaatgaat    228960
     tgaatgccga gctatctgta ctccatgtat taccctcgtt ttttagtatt tcagtgggag    229020
     aaatgaacat agataaacgt ggattgtttg atggtggtgc tggtggttta gtgtcaagct    229080
     tttcggagct caaaagatta aacgccgagc cacctcctaa gctatacaaa ctcatccttg    229140
     aagctttctt cttcagaatc ttttcagata tatcacttgc aacatcagag tcactactag    229200
     aataatcatc cttgtcacca ttttggaagt agtaaggatc aagctgatat ttattttccc    229260
     gttctctaat ttggtattct tttcttgcat ttttccaaga ccgtagagtt aatgctatcc    229320
     aaactaacac aagaactaga gcaataaatg ctagacaact accaaaggcg gtaaaaacgg    229380
     taccagatgg atgtgtagca tgataaacat acttgttatt ttgtgcactt ggaatatata    229440
     ttgggccaac ggaaacagaa gtagttgatg gggtatagga agtatagctt gtcgtgctgg    229500
     atgtttctga atcagtatcg cttgttgtgc tagatgctgt tacagattca gaataaatgg    229560
     aggattcgga agtgcttgta atttctgtgg atgatccttc agtttcagag ctctctgagt    229620
     tgtctgaggt tgaggatgta ctaggctctt ctgtagaagt tggagttggt gtttcacttg    229680
     ttgtcaccag ttttggcaac cctctcatat gcaagtggtg ggaaggctgt gttgcaacca    229740
     caacggcgtc aacagacgag actaggaagg atgctatgag caaaaatatc tgtgtaactt    229800
     gtgaagattt cattcttcaa ccttatgtta gtatgaattg tcccttcaat agcaaaactt    229860
     tttaggtgaa tcttaaagac tataattata atgctatttt gtaatagtga tcctataact    229920
     atgcctattt agaatggtct tcagctctcc ttatataact atctccaaaa taattaggct    229980
     ttcgtttgct tccatcaatg aataaaacgc acacaataat aagacagtat ttactgcatc    230040
     tgagttattg gtcagctccc tcagcattta tataccagaa cagcattttg aaaagcccac    230100
     gatcctcatc tattagcaga atggatgacc ctccctgcta aaactgttcc atcaatatgt    230160
     gattatattt ttagatcata ttcgctcaca tgctgcgcca aaatctgact ttctctggcc    230220
     tttcagtcta tacatggtcc gaattctgag aataattttg ctttgccttt cttaatctct    230280
     tgcagcttat tactagatca tggttagaaa attatcagcc cttgatctgc actattacta    230340
     aacagtgggg caatatgatg ggttcagcac gaaaagtgtc tacttcatat gtttttaaat    230400
     tttccaattc gcgtttggcg tttcgcgaaa cctttggtcc gggtaaatta ggttatacat    230460
     tataaagata tagcatagta ttgtagtgta tcaatataga catggggtga attgttatta    230520
     ccacccttta ctaaggtatg taaaaagaaa agaagttgta taggtgcaaa attcaatatg    230580
     caagactttc ttatagaatc tgttagagct ataattcgcc ccgcaatatc aatctagtat    230640
     tgatttcgtt aacatacgaa aggttgttat ttggtgagtt gttaactaca tattaatgta    230700
     attgttataa ttcgtgtgtt agataactaa atgatttgta tcattaattt ataactaatt    230760
     ttaatgcaag ggtctttgta tgcatctaag taatattaga atctccaggt ttcatccact    230820
     gattcaattg cccatttgaa tttctccctt agagatttcg tgaagatttt ttctataggt    230880
     acgccatatt tcttacaaaa caccactgat aatctgggat caatatagtt aattttagat    230940
     gtgcctagag acacctcaga gttggcttct ctatcctgga gttgcacttg gcttgtggag    231000
     attctctgat ctaaccgttc aatcgctttt tctaattttt ctacactatt catggaagct    231060
     tttaactgaa caatacctgt ggctaattct tcagcatatt gttgttttaa ttgtttaacg    231120
     ttatcaagcc actccttcag cgtctcctca ggcaacggtt cttcaccttc gaatttccgt    231180
     ttatcgtttt ctcttttgaa cttgttatga tatttttgta tttctctttc tataattctc    231240
     tcatgaattt tagcctctat ttctttatcg atactgttaa tatcctcaaa ataatttgga    231300
     gtatccttaa ttctatctgg ttctatttgt agaatacctt tttttaatct ctccttttgc    231360
     catttgaatt cttctattct atcagaggat ttagcaacgg atttagcatg gcctgcagta    231420
     accgtccttt gatggttaca tagaattgca accgttctat ttgctgcgtt atattttagt    231480
     aatttttcag ccacactccc ttcatttgga ataagatcca gttgctcttg catggtctta    231540
     gaagcattgt aagtacgaaa aactttagca gttaaacctg tcatgtaatt ctgtagaaat    231600
     ttgtttaaaa gtgaaggatc taatctgtca aacaattgat ggccgggttg tttagggggc    231660
     tttttaaata aagccaaatt tttgaagact ttagggtcca cctgtacctc ttgatagaat    231720
     ctgattgaat ccttacccaa gaaatcgaaa atgactgtat tgggaggttt caaggttata    231780
     tgctcatatc ttaaggagca acatcctact gtatcagctt cttcttctga tttttcacca    231840
     ccagctctta aagcaaagac gtcaattaga tacactgcga cagccttttg tcgctccacc    231900
     ataagtttgc tcttgaaatt gtttcggtac tctttacgaa tcctgtctat gtgctttttc    231960
     aattccctag ctttctcaaa cttcttgaaa tcactttggc ccttcaatga ggaattggcg    232020
     gctaagcgaa cgtatttgaa agagccaaat atgttctccc tccacattgc cagccactgt    232080
     acagtattat catgtcgtat ctcaccccat tgatgaccgg aaggaggggg aggaatgggt    232140
     gctccctctc caaggtttag cactatgtct tcaggtctta ttcttctttt tagcttccca    232200
     gtttttggat gagcacctct tcctctaaat aaatcaggtg gttcaacttt aaaatttcca    232260
     acttgttctc gtctaccatc cagttcacaa aacttatatt tctcttcaaa tttctccctc    232320
     tcgagtctta tttccttctt ttgcatcgca gtcatactct ttttttcttc ctttagctga    232380
     acaaaataat catgcatggc agaaaagtcc attctatcaa agctttctat ttcaattcca    232440
     ttttgagtac cgccagcatc attgagaaca tgtttaaaat cctcaaaaaa gttcttttga    232500
     aacaccggat tttgagcatg aggagtttct aataagtgtg caaaaaaacc agcaacttct    232560
     tccgcttcca gaggtaaatc caccgggttg ccttcataat aaagtttaac atgggatggt    232620
     agagcctcat atggaggtgg aaataggaca ccattgtgtt ccaaagtggt ccacttaatt    232680
     gtgtcatctt tatcttgttc ttcccaccat ttatagtctt cttcaagatc atcgcttaca    232740
     ttttcttcaa gatcatcgct gataggcgag tcattatctg tattcactaa tttagcatcc    232800
     ttggtttctt catctccttc ttctgccttg actatgctag acttaagacc agttatatga    232860
     ttctcttcat catcactctc atcttttacc acattataaa gctttcttct ttttagaata    232920
     acaccatctt catcatctga tactgtcata ttgcctattt accagttttt aatctcaaca    232980
     cttattaatg ctcgtgatat aaatcaatta ctactataca ggattatgtc ctaataacaa    233040
     acaaatgggt gtgttctata tggtttccaa ccgcaatggg aattcagcat tttgggatgc    233100
     tcatcggtat tttacgtgtc gcgtgcaatc atagtcagat tcaagaatct ttgaaaaatc    233160
     tagcctcacc gaggatatga aagcgaggga aaaatctctg cacaaaatgt gattttctta    233220
     taaagttagg ccaaatgctt tcattaatgg ccagatatac tctataattg catattcttc    233280
     caaacataac ggcttgcgtt attggatttt agaattttat ggtaaaattt ataatgcaaa    233340
     atcagtcatt tttaaaaggc gtcatccgca gctaaggttt gcaagttcca ttccgtttcg    233400
     aagttagatt tcagagctcc aagtttatta ataatggagc tacaagcatt ccttaaagcg    233460
     tcttttgggt cgtatccttc aactgtttgg attctcaact taaatctagc aaaaaatgga    233520
     tgctcaacct tgtaagcagc gaaaagcacc ttattgtcgt taagaagttc tgctctgatc    233580
     aagttaccta atgtgtggtc ttctttctca aatgttatta ctacagcatt tggagctttg    233640
     gtatccgggt caattttcag cttggattca ccttcaccta gcaggaataa ttcgaatcta    233700
     tctggagcat tcattgtgta atattagtat atggttattg ttgttaagtg atatctcgac    233760
     tagcttctca acaaaatgat tttcttagcc ttagtactgc cttcccaagc actaatcttc    233820
     ttatactttt ccactttcat cagcgttttg tcatttcgtt attttcaatc gtggactttc    233880
     tgttactgtt ttttttttcc tctttcttcg gccgcaatac tgctacaact acttctctgt    233940
     agagagaatc ctgagtttat cattttgtcc cctcctccga cctgcaactt ttgtcaatcc    234000
     ataagttttt tctttgggtt gctgtcatct cttggtagga tatagcttgt tcgatcacgt    234060
     gaattgttat ttattgaaga gcaaactgta tagtgtattc attttaaact ccttaaacct    234120
     ccccgctgga ttgttactcg ctttagtagg agatttattc actttagttc ctaattgcga    234180
     aattcgagga agagtagaaa gtgaagttaa ccgtttggcg attgagctgg ctgtatttat    234240
     attcggggcg tgataactgc tggaagtact aagataacgt agaaagtaca cccaaacgcc    234300
     cccttcaaca aaaccctgtt atatataaag ttatgtacac tgtaatgcac gtataggatc    234360
     ccttcaagta tattacagac ggttcttcct agttatagtg tcgtaagtaa gaatttagcc    234420
     gccaattcac acacacttag ttgctctgac cctcttcttc agtgtctgtc gatcctagaa    234480
     tttagcgtgc acacagcagc aaaagactac ccgaaacggg gaatggtagg cccttggtat    234540
     actagtgctt gtctagtaag aaatgggcgc agaaacatat aatggaaaaa gtgtaggcga    234600
     tgcacaagtc actattcccg cctgcactct tgcacgagat ttctgagggt taggatataa    234660
     aatgcccatc gctctgaatt ttgatgcttt ctttgtgcta ggagtcgtcc acaagatctc    234720
     taggtgatca cctagagatc tcgtaaagaa actcgttaag gactcgtaaa ggacttgcgg    234780
     agggatgaat ggctacatgg gcggctatta aggttttcag cttcgtgtaa aatcttcaag    234840
     gtaataggta aagcttgtaa atagagtaag cattgtagag ccttagagat tgacgtggcc    234900
     aagcttaaca gtgctctttt atttggcaat atcagatcta ttactatcgc aagtttctag    234960
     tctccatgag tctctaccag cccggagtag accgaactag caatgccaga ggaaaaacaa    235020
     aaaaacggat ctcagattgc cgccgaacgt atattcccat atggtgctgc tggagaggca    235080
     cgagggggga gggggaagta taaataggcc acggatagtt agagttgtgg ttcttttttt    235140
     aagagggtaa gcttctgttc tttttataag tctgatttcg tactgcgttt cacgtttgaa    235200
     caacatttat ttaagaatgg gtcccatgtt ttgtatgtat tacaaccccg atataggcca    235260
     tgtttacgca agaatcattt ttaatatact agtcatttat gaatcctgac aacatttacc    235320
     tttagttttt gcagaaatga tcaaaagttt gccgctagag tgatgtcaac ccggaattcg    235380
     agagaggtaa tctcctttga agacgtatcc gccaaataaa cttgaatcga aaagtgttta    235440
     tagtgaggaa atcagtatgg atagtgcgtt ataggctttt ctacgataaa cagggagttg    235500
     cgtcatgtga atatacaaca ttaattgtta actcgcagtt gacaactttc acgatatcag    235560
     acaaaaattg ggctaaggtg tcttgcaacg accagggggg aggagcagaa atatgcccaa    235620
     ctacaattga gatagcataa cggttgtctt tacgcttccg atccacccaa gtttcattcg    235680
     acaggaaaag tacgtagaag cttttcagct ttttcagtta gctgtgtgat ttttgttatt    235740
     ttagcctgtc ttgtgtttgg ctcttcccaa aaatgattga ggaaagaaag gaggggcgaa    235800
     agagtaacca tatccatctc tacggatgtt cttagtgagc cacgggtagc cttgcaagag    235860
     tatttcaagt tttcttgtgg gaatactgtt cagagtaaga ttgccaaaaa aaaaaaaaaa    235920
     aaaaaaaaaa aaggaattga tcaattcggt tttgttagaa ttttagggcc caactctctc    235980
     ctggtgtctc tcagaattgc atttcctgaa aaaaaaaata caatactcca ttaagtatcc    236040
     tgctaaaaaa gaaagcaaaa aaaaaattaa gagaaataaa taaagctata acaaacatct    236100
     attcaaggga attgatacca gagcaaagat tagttacatt tgattgataa taggtataaa    236160
     ctaataaaca aatcacagtt tgcaagtgca gaaacactag agtttcctta aaggtgtgac    236220
     aggagctaat tcaagatcaa attgtctttg gtttaaagtc aaactttcag aacagtcaaa    236280
     acattccatt gttgcatagc actagactgt cattttcata tctatctgcc cagaagtcag    236340
     attgtgtatt cctgacttac tgtgtttcaa gactaacaat atcatcaaat tgaaactgtt    236400
     gtactattac aagttgaatt aacgagtgct cattaggttt tgatacgtta gtctcttctt    236460
     ttgttacact gttataagta acaacaagat aactatatca aacccagcta gctattccta    236520
     ataccgacag attaactata aaaatagtaa taattcatca tttcaaaaca cccaatatca    236580
     tgagcaacca acaaggaagt gtcaaccatg ccattggtag tggtgccgca gaaactgtta    236640
     atgtaacaca aaatgccaca agtaatgttg ggattaatga taatcagaag attgacggaa    236700
     atgccgaatc atctaattca atcaataata ctagtaataa taataataat aatgagagaa    236760
     ttatattacc atccttctcg tccctaaaaa cagaagataa tcgtatagat acttccatga    236820
     atccaatagg tccaaagtct atcacaactt cttctagtac gcctgcttct gtaggatttt    236880
     ctgttgccag tcttgataat cctttacctc ctgctactaa gaagccagaa ataaagcttc    236940
     atccactacc tcaacagcag cagccgagga tctacactca acagcaacca cagcagcagc    237000
     aaattcttca acaagatcag caggaaattt tgcaaaatca acgccaaggt agtacaggcg    237060
     cttcagaaac atctacaact cagtcacccc ttgtgtcagg accggcgcag acacagggtg    237120
     accccatgtc ttatagacct ctaaatgtta aggatgcatt gtcatatttg gaacaagtta    237180
     aattccagtt tcatacaagg ccagacatat ataatttgtt tttggatatt atgaaagatt    237240
     tcaagtctca gacaattgac acacctggtg taattgagag agtatcatcg ttatttaaag    237300
     ggtatcccaa cttgatccag gggttcaaca ctttccttcc tcagggatat aggatagaat    237360
     gctcaaataa tccaaatgat cctatcaagg taactacacc aatggggtct tctacgactg    237420
     tactaaatac agcccctcaa aagtctcctt caccatcaga tatccagact aataatcagc    237480
     aaacacaggc tattgctcaa gaagctcagc tccaatctca ggcaacaccc atcccaacac    237540
     aacatgatgt aggtcaaaac tttggttctg caaagaagcc tgctgatgtt gaatttagcc    237600
     aagcaattac gtatgtgaat aagattaaga ctcggtttgc tgatcagccc gatatttaca    237660
     agcaatttct agaaattctt cagacatatc aaagggaaca aaaaccaatt catgaagtgt    237720
     atgcacaggt aactatatta tttcagaatg cacctgattt gcttgatgac tttaagaaat    237780
     tcttaccaga ttcatcagct tcaggatctg aagaaaccca ggttcagcaa cagcagcatt    237840
     atcagtcttt atcagataag atgggaggta atgctgaggc tgcaaactat gctgcaagtg    237900
     ggatgaatgc tcaaacaggt tattatgagc cagtgaaagg gggagtttct tacaatactc    237960
     aacaaaatca acatcaacaa cagaacctcc ctccaattgg cagtttctca ccacctacaa    238020
     atgggccttt tgttgatcaa acacagcaat cagccaatcc ggaaactcag aaaggtgtta    238080
     tgagcttgcc ttctatgatg aataatgcag aagcagtaaa ggagcaagct ataaagcagg    238140
     cgcactctcg actaatttct gattctcatg atcacaattc ccagcaacaa gttctctctc    238200
     aaaatatcca cagtaatgat gacattcctg tttccaacct aaggacgact gttgttgagc    238260
     aaaattatca cccggaaaca atttatcaac aacaaggtaa tgctcaacaa cacatggttg    238320
     atgggggata tgttggtaca cctagtgagc tagttgttag accggagata gatttagatc    238380
     ctagtctcgt tccagtagtt cctgagccta cggaacctat agagaatagt ctaaatctga    238440
     tggaagaaac taacttcttt gagagagtta aaaaatcaat tggcaacaaa caaatttata    238500
     atgagttcct aaagatcctt aacttgtttt cattagatct tctgacagta gatgaattgg    238560
     tagacaaagt tgaatattat attggagcca acaaagaatt atttgactgg ttcaaagtct    238620
     ttgtcggtta tcaggacaaa ccaaagagaa tagaaaatat tgtgcatgaa aaacataaat    238680
     tagatttaga tctatgtgag gcctatggtc ctagttataa gaaacttcct aagactgata    238740
     cattcatgcc ctgttctgga agagatgata tgtgctggga agtgctaaat gatgagtggg    238800
     tcggacatcc agtatgggcg tctgaggatt ctggttttat cgctcataga aagaaccaat    238860
     atgaggagac tttattcaag atagaggaag aaagacatga gtacgactat tacatcgagt    238920
     caaatttgcg aacaatacaa accttggaaa ccattgccaa taagatcgcg aacatgaccg    238980
     atgcagaaaa ggcacagttt agattgcctc ctggtcttgg ccatacttct atgacaattt    239040
     ataaaaaagt tattaggaaa gtttatgaca aagaaagagg atttgaaata atagatgctt    239100
     tgcataacta tccggccata tcagttccaa ttatattaag aagattgaag caaaaagatg    239160
     aagaatggag aagagcacaa cgtgaatgga ataaaatatg gagagatctt gaacagaaag    239220
     tttatttcaa atctctagat cacctaggtc tgacatttaa gcaagccgat aagaaattgt    239280
     taacaacaaa gcagttaata tctgaaataa atggaattaa agttgaccag aatagcaaaa    239340
     ggattcattg gcttacccct aaaccaaaaa accaacttga ttatgacttt ccagattatg    239400
     atatattatt cgatattatt gccttgggtt ttgtttttac catcaatact aacctttact    239460
     ctaacccaga taaggaaaga attaaagata tgttgagagt ttttgtatca caatttttct    239520
     caattccatt aaaggaggtc agtgacgcct tggaacgcag aggattcagt gatgacaaca    239580
     ataatgattc tgataagggt agtggaaaaa tggatcagat tgctgaagaa attggtgaaa    239640
     ctgagcaaga cacatcatca tcaaagaaga gaccttttga caatgatttg aacatgtcag    239700
     atatcttaca taaaaccaag caacagaaga caaagatgaa taaagagatg gatggcagca    239760
     aatccccttc ggaagatctc ggtacagata gaaatgtagg tactattgaa gattctggca    239820
     gtctctccga acacaggaaa caatggttag ttggtgatgt ggttgacagt gcgaacaaag    239880
     agactccaat ggataacagg aacatttata acttgtttgc taacaccaac atttacatct    239940
     tctttaggca tttagttaca ctttacgaga gattatcaga ggtcaaacag attaatgatg    240000
     agatcaataa ggagatcaaa tctagaaggg taacaacttt tgctaaagat ctaggactta    240060
     tttccactca actatctgaa ctaggacttg attttaatag ctcagatgct tatcaacaac    240120
     ttttgacatt gagcaagcgc ttgatagagg gtgatattga gcaccaatgg tttgaagaga    240180
     gtataagaca agcatataac aatcgtgcat ttaagcttta tacaattgat aaagttgtcc    240240
     aatcgtttgt gaagcatgcg cacactttga tatctgattc aaaaacatca gaaataatgt    240300
     tgctgtttga aaatcaaaga aataatacct taactaccac taaggaccag attctataca    240360
     gaattcaatg tcgttcacat atgtcaagca cagaaaatat gtttagaatc gaatataaaa    240420
     gagagaaacg tcatgcatca attcaataca ttgctcttga tgacctaact ttaaagactg    240480
     ctaaatcacc agaggaggcg tggaactatt atgtcacttc ttactctcta tcgaatccaa    240540
     ctgaaggggt tccgcatgaa aacttagaag tgccattttt agagaaagta attgaatttg    240600
     atcaagaata tagcaaggac aatggtaata attcaactta ttctttggct ggtatttcaa    240660
     agtccaactt acatattgat atcgacagag agaaatataa cttgatttta caaggcggat    240720
     cctcagatgt atactcacgt gctactattc aaaagtatcc tattgttgca agtgatgaat    240780
     caagagcagc aaatatttca gagaaaactc aagagatcag aaaggtttta tcacattacg    240840
     atggaaattc gaatgatgac gtaaatgaga aattcaacta cattcttgcg aatggaacta    240900
     ttgacggata tgtgagacag tctgcagctg ttgttcaaga gacggagaag acttataatg    240960
     atgattcggg tagaaatacg agcagtatca agtccataat tggctctgcc actgaaagaa    241020
     cagaaaagcc tttaattaat ggctccccta ttattgatta aaaatacaac atcaatcgga    241080
     tcataaataa aacatagatt ccattaccca tataaatata tatatattag tactaattgt    241140
     aatgataacg tgtaactata ttttgtaagt attgtaattt tctgcctaca tcagttatat    241200
     tttctcgcta attgttgatt atttataaga cgcgagatat tagtatattc attaccaata    241260
     aaatatgctt acagaaagat taacttcaag taagaagccg tatcatagaa agaagtagta    241320
     ctggggtaat gagtataaag agcaaatgta taaattactc aacatccaca tcgactccaa    241380
     aatcttcaag cgattcaccc cagtcattta gccattctga tctggagagc tttttttctg    241440
     gtgttcggat tcgtattact tgttcacctt cttctgagat gatctgaaca tttgatgtat    241500
     gttcgctagt agaatttaag tgcttagtcg aatctggagg ccaagggaga caaagtataa    241560
     tatcattcaa agaattagga tcttctatca tggactcctc attcttttgg aaatgtaaac    241620
     catcatcttg tggcccgcta aatggataca accataaagg cggggtgcct aacaattgaa    241680
     ttgcgttcct gaaagggcca agatcataag gaaaattaac taattcatcc aacgataatc    241740
     tctttttgtt taacagggct tcagcctggc tctcaacatg ttcatttcgt aggttaggga    241800
     agatatacca aacattctct attaatatag gtaatagttt actcattcga gctaaagttt    241860
     ctaatctatc catttcccaa gattctattt gagatcttcc attaaatatt tggttgaata    241920
     aacatctgat cattaaaatg ctaattgtta ataatatgaa agcattgagt ggcgttaaaa    241980
     tagtgagaaa tatcaattcc gatttatagt agagataact tggcgagctc cggtgtaccc    242040
     atatcgaatg gattctagtt gttaaaaata tagccaaact agtagtgcca acaatcaccc    242100
     aaaataaaaa tcttataaaa tgaggaaaat tgttatagcc aacacaattc atagtccaag    242160
     ggcaatgatg atccatcatt aggacacatt gattacatgt tttgcaatga tgacttcttt    242220
     ccggtttgta acacttgcac tttttgcaat acactttcca ctcattttta gatggtttaa    242280
     agtttgttgg aggttttcct ggtggtgtgt atattgctaa atagtatgat agccaaatca    242340
     ttgtttgaca aaactgatac cacagctgtt ttcgaaggct taagaaattt aataaaatga    242400
     agtaatgtgc acagtagcca atggatgcaa tcaaaaaact aggtattgca atgcctaacc    242460
     atggccattt taatttcacc ggcataataa ctgattaaat tagtgtcgat cttgattgag    242520
     gtcaaatgat catacagtaa atcaaaaaac tttgaaaatc agtgtgctat tattttctta    242580
     ctttaacctt gtaaaccact agattcctat cttctcataa gtattttcta tagtcaataa    242640
     tgttatgtta ctttactaga tcaaacatac taaattgtca attcggtact ccattaaaac    242700
     tgtatctcgc tacctttttc aaagttggtt aattagtgga agtgtgcact gttaggccaa    242760
     ttagccctcc taaacataaa ttatacatac taagttatac atgtaaagtc atgaatctga    242820
     atcattttaa aacaaaatat aaaacaatct ccatactgtt taatcctcaa tacatatcta    242880
     tcataaatct ataatggact aaagaatagc tacctaaaag agcctttaaa tgacaaaggg    242940
     cagctacaac caccaaaatg tgaaatatct gatgagaatg gccccacaga tcaaaacttc    243000
     cgggactcat cttctctgga aatctaattc cgtacagaaa tgcaccaaat atataaaata    243060
     caccttctaa gataacccac tttagttgta tccttgtcca agtttcagta ggaccatact    243120
     tgaaaagtcc agctagaata ggcagtactg ctgataaacc aaatatcaca aacagagctg    243180
     ccctgtatgg tctccattcc cgcgatctaa aagtatcttt gagtgacact acggcgcatg    243240
     ccgccccaaa agtcatagtg attaaagaaa atataccgaa gaaccatgga ttaccgtgaa    243300
     agccataata taaaatgctt accattgatg caacaatgag aaatacaatt cctagataat    243360
     caagcttatt gccaaagaca gctactctca acgaatggct ctttaagcaa tggaatgtgc    243420
     tacttaggat caaacatgag aaagcaccta ggaaaaatat gtcaataatc aaatagtcta    243480
     tcaaagtggt agtactgtat gtgggcacaa catacttatt aaagaatatt gtactgaaga    243540
     aagcaattgc aggtatcaaa tgtgagtaga tattcacagt ttcattatga agatagaaca    243600
     aactgcggat acactccatg acactgctag tctccctcac gtaaccagtg tgaatgtgct    243660
     cattatcctt ttgccattca ggtatttctt cccatgtata tagtttcctg acaaccgtct    243720
     tcttccgtag tttgatttgt ccatctgtac ctataagtgg ctgttcttct gtggtcacca    243780
     ttgtggcaac ttttctttga tgtacgtcac ccatctaccg tattttcgaa tcgctatact    243840
     actaaattaa tagtgagagc atgctatttt cctacagtat ataaatcata tctttctagt    243900
     cattatatat ataaaccgat tcatcgcgag gtcaccggcc ttcgcaagtt ttctcccaga    243960
     aactcaacaa tcagtctcaa ctaaatctgt tgtactcgca taattgaagg aaatccaagt    244020
     acgcaatgca agacactgaa tacaccaaat atataggtta tagacaactt ccggcattag    244080
     taaccctcgc tccgcaccta tatgtcttta caacatgatc attgcgaact cgaaattggt    244140
     cacatataca tatacaccta atggcttcca tatactttaa taagcacaat cgctacccta    244200
     cacattaaca atccactatc aacagcggct ccgaccattc tcttgacttt taaataatgc    244260
     cgtcactagc acagctgcct ttatgactcc aattcttgcc tcatatagat tctacatttc    244320
     aaagctaatt gagacatttc cttgtcttta ccaaatgctt caaacaattt tttttcagaa    244380
     atcgtcgcac aaaaacgtgt caaaacttga ttccagttca acattaaact gaaaagcgta    244440
     aaaccagctt agactaattg tagttgctat actttatatt acaccagaca tccttagtgg    244500
     attaataacc agtgatagtg atattgatag aatactactc aatataagcg aacagttgaa    244560
     acaagacctg tattgcaagc atcagagact cgtttgctgg gtagacattg tgctagattt    244620
     tgtactattg gtttagcctc acatacaaaa tcacaaatct tcataaatca atatatttat    244680
     cgaagtttgg atacgctatc aatacaccat taatcaagaa gttgcatatg ctaaactagg    244740
     aagagaagtc ttcctattag cattttattg tatcatatca tagcaaactg ttatgaaatt    244800
     agagtattaa actatgactc cccaagatgc tcagatcaat acagatgaag aaataccaac    244860
     tatcaaacta ccgagagatt ttctgaagtg cccgaaaggt gacctagtca ttctaatagc    244920
     acgaatgcta cagtttatca tacagatcaa tgactccaat attaaggaaa acgaacgaaa    244980
     atatggcctt actagatttc attcaaaaat agcacctaat atatcagtat tcaactactt    245040
     taccagatta accaaatatt ccctattgga acattctgtg cttttatccg cagtttatta    245100
     catcgacctt ttgtctaacg tttacccagc attcaatctc aactctctaa ctgcacatag    245160
     atttctactg acagctacca ccattgcaag taaaggcctt tgtgattctt tttgtacaaa    245220
     cacacattat tcgaaagtag gaggtgttca atgcaatgag cttaatgttc tagaaaatga    245280
     atttctgaga aaagttaatt atagaataat accgcgagat aacaatataa cgttctgcaa    245340
     aatggaggta cagaagaatt tttttatact accagagtca atagaatctg acttagcccc    245400
     ttccctgcgg caagggtatt cgtcaatatc aaatgcaggc tataacgttc tgacacgata    245460
     ttactataaa attatagaag ttgtagggaa atatagctct tccccagaca aaacaaaaaa    245520
     agtcaattac gacatagata tgcctgctaa aactttgcat gaacatcagc aaaatgatgc    245580
     tgtgaaaaac tgctcaaata acaacagcaa ctatcaaaca gctagtaata atattcccat    245640
     cccacaaaca atacctcaga acagaccgaa aagaaacttc gacactgttg aagagaggca    245700
     taatatctac atcgaagaga aatctaaaat gaataccaat gggcttgccg aaaagttaac    245760
     atcttcatcc tataaaaaac aaattactga agataaaaag aatcaaatac tagataatag    245820
     catatatcct tcatctatat aatcccatat acatttaacg aaacgattcc actgcatttt    245880
     accaaaatta cattttgaaa caaactaatt actgcttttc taacaaaatt aattacttcg    245940
     gaaaccataa cctttacgac cataaattta aaaaataatt gatttagttt aaagttattt    246000
     aaaatgtata gaaaaagtat gtatattaat cacatgatca gagtaataat atgagctttc    246060
     ctagtttgga tcgggattta ttaggtgaac ttatatataa tagtaagttg tagacctaga    246120
     tgaatatgaa attaatataa ttattaagta ttattttggt ggattgtgaa acttggttgt    246180
     ttgttgcaat atttttcgtt tccagtttga ctttgcttta taattgctta ctgggtcaga    246240
     ggtgtgtatt tcacacgatt taatctcatc gctagtaaag ttgaaaattt attcaattta    246300
     ctcgatgcga tgagatcaaa tgtcataaga atagtaaaga ttctgaattc taatgttcat    246360
     gggtaaaaat agttgataca gataacaatc agtacccata atcaatttct atatcccata    246420
     ttcatcatgt cgagtgacag tggagataat gtgctgaaaa aagtaatgga gactgtcaga    246480
     gcctctaatg ctctagcatc gcaagatgta gaatttcata agagtataga cactagcgtg    246540
     gcaaactcac tagaaaagag tatgaagagc atggcatcgg tgatgaacaa tatattacta    246600
     tcaatcgata acaataacga gaaacttgat ggtaccaatg aaaacctgga ggaggtatgc    246660
     aaagaattca gcaatgtcat ggatgttcta ttcgaaaagg ctgatagatc gctagatatt    246720
     cttaatagga aatcctcaac gaatgataac aaaaagaata tgcagtttct tgacgatgtc    246780
     aatgtagcgg agaatgatcc tagcagaagg atttcaaaac cacagctgaa ttttaaaact    246840
     cctgttgaca acagtgaaag ccacccattt aagcctctgc ttatcgagaa gcccaatgca    246900
     ttaaagtcta ttgaagaatc tacacaactc gttttagcaa cagaggatat cccagagcat    246960
     ttccaacaac catacgagta cgaaatttta aatcaagaat acaataacga tattttggag    247020
     aaaaaagaac caattccctc aacttcctgg gttgatacca atgctatctg ggtagacaac    247080
     atcaatagtc tacaagatat gatgcaagaa ttaaagaaat cttcagaaat tgctgtagat    247140
     ttggaacacc atgacttcag gtcttactac ggtttggtgt gtctaatgca aatcagtaca    247200
     agaactcagg attatattgt tgacactata gctttaagag atgatcttaa aatgcttaat    247260
     gaagtgttta caaatccttt gatcacaaag gtattccatg gtgcctttat ggatataata    247320
     tggttacaga gagacttggg gctttacatt gtgagtcttt ttgatacgtt ccatgcgtcg    247380
     aaggctcttg gtcttcccaa acatagcttg gcttaccttt tggaaaaata tgccaatttc    247440
     aaaacctcga aaaagtacca actagctgac tggagaagaa gacctctttc aaaggcaatg    247500
     atggcatatg ctcgtgcaga tactcatttt ttattaaaca tatttgatca gatgagaaat    247560
     gggctaattt cttctgggaa actagctgga gttttgagag aatctagaaa tgtagccctt    247620
     agaagatttg aatactcaaa gtacaaacca aagattcctg tggccaatat ttttactcct    247680
     gttgaaaaag aaagtccttg gagaacttta atgtatcaat ataatattcc agttgataag    247740
     gagccactaa tccgcgagct ctatgagtgg agagatatga tggctaggcg agatgatgaa    247800
     tctcctcgtt atgttatgcc taaccaacta ctggtatctc ttgtagcata tggtcctgtt    247860
     gaccctattt ccgttgtgtc agtaagcagt gttgttacag atcatgtgag aagaaattca    247920
     aaaactcttg ccaacctgat aaaaaagaag ctggaagaaa tcaaattggg agaagtgaaa    247980
     tctatcaaca acagactacc aagctcacta gatgtctcac aggatgaatt acagttctta    248040
     ccatcacata agattgaatt aatgaccggg gctttcaaag aaattgaaaa tcaactcact    248100
     caggcaacta agtctaagca agccatgact tcatcagtgg tgcttagcga aatcctgcta    248160
     caccctgaac atgcagtaaa atatcataat ggtagtgcat gtagtgttga agaatcagaa    248220
     ttgaaagata ggtatttgtc atatattaag gctactcttc ttgcggcaag caaaaatatc    248280
     aatatggtgc tggaaacttc aaactctaac gctccattag aaactgaaga aactcataac    248340
     aaaaagagcg atcaaattca ggttatccca gagaaacaag aagatatgga tgaaattgtt    248400
     gttctaaaga aaaagaaaat tcattctaac gaccagaaag ctaaacatga tgatggagac    248460
     attgttgaag agcctgttga ttacagtaaa gccaatattt tagctagtga taatagagaa    248520
     gttaaaaaga aggacaaaaa acgtgtcttt gatccgtact cttccactgg tgaaggtcca    248580
     aaggctgcca aaaagaggag acttgtaacc aagggtaaaa agatatcatt taaaaaatag    248640
     tagcattatg acagaactca agtagctaaa cataaccatt atcaaagttt gcataatttt    248700
     tttgcattat tgaatattaa gcatttatat cgaatttagt ttattattat aactaatcac    248760
     tctacattta taaaccctca ataagtttgt tacatggatg aataactagc aatatgacgt    248820
     gtgtattttc aacttggaga caagtaagaa tcagttaaaa ttattaggat tagaaaacgc    248880
     tcttaatata caaataaaac ttattatata agttacaccg cgagtgcatg tactggtaca    248940
     aagtaccatc gtgcaaaaaa cgaattgatc agataattct tgaccatgat attcatttca    249000
     acaactacat gaattacttt cgccttctaa ttgaatgtta atggcatcgt tgaaatcatc    249060
     ttcaaatgca tgtgcgtcgt tttgattctg ttgtaatgca ctctttgcta tttcttcaaa    249120
     agcggtatcc acatttatgg cactcttggc acttgttaaa aagagaggta catctccaag    249180
     tgactttgcg agttcctgac ctgctttctc actcaccact ttcttagagt cttcaatatc    249240
     tactttgtta cctaggatca cgaaagggaa agactccggt gaggatatat tagcatgaac    249300
     caaaaactca tccttccagg actttatatt ttcgaaagac ttcgcattcg tcacatcata    249360
     gactagtaca caacagtctg caccacggta gaaagcaaca ccaagggact ggaaacgttc    249420
     ttgccctgct gtatcccaca cttgcattgt gactactttg tcatcatcta aaactacctc    249480
     tttagtcaaa aagtcagcac cgatagtagc tttatactgt tgagaatact tatcgttcac    249540
     atatctgtgc atcaacgatg tcttaccaac tccggaatca cctaggatta tgaccttcag    249600
     tatattcttc ttccttgcaa tcatctcaac aactatattt cgaccaactc gatatcgatt    249660
     agtctagtct ttactttaac tgtagaacaa atactgatta ctaaagtcca ggaacacaca    249720
     ccaaaatgct atttctaacc aagtaacctg cttattattt tgaagtaatc ccttgttgat    249780
     agcttctgaa atcccaaaag tggtcttctg gacttgcctt cgtcccgaaa gttcaagcga    249840
     gtcaaaagac ccttcgagtt tcgaccatag ttcatcacat tttatcaaat tcatagttac    249900
     aactgggaag agattgatac caggtgtata tcttggctcg agattgcaac aacaatagcg    249960
     atagaaacag taaggactaa cttggatcga tcagctttgc accaatacga tgagcagcga    250020
     gaagaaggat aagaaggctg tcagtaagtt tgagagtgag caaggtgagg agtccttcta    250080
     tgcgtctcca ctgtatgatt tcttgtttcc atttaggcct gctggcagcc aatggcttac    250140
     cgagtggata ataataatgt ttgccatgat tataaggtgt gctataggtt taggtcccta    250200
     ctccggttat aaggatggtc ctatgcatgg agattttgag gcccagagac attggatgga    250260
     aatcacacaa catctaccca tatctaagtg gtattactat gatttaaagt attggggttt    250320
     agattatcct ccattgactg ctttccattc atatctactt ggtaagctcg gtaccttttg    250380
     caacccagac tggtttgcac tagacagttc tcgtggtatt gagacccaag gcttaaagaa    250440
     ctacatgaga tttacagtac ttttaagtga agctatcttc tacatgcctg ctgtcgtgta    250500
     tttcacgaaa tggttaggta gacgtagaaa tcaatcacca attggccaat ttattgcagc    250560
     agcagccatt ctatttcaac cttctctgat gttaatcgat catgggcatt tccaatacaa    250620
     ttcgataatg ctaggtttca cagtttatgc aattaataat ctactggatg aattttatgc    250680
     gccagcggca atctgttttg ttctttcaat atgcttcaag caaatgtcat tgtactacgc    250740
     acctattttt tttgcttacc tacttggccg ctcaatgttt ttccctaagt tgttcaacat    250800
     ccctaggttt atttccatct ccatcgccac attggttacc tttacagcga tgttctcacc    250860
     tttctacata tttggtggcc ttgatggctt ggctcaaact gttaggagaa tctttccatt    250920
     tgccagaggt atctttgaag ataaagtggc taacttttgg tgcgtagtca atacaattgt    250980
     taaattcaaa gttcttttca caaatgatca gttaagaatg tactccttaa ttcttacagt    251040
     ggtcggtttt gcacctgcaa tgatcttgat tatattatat ccaaggaagc acttgctacc    251100
     ttacgctttg gcagcatgtt ccatgtcatt ttaccttttc agtttccaag tgcacgaaaa    251160
     gactatcttg gtcccactac ttccaattac actcttattt acctccagag attggaatgt    251220
     gctatctatg gtaagctgga taaataacgt ggcgctattt acattatggc cactattgaa    251280
     gagggaaggg ttgtatctac aatattttgt ttgcttcttc ttaagtaact ggctgattgg    251340
     taatttcagt ttcattactc caagatttct gccaaaattt attacaccgg gcccatctat    251400
     aagtagtgta agtgataact acagacgcag gagtctgctg ccccacagca tcttttggaa    251460
     attgatcata gtatcatcat atattggtat gactgcatac catttcctgg acttattcat    251520
     tgaagctcca ccaagattcc ctgacttatg ggtgattcta aactgcacta tcggattcgt    251580
     atcattctct ttgttctggc tatggactta ttacaagttc tgcacattac tgaagaaaaa    251640
     tatccaagat ctatagacta aatatatgga actttcagct acatagtttt ttttactgtt    251700
     aagaatcata ttgtaatata ttagatgagc tgctcgatac atcccattag acgtcaatga    251760
     ggagcaataa gcagtacagt tgaaaggcat ataacggaaa actgagtcat cataactaca    251820
     aaagtattgg actatgatag atatagccaa agtagaatag agcaattatg ttctctttct    251880
     atttgataac tagtgtctat tacttttgga tttttacctc agtggatgca gccactatcc    251940
     ctgtggatct gagtcatcga gaatcggctt ctcatgacta tactctaata aatcgtttgc    252000
     tgaatctatg gcgaggcaag ggaattgagt acaattttaa tacaggtagt aaaatatatt    252060
     ttgactctgc gaagaatgat atgataatac ccaatagata cattgtactt tttaaggatt    252120
     ttgttaccga taaggagata caaagccatc taagtgcaat tgaagaaatt aatagctctt    252180
     ctatttttct acaagatagt gacttcggta aagctacaca gtataatgat atttcaacca    252240
     gagggattgg cctacagcat gaatttagta tcggaagatc catgacaggt tatattggat    252300
     atttcacgga aactacagcc aaatttattg ctaatagtcc tttagttgag ttggtagaac    252360
     atgactctat agtaagaatc aataattaca agatgcagga acatgtgcct tggggtttgg    252420
     gacgtatctc tcaacgtgag aagttgccaa tcctgggtaa gcgcttttac cattatgacg    252480
     acagaggagg taaggatacg gttacgtttg tgatagatac tggaatttat gtggatcatg    252540
     aagattttga aggtcgcgct tcttggggca agactattgt cgagaatgac aatgattacg    252600
     atttgaatgg tcatggaacg cattgtgcag gcacaatagc atccaaacat tatggcattg    252660
     ctaagcaggc agaagtgatc gcagtaaaag tattaagatc tgatggaagt gggtcaatgt    252720
     cagatgttat tagaggtgta gaatatacag tcgaggctta taatgatctt aaaaaaacca    252780
     agagcaattt gaaaggtgcc gctggaaata tgtcattagg agcatggaag tcatatgcct    252840
     tgaatagagc tatggatgca gccgcagctg caggtatcag cttcgcagtg gcagctggca    252900
     atgaaagtga tgatgcttgt aattcttccc ctgcgtcagc atggtcaccc ataacagtgg    252960
     gaggttcaac tttaagcgat gatgtagcat tcttttccaa ttacgggaga tgcgtggaca    253020
     tatttgctcc tggggttaac ataatgtcca catacattgg cagtaaaaat gcaactgaaa    253080
     gcctctcagg cacatccatg tcttcaccac atgttgcagg tgtacttgca tactatttgt    253140
     ctttacaacc cgatcataaa agtcaattct accatgaaca cagtgccatt tcacccaaaa    253200
     ttctcaagaa aaaagtttta aattatgcta ctaatggaac cttaagttat ctgcctgctg    253260
     aaaccgttaa ccttttggta tataatggtg gtggtaagaa cttatcaaag ttctggggta    253320
     cttaattctc aactttcagt ttctctgcaa gcctgttaca tttagtttct ttgatgtaac    253380
     tctcctggta agcctctttt gctactcaat taataaaaaa gtatataaaa aatatatgat    253440
     tttcattcac ctttttaatt cgccatctgt ctacaatatg taaagctaat tgatggcttt    253500
     gtaaaactta cctgcactgc tttctcatcg cttgttttag ggctaacact cttgaagttg    253560
     aaaagtgaaa aatttctgag ttttgaaaaa ataaaaaaat gcgatgagca tcgaatataa    253620
     actgagttag aaaagtttat aaagttttaa attcgcaaat tctggactat attgtagata    253680
     aaatagagat ataagtatag aatcatgcgt caaaagaggg ctaaatcata cagaaagcaa    253740
     ctgctggtat acaaccatac attcaagttc cgtgagccat accaagtatt actcgatgat    253800
     cagattgtga tggacagcac tacttcaaaa tatgatctag ttaaagcttt aaagaggact    253860
     ttgcaagcag aagtgaagcc tatgattaca caatgttgta tgcaagcact atacgagacc    253920
     aaaaatgaac acgccattga cttaggtaaa gaatttgaga gacgtcgttg tgggcatatg    253980
     ccaggtgaag cagtctctcc gaaggaatgt atcctaaatg ttgttgatgt gaaaggcaaa    254040
     aacaagcata gatacgttgt tgcttgtcag gatgtggaaa taagaagact acttagaaaa    254100
     gtgcctggtg taccactgct tcatatttcc agatcagtaa tgatcatgga acctttgagt    254160
     gatgccagcg ccaaagtaag cagaatggaa gaagaaagta aactatttag aggcctaaat    254220
     gaccctaaat atgcaggttt gaagggtgaa catgaagaag aggaacaatc taaagaacaa    254280
     actgttgcaa agaaaagaaa aattggccca aaacagccaa atccattgag tatgaagaag    254340
     aagaagaaag aaaacactaa gaaggagcaa caaacagaaa catctgctga ccaatcacag    254400
     cctacaaaga ggagaagatc taggaaacac aagcatggtt caaagaactc tacagacaca    254460
     aatgaaaatg gcaatttatc tgaagaagaa aactagtcat ggctttctaa aataatcacg    254520
     tagtgctcaa atgaactaca tataatgtac attagatact tacataaatt aatcggcatt    254580
     ttctatccac ctatggtaac ctataattgt cttctgcaac ttgagtattt tgtttgatgc    254640
     agtcgtatag ccatccttcg gacaccatat caggtattcg cggtggatga tcttgtttaa    254700
     taacttcaga ggaaatctgc tttctgatgt catttatacg tctctgggtt actgcaccga    254760
     caacaataac caaattggcg ctgcttagtt cattggttac tttccctcca tatgcatcta    254820
     ccataaagct ctccttttgt atattattat tatcgctaag aagaaaaact attcttccat    254880
     gaaagaggaa atgtggaaca tccatcagtg aattatcaaa ttgtacatca ggttgctgct    254940
     tagcggttgt gcatatcttt tcactagtca aagaactcca ttcatattta tttatatctc    255000
     tttcgtatgg atctccgtac tgatcaatcc ttttgtaggc ataatccatt agttgcttcg    255060
     aaaagttaaa acagtgactc ggttccaatt tcattatttt accagacaac aggcaatcaa    255120
     atacccattt cggactaata atatcataac ctctaacaat caacgagttg cactcaactg    255180
     tattcctact acttataatc ctcaaatcat taagattata gttgcgtgtt ataacatttt    255240
     gaactaactg accaccattt gctacaataa ctttctgaat ttccgatttt tttattctct    255300
     ttcttttcac gccatcaaaa tagtctgata aaacatagaa atacatgcca tcaaaaatgt    255360
     ctgaacggtg ttccaattct gcaaagtctt caagggcttt atttacagag gagatgatat    255420
     tatatcttct tttcttagat attacttttt ggggcttgct actacctcgc ttccgccaat    255480
     tattaccgct ttttgcacgt tcaaattctt gaagtgtata acaagtcttc cagtttttat    255540
     cttcccggat ttgcctacaa tagcctccaa ataatgtaca tcctgctgca aattttctct    255600
     cactacttct agtattatct agtgatctag ctttgatttc cagtattaat gatttctttg    255660
     gatctatcca ctggcgtggg acttttgatc caaatttcat gtattccaaa ggtgggattt    255720
     tctcactatc attccacaag ccttttgttt tcctgtcgat ttctttgtat tcttcatttg    255780
     agataccgtt cgcgataatg caaagcgata caaaacctct gaatctttga gaattttcct    255840
     ctgatgattg tgaattaacc atgatgggac tatcttgaat aacttcttca tagtccaata    255900
     agcccaacat caaggaatcc tttttggacg gatctctccc cattaatacc aaatccatat    255960
     tctcaccaaa ttgctccaga tattcaggtt ttatctttat ccaatcatca cttctacttg    256020
     ctattacata tctagaatcg tacctcttga gtattatgcc ttcagatcca actgataacg    256080
     ctttctcaag agatttttta atcatttgct catcatttgc tctaatagac ttgattattt    256140
     ctatcctatg ggctgttggt gttagaatct gttttagata ttctcgtcgc ttataatacg    256200
     gcaagtctac tagagttgcc ccattaagat ataacacatc gaaaaccatt aacaaagggt    256260
     gaaacccttg tgtatcaatt ccatcttgag ataacatatt ttttgcactg ctcttaacca    256320
     ttccaaaggg aagcacaatt ttgttatttg aatcaaacgt tactacctca cagtctaaaa    256380
     cacaatcttt aacatttttg ttcaagttga tgaaatttgc caatgttcct gtcttcaaat    256440
     tgttaccata cagataagta taatcagtag ctcttctact gtaaaactta atatctgatc    256500
     caaagttagt ataatgcatt tggattcttt caccatccat cttttcttca ataaaaaaat    256560
     cccaaccaag tttctcgcca attttttgat aagatacatg caatttagta gccagctgcg    256620
     gagcaaatgc tagaccaata tttattttca aatcctgatt gcctaaacgc tggcttggat    256680
     cccataaccg cttcgcaaca gtctcaagat cagatactac actaagatag tcttgagcat    256740
     ctgggtgcca gcagttgaga agtttatgtt catggccacc aagaggtctg tttttaagta    256800
     gaatatcaaa aaagtattgc atttctaaaa aagtcattga tgtcaaacat ttattcatta    256860
     tgtctgagtt tgcaagattt ttaaagcttc gtccttgttc agttctttca atggccagct    256920
     gatcaagata gccgttcaaa tcatcgatag taatcctctc attacggtca atctgcggtt    256980
     cgctacgccg tttcttgatc tcctcaacac agaatttaga caatctgaca cttcttcctg    257040
     catcttgctt ccaatttatt aatttctttt cagtacttga gtcctttggt agcttaagaa    257100
     aagcacaaat agctttgatt agagtatagt cctttatatt gaaaacacgc ctatcccggt    257160
     agggcaatat aagcctcagc gctggataaa tattattccc tacagtagtc ctccataatg    257220
     tagtaaaatt cgatataact tcataatatc gtgcagtaac tggtttagtt aacagattat    257280
     tagctctctc aaactgaaca tggtcaattt tagcaaacaa ttgctcacat agccataaga    257340
     aatccggaga tggagcaaaa ttgacagctt gttcctcagt tcccttcagc tcatcatgag    257400
     ctcccgtttc taatccacct tcatcagcca ttataatgcc atcttctcac atcgagttat    257460
     aacatatcat tggtctattc tgcatagtaa agcctggtga tgcaatttat aacactgttt    257520
     ggaataagga tatatactaa ttaatatttc aaaagtaagt aaatatgagt taggagccct    257580
     taatgtgttc accaacgatt tgaaccatgt catatcgtct gcagatattt tagttcttat    257640
     gccataatat cattaccaaa ttattaattc atttagaatc acatatactt ctatcaattc    257700
     tatttatcta ttcaattgct aatttgccaa cacgattaac aacttcatca acatgctcat    257760
     cttcatagtc ttcatctgaa gcttcatctg aagattcctc attactatag tctgattcgt    257820
     tattatcatc ttcactatct tcaattatgt tacccagatt atcatacctc acattctttc    257880
     tagttgtggt atcttcttcc tcctcttcag cttcctcctc atattcttct tcactatccg    257940
     atgggggcat tagacccgaa ttaccgcggt ttgtattgcc catcatccat acatcctcag    258000
     tttgagcctt aagttttctc tcctgcactt cttgatcaat ttgttgaagc cagtcctctt    258060
     caaccttttt gatggactca gaatcagtac attgttggta acgctccagc aagtctttgt    258120
     tcagctccaa aaatccaaga ccccaggaaa aatgagataa aagttcgtgt gctagatcag    258180
     tacgtcccac aatagcaaaa catgcagcca gcgcctctac acagttgagt ctccagggtc    258240
     taccgtagtt aacctggttt gcagcgacca agtatggcaa taacctctca tgcttcccac    258300
     caattttgtt aaacggtacc tcctcaagac gtgcccaaga gcactccact actgatgcac    258360
     cgtgagcttc cacaatctct ctgtcatcag ggcatactac tgacttacca ttaggtgaca    258420
     ccactatacc ttggaatttc tggcccaccc tcagagactt gatcagaccc agcctctcca    258480
     gcttcttacc gctacatcgc ttgggatcac agtggtcaaa atcccacata gccagcttca    258540
     ctgggaatga actgtcttta ctaccaccac aatacttcat ttccatgtga cgatgattcc    258600
     tccgggtatg gtgcccgttg gacccgccag atttgttgct cctgccttca tcatgagact    258660
     tgttcttacc tttaccctta gccatttttg taactatctg agtagtgtta tctaatctat    258720
     gcagtcttag ccaagttcaa aacatgcttg atagctcgat gagctgcaaa tttatttttt    258780
     tttttttcac ttttttgcga tgagatgaag cttaagagcc aaacctcgca taactaagta    258840
     ttactcaaat gcaattgaga tatcgagtta cacctttatc aactaatttt attgtttata    258900
     tatatatatt gactagatta cagtaaaatg tatgtgggtc cgttttacgt gcctatgcaa    258960
     ggggaaatgc tagaatataa caaaggaaaa aatgaatact gctaatgaaa acttagctga    259020
     gactatttct cgtcgatttc accctttggt tcagcacctg gggcatcagc gtcagcacct    259080
     ggagcacctg cacctccgaa catgctgctg gccatgtttc ttagagctgg gttgctcatc    259140
     aggtcgtcca tgttaggagt gccattacca gaagtgaatt gctcggccat ttgtctgatg    259200
     cttgggtctt gcatcatgga ttgcatctgt tgcagagcct gtgggttgct catcatctgc    259260
     tgggcagctt gcatgatctg tgggttgttc atcaggccgc tcagaccgcc gctcaacatg    259320
     gaagagaagt caaaaccacc agcaccacca gcgccggcgc cggcgcctgc accgctgtcg    259380
     gcaccgcgtg catctggagt cttctccagg ttcagggact gctcgacctt cttcttggcg    259440
     gtctcgtagt ctctcttcat gatgtctgtg gccttgtcgc cttcaaggtc catgaccttc    259500
     ttgtatgcct ccagagcctc ctcaggcttg ttctgggcgt acttggcaaa accaagtcta    259560
     gagtaaccct tggagtaagc agggtcgatc tcgatggctt tctcagcgtc tacgacagcc    259620
     tcgtcgtact gcttcagaga ggagtgcgca gcggcacggt tagcgtagta gatagcgttg    259680
     gtaggcaaga cctcaatggc ctcggagtac ttggcgatgg ccagctcgaa gtccttgcca    259740
     gccatggcct tgttaccttc aagcttcagg gcctcggcct tggccttggt ctcggcgtcc    259800
     tcggcaggaa tgttcacctt gacgtcctcg ctcttaacag cgccaccctt catgcactcc    259860
     agacactcct ccagcccctt gctgatacca ctctgcttca gcacagagtc aacatcaccg    259920
     cgctccactt caaaggactc ggcaatacag tcgatggcaa cgttcacaga gtccaggtag    259980
     tcctcgccca ccgccttctc ggcaacaaca ccttccaaat acttgataat cacagcagct    260040
     acctccttag acatttaaaa cagattgtta gcttccttca cgcggttgat agtctgaagt    260100
     ggaagagtgt ataacaatta cacattagta ttaaatatat caaatgcaca attaatttgg    260160
     ctatattcct agttcatctg gaccgacaag agctggattc tgctggaact tgagagaata    260220
     gagatataac aatatacgta catgtgatca tgtgaaatat tgtattacac gtattatcac    260280
     atgatcctac atcaacatac acgtaaaaca ctgtacacgt aacgcacatg atatacgtac    260340
     aacacaacac tgaaactgga cagtttccca aaaaggcgga agtgtaggct gtgtgtgcat    260400
     gtaagtatgt atgtatgtaa gtatgtaagt aagtatgtat gcatgtatgt atgtgcattt    260460
     cgggatattg agcacataag tagctggttc accgactcgt ggtttttttt tactgtctct    260520
     acagtgtgca aggcaagtgg atcagaggtc ttgataaagt tgtgactttt atctttatct    260580
     tgtgagggaa ctatgaagct ggattactat agtgttattg gcgggctggg ctcgctggac    260640
     aggtcgcaca gtgtggtgct tgggccgcag gagctgcggg agctggtgaa gaacacggag    260700
     gagaatcgtt cggacacggc gctgccggac ctgtaccgga acaacaagga gcgtgtgaac    260760
     atacacgggt acctcggtgg gcgcgtggac atgaaggaag tgtctgagat gacgtatgac    260820
     ctgaaccaca cgctgctggg tggctacgtg cccaggcagc agctcgagac gctgtgcagc    260880
     acggatttcg cgcggtacat gcacagaaag gtggactgcg gtgacgccat gcaggtatac    260940
     gatacttttc ttgcagacaa ccacttgggg ctggcacaga ggccgcgcat acatacacaa    261000
     acaacacagt caccacaagc acaatcacaa gcacaaggac aaggaatagc acaaccaatg    261060
     caggacaaaa taccacctgt gcagcacgac acacacgtaa ggaaggtggt cgtgtgcaaa    261120
     cgctgcagcg ccaggttcct gggaccaagc agaatgaagt ctctccgcag acacaactgc    261180
     aaagctgcga tataggacta ctcgctaggc aatataggaa atcaatgtat atatgtgtat    261240
     aacactatac ccaatacaat cacgatatac gacactataa aaaaataatg gtctcttact    261300
     gccttgggag atcgaaggtc gaggggcttt ccctttcttg cggaggataa gaggaggccg    261360
     tcctgcgttg cgcttaaagt tcacccctat tagccgccca ttcaagatac ataccgctgt    261420
     tacagtgctc gagacaagtg tttgacaggc gaggctttct aaattattgg taattgagtg    261480
     tctcaacccc agaaagatag gatcaatttg ggtagcgagg taaaaagaaa aaaggagagt    261540
     cgatactggt gtataccaat tgggaaccga gtacgtacag atattgagtg tgattcgtac    261600
     tgtgattttt atacattttt ttgagacgtt gtactttagc tgacagcgac gacgatctgt    261660
     ggaaatgacg atctttctcg gcgtgtacaa ggctgtgtac agttatgagc cgcaaacgcc    261720
     cgaggaactt gccatccaag aagatgactt gctgtatctg ctggagaagt cagaggtaga    261780
     cgactggtgg actgtgaaga agcggatcat cggctcggat gcggaggaac cgcaagggct    261840
     ggtcccctcg aactacatag aggccgcacc agtgatctcc actatgaggg cgctgtatga    261900
     cttcgaccag gcacagaatc ctcaagaaga gttggtattc aaggaaaatg atatgttcga    261960
     tgtgtatgac gacaaggatc ccgactggat cttagtcaga tcacactcct ctaatgaata    262020
     cgggtttgtt ccaggtaact acgtggagcc agcaggcggt gccggaatga gtagtactgc    262080
     tccagctgca agcgctaccc cagcagctgc acctgttgct gcccctatta ccacagctgc    262140
     cactgctttc gctccacctc cacaacatgt agatagggtt aaggccgcta cacctgcagc    262200
     agaagagaat gatagagaac cagaggaaga tatacctcct cctatgcctc caaaacaaac    262260
     cgaggaccgc tacatggatg aagaagagga tgttccacca cctaagccaa tgagaccaac    262320
     tgcagataat gctagagact ccaacagaga aagagctaga agcagaatga attatgatga    262380
     ttacgaacct tcagaaagtc gtagaagcag agatatggat gactatcaaa gtccaagaag    262440
     gtcaagacct cagaatgact acgacgatga agttcataca tggacagtct ccgaagttga    262500
     aggtaaaaag aaacataagg gtaaactatc tataggtaat aacaggatta gctttactcc    262560
     aaacaaggga agcactcagg aatggtccat tgataagtta atctcatatg ataatgaaaa    262620
     gaagcatatg ttcttggaat tcaaagatcc atataagagt tttgaattac acacaggcaa    262680
     caacgataca tgcaatgaaa taatggctat tgtaggtgag ttcaaaggtg cacaaagaga    262740
     tccaggtttg agagaagtcg agatggcaac aaaatcatct aagagaggtg tggcattgta    262800
     cgattttgaa gctgaatcac cagacgaatt gacaattagg caaggtgatg cagtttatgt    262860
     tataaatgat aagaaatcaa aagactggtg gatggtagag ttaatatcaa atggaaagaa    262920
     aggtctggtt ccggctcagt tcattgaatt ttccaaatcc aaggagagta gtggtctatt    262980
     aaactccatt aaaaagttta ctaatagatc acctaaacct tctaaagttc atgatgacga    263040
     agaagacgat tggaaacatg atgcaggcca agataattcc agtagtaaag gtagaagtag    263100
     aagtagaaaa aattcactca gtagcaggag aaaaaggtcc tcttcggtca gtgcaaagaa    263160
     agattatcca aatccaaaga agtccagact ctgggttgat agaagtggca cattcaaagt    263220
     tgaagctcaa ttcattggat gtgctgatgg taaaattcat ctacataaag ccaacggtgt    263280
     gaaaattgca gttgcagctg aaaagctatc tgatgatgat ttgatttatg ttgaaagagc    263340
     cacaggtttt agtttagaga agtacaaatc cagaaaatcg gaatccaagg gtggtgatcg    263400
     tgatagagaa aagagacgta gaataagaga acaagaagaa agagaatatg agagaaagtt    263460
     aagggaacga gaaattgccg aactgaagag agctagagaa ctgcttgatg aggaaagaaa    263520
     caggttgcat gataaagaat tacctcccat caagccacct agaccacaat caactggtgg    263580
     tgcacatact agtggtaaat cagactatga ttggtttgag tttttcctaa gttcaggtgt    263640
     tgatgttaac aactgccaaa ggtatacaat taactttgat agagagaaaa ttactgaaga    263700
     tatgcaggct gatatcaacc caccaatgct aaggaccctc ggtgttcgtg aaggtgacat    263760
     tgtcagagtc atgaaggctc tagataaaaa attcaataga gaacctgcac aaagtaatgc    263820
     tactggacaa aacaatatgt ttaccgaagc cgatggttct ttgaaaaaca actctggacc    263880
     aaactcaggc agcagcggat taccagaaca attactttca caaccagcta tgcaggcgtc    263940
     acaaaattct aaccaggatg atgatgcttg gactgctcaa cctgctgctt ctgctgctaa    264000
     tactgtgcaa aagaagtctg agtttacagg atcaatgcaa gatttaattg atcttcaacc    264060
     tctggaacca aaaaagaatg aacaacctaa atctgatcaa attcccgttc ctaaggtcga    264120
     gaatctcgaa cctgttaaaa cagggcaatc tgctgctaca aatatacaac ctaaccaaac    264180
     tggtactagc aagctagttc ctctagaccc tttcaaaact ggtgggaaca acatcctgcc    264240
     agtcacaact ggcttcgtca tgatgccaat tgctactggt ggactacttc cacttcagag    264300
     aactggagga gttgctatgc caatgacaac ttttggttca caatctactg ggggactaat    264360
     accaatgacg actttcggtg ctcaattgac aggcggcgca ttgcccctac aaagaactgg    264420
     tgggttacta cctttacaaa gcacaggagg ggctattcct agaactagct tcaatatgcc    264480
     accagcgggc tcggtattac ctgttcaaag aactgccggt gggttaatgc ctgtgaatac    264540
     aggcggcgca atccctcaaa caagttttgg agcccaacta acaggtggag ctttaccaca    264600
     aacaagcttt ggtgctcaaa tgactggagg cgctatacct caaaccagtt ttggtgctca    264660
     aatgactggg ggagctctac ctcaaactag ttttggtgct caaatgactg gaggtgctct    264720
     ccctcaaact agttttggtg ctcaaatgac tgggggagct ctacctcaaa ccagttttgg    264780
     tgctcaaatg actggaggtg ctctacctca aactagtttt ggtgctcaaa tgactggggg    264840
     tgctttacct caaactagtt ttggtgcaca acaagcgggc tatggaatgc aacaacctgc    264900
     tttcaatagt caattaacag gaagtgctat acctcagact agttttggtt ctcaacaacc    264960
     tgctatgggt atgcaaagaa caggtggctt ccaaccacaa tcccaatttg gtatgacttt    265020
     acagagaact ggaggtatgc agactaacca atttactggt ggtgcgatgc aacaacaacc    265080
     tataacacct gcaatgggcg cttttaacac tggaattcaa aacataacac aaggcatgca    265140
     aaacactttt gtttctcaac cacctttaca aaaccagcct actggatttg gctttggtaa    265200
     cggccctcaa cagcaaccac aacaaagaca agcaaatata tataatgcca gtgcagcaaa    265260
     tccatttgga ttttaaacag gactaggctt tgtcatcata tttttatgga tatgtaataa    265320
     ccaatgtaaa ctataatata attattgaat tatttatatg ctgaatttaa tgcttatata    265380
     gacgatgatt gtgggggaat ctcattctca gtgagcagta tattagcaac agtttctctt    265440
     ggtgccacta actcttgaat ctcggaccaa cacccaaaat atgctaacca tttgaagctt    265500
     ctattattag tgaggtgcac aatcacagtt ttttcagaaa cctcaaactc aaactttcga    265560
     atggacttat taactcttac tctgtttcct tcgactgggt cattgtttat gattggtagt    265620
     attgaaacat tcttgataac agaccttttt gcagagatat cccaagcgta aaataaacct    265680
     ctttcagtta aaacaagcag gtaattcgag caaacaactt gcttaacaac tttttgacct    265740
     aaattaattt tgggtatcaa taattgcccg ttgtaagata ttatatatat aaaaccatct    265800
     gctgttgcca agctccaata ttttgaaact ggcgaaccaa cacctgaaat gatgacattc    265860
     ggaataaatg cttcaatagt cctctgacct tcatgataac caagaatgcg agttggattg    265920
     tcaaatagcg catcactatc aaactgaatt gctctttcaa caccatttct tatctcaagt    265980
     gtaaaaaagt catcaattga tccacattcc aaaagcacgg catctgtatc ggctatgaca    266040
     ccagtatttt ctatatatct caaatatggc tcattagagc tcactttctc tttcgtcaaa    266100
     cgattattca aggtcattcg atactcatct ttcatcaagc tatcctggcc atatgattca    266160
     ccatcaaatg taatttggtt actagcttct cttaattcat catctggccc tacctcagct    266220
     cctctttcaa atttatcttt acctctttct tttagaccca tcaccagggt gtgtatacca    266280
     agtctaggta ttggaataga gggtgtactg agtcttccag agtactcatt tatgtcgttg    266340
     gttttcttta gcactggctt taccacctta cctgaagaac tcgctacttc tttgacgtta    266400
     gtaacagtag gctgtaaacc ggctgtagat atcagggtgg gtgcaaccct ctttttaccg    266460
     tctttaacaa ttactttatt cattttcata tccttttttc ttttcggtat gagaatgtta    266520
     accttctctg tggattttaa tggtgagatt tctcttgaat taattttctt ttggaactga    266580
     ttgggctcca gtcttctttc gagagcagtg gattgagtgc tactggataa ttcatgttgt    266640
     ttcttcttag taccatattt gtcctctaat agtaattgat tgacactttc gggtaagtca    266700
     aaagagtcct tatcaacacc atatctatgt aattgttcca tatttccttc aatcggtata    266760
     ggcataccaa gctcgtttgc atcaaacatt agcatcacaa tagatgagtc taaagaagta    266820
     acaaaaagaa tgttcccatt gggattccaa gccatatctg ttattgattt ttgagctata    266880
     tcatatgcaa caaaaatagg tctaggcctg cttgttatcc acaatgccaa tgatttgtcc    266940
     tggccagcag ttgcaataat ggactccaac ttcttattat tttttgtatc tttacttaat    267000
     tcatcttttg catttttagc ctttttctcg acatctgatt taaataatct agggttaaac    267060
     cgggctacct ctgttggtgc atcatggcca atcaaactga tactcgaatc ccatgtccct    267120
     ctgtttatga ttgcaacaga actaactggc ccattagtag cattcggcac agcaatatgc    267180
     tgaccatctg gggaccagga tagtcttcta aaatatgtag ttaatggtga agcaataaaa    267240
     ggttctacaa taacctgttc tattgtaaat gatacttcac cagtcttatg gtacctgaac    267300
     acgcgcattg ttctgtcatc tgacgccgtt gcaaaatatt tattagcggg atcaaatatg    267360
     acacctttta ccagagattg atggacgtca aaccttttta acctttcaaa atttagccca    267420
     ttccaaacaa ttacagatct atccaaacct acagtaacta atatacttga gtcgggcgcc    267480
     cagcatatat cttgaatatc gttatcatgt gccactaacc gcttccgcac tgtccagtgc    267540
     tctttctcac cctctgaccc aaaagaacca ccgtggtttt cttcatccat ggcccatatc    267600
     aacaaaatac ggtcatcaga tccactagcc aagtagttcc catcgggact aaatttcaca    267660
     caagttacag atccagtatg cctgctcatg ctggctaatg gcctatgagt atctctatca    267720
     actccagatt ctccagcagc agcactcact aacgcatcta cagaccatat ccgtatctta    267780
     ccatcaagac cacccgtagc aacacgctta ccatcgggac tcacatcaac agtgtatatt    267840
     tcatagtctc gcgactcctc atggtgtgag aaccatggaa acttcacaat acgcatatat    267900
     aacccaatgg acctacctag cacgccaaca acactgtgct gtgatatagc agttgttaga    267960
     aacttggtgc tatctgttgt cttcaatcta tttggcaaga atgatgccta aaagctttaa    268020
     atttgccaaa ctttcaaaat ttaaaagggt agaatgaaaa aaatagcttg gaagcgaaca    268080
     gatgttcaag aagagagata aaagtgaagg attttgagga tagcaacaga gtttcgaggc    268140
     attgcccagt tacgtatttt agaagttctt gaattgggtg tattcggtaa ttttttggtg    268200
     ggtctagcgg ttctggaagg tataaagtag tagtacaatg gcagaaaata acagcgattc    268260
     aggtgatgag tttggtgatt tcgaaggtgt gacggatgac caagaacaat tagtgttata    268320
     tgtcaatgag ttagtaccga aggtgaactt gggagatgta tgccaacaga aacacgatct    268380
     tgaagagcta ctggccgagg agagacctcg agttatctac gagcaattag tcgaattgca    268440
     tactgtatta caacccataa catggaagag ttcccatctg aggtctcatt tgttgcatgt    268500
     aatgaggctg gaggagcatg ataaaagcga taagcacatt atagaggaag ctgtcgacga    268560
     tcaactgtat acgcggatat gctctatgct tccgacattt tctgctgaac aagtacgctc    268620
     gccggctctc atactgaggg accaattcaa gtatatgtat gcccctccac taacacattc    268680
     gtctttgcaa ggtgaggcaa tccatgaaca agaagaacat gtaccgtcac tgctggcagt    268740
     aaaaatggac tcaatacaaa gtgcaaaaga gatggaacag tatcatgata aactatgtaa    268800
     tgctattgat gcattaattg tgacgttgaa acagatcgag ctacaacaag ccaatttaac    268860
     agcagataag acaacttacg agaatgtcgt aacaaatttg acaggccata cgcaacggct    268920
     tcagagagat gaaatcgagc tatataacaa gcataagaat agacggaaga gattttcctg    268980
     gatcggtaga taggctagca ttattttaat atgaatcatg aactaattct gcaacagaat    269040
     aatgaactac ttcatagtcg gaactaaatg ctaaaacaaa ttttttgcat gctttataat    269100
     gataagttta actatgtatt ctatttttac aaattgatac gcataccgtt gttcattcat    269160
     tttcatttcg cttactgaac atggctgcag ttattttttg agaaagagcg ctaggttctt    269220
     tcgattcttg ctccatttca gcatcagatt ctgatacagt gctcgatgaa ggcagtaatg    269280
     agtatgttga agaggcctca gatttacctc ccaatgcaga tgagaatatt ggaatatttg    269340
     aaagcgagtt atcactattg acaagagata tagcatcgga atcttgtgtt tggtcatcat    269400
     aatcgttttt atcagaaata cctctggcat tttctctttc tttttgtctc ttgattattc    269460
     ttcttctcct tagttctgct gtttttcttt cttcttcctc ttcatctaca gcgtactctt    269520
     cagacaaagc tttgtagtca aaatcgggaa ataaaacaga tccaaaattg ttaacgacct    269580
     cagtgattct ttttgcaagc tgtcttcttt ctacttgcaa tctcttcaga ccttgaggtg    269640
     tggtaataga gatgtataaa ggcttcaatg acttaaaaat gtccatacca atatctccga    269700
     caaccaaagc cgaatatgta actattgcgc atgccaagta agacaaaata aatattataa    269760
     ccttactaat atctttgtgt ctcaagtaat aagtagctaa gctactccac aaaacataaa    269820
     gaattggtgc aacacccata ctcattaaaa ttttccaggt tgctacaacg tcattggctt    269880
     taatctttac agtggaactt gccaacgctg ctctcttttt gtcatttgat atcttcctag    269940
     caataacaaa taccggtgaa aataaaatca aaccaggtaa ggataatgtt atcattatag    270000
     tcaatctcaa agatctaaat actagcagtc caagatttct agctacatta atctttgtgt    270060
     gttcaacaag atgatctggc aaattaaatt gactcaaatg cgcattatat gccatgatat    270120
     cagttttcag ttggacaatt tctggatcat ccttaaaagt ttcatatcct tttactaacc    270180
     ttctgttcat ctcaacaaca agaggtagag gcaatttttg gtgaaactgc cctgaatata    270240
     gtcttctcat agcttgaaca accatcaatg tctcataatc ctgtgaagtt acagttacag    270300
     attgtaaacc atctgaaatt gtatccaata gttctttcac agcctcttta tttgtcgaag    270360
     ggtttttata tttttcgatt agctcagtag gtatctcaat aggatcacca aactcaacaa    270420
     ccgctctcga tctaaattta tgaggatgga agtaattcat accacaagga acaattttca    270480
     catttgtatt cggatgttgg gccatacatc cgagggccat tattgcaaca ccagctttga    270540
     gtggtagtaa gtccgttctg tcgtgagaac ctccctcagg gaaaatacca atgcactcat    270600
     tgtgtgctaa gtgttcaaaa actctatggt agacaaccga ttgatctact tttccggcgt    270660
     acttatatga agtgccttta gttaaaatat gcttcacttc cgttttattc atcttaaact    270720
     cctttcttaa agtcaattcg gtgtcactct caatcgattg gatttcaaca tgacctagag    270780
     accttggtag accgattagt ccctttggct tgaagtcctt ggtaaattga gtgccatggc    270840
     caataatctt cttataattg tctggatcaa cagttatctt accctgcgct gtagccaaat    270900
     tatcctgtgc tctcacaaca ccaattgcca ttgctcttct agccagaaaa ccaatagctg    270960
     gatgctgcaa tgatttctca gcgatcagga atgatatcct tctattagac agttttttcg    271020
     ccaatgacat cagcaccaca ggatcaacaa actggtttgc gtgtggggca gcaacaaaga    271080
     tcactgggcc attccttgga actttgaagc taccgcggga ccttatttcc ctgaagaaac    271140
     atccaagaat cttggacaat agaaacaata tcacgtcata gataaactta ctgataaaag    271200
     aagcttcttc gtattggtaa tctttaactt tctcaggttg aagggaagat gagtctttcg    271260
     aagctccctt ctccttctca gataacaacg gcttgtccat caattctcct cgcttttgct    271320
     cttatatcaa cacttcaaat ttattaacct cagaccgacc tacaactata ttttttggca    271380
     ccttgcttga aagataatca agtaatgctg tggctaaact taacaatcaa gctctatggc    271440
     acaatattgc gaccttcact tcgatgtttg cctttttctt gttcctgcca ctttttccaa    271500
     aattttagaa aaagccactt ttctgcggaa ctttctgtgg tgcctcaccc aatttgttgc    271560
     gatgagccaa ccgatttctc gcaaacaagg aaaaccttga aaatattgga gatcacgtga    271620
     acatttttat tatagccgat taacatgcaa tagtatacta gatagtatct gggtaaggca    271680
     atccgggtta gtgtggcaga atggacgtta gatgatttgc atcaagtctc atttacaaac    271740
     actagctcct tggccagggt tttaccgcac cttttgggta atttcttcat gaattgctct    271800
     ggagtttcaa tagcacaagc ttcgaactgt aacttcttaa tcaatatcgc tgtattgcga    271860
     ccacaagcta tagtaatact atcgtggttg tcttgtgtaa aagttccgca ggtttggttg    271920
     ctaattaccc gctcaatcac atcaaagtca tgtatgagaa ctctctttag ggacaagggt    271980
     gatttgcttt tcaattgaac tctcttgaat gtgtacaatg ggcctaaagt ttgtaatcta    272040
     ttcagtaggt cagtagctga gtcattccaa ttgatcatct tgtcctcagt tttaattcgt    272100
     ggagcataac tgggctcata gttgctttca atatgcgaca ctgggtcttg ataagtcctc    272160
     ttctctagaa catctgccaa taaattacca cctacaatac ccaattgatc catcaatttg    272220
     gccagctttg gggggcgagt atcctcttga ttaatgagcg gcggcagagg tcgacttgct    272280
     aggagatcac tgacaggtaa tggatcactc tgtgctacta tgctcccatg atcaaatttg    272340
     gttgggtgca atgtctgtac tgtcacgcct gtatattggt cttggttgag caaagtatgc    272400
     tgtaacggtg cgctccctcg gtatctgggc aacagcgatg gatgtacatt tagcgagtat    272460
     ggcacccttc caatcaatcc attaggaatc aattttccaa aagatactgc tataatcata    272520
     tctatcttct gagactcaca caatgagctc aattgtaaca tctcctcatt gctgtcgaca    272580
     tgtataggtt ggtcaagtct cagatcttgt gcatattgca ctatttcggg ggacttcagc    272640
     acagacttct ttctcccaca ccattttggc ggcctgctaa ccacttgtat ggaatctatt    272700
     acctgcttat gcttcagctt cacaagactc ctcagtgcat atgcactaaa ctcatcacta    272760
     ccaaagaaca ggatatttag tggtttagtg gaaaatttcc tggcataaac tctccttaca    272820
     gatataaacg gcaacatatt aaccttataa aagttgaaac taagacatta ttgtcaattc    272880
     taaccatgtg ttatgaacag ttacaagaaa gttgtccttt caaataggtg actaggtgag    272940
     tcgttcacca cttctcgtta tttgttagca catgtgaaaa ttagtggata gaatcttcca    273000
     tgttagtttt atctatacat gtaactcaaa tgaaatacaa ttctaagtta ttcacctaat    273060
     ctgtatgatt tcttagtata acacacttcc cttctatttt aaccttggtt cacacttgcg    273120
     catgtttcga attacggttt agtccagata agctatataa agggtatgaa aacggggtaa    273180
     attagcaaaa gcgctcaaca ttcacatctc atgtcaagtt acaaatgtgc atgtcctcaa    273240
     tactcacccg tttgacctgt agttctatca agtctttatt gctcatcgca tcctatctga    273300
     atttttcaac tgaccgccag catcggcttt tcgactgaaa aatttggcta aacaacgtga    273360
     aatcataaaa agttgcgatg agcaactaat aatgtaaata ctatcttgta tactgtagct    273420
     gaatcccata gctgaagtgt tctgagcaca actatatata tatggaaggg agaagagtgc    273480
     ctggcccacg accgattggt gcacagttgg gtattggtat tcaaagtccc gggttataca    273540
     tacctagaaa ccctaggaat tatgatcctg acgatgacga tgatgctgat gatacaacct    273600
     atagtgaaaa tgatgttagg cgcaagaagc aaaaaacgtg gcttaatagt gttgatgatg    273660
     ctattcctaa gaacatcctt gatttttctg tgattgcaag tgaggaagta gacacatctg    273720
     aaggtgccaa agttctgagt gaagccttgg tgaatgaaat cgatgatgaa atggatttgc    273780
     taacagataa tacagagagt gatgctgata gcaatctagc aggtgaagaa ttgcataata    273840
     gctctatgaa atggcaactg gggtgggata gtattcaaac agatgtaccg aaggaacttg    273900
     aattatatcc cagtgtagat attcatcaca actacgatct cgcatatgca gcaactgtta    273960
     atgacaaccc gagagaaaac agctatatac cgagtgatat cataaatgaa atggcccaga    274020
     aggagaaagc caatagaaac aatacggtca atgatcacag cgagagtaag aaattcacac    274080
     ctcttgatcc taatacagat ttcctggtag ctattggtaa agtactaacc aaagctgaca    274140
     ttaaaaatga tcaagaagaa cgtgcgcttg ttgcatatag acatccactc tctccgtcaa    274200
     atttaatcat cacctatatg gaaaaagaaa atattactgt gcaaaacaaa gaaaaggcag    274260
     atagtaatgt gataatatat agaccttcac aaaagactta cacatcgata acaataaatc    274320
     taaattctgt cattaaatgc ataaagtttt cgaaacttgc tgaatcactg ggtagctact    274380
     ctgatatggt cggagtcttg acagagaata ctttaacagt aataaagcta ataaaatttg    274440
     atgcaaaaga aaaaaaaata gattatacat tatttaaccc gctagaatcg agattaatta    274500
     gcgattttac gattgcagac ttcgatttca atccatggga cactgatata atagccacaa    274560
     tcgataccaa aggtaactgg tccattattg aaattccgac agtcaaaaag aaaatgccta    274620
     atcctgaatc tttaaacctg aaggtcaaaa gtaaccattt tggctcaata tttgatatag    274680
     aagaaatgtc taattggaaa aggatacgct ggtccaacaa ccatactaga cttgtagtaa    274740
     tgaatgaatc acgattgata gaacttgatt tcaagcaaaa ttggcaacaa gaagttatac    274800
     aagcaaaaac ctggtctaaa attagagatg tggttgacct aaatgataac ttcaaactga    274860
     ttctgacatc gagggagatc attgttacaa caatcaattc tagtaaaaat acgagagact    274920
     ctaaccataa aattaatttg aaaagagaag tttcttggct tcataatatc tcagaagatg    274980
     atgcgtcgct aagatgccgt gttcagaaat accaatttca gagaaagact ctgtttttcg    275040
     tgtacctcta ttccaagaga tttaatgtag tatatatcca tggtttttcg attggatata    275100
     atgatactat ccaatcattt ggcgtatcaa agattatcta tataccagga atttacaata    275160
     tcgactcaat tgatgttgaa actttggaga taaatgatta ttacactgat tccattgatc    275220
     tcggtgatat tacttcaacc ttattaatat acgacattgt agggaacaaa ttgatcaact    275280
     atactctcaa caactccgct aatttcgaca acattcagtt aaacaatatg gcgatagaac    275340
     gattcagagg tccattagtg aaatatccaa tacccaatgt gcaggcccta tttaaggaac    275400
     tacagaaaga atatttgtat gcgattaggc aatacaggaa gataacaagg caaaagcaaa    275460
     gagataattt gcaggatttt ggttacgagt tatcgcaaaa gcttaataag gttattgaag    275520
     actcacacga cgtccgttcg aaaactagca taaaattgca atcactgatg cccaaaatac    275580
     cagtacaatc tgatttaacc gaaatccaat catttttaga acaactatcg gagcattata    275640
     gtgaattagg tctaatattt actaatgtaa tcaaaacgtt aaaccaaatt attcatgaag    275700
     acattccaac aatcgatgtc ttttacaata agcttttaca atgctggtcc attgtagaat    275760
     ccaatgatct taaaaaagtg gctgataagg ttacgaaaga aattgtcacc ttgacagtct    275820
     ggaatgcaat taagtgcact aagaaatccg acatcgatga gctacgcagt ttaaattacg    275880
     gaaaactatc agaggagcag aaatcaattg ttgaccaatg ggatctgact gacgaccaac    275940
     tacaagatgg tcttgtcgat gatggtgaag ctagcgagca gatcagaaga ccagtgcagt    276000
     tctcacaata ccaggaatca caatcacaaa ttccagtgat caaatcttca caaaccgtac    276060
     gaactaggat aaactcacaa cgcaagtcca aaacaccttc tagtcaacta gcaccatcac    276120
     aggcatcaat tttaccatct agcatgagcc cagcattcag tctggactcc cagcctccat    276180
     tactctcgca aacattctct caaagctctc aacctaagaa acggaagaag aagagaatgg    276240
     gagggtttgg ataacttaat ataacaaata caagctacag atatagacta attttgtatt    276300
     ataacaagta ttacttttga gatgttcatt gtttaaccac attttcttcg gttttgttta    276360
     catcaaataa atctggaaac aagcaaaata atgtcagaga tcgctaatac tctactttgg    276420
     catgaataat gttactaatg cctaataatt ctggttaacg tcatgatata ctcatggaat    276480
     gaaaatacca gtatgaccag caccaagatc cacgctagcg ctcaaacgca tcactaaata    276540
     cgttaccagc attttgtaca ctgtagccag cattttttta atgtatcaac ttgctacgga    276600
     ggtttctctg gtaatcttat gaacacagaa cgaacttgct ggatcacatg tatttacaac    276660
     cagccaatta cgatgatagc tttataaatt cacaactaat ctatcaggca acataattgt    276720
     cagaatacat cagagacttt agctttgtat aataggtaaa tctatatatt tttttatttg    276780
     tttgtttgtg tttttttatt tatgtttact tgcataacta gcgtcaatcc aatgagcaat    276840
     aacaattagt tacattttaa tgaaaataaa catggtatac tgtttactaa taaaaacaaa    276900
     taatgctagc cgacaaatgt aaatagtcaa gctgttgttt gaaataccag tatctgtatc    276960
     tgattagcag agcatccaag tggaaaatgg aaaaataata tcgacatcga aacagaattc    277020
     aatctaaaaa ttttgtgata tataaatgcc caataatttg ggaagttatt ctagatcgat    277080
     ttgctgtatt tttattatta ttattttaat tttattcaac atcgaaacac catcaaataa    277140
     atcccatact atcaagacca actcaatttc attctttaac agattactta aaattgattt    277200
     aagacacacc catttatttc aacaattatt ataaagttct attaaaatat aagatgctac    277260
     cgttcataca attactgtat ctggcgctat acctaactag cgatgttctc gcaatgccgc    277320
     tacgtaaaag ggaaattgta acaagagtac acaccgccag caccactaac actgtgacca    277380
     atttcttttc taccaccact caggttatta ttgcaccaac tgtacaggta attattagtg    277440
     gtgatactac ccttttcagt actatggttg gagaaggtgg tgacattaac gctgaaccaa    277500
     caacaaccat aacttccata atccaagtaa agagggtttc tttagctaat gagcaaccaa    277560
     ctgcaacttc cacaacccca atgctagaca gttcatcatc atctgctacc actacatcct    277620
     ctgctatttc atctgacatt actactactt ctattccaag ttcttctagc ataccaacaa    277680
     ctacaccatc atcgtcgtcg tcatcgtcgt catcgtcgtc atccatacag tcatcatcaa    277740
     ttagatttgc cagccaagta gttaatttag agaatgtcga agccaatcaa aatcagcaaa    277800
     agcaggaaga acaacaacat gttcataaca ccgctcatat atcgactcct gtcgtagaga    277860
     tgactactac cacctcttca tcaagtacca ctacattgga accaaccgca agtcaaagct    277920
     caacatctaa taataatgcc gatactacta tcaaatcagc tccaattgct attgcatatt    277980
     caccatacaa caatgatggt acgtgtaaga gcgctgatca agtaaaagaa gatttgcaac    278040
     taattaagtc caagggcatt aatcaaattc gtatgtatgg tactgactgt aattcattac    278100
     aaactgtatt gccaaatgca aagagtattg gcctatccgt taatcaaggt ttatggatta    278160
     ctagctcagg tgttgattcc atcgacattc cactacaaca gttgattaac tacggtcaaa    278220
     ctaacggctg ggatgtattt gcctatatta ctgtaggtaa cgaagctgtt atctctcaat    278280
     actgttccgt aagtgacttg gtttctaaga ttggacaggt tagaggtcaa ttgaaagcag    278340
     ctggatatac tggtcaattg acaacaagtg agcctcctgt cacctatgaa caacaccctg    278400
     aattatgtac agcttcaggc attgacttcg ttggtatcaa tccacatgcc tactttgata    278460
     catattccag tgcagataca gccggctcct ttgtaaaggg tcagatcgaa ctagtacaaa    278520
     aagcttgtgg cactggtaat attgtagtca ccgaaactgg ttatccatct gccggtattc    278580
     aaaatggtgg taatatccca tcgaaaccaa atcagctcat cgctattcaa aaaattctag    278640
     aagccactaa caaccaggtc acattgctat cctgtttcaa cgatttttgg aaggcgcctg    278700
     gcccatatgg tattgaacaa tactttggta tcttggacaa cctgccatga acctagaaga    278760
     tccaaacaat aaaagatagc cgaaggctgg atacttcatc aactatcgat cagactttat    278820
     tcaaattaca tgccttggtc caaccaatta actcataaaa aataattatc gaaatgttaa    278880
     aaccaaggca atatgtaatc taatgtcccc tcaaaagtaa tgattaacaa tacaaaccaa    278940
     acaaaattaa tatagataaa attgcatatt gcattggtta agcaagctat aaccctcgca    279000
     tcagatgata taaaacatat catcaatcct cacctcacaa aattgtataa tattcaatct    279060
     caactaactt aagtgtctaa attgcattta gacatatata gtatcattta ttttccataa    279120
     tttttagtta ttaatattat tttcgttcca attgtatcaa atttaattat gatgctcaaa    279180
     atttatttgt tgaaatgatt gtcttatttg ctgttgctaa cgtctaatat acagatattc    279240
     atagtattta aatagtttta agtttacctt caaagaaatg tttaacgctc tttcaaagcc    279300
     ttgtttctct tttctcttct cctcaatctt tcaaccttct tagcatgcat cttggccgcc    279360
     aatctttcgt atctctcttt ctcttccttc ttctcacgtc tcaatttcat agcctcaatt    279420
     tgctgcctct tagtttctaa cttttcatcc tttaatgcct ttaacctctc cttatattgc    279480
     tgttcttcaa gcctcttctg tttctttagt tcccaggacg tgagcttctt gtttttaaca    279540
     acacgactgt tagcacgcaa tggctccttc tcttgcttcc atacacgctt actcactggc    279600
     aaccctttag cttcttcttc aaccattgct gtttcgtgga ctttgtatga gttcaaatga    279660
     gattattaaa ctagaatcaa taatatgctc tttataagtt gcgatgagct catcgcatcg    279720
     gtcctgtgaa atttttcact tttcatggaa aaactccaaa atatatgctg aatcacaatg    279780
     aaagtcatac aaaaattact actacagaaa ttgcagatgt taatgaataa cataaccaag    279840
     caatacggga ataactaata tgcgaactgt actaccagtt cacaggtttg tgcgaacggt    279900
     ttacctacct gcgcgccggc tagtaaaggc aaatgtaggg gcgcaaaaga tagcaccagc    279960
     agccagttct gcgattctgc cgaaggacct agacattgat atacgaggta tcgaagatcc    280020
     aaaagtctta gagatgaaag tgaaacaatt acaagagttt actagaaata taaagactga    280080
     gataaagcgt cgagcgaagc aaaaacacac tgaagagcaa cctctcgagc tcagcaacaa    280140
     tgaagatatt tcagctgtat ttaatgcagt tgtaaatact ccaaagaaag ctgattctat    280200
     cggaaaaggg atcactgaaa agttgatgga gaatactgtc gatcagatca tcgataatgt    280260
     ggtaccgaag gcgatacagg aacgaattgc tgacaaatct ttaatggtca gagcgctagt    280320
     gcgtacatcg gttcataccc ctattgaatc caatatgctt gttaaaaaat tagcagaatc    280380
     cgagatgaga ctaaaaggtt tgccgcaaga agatattcgt acatttttaa agaaaagtat    280440
     aaagaatcta aacttcacca acattttaga attggataaa atgctcttgg aatatgttgg    280500
     aaatgacata agcaaattct ctgataacat gtacaagtgc ctattttcta acctgtcaaa    280560
     actaaatgcc caaagcacac aacatagtaa agatgatctt gtgattaaaa tgttcaacaa    280620
     attattgaaa aggtatgata cgaatctgaa cactacaaac gcaaatgttt ggaatgaaaa    280680
     gatgactaac gtcatattat cttactgcat taattatagt atcaaattga aagactttga    280740
     aatcaccgat aaatttgtct cgaaatttaa gaatgattac aaactactac ctgataaaca    280800
     aaattataca agtataatac acttctattc gaagctggga ctcagtgata aagcctggga    280860
     tacctttgat accatgaagt ttctatcgag atctcatgca cctgatacaa aagcttataa    280920
     cagtgttttg atgctatgta aacaagaaaa agacttcaga aagacaattg acctatatca    280980
     tgaaatggtt gacaagaaag tgccaatgga tgctagaact tatacaacta tgattcatac    281040
     attagcggct gctagtacag attcttatac tagtgagggt aagtctgatt cactccggat    281100
     attgggttgg aaactgatca atgagctttc aaagaatttg caatatgatg ttatgaaaaa    281160
     caaacatata ctgatttcga tgctctcatt atctgcatat gatggtgatc tgggtatggc    281220
     aagagcgttg tattacaaga ttttccatca aaagtccgac gaactttatg ccacaatgaa    281280
     tccagctcaa ttagaaaatc tctcagcaaa agatattttg tcatacgtgt tggatccgaa    281340
     agtactgaat tatttgcttc tagcgtactc aagatatgat aagggacgct taccattaat    281400
     tttagcgaac gatgagggtt ctacattgag aagaaatgtt atcaatgctg ttgattttgg    281460
     agggcattca tcagagatgt ctgcacttga gttggcgaat aaaatcacaa taccattttt    281520
     gccatattca gaaatttctg aaaactggca aataattgcg gaatcaagag cgctatggtt    281580
     gtttaacctt gaatatggtg gcattactga tatttccctc acatcatcaa tacaagaaaa    281640
     tgcgatgatt tatagagacc aagccataga tattaatgaa ttcaagttaa agattatgaa    281700
     tgacttgatc gaatggaaga ccgaaaacct gaacaacaca gttttaaatc caaccctttt    281760
     acagacgttt ttaacaattc ctttaaaaag tggtaataga gaagaatttt acagtagatt    281820
     gaatgccttt acatttcagc aacataactt aaactccgtg atggaaaagt tttatgaata    281880
     taaaccagag tcagaggaat ataatgattg cctcaaatat tttgagagtc tgaaaagaaa    281940
     aattctaatg tcgaatagtc actacgatct tgttatgaag gctgctacta aatttggaga    282000
     tattgacgct gccaatcaag tttggaaaga tagaggtgag tacaggaaaa ctaccagctt    282060
     tgctaagcta cctaccaagg atagaattat tagtgattct aactttgcaa agcttatggt    282120
     tgagtttttt gtttctcaga ggctatattc tgatgctatg gccgttgttt tatcctccaa    282180
     aaattttatc aaatgggact actcaatggt taaatctcta caccatggcc tgattgaagc    282240
     tgaagatatt ataaatattg aaaaattgct tgacgttgtc aaccgtagca aaggtacaaa    282300
     gaaagcagtt gatgtcatta atgaacaaat cgaggaactc aagttatcct aagttaagga    282360
     tgctaaaggt ttcaaataca aaccgctagg gaggatggag ttcagagaaa aatgtgtgca    282420
     tatgtaatta cgagaacact ataccatgta aatatataca attttgcatt tcataattag    282480
     aaattaatgt ttaatccaaa taaatgttat agatgagaaa agttacagaa aaattgatag    282540
     ccataagaag aaaaaaacct caaatatcag atccactttg agccatgtct agttcctctt    282600
     gtagctcttc aacctcaacc tttagtttag taacttcatt ttctagactc ttgccataat    282660
     aatcaatgta ataagtagca ccgttatgtg cagcacataa gaatatagct aaaagaaaga    282720
     actgcgacca tatttcatca tatttaatcc agatattgca aagaagcata gtcgaaagtt    282780
     ggtacaggta ctgtgataac gtatatatta caatcggcca aggtgtgggt aatttcacgg    282840
     cccagaagtc cttgtattga tgagtagtca ggtaatggaa actagtttca cgctgaccag    282900
     cttgtatctt tgagctcttc cttaatgtga taaagtaatg gtataaaact tgccagatta    282960
     ggtaatacag ggacgtgtta atgatattgg tctttaacga tatggagttg cgagggtcta    283020
     gtataactgc accagggaat ctttctgctc tatactctgg tgaaatagcc ctgtatatca    283080
     caaaaataga acatgggggg ataatatgga taaaacagga agtggttttg tctattgaat    283140
     gaatcaccag cgaattccgc catgtaataa cagcaaagct gagggaacca aatgtcagtg    283200
     caaagcatga taagaaaagt gtttgattgc gtggaaacac ccaaatgtaa gcaaggcaaa    283260
     gaatattaac aaagtaacac aagtccgcta agaaataatg gttattggtc ttgtagtaag    283320
     tgtaaaaccg gattggaatt aaaatacaga acaaaactgt gtagtaaacg tggaagtatt    283380
     gtgggaaccg gcccatgatg aatccgatga agaatatatt aaacagcgta aatgggtaaa    283440
     ataacttttc tagcgtagat gttttgtgga aaaatagcct gtttaagggt ccgtcccatt    283500
     tcttgatttg ctcgacaagt ctctccctgt gcttcttgat taacctctta tggtccccgt    283560
     ttagtttatc cttggctcgt tgccacgtct tcttataatc atagttttgt atagtcggaa    283620
     attgagtgta atgtatctta gaggctatgg gatccagtag ctccactagg ttgcccaacg    283680
     acaactcaga ccgcagctca tccttctctt cagtagccat attaaatggt tgtattgtgg    283740
     tgtatttgct ttctactagc caaaatgcag atgtttggac cagtgagttt taaatatggt    283800
     tcgattaccc tttaagactc gggctgtttt tcgtttctta gcacctctaa gcgttcctga    283860
     ctggatgctg attcattaac ttgagtgtgt ctgggaagtt aaagggtttt tcaggtacta    283920
     aaagctctaa cttcaagcat ttttcttttg aatatatata tttatagttt cattataatt    283980
     gcagaccgag cgcttatacg atatactcct tagtattagg gtcgagggta cggagaaacg    284040
     cgatgtttag gtctatgttt cctgggatca gtcgtggtgt gtccactaga ccgttgggtt    284100
     ttggcgctag tagagctacc actagggtgg ctgcttctag gttaaccaat agatttgcca    284160
     ctaggatgtc tggtgcacga atggctacca ctacagcgca ggccaagaag gagaaaggca    284220
     tcaagctgct gatgaagaag tacggctctt cagcactgat tgtatacata ggtttaatgc    284280
     taattgacct gccgttgtgc tatctggcag tacactcgct tggtgatgaa accattgcga    284340
     tttacttgaa cagagctaag cgtctatttg gctacgggaa ggacgaatat gaactggtag    284400
     acgaaatgaa tcgcaagaaa catgagaagg aggccaaagt tcagtactca gagagctggt    284460
     ggactcagat gaagaacagc cacatgctca cagagctgat tctggcttat ggtttgcaca    284520
     agagcttaat tgtggtgcgt ataccgttga ctgcagcaat tacgccatac gccgccaaaa    284580
     tcttcaagaa atacggccta gtttccaggc taaacttcac aagaaccatg gctgatgacg    284640
     ccaagatacg ctataaatag agaatacgct gccaaatttt attttccatc actaacatgt    284700
     gatttattta actattgttg acttgtaatt agctttcatt tttcctctaa ccatggacca    284760
     caaatctatt atagttccat atgagatgaa tcaaaaagaa aggaaaccaa aaaaccaaaa    284820
     aatatacgtt gatagttcta gaaaggatct gggcacagtg ccatatcagc ctcgttgcat    284880
     tgagatgcaa gatagcattt ttgagttctg aaagttctgg aagttctaca attatcacag    284940
     gggcccctat tggccttcac ggaatgttga gtgacaaaaa atttaccata tgaaagataa    285000
     tacaatacgt atatggagaa gccaacttct gtcgtgttgg agctggcctg ctcttgtacc    285060
     aatccaattg aacttaactc tcgcacacct ggcttcccaa ttgttctcgg gtttggcttt    285120
     actaccccca cccaggtaga acagaagcaa aggtgcgatg agctctacac ctaggtgtat    285180
     aggtgaagca aggccattga gttgagacat ttcttttgat aaaaataaat atctagggca    285240
     ccttttgctg gaaatcgaag ggattgagct aatgtcattt cttttttttc ttaacttgga    285300
     ctttgttgga tcagatcaat ttgttaaggg ggatgcgttg atccaatcct agtgcataat    285360
     agggctaccc ggttaggtaa ctctgatcca gatatactaa acgaaaatga tttcaattga    285420
     ccccagttgc tgatatataa gctggggtat ttcgagatgt attcagcatt acattggagg    285480
     caaaaagacc tcgaatatta agacggtaat cgcagctcta tgatatagtc taagggatat    285540
     atttaactct gtgatgcata attgccaatt cgaaaataat ggctgccttt aacgattatt    285600
     gcgctgtttg cgaaaagttg cttgatggtt tggatattta ctgttcagaa gagtgtaagc    285660
     acctcgatga agcttttaga gatgatgctg aatcaacaat tgatcctttg ctaaagtcac    285720
     cgttgctcta tgctcaatca ggtattgatc atgaagacat ggacgatctg gaacttcccg    285780
     cttctgatag cttacaggta cctagaacca tgggccgctt acgcaatctg tgccctatac    285840
     aagaagtatg caatgatgaa aaagcagcag cacaaaatta tagactatgg ctacaataca    285900
     acagtacgta aaggtggact agtgttgtag aacccttagt tgtttaagga tttattcttc    285960
     aagttaacga tagctgctca gtcactattt tatactgaca tacattggat tttagttttt    286020
     attggttttt gtacactttt tctttttatt tcaccttttg tggttacatt ttgttggtta    286080
     ttatcatgtt tttggacttt cttttaactt attaacgaat tttatatggt ttctcttttc    286140
     tcggcttcat attagactaa cattttttat aaactattta gataatagat aaattttttt    286200
     gagatgaaag tagaatattc aatcgaattt tttgtacgtg agccttttat tatcaacaat    286260
     tgacgataat tttggaatta ctttataatg cagatataat ataaatttat gcttggttta    286320
     gtttatgtta attaacatat ttacatacct ctgaaaacgt ttttgcttgc ccttcttctt    286380
     ccctcaaatc taggtttcgc tctaccgttg tcaggtttat tgtcatcgtc atcttcatcg    286440
     ctgtctgatg aagctctatg cattctcttt ggcttgggag atttcttacc aggcacaaaa    286500
     gttagctcag ctgcaccacg gtggttacga cgaagaactt gagcggtgga tttcttatca    286560
     gtgttttctt cctccaaagt tttaacttgc tcggcaaatg taacagatct cttctcgccg    286620
     ttaactgaaa gtccactatc agaaaccttc attccatcta ggaacttctc agcttcttct    286680
     ttatcctttc ttctacgttc aataactttc ctttgctttt ctgcttttct cttctcagct    286740
     tcagttaact cagccttatc ttcttcactc tcgctctcac tttcactctc gctatcgcta    286800
     tagtgaccat tcttcatggc tattctttct tcatcagatt cttcggctgc agttagggct    286860
     ctaatacgtt tagcagcacc ttcgtcagtt tctttagcag atttaactgg gttcaattgc    286920
     ttgtaatcat aatcgttctc atcaactttg aaatcttcat cttcaaacat ttccttgaaa    286980
     cgatcatctg taagaatttt actggctgct gagtcaccac gtttggttgt aattttctcg    287040
     acaagatctt tattaaattt gactttaggt ttcgataccg cgccagaagt tctgattctt    287100
     gattctcttt ccttctcaat cctgcgtctg atttctctct ctctttcatc tttgtaagca    287160
     tttggattag caatcaaaga aaccttatca tataattctg tattaatgaa gaaaccatgc    287220
     atatatgctc ttagaacatt cgagcccacc aaatgagtga tatttaactt ctttacatca    287280
     tctctcgtta tgaatctgta gttcgagtaa actgagtcac ttggtttctc ttctagttct    287340
     tcggtgatgg agtccaagaa agaacaccat cttggagatg gaccaagagt aggaatgtaa    287400
     tatgtatgca ttggaatacc ttcattggcg gtgaagaaca tacctgagcc tgggatgtgt    287460
     tcaatatcgt taatgtcgac actaggttcc attgaggcgt atgctttacc agtatcttta    287520
     ttccaaatct tggcgattct tttatcacat gttagaatgt tatcactgtt ttcaacacca    287580
     acgttatcaa gccatattat cttcttgata tcaaacccat aaccttgatc cttgacctgg    287640
     tatggctcag aagtacgcaa gtcgtataaa taagaataac cagtagatgt accacaggca    287700
     aagtttaaac catctcttct gaaacttgat gtagtaactt gaaaatcaga gttatccaaa    287760
     tcattttcta acacgagttt agcagctctt gttcttgctc ttggatccca gaattctacc    287820
     gtattatttt ccatggatac agatatcaac ccgttgacat cacacatagt tacatgattc    287880
     acaccttcat catctaattt gaatgggttt aggaatctac cctgctctag gttaagtcta    287940
     taaagttcgt tgctgctggc accgacatat aggtcacaat tcacaggatt ataagtcaaa    288000
     ctacgaccaa attttggtat tctggttgtg taatggatac cacctttact ttgaaattgg    288060
     atacttctgt cgttttgtag atgaacactc ttggtccagt catctgatat aagcacgaag    288120
     tcaacatttt cagcatcagt atgtctgtcg aacttcatag acaagttggc aaaatcatat    288180
     acgtgaatct gtggcttata agtaccggta gccatcgcat agttaccatc ttttgtaaca    288240
     cgaatcttgt tggaggcttc actaaactca aagtcctgaa tcaattcaac tctgttctga    288300
     tactctaaat cgttctttag ggacctctta cgcttctttg caatccagtc aggcaaagaa    288360
     cgagatacat tggtaccaga gacctggtaa acagagatat cattagcaga tgtggacttc    288420
     aacaccatct tgcaatattt tatcgtcttt ttatgttggg ccttgtttat ctgaacaaat    288480
     acagtcttta taactcttct taaaccatta tattaatgcg atgagctagc tcatcgcatt    288540
     tttttttttt ttttttcgtt ctgaaaattt tttttcaaaa cagcgatgag ctcacataat    288600
     taaggattat aacagttaga gataagaagg atcacctttg agctgttagt cagaaatggt    288660
     tggtttccta tattgaattg ttgcctatta aataaaatat tatatagaaa taaaactaag    288720
     gttgatacta aattttggct aaatcctaca ttacttactg attggagaag ggtgtagact    288780
     ccatgggtac caaagaaatt attagcgttc gtttgatgga acgcgttcat tgaggtgatg    288840
     tataccaatc ttgctgtaac tttgttacgc ggcgccattt agtcggctat aaagaataac    288900
     attggctcag actttaagca ggttatatag tgtaacactc ctctaaatcg tagtatatgt    288960
     tttttgcggg cacatggcgc agttggtagc gcgcttccct tgcaaggaag aggtcatcgg    289020
     ttcgattccg gttgcgtcca tatatttttt ttttgtttct cgtagtatac tctgctgtca    289080
     ggaacaatat catgagtttt tctattacca acagaatagg ttctcctatc atatgatgta    289140
     tcttgtttga gttttttcta gtgtttgcta taatactttg cgccaatcta tttttagctt    289200
     ttgcccagag aatatttcca cattcctagc tatttttagc gcgccgtcaa aaaagataat    289260
     aaaatgaatg ttataatatt acatgataca tgagaggtcg aataggcgcg tagcgctatt    289320
     ccatatgggt gggatgaaca agtgtagctg ttccatatat gttgatatac taaaagtgtc    289380
     ttaggtgaat gtcttatgtc ttaaaggatt gtgcataggt tgtttttttt ctttttcttc    289440
     ttctcctgtt ttatttcagc aggagatgca gatgactgag gtgatgatgc atgtgctctt    289500
     ggtttctgct tctttgaggc ggcagtcgct ggtgcagtac ccttcttatc ttgttgtgta    289560
     tttctagagc tgtttgtagc tatctgcttg cgtaatgtgt cctgatttga tccgctttgg    289620
     tgtttcttca gcgatcctgg cgaatttgat ctattcgtgt ttgttctgga taaggtagac    289680
     ttcttggtag attgttgtga cgatggagtc gcgttgctgt tgctccgtgt gttcttaaaa    289740
     ggtgagtgtg gtctgtcgtt attcgatgac atgttgccct ggctcccgtt cttcctcagt    289800
     ggatcattta gggatgcttg cgagagggat gggtggttgt tggtggtgtt cgtcaccgtt    289860
     tctatctcat tccttatgat ctgcctcacc aggtcaacga atacttcgtc gacgttgctg    289920
     cgcagcaagg cgctggtttc atagaagggc actttacccc actgcgagct cacgccgata    289980
     ccttcctcga ctgggatgat tctgtcgtct accagatcgg ccttgttgcc gaccagcacc    290040
     atgggcaccc gctgggagtc cttgatccgc agcacttgtt ctttcagctc catcagttcg    290100
     cgcagggagt cgcggtctgt cacagagtac accagcagga agcccatgcc ggcctttatg    290160
     tacagctccc gcatcgcggt gaactgcgcc acgcccgcgg tgtccagaat ctccaggtca    290220
     aacaccttgt tgtcgatctc gattgtctta cggtatgaat cctcgatggt ggggtcgtac    290280
     gtgtccaagt aaacaccttg cacaaactgc acggtcagcg aggacttccc tacaccaccg    290340
     gcacccagca ctaccagctt ataatcacgc atctcttcct ggctttttgc ttaatacctg    290400
     tcctgccagt gccagtgcca atgccagtgc caatgcaagg atcagcatca ccattgttat    290460
     atgagaattt ttttattttt ttttgccctc ccgcaaggag aagtcgcagg tgaagaacga    290520
     gaatgccgag caaattcctg gagagcaaat aaattcgtac caggcatcat catatgacgg    290580
     ggggtatacc ttgcactaca cgcatttgca aagcaagtcc agatatacag ggtatctggg    290640
     aacttcgatg gcaccgttca taatcttaca gcagggaggg tcttcaccgc agcgctatgg    290700
     gatgttagag tagcatctac cagggtgtta ggcgtatgag tatatgtcat ccagacatag    290760
     tcatcgatca tatcatctag tcatatactc atcgatcata tacccatcga tcgtatcatc    290820
     tagccgtcga gccgtcgggc tcatagccgt cgggcacata gccgtcgggc gcttattccg    290880
     tggatcctcg cgacacgcca cagttttgtc tgcagcgcgc aagaaagctc cccccggcag    290940
     tgtgggcagt gccagaagtg tgggaagtgt ggagggagtt acccggctac ggcaccggtg    291000
     ccgtgtatag taccgtaaga cggtgtggag gtcacgttta ttctttcaca aatttttttc    291060
     agttccagaa tcgttggtgg tgggggggga ggaagccgtg ggcctcatct cgaagagtcc    291120
     ccccatctct tctagatccg caccagtgta tatatataag gttgttctct tctcagctgg    291180
     atcctgattc tacttctatg agataacccc acccacagta ctgttattcg agaataatgg    291240
     attctagaca caacgttata gatttggttg gtaacactcc gcttatcgag ctgaagaagc    291300
     tgcctaaggc gtatggtatt cgtcctcgtg tgtttgccaa gctggagctg tacaacccag    291360
     gtggttccat caaggaccgt atcgccaaga gcatgatcga gtacgcagag gagcaaggca    291420
     tcatccaccc ttcgaggtct acgctgatcg agcccacctc tggtaacacc ggtattggtc    291480
     ttgcgcttat cggtgccgtc aagggttaca gaactattat cacgttgcct gagaagatgt    291540
     ccaatgagaa agttagtgtt ctgaaggcgc ttggtgctga gattatcagg acgccaacgg    291600
     aggctgcttg ggactctccc gagtcgcaca tcggtgtggc ccgccgtctg gagaaggaga    291660
     tccctggcgc gatcatcctg gaccagtaca acaacatgaa gaaccccgag gcccactact    291720
     tcggtaccgg tcgcgaaatc cagaagcagc tggaggacct gaagctgttc tcccacttga    291780
     acgccgtggt cgccggtgcc ggtactggtg gtaccatctc cggtatctcc aagtacttga    291840
     aggagcagaa cccagagatc aagatcgtcg gcgctgaccc tgtcggctcc atccttgccc    291900
     agccagagaa cttgaacgag accgagatca cctcttacaa agtcgaaggt atcggctacg    291960
     acttcatccc agaagtgcta gacagatcct tggtcgacgt gtggtacaag accgacgaca    292020
     agcctgcctt caagtacgca agacagctga tctccaacga gggtgtcctg atcggtggct    292080
     cctccggttc tgcgttcaca gcgctagtcg agtactgcaa cgaccaccca gaactgtccg    292140
     aagacgacgt cctggtcgcc atcttcccag actccatcag atcgtacttg accaagttcg    292200
     tcgacgacga atggttgaag acaaacgacc tgtgggacga cgagatcctg aagcgcgtag    292260
     acttcgacga aaagaagaag ccagccaccg acgacgtctt caagggcgcc accgtcaagg    292320
     acttgcactt gaagccagtg gtcgccgtca aggacaacgc cttggtctcc gacgtcatct    292380
     ccatcctaag agacaacgcc ttcgaccaac tgcctgtcct gacacaagac ggtaagctaa    292440
     cgggtctggt gactttgtcc caattgctaa agaagctatc caccggcaaa gttaacaaca    292500
     cagacacaat caagaaccta tacttggatt tcagaaagtt gaacaacttc gacgaagtct    292560
     cctcttacaa cgaaaacaag tccggtaaga agaagttcgt ccaattcact tccgaatcca    292620
     ctttggctga attgaacaag ttcttcgaaa agaactccag tgccgtcatc acagatggat    292680
     tgaagcctgt tcacatcgtt acaaagatgg acttgctaag ttacttggct tccaccgctt    292740
     gaagcaataa ccagcaaaaa aacgaaaaag aaaaaaactt cgataaatat agattcaacg    292800
     tactataatt ctagcattct tatcaacgct ctaatagcgc actattacac ccatcgaccc    292860
     atgtttatct aatgtattta tatagtttct caaacctctc gcttctgctg taacgacagg    292920
     agcaaattct gtacactttt ttttataaac taaataaaca tatgatagat gcacataaca    292980
     gttctcgcca agtaatcgac tatgcaggtg caaataactg actttataat gcttctcatt    293040
     atccaccaga tctaaatatc agaattgacg acatagttaa gagggtcctt tcacgtaaaa    293100
     aatcttttct acggtaaact cttattttga gggaccgatg ccgacactaa taggactgtt    293160
     gagtcaattc tgactgctgt caaaaggtta taccatttga caactcgcta agtgtgcagc    293220
     tatcttactg ttttcccccg tcttgctgtt ataatacgtc tttcagcgtc tcattagcag    293280
     ccctatagca cgaaaactag cattacgtca tatacataac agatgagtga tcctagaaag    293340
     agaaatacgc gacaccaact tacgccagat aacttatcta catccattct ggttactaat    293400
     atacctagtg attggaacca agacgtggtt tcttcagtag tggcagggtc aggtcccatt    293460
     attgacatca gcagtcgtaa agacccacgt acaggcaaag taaacggact ggtttatgac    293520
     taccgggaac cacaggactg cagaagggcc tatgacctct tgcaaagggt agagaaacta    293580
     ccgtttgagt tggagagaat aataccatct aattataaga ataggacaga gagcgtgaag    293640
     gataagccag agattcagct ggatagggag aattttccct ggaatgcaca attgtcatta    293700
     ccatttgata tgatctcaga agtacctcta cctaagaagg caccaacagc gacggccact    293760
     tcaagtaata ctacgaagaa taatgataac aatatagtaa atagcatagg aagtaatggt    293820
     gtggtagtat tccccgaaat actcataaaa agctctcaga acctgcctaa gttagagaag    293880
     gaggcattag aaagctcgga tcctatatcg gccaacctaa gtaaaatacc acctgcccag    293940
     atgatcgagg taatatccaa cttaaagatg ttggcaaatc aacataatac taagaggtcc    294000
     caattagaga catttttgaa gtctaataat gatattttga tgaccatgtc acaggcaatg    294060
     ttagagatgg gctttatcga ctacgaggtg gtaacacaag tcatgaaaga tgtaactaag    294120
     gaatccaaga gtgggaaatc taccaatagt aacagcaata gtaacagtaa cagcaacagc    294180
     gctactccta taatgccgca atttaataca atggctacac cacctatggc tatgggtggt    294240
     atggtcccac cagtaaacaa catgaacatg ggtggtatgg tgccgatgca aggatttatg    294300
     ccagctgctc cacaattcaa ctacagccct ccaccaccag tacccgcacc aatgcaagtt    294360
     ccaatgtcag gaccggtatc taccccaact caggccccac cagttcctat gccagcacca    294420
     gtacaaatga atgaaccaga aattaacgtc atcaagctac aacaactacc agaaaaccaa    294480
     agagagatgg tcaagcaagt gctgaaacta actgatagcc agatcgcagc acttccggag    294540
     caacagcgtg ctatggtcac aaatctacgt aaagagtatt tgtactgaag tatataaata    294600
     taacattcac tctgtaagca ttctgtactc cagtttatgt actgatatcg ttggcgaagt    294660
     gacctttcat gtgatagcct tataatcact tcgtgcccat tgtttacttg agcacaatct    294720
     tggcatcaaa tgcagtaagt gccgtgtggc aactaacatg ttacacattc agcagaatgc    294780
     catcaacctt cgtccgtatg gctagagcct ctcgccgtga agttgagtca gacttagtta    294840
     agttccgagt cacacaaccc acacattgct tgtctccttc actttcccag aatatggctc    294900
     taaggaacta tctagcaaaa aatgacgcaa tctccaaata gtgattgtca aggcacctag    294960
     ccactggcac acttcttgtt agttaaactg tgtccccaat catatttcta atgattttat    295020
     aaaatgtata aaatggatta ctgtctcgga gatcgataaa aagtactatt cacaagtcca    295080
     tgtgaaagta aagcaacttc caaaagtgca ataagttcaa ccagaaattc aactagtatc    295140
     ttcaacagat aacatatttc cgttagtgtg tagatagtgt aaatcttcac atgctaaaag    295200
     gagtcgagac ttaatagtat ataaataaga aaatattaag gtctactgca catttggata    295260
     ccatttggat acctaataat taatatattg caaacagaaa tacaactcgt acattggata    295320
     tgtcagttgt tgctaacgtt gaagtcaaaa tgaaaggcag aacacggagt tctggtatac    295380
     attttgaccc gccagagact cacgatatgg tgagatcgct attcgatcct cgcatcaaga    295440
     aatcttattt ggagatagta atagcttctg tgattttatc aaattttgtg gtttgttact    295500
     ggctcctgaa tagttatgga cttcaggtcg caaaatactg cttcctcggg cagtatgtgt    295560
     tctggagatt gtcatataac ctaggtattg gttgtgtact acactaccag tctcattatg    295620
     aaacgctgac gaattttgcc aagactcaca gactattttc taaaaagaat aatgcgtttt    295680
     tggctaaatt tgcccaattt gaaataagct ctaagatgcc tactaattac aatatttctg    295740
     aatacccaga agagttaaat gtatggctgc tgtttcgtca attcgtggat ttgattttaa    295800
     tgcaggattt tgcaacttat atggtctacg tttatttatc catgtcatca tggagattta    295860
     cttggagaac aggtcttggt ttggccatga ttttatttaa tatctgggtc aaactggatg    295920
     ctcatcgtgt tgttaaagat tacgcctggt actggggtga tttctttttc ttacaagatt    295980
     ctgaactaat atttgacggt gtattcaaca tctctccaca tccaatgtac tctatcggtt    296040
     atttaggcta ttatggttta tcattaatct gtggtgatta tagagtttta ttggtgtcag    296100
     tctttgggca tctactgcag tttgttttcc tgaaatatgt tgaaacccca catattgatc    296160
     gtacctatgg tacatctgaa acaaaagaat taactaacgg cactgtagat gatcagattg    296220
     caagagaaca taatgactac acccatccgt tgatcagtaa cggtttgttt ttggaaaatt    296280
     ttg