(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_7

ID   CAGLA1_7; SV 1; linear; genomic DNA; GRV; FUN; 927101 BP.
XX
AC   CR380952_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 21)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome F, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380952.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927101
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome F"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        19572..21284
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348965"
FT                   /locus_tag="CAGL0F00187g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG58906.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124652"
FT                   /db_xref="HOGENOM:HBG207660"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniParc:UPI00003B62E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW2"
FT                   /transl_table=1
FT                   /translation="MGKVGEFFGHPGRRPMFRHRANIPVIKSDCEYEESCNEKNDPKND
FT                   ETICRVDSFNNSSSDSSLNDVHLQDDGNILTTHNFTGLSTSRTDKVLDWMVMVAGSQFM
FT                   FFLIWIILIIWIVTGIIYNGPFNWQVVMQDGQSIQCYVWDTLLMRQQLNSTHEQILIIS
FT                   DIRSRLASFSGFFERLSFACIKGSKESDVDTTAQGVDESSNKSDINCDCEDKNETTEFI
FT                   KTGELPVENWYDNLCTKASYIIGSIPMMIAFWLGVMVWIVCGIIPKDAGNSPPFTGETT
FT                   GSNPKLKKFSDTWQMYINTAVAVSLLICSTFLQNIRARHDKFIAKFLLQIYDLEHEIDT
FT                   KLRTALNDYDTLHPIIEVAPVKRSKLEVIIDWYADVIGTGIGVVVAIIVFGVWIGIGQP
FT                   LHWNDNWWLIIGTYTGLVGFLDGYIIRQVYFKIIQHEENNFQMLADEDMALFQRYNIPC
FT                   EDEYFGIKGPVKMNWNLKISTYINYLCASQWSVVCSVLIILGLIGAASGLKWSTTGQLI
FT                   ANTPTMIIEEFFLIVLIQAHNEADLERRKEVTALYMRRKLLLNYVKKELGISH"
FT   CDS_pept        complement(22109..23731)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437760"
FT                   /locus_tag="CAGL0F00209g"
FT                   /product="Similar to uniprot|P53322 Saccharomyces
FT                   cerevisiae YGR260w TNA1"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG58907.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG326782"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B62E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW1"
FT                   /transl_table=1
FT                   /translation="MIESFDDDDSKKRNEISHVEDSSKYDLTVHLSSKDEDSSLQNVDD
FT                   IKGDFEEEAIPLFVSKDEIPESLKDYTTEELEILDKKTRRKMDLRILIMLCWIYICNYL
FT                   DRSNIASARLGGLEEDLHLSSQQYQTAISILFVGYITMQIPCNIILNRLGRPSVFLSVI
FT                   MTAWGIVSTCTGAVQSYGGLLAIRVILGFVESGFFGCSLYYLSCWYTKKELGLRNSILY
FT                   SGSLISGAFSGLISAGIIEHMDGTRGLRAWRWCFIIEGAITVGTVPLAYFILPDNPDNS
FT                   KFLTETERDLVMWKLRMEVGDSDSDKEMLGESGHNSFWYALKLALTDTKVWLLTGCLTF
FT                   LVAAAGVTNFFPSVVKTLNYGRIKTLCLTAPPYLIAIITTFGWSWHSDRTGERFWHIVC
FT                   PLFIALAAFIIAVSTLNTGARYFAMCLMPTGLYCSYTIIISWMSSSVPRPPLKRAIALS
FT                   VMNCVCNSTSIWNAYLYPLSNAPRYVIAFSSNCGFIAASICCAVLMRLYLLHLNRKIKN
FT                   GTMDWFKEFGNDGSKVKNFQYPV"
FT   CDS_pept        29705..30628
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044600"
FT                   /locus_tag="CAGL0F00231g"
FT                   /product="Similar to uniprot|P23641 Saccharomyces
FT                   cerevisiae YJR077c MIR1"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG58908.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG526109"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B62E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUW0"
FT                   /transl_table=1
FT                   /translation="MSNQLPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEP
FT                   TVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYD
FT                   TAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGVG
FT                   SFYSGFTPILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGL
FT                   AAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTS
FT                   LQFGIYGQLKKSLGCAPTIEIAGGGH"
FT   CDS_pept        complement(31114..32568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000280459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437761"
FT                   /locus_tag="CAGL0F00253g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="anthranilate synthase activity"
FT                   /function="indole-3-glycerol-phosphate synthase activity "
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="glutamine metabolic process "
FT                   /biological_process="tryptophan metabolic process "
FT                   /protein_id="CAG58909.1"
FT                   /db_xref="GO:0004049"
FT                   /db_xref="GO:0004425"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="GO:0006568"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG059258"
FT                   /db_xref="HOGENOM:HBG395589"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI00003B62E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV9"
FT                   /transl_table=1
FT                   /translation="MKRVVLIDNYDSFTWNIYEYLCQEGADVQVFRNDKVTVDEVVALK
FT                   PDVLVISPGPGHPSTDSGISRDAIRQFAGKLPIFGVCMGQQCMFEVFGGEVAYAGEIVH
FT                   GKTSPIFHDNKGFFKNVPQGVAVTRYHSLAGTPESLPDVLEVTARTEQGIIMGVRHKKY
FT                   TIEGVQFHPESILTEEGHLMIQNILKVTGGTWDEYEANEKNTSTGNNQESILDKIYAKR
FT                   KSDIASQSKVPGFTMRDMEFNYKLGLAPSQIDFYSKIKSAKQRAVVLSEIKRASPSKGD
FT                   ICIDALATEQGLRYARAGASAISVLTEPHWFKGSLQDLINIRRALDIEFKTHPEDRPCL
FT                   LRKEFIFSEYQILEARLAGADTVLLIVKMLGEEELKRLYNYSKTLGMEPLVEVNCEKEL
FT                   EKALSLDAKVIGVNNRDLHSFNVDLNTTSSLINSVPAETMLIALSGITSPSDADKYKEE
FT                   GVRGFLVGEALMRTSEPESFIKALCQ"
FT   CDS_pept        33830..35044
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437762"
FT                   /locus_tag="CAGL0F00275g"
FT                   /product="Similar to uniprot|P32458 Saccharomyces
FT                   cerevisiae YJR076c CDC11 septin"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAG58910.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00003B62E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV8"
FT                   /transl_table=1
FT                   /translation="MSGIIDASSTLRKRKHLKRGISFTLMIVGQSGCGRSTFINTLCGQ
FT                   QVVDVSTTVMLPTDTSTEIELQLREETVELEDDEGVKIQLNIVDTPGFGDSLDNRKSFD
FT                   IISDYIRHQYDEILLEESRVRRNPRFKDGRAHCCLYMIVPTGHGLKEMDIEFMRQLGTL
FT                   VNIIPVISKADSLTQEELKLNKKLIMEDIDRHNLPIYNFPFDEEDISEEDYETNTYLRS
FT                   LLPFSVIGSNEVFDVGNSTMIRGRKYPWGMLDVEDTSISDFVVLRNALLISHLHDLKDY
FT                   THEVLYERYRTEALSGETSFNFRNDIPPQSLPRGDVSHLPHGSQSPMPPSSQSITGQDA
FT                   SSSDTYTAREEQIRLEEERLKAFEERVQQELILKRKELLQREQELREIEERLEREAKQK
FT                   QEQAY"
FT   CDS_pept        complement(35347..36531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195746"
FT                   /locus_tag="CAGL0F00297g"
FT                   /product="Similar to uniprot|P47124 Saccharomyces
FT                   cerevisiae YJR075w HOC1 suppressor of PKC1 "
FT                   /protein_id="CAG58911.1"
FT                   /db_xref="HOGENOM:HBG059571"
FT                   /db_xref="HOGENOM:HBG332675"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B62E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV7"
FT                   /transl_table=1
FT                   /translation="MTMARKRSNFKILRIFFFLIAGLAGIALLLKLSSNARASDIQKIL
FT                   QNLPKEITQSINVANSNQKADADVMAKFAKLAEDIKLKQEEQSKQFERQRKVLERKLRN
FT                   MKQISTDATLREKLAYNFEYDGKSRFPAFLWQTWSGSQTPEEVLHVKATWQEKNPGFVH
FT                   EILTPEMMNALVHHYYSIVPEVVEAYKLLPDNILRIDFFKYLVLLARGGTYADIDTSPL
FT                   QPIPNWIPETVEPSDIGLTVGIEHDAQAVDWRSHYVRRLQFGTWVIQAKPGHPVLREVV
FT                   AQIVEHVLNNKDDLSTVNVRNDLSVMKFTGSALFTDAIMTYLNDFIKSGLDRKVTWRDF
FT                   TKITSPKLVSDILVFPEFSFNVPENFDKEDPLRAQFFISHKGEKFWKAAPKVAS"
FT   CDS_pept        complement(36920..37489)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437763"
FT                   /locus_tag="CAGL0F00319g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58912.1"
FT                   /db_xref="HOGENOM:HBG192148"
FT                   /db_xref="HOGENOM:HBG739096"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI00003B62E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV6"
FT                   /transl_table=1
FT                   /translation="MSTCTTQLYGGAITTVLPLGFMDVSMLREVPDTQEVFVNSRTPQE
FT                   CAHAEDGLAENESIIIDLLQMVEAPSDDEALNVHIEDVTSLNGGDAWDTVKKETQPDGT
FT                   ITCILTESVHKWGKQDMRETLAICLALKRMKDVETDALISINVPLKAEEVELLSKTEEV
FT                   KRLTASYDVLKNIVKEFKVLDKSLFA"
FT   CDS_pept        37817..38098
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437764"
FT                   /locus_tag="CAGL0F00341g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58913.1"
FT                   /db_xref="HOGENOM:HBG124555"
FT                   /db_xref="UniParc:UPI00003B62E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV5"
FT                   /transl_table=1
FT                   /translation="MSSVYLVPAKIELVGNAGVPEEIKFEEVAQLRGKELHGEDLIQHL
FT                   DGYHGQLVKDGKIEELSSVVDFEREEEIFKQELNAFKETADILSALHN"
FT   CDS_pept        38589..39242
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437765"
FT                   /locus_tag="CAGL0F00363g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="N-methyltransferase activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="CAG58914.1"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="GO:0008170"
FT                   /db_xref="HOGENOM:HBG183696"
FT                   /db_xref="HOGENOM:HBG524237"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniParc:UPI00003B62E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV4"
FT                   /transl_table=1
FT                   /translation="MFGADFVEDKVIQFENFVEGLMYSVDYDAPYFYSALLFIIFNPLF
FT                   WNIVARLEYHTHFLTKIAGSPKRGCYFLAATIFSLGIARDLTFEKALRHQEVSPLLDTP
FT                   KITNIGYAFLIVGQILVISSMYQLGITGTYLGDYFGILMNDRVTAFPFNVSNNPMYQGS
FT                   TFSFIGTSLIAGKPAGLILAFFVHAMYYMALKFEEPFTAEIYAKRDEEKKSKKQ"
FT   tRNA            complement(39475..39546)
FT                   /gene_name="tRNA Thr (CGT)"
FT   CDS_pept        41539..42507
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195747"
FT                   /gene_name="LIA1"
FT                   /locus_tag="CAGL0F00407g"
FT                   /product="Deoxyhypusine hydroxylase "
FT                   /EC_number="1.14.99.29"
FT                   /function="deoxyhypusine monooxygenase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58915.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0019135"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG028810"
FT                   /db_xref="HOGENOM:HBG434986"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B62EA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUV3"
FT                   /transl_table=1
FT                   /translation="MSTNFEKHFEENVDDCNLEQLRDILVNKEGKSALANRFRALFNLK
FT                   TAASEFEANPSDAEKAVQYMGETFGDNSELLKHEVAYVLGQTKNLKAAPLLRKTMLDLA
FT                   QQPMVRHEAAEALGALGDKDSLEDLEKCLKNDPHVAVRETCELAIARINWQHSDAPTKE
FT                   SLQQSLYSSIDPAPPLALEKEYDLEELKKLLNDQEKPLFLRYRAMFRLRDIGTDEAVLA
FT                   LASGFNDPSALFKHEIAYVFGQMGSTAAVPSLTEVLGRKEEAPMVRHEAAEALGAIASE
FT                   DALPILKQYLNDEVDVVRESAIVALDMWEYENSNELEYAPA"
FT   CDS_pept        43066..43644
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437766"
FT                   /locus_tag="CAGL0F00429g"
FT                   /product="Similar to uniprot|P47119 Saccharomyces
FT                   cerevisiae YJR069c HAM1"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG58916.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG340523"
FT                   /db_xref="HOGENOM:HBG697237"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI00003B62EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV2"
FT                   /transl_table=1
FT                   /translation="MAPTEITFVTGNANKLKEVQMLLAAEDKKGSITLKNEPLDLDELQ
FT                   DVDLKAIALTKCKQAVKELGVGTPVFVEDTALTFDEFNGLPGAYIKWFLKSMSLEKIVK
FT                   LLEPYSNKGAEAITTIAYCDENGEYHIFQGITKGKIVDSRGPTNFGWDSIFEPLEGKGM
FT                   TYAEMEKDFKNTLSHRGKAFVEFKKFLYA"
FT   CDS_pept        complement(43750..44808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437767"
FT                   /locus_tag="CAGL0F00451g"
FT                   /product="Similar to uniprot|P40348 Saccharomyces
FT                   cerevisiae YJR068w RFC2"
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="CAG58917.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI00003B62EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUV1"
FT                   /transl_table=1
FT                   /translation="MFEGFGQNKRRKINTESAAEAEHNKPWVEKYRPKKLDDVAAQDHV
FT                   VNVLKKTLSSANLPHMLFYGPPGTGKTSTILALTKELFGPELMKTRVLELNASDERGIS
FT                   IVREKVKNFARLTVSKPSKHDLENYLCPPYKIIILDEADSMTADAQSALRRTMETYSTV
FT                   TRFCLICNYVTRIIDPLASRCSKFRFKSLDSSNALQRLKYVAEEEGVKVKAGSLETILD
FT                   ISAGDLRRAITLLQSASKNIGYSGEDEVSKELVEELAAVVPESSIKQIVELVATRDFNK
FT                   ISEYIQEFTRNGWSAASVVSQLHDYYIKSSEYDTAFKNKVSIILFDTDSKLTNGTNEHI
FT                   QLLNMLIKISQV"
FT   CDS_pept        45204..45638
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501125"
FT                   /gene_name="YAE1"
FT                   /locus_tag="CAGL0F00473g"
FT                   /product="Uncharacterized protein YAE1 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58918.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124571"
FT                   /db_xref="HOGENOM:HBG626694"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniParc:UPI00003B62ED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUV0"
FT                   /transl_table=1
FT                   /translation="MADLLDDVWGSGDDLDESTRELSPDLLKLKDNHSKRGYLDGIVSA
FT                   KEENLQDGFDMSFPLGAELGLRVGKIIGRLQGLEYRYGKDDEELKKDFNNAKQELQIKN
FT                   ILTKRIFTEDYNLEDSKHPVVSKWEEIVTKYCEKYNVKTE"
FT   CDS_pept        complement(45806..53176)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044601"
FT                   /locus_tag="CAGL0F00495g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAG58919.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG143897"
FT                   /db_xref="HOGENOM:HBG320181"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR009076"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI00003B62EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU9"
FT                   /transl_table=1
FT                   /translation="MSSLKLEDRDSSESAALLRSAVIGTPNEQSMSPVPILDYDSGSAS
FT                   NFTKGESTMLESDVLPDLESLPMLMDYILELLKSPNVRLRLSATNKLKTVLISLAHEIS
FT                   IEQFQSFNHKLDNKIYQMVHSKDVRSQIAGVLSVDCLIWYYSQTEELPNYTTKLAGYLK
FT                   VLIPSKNLDLMKQAIEILGKLAIPTSSITSEFLQHEVKNCIEWLTTSPESKFSTQTQEL
FT                   RKHASLQIITVLSKNSPTVLYPYINSILDNIWRALRDPDNLMRFDAAKVVGCCLRIISK
FT                   RDESACKEWIIHLMQGCAFGLTLKTTDAIHATLLVYHELLELDSECLNDFFDDIYYVTM
FT                   SFKDHRSPLIREEICSIVSLLASLNPVMFSNLYLDKVMNHFLDLLQNITTYNISNKERS
FT                   HIFISIGDIADNVGEMMFEFLEPTLITLKESLRTRYRTRKDYEEGVFYCIGKLSSAIRE
FT                   DLQKYLEGGLLKLILECPLSDHMQKTLSILSANTPDYAKHIDKELLDLLCIHLSGDHFI
FT                   EPGTPIKGKPFSPNAARVWRNQNVYHQIGIANDDLNDAQILIQTLKIFRETKFKVVLTE
FT                   FVKNVIIYYIEHENQLVRKLAALTSCEIFINDSICKETSLNSLNTVSEVLEKLLTVAVT
FT                   DLNPEIRLEILKHLSSPFDSHLAKPENLQLLFTALNDELIAIQIEAMKIIGRLVTVNPA
FT                   YVIPSLRNYLLSLITELKYPNFSTRKDEAATLLCTLIQSSKNVTKPYIEPILNVLLPKL
FT                   DDNSSTVASIALKAIGALAVVGGEDMKQNNSTLFPLMIKTLQDQSNSFKRDAALKSLGQ
FT                   LAASSGYVIRPFLDYPDLLSVLIGILRAESAQNIRRETVRLIGILGALDPHKQRDVEVN
FT                   LKTKLAVEQNQPPIDVALLMQGNSPSNDDYYPTVVIVSLMKILKDPSLSSYHTSAVQAI
FT                   MQIFQIMGLKCISFLDKIIPGIISVMHMCPSNLLDFYFQQLCQLTVIMKQHIRPYVDEI
FT                   YDAIIEFFRFENLQVTILSVINSLCYALKGEFKRFIPLTLNLLLGVLEKDRSAGRENSI
FT                   RVLQSFVIFDTNLELYAHTILPSILKLTEFSTGHLRKAAIITVGKLSKCINLSEMASRI
FT                   VHSLARVLYVNDDELREVTLNTLSLLLLRLKRNYIIFVPVVNRILVDCSIKHAIYDDLV
FT                   TKLLNGEALPNTIILEDDTEQKQLSLSNIAETTDKKLPINQNGLKSVWDCSQLRTKEDW
FT                   QDWIRRLSIQFLKESPSPALRTCANLASIYHPLARELFNASFSSLWSELYTQYQESLIG
FT                   SLCSALSSPQNPPEIHQVLLNLIEFMEHDDKPLPIPINTLGQYAERCHAYAKALHYKEV
FT                   KFIKEPVSSTIESLISINNQLHQTDAAIGILKHAQQHHSYQLKETWYEKLQRWDDALDS
FT                   YTKRAEAGDNSIEVTVGRMRSLHALGEYETLSQLAENKWKTSNLQVRKKIAPLAAGAAW
FT                   GLGEWDEIEKYISVMKENSPDKEFFDAVLCLHRNRFDEAEKHIFAARDLLVTEISALIN
FT                   ESYTRAYGVVVRTQIIAELEEIIDYKKASHNSAKRTHYRNLWDQRLLGCQKNVDIWQRI
FT                   LRVRSLVVKPKQDMHIWIKFANLCRKSGRMSLAQKALYSLLEDGSDPNQPNTAKAPPPV
FT                   VYAQLKYLWATSSHEEVLHHLIGFTSRMAHDLGLDPSNMIAQSVPQNATVAPQHIETYT
FT                   KLLARCFLKQGEWRVAIQPNWRVQNPDAILGSYLLATHFDKNWYKAWHNWALANFEVIS
FT                   MLTSKNKNEDTNGAQVNGDWRIENSIMGTDYFSNDESKFSPEIIQRHVVPAIKGFFHSI
FT                   SLLKASSLQDNLRLLTLWFTFGGVEEANKAMHDGFGMIKIDNWLEVLPQLISRIHQPNP
FT                   VVSKALLSLLSDLGKAHPQALIYPLTVAIKSESVSRQKAALSIIEKMRIHSPILVDQAE
FT                   LVSHELIRLAVLWHELWYEGLEDASRQFFGEHNTEKMFATLEPLHELLNCEPETLREAT
FT                   FKKSFGRDLNDAYEWVLNYKRTKDVSNLNQAWDIYYNVFRRISRQLPQLQSLELQYVSP
FT                   KLLAAHDLELAVPGTYSATKNVIKISYFEPTLTVISSKQRPRKIWIHGSDGVEYQYVLK
FT                   GHEDIRQDNLVMQLFGLVNTLLRNDSECFQRHLDIQQYPAIPLSPKSGLLGWVPNSDTF
FT                   HVLISEHRDAKKIPLNIEHWVMLQMAPDFDNLTLLQKIEVFTYALDSTKGQDLYKILWL
FT                   KSRSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRTTGKVIHIDFGDCFEA
FT                   AILREKFPEKVPFRLTRMLTFAMEVSGIEGSFRITCEHVMRVLRANKESLMAMLEAFAF
FT                   DPLIHWGFDLPPQKITEMTGIQLQLSNTNELLRRGAITLEQANKMEKEQQAEIKNARAL
FT                   LVLRRIINKLTGNDFKRCKDLGINEQVDKLIQQATSVENLCQHYIGWCPFW"
FT   CDS_pept        54743..56107
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233339" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437768"
FT                   /locus_tag="CAGL0F00517g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="actin binding"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAG58920.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR015623"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00003B62EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU8"
FT                   /transl_table=1
FT                   /translation="MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTK
FT                   KSTVVNKSSAGGADSSGSGYFGNSTSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGN
FT                   EALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPP
FT                   ENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIP
FT                   VAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEQDTSLKTAERIKQEYCYVCPDIVKE
FT                   FNKFDRDASKFAQFVVESQEKTRKKIVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVD
FT                   ETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTG
FT                   VDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYDEYGPEIVRNFSLFNMV"
FT   CDS_pept        complement(56293..57990)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437769"
FT                   /locus_tag="CAGL0F00539g"
FT                   /product="Similar to uniprot|P40413 Saccharomyces
FT                   cerevisiae YJR064w CCT5"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58921.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012718"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI00003B62F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU7"
FT                   /transl_table=1
FT                   /translation="MAQPQQQMMEMPDLSNAIVAQDEMGRPFIIVKDQSNKKRQHGLEA
FT                   KKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNQIAKLLV
FT                   QLSKSQDDEIGDGTTGVVVIASALLDQALELIDKGIHPIKIANGFDEAAKLAVSHLESV
FT                   TEDITAIEFEKDSKLLNDYLFKAAKTSLGSKIVSKVHDKFAQMAVDSILSVMDKERKDV
FT                   DFDLIKLQTRVGGSLEDSSLIKGVLLDKEFSHPQMPSKVLPREGQKSVKLAILTCPFEP
FT                   PKPKTKHKLDISSVEEYKKLQTYEQDKFKEMIQYVKDSGADVVICQWGFDDEANHLLLQ
FT                   NELPAVRWVGGQELEHIAISTNGRIVPRFQDLSPDKLGECSSIYELEFGTTKDRMLVIE
FT                   QPEESKTVTCFIRGSNKMIIDEAQRALHDSLCVVRNLIKDSRIVYGGGAAEVTMSLAVS
FT                   EEADKQRGIHQYAFKAFANALDTVPMTLAENSGLDPIETLSTLKSKQLKENIPVFGVDC
FT                   LGKGSNDMKELFVVDPFISKKQQIMLATQLCRMILKIDNVIISGKDEY"
FT   CDS_pept        complement(58585..58971)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348966"
FT                   /locus_tag="CAGL0F00561g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG58922.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniParc:UPI00003B62F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU6"
FT                   /transl_table=1
FT                   /translation="MSAVGSLIFCDDCGNLLDNPEDKINNSNVIECSQCQAEYAKSQFT
FT                   NLKVVTSTSEDAFPSSLRLKRSVVKTHLKRDELKDDGATIKEKCPKCGHDEMRYQTLQL
FT                   RSADEGATVFYTCIKCNYKYRTNN"
FT   CDS_pept        complement(59518..60636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348967"
FT                   /locus_tag="CAGL0F00583g"
FT                   /product="Similar to uniprot|Q04410 Saccharomyces
FT                   cerevisiae YDR517w GRH1"
FT                   /protein_id="CAG58923.1"
FT                   /db_xref="HOGENOM:HBG059714"
FT                   /db_xref="HOGENOM:HBG203338"
FT                   /db_xref="InterPro:IPR007583"
FT                   /db_xref="UniParc:UPI00003B62F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU5"
FT                   /transl_table=1
FT                   /translation="MFKIAKNLVKTFEQTLSLSDQDRLDGFFQSIPPNLLESQIHSNTD
FT                   MSTLSDVLSGLRVVYVDELQLQLESYFDFIVGIDDDPLPLMNNQHGYLYPDYNEIIRLL
FT                   NIHAEQASPVKLNVWSAKGGTFRDEYMSLSAIPSDENQMEDINLSNDTPHHQLSSKIFS
FT                   PLGFKVQWTPLIAATYTYHVLQLNIEGGPAHAAGLIPDEDYIIGSQDGLLATGGETLLQ
FT                   DLIRSRANHDLILYVYNKVVDCVRPVTVNIGPDGRLGCGVGYGFLHRIPTVRKQEDGNT
FT                   SMHSNKGITNAPTAAIPVPTFDQPMSSETFVPGIAKPPPTSKSSKKHAVNISTMGDYFS
FT                   EGKDQSPTPKPSTGDKDASIPPPPSKNTEETQ"
FT   CDS_pept        63354..64841
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501126"
FT                   /locus_tag="CAGL0F00605g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="hexokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG58924.1"
FT                   /db_xref="GO:0004396"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG130961"
FT                   /db_xref="HOGENOM:HBG522186"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI00003B62F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU4"
FT                   /transl_table=1
FT                   /translation="MSFENFHKATSEQLTKAVDELCKEFEVTPKMLDELTAYFIESMEK
FT                   GLAAEADSENKGLPMIPSFVTGMPNGTENGVLLAADLGGTNFRVCSVTLNGDNTFKMEQ
FT                   MKSKIPDELLDDEGVTSEQLFGYLGRRTVAFVKKYHPEFLNKGDDIPPIRLGFTFSYPV
FT                   DQTSLNSGTLIRWTKGFKIEDTVGKDVVQLYQQQLDAQGLGMIKIVAMTNDTVGTFLSH
FT                   CYASGSHSSSGGEISEPVIGCIFGTGTNGCYMEEIENIKKLPEDMRHQLANEGKTHMCV
FT                   NTEWGSFDNECRYLPTTKYDVDIDQKYSANPGFHLFEKRVSGMYLGEVLRNVLVDLHSR
FT                   GLMLTQYRDYDQLPHRLKTPFELSSEVLSRIEIDDSTGLRETELSFLQSLRLPTTPSER
FT                   EAIQKLVRAISRRSAYLASVPIAAILIKTNALNKRYHGEVEVGCDGSVIEYYPGFRSML
FT                   RHALSLSPIGADGERKIHIRIAKDGSGVGAALCALVA"
FT   CDS_pept        complement(65516..67393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437770"
FT                   /locus_tag="CAGL0F00627g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58925.1"
FT                   /db_xref="HOGENOM:HBG124298"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B62F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU3"
FT                   /transl_table=1
FT                   /translation="MSQEENVETVPVTVTGKADSASQAAPESTTDVDIKKSKKADAKEP
FT                   GVDASKLVPAPIPTSSPWKAVSQTGESVNASEVSLEEEIENTRKQKERKNGGSANTMKP
FT                   TGSNVKWVPMKASITVSSGNGGSKRSGRRSGNKGKDTKKTGNSNSTSDSQGTNATSSSS
FT                   QSKKKNTKQAKSNNVKNNNKKKDDENNTSSTDTDKDNTKSSEVKTKSDVKSSSETVNGG
FT                   SSHAHHHHHGNNHNHNHSHSQHNHQHHHGHKHEQNKQKDVNTKDINEEKETASVQETES
FT                   KTPTGQRASSGSGQKENYSTENTNEQNVGEPSSKHVRRHSYHHQQGGSYGHTGRQFNNH
FT                   HSTNYSYNTSNTNFHDKTQRNGYYPRQNQKPYVPHNRNFNNNMHYVPYVQNSYNAQYYN
FT                   TMHALITAVQNVSKQIEYYFSEENLSRDSFLKSKFSDAGFVPIDLIAKFFRVVNMSFGG
FT                   DPTIILAALREIAANEDSVVEVVRGKSNAEEHEAKGQDNFYGPEYNINNYFVRAKNWEK
FT                   WLNETNQDSFAVAIEKTLAGTDLDQFTINSSLLPAQPYMYGRSYRPNGYKRGQSYSRGG
FT                   KQRYNSNSSPDNHRSQVGDGANEENDDPVNDNSTPVDTKSAEKSENDEQ"
FT   CDS_pept        71961..73505
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501127"
FT                   /locus_tag="CAGL0F00649g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58926.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG738506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020650"
FT                   /db_xref="UniParc:UPI00003B62F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU2"
FT                   /transl_table=1
FT                   /translation="MSLYSYNSMSSSSFGNDTDDLSFNNPLYSDQTTIFRDGDLFKEQL
FT                   DLRSPHFGNEIQFEEQEDLNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPK
FT                   EDFHDHNLKKTSKLQTLNELNIHLKLTKANVPNVVKLLEFQVSKKYYYFIQEYIEGGEI
FT                   FNQIVKYTYFSEDLTRHVIRQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQ
FT                   KLRKSDDPKTKLDEGKFIPGIGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAP
FT                   EVLNQYKVDPRTSNTSYSYKVDIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNY
FT                   KFLAPWWDEISIEAQDLIRNLLQVDPAKRYDIDQLLAHPWLNHYDCETSRPESFYEAEL
FT                   LDKTHLNYVLTSQADRKTNAHQDKDILLFDLDDVSDYSTQSSPFDSSNGLNLHSTQKEQ
FT                   IRNFFNTATGIQQENFKVETEKATCNKSNFFKNHFKLKLSSATIINRRKKMKLQTD"
FT   CDS_pept        complement(73893..78593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437771"
FT                   /locus_tag="CAGL0F00671g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAG58927.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniParc:UPI00003B62F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU1"
FT                   /transl_table=1
FT                   /translation="MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSV
FT                   NIETKDLTDESDESLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSG
FT                   IVLIATNPFDRVDQLYSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVS
FT                   GESGAGKTVSAKYIMRYFASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTR
FT                   NDNSSRFGKYLEILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPK
FT                   EKAELHLKGAEDYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAA
FT                   LLHIGNIEIKKTRNDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNL
FT                   NYSQALVARDSVAKFIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKN
FT                   SFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGIL
FT                   SLLDEESRLPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEG
FT                   FIEKNRDTVSDGHLEVLKASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRT
FT                   VQRKPTLGSMFKQSLIELMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVL
FT                   ETIRISCAGFPSRWTFNEFILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVK
FT                   EKEKYQIGNTKIFFKAGMLAFLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITS
FT                   LQQRVKGEVRRSIIDREFKNKAATEIQSLLRGYRRRSQILSIISSIRCIQLKVRKELNR
FT                   KHAQVQHETDAAVAIQSKVRSFKPRKAFLEDRRKTVVVQSLIRRRFAQKKLKQLKADAK
FT                   SVNHLKEVSYKLENKVVELTQNLAAKVKENKSLSARVVELQTSLEESALLQEELKQIKS
FT                   KHDAELLEQKDVFAEKGKQIEEELNAANLQVEEYKSKLLDLTQEYEEHKATTKSYLEEL
FT                   EKTKAELIEVQTFNSDLQNEVNSLKEELSRLQTQISLGTVTANVLPQTPSKDIHMQRNV
FT                   TNGTDIGPGSELNVRPVNSKDAGSVSNMGMDSYASDSNALTQINEELFRLLEDIEVLNN
FT                   EITDGLLKDFEVPAAGVGMQLSRRDVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTT
FT                   IQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSL
FT                   VTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAVVLSEALPGFSAGQSGGLLNKIFSS
FT                   GEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWK
FT                   RGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSKLLQVRKYSIEDIDILRGICSSLT
FT                   PAQLQKLITQYQVADYESPIPQEILKYVADIVKSEASLSASSKAPTHSNDIFITPETGP
FT                   FNDPFADIETHKFDQVEAYIPAWLVLPTTKRIVELVAQQVSVQESQ"
FT   CDS_pept        79324..80691
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437772"
FT                   /locus_tag="CAGL0F00693g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="NADP or NADPH binding"
FT                   /function="glutamate-5-semialdehyde dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="CAG58928.1"
FT                   /db_xref="GO:0004350"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG001290"
FT                   /db_xref="HOGENOM:HBG318080"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B62F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUU0"
FT                   /transl_table=1
FT                   /translation="MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIE
FT                   SANKEDLEQARAGGLADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDN
FT                   GLMLYQVTAPVGVILVIFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVN
FT                   QTIEQYKDETGVPVGAVQLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPV
FT                   LGHADGICSIYVDRDADLEKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLI
FT                   TEGGVTIHATTDVKEAFLKKLQDSGKLNDDIKAKIVDAKDGDFDKEFLSLDCAVKFIPN
FT                   TVDAINHINEHSSKHTDAIITESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEV
FT                   GISTSKIHARGPVGLDGLVTYQYQIRGDGQVASDYLGAGGNKAFVHKDIDVTNIKL"
FT   CDS_pept        complement(80864..81796)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501390"
FT                   /locus_tag="CAGL0F00715g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58929.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG336099"
FT                   /db_xref="HOGENOM:HBG522263"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="UniParc:UPI00003B62F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT9"
FT                   /transl_table=1
FT                   /translation="MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSC
FT                   PLANSKYATVREYGDKGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYW
FT                   NKFFLHRCKQRYVKLSQIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAA
FT                   KIEESISKELLNRLKSGAYSNADKTLTPLNVDENIWNKIMGKLGEEDMEGVSADEEEEE
FT                   SDVEREIEYIEDTEEEEEVDLDNLEKWLEDKSDHSDKDEDDSDFSSTDDEGDDDESYQR
FT                   KLKDIKKKSIEVELEFENENEQQQSTVSN"
FT   CDS_pept        82773..85160
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438850"
FT                   /locus_tag="CAGL0F00737g"
FT                   /product="Similar to uniprot|Q12502 Saccharomyces
FT                   cerevisiae YOR322c"
FT                   /protein_id="CAG58930.1"
FT                   /db_xref="HOGENOM:HBG058510"
FT                   /db_xref="HOGENOM:HBG395688"
FT                   /db_xref="UniParc:UPI00003B62F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT8"
FT                   /transl_table=1
FT                   /translation="MLNFQRLGRIQSNDNSNSTAQSQSKFGSPVKLRRGSEVHTPGKPE
FT                   DVSGRPPCKLPIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDN
FT                   QEHGGRNATQHETGYNNITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGN
FT                   IINCKNCKVKYTSLKSWNIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQY
FT                   ELVGNVSYYDPVHKDKEYMLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVV
FT                   YPKSTFPLEMKLNGISSPSTGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLE
FT                   DQVKLKEEERSKKPPVPIKRYGDIGPQIRIALSSPSNMPLSGGRSGPQPTLTSSEEAPN
FT                   SATLSSREGEAGNIDTDENETTDQFVHPSDDAMRQELLQQQQRQREQQLKQELKNSSAL
FT                   FSEEVRIISKGEMKSGWKTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKK
FT                   PDLPPVTIACDIQDPNLGIYVNHTLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGS
FT                   KPEGTTENMNDDDDDSREMDQRLLELSPMFANRNAQRAKPVEYNDLSPVNSRSSTRSGN
FT                   NTGRITPHMSSTPRIVSVPTGAARVLRMQFRINVTERSGLGISWDEEVPPMYHEIQTNA
FT                   PPSYEAALKDSGGVQIVDNSEDLGEEPEHQTPIIAFPPMAHHNNSNIRNNLTTVQSPQL
FT                   ENIISIQGAVPYGRGSPLTPNNTIEMGIRNLSEVLDTDRITQ"
FT   CDS_pept        complement(85452..87656)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196030"
FT                   /locus_tag="CAGL0F00759g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58931.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG332413"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI00003B62FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT7"
FT                   /transl_table=1
FT                   /translation="MDSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLE
FT                   RVAMPIVFTLLALLVRLYRLDVVKKVTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVG
FT                   FSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVW
FT                   LTTILVLCENSYTTLGKLILLDSLLLFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTG
FT                   ASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFL
FT                   IFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGA
FT                   YLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRL
FT                   VHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPI
FT                   TTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEA
FT                   PENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWN
FT                   ENDTRYLLLGSPASTWPSTVAVLFLVFALLYKVLKWNRQMQIFQNEHDEELFIYGGVYP
FT                   LLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIY
FT                   AGYMSVVIGGFILFAPFSYGMTGKLENYKHLNWMKNWDVV"
FT   CDS_pept        88454..90970
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349211"
FT                   /locus_tag="CAGL0F00803g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /function="transcription cofactor activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG58933.1"
FT                   /db_xref="GO:0003712"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG124621"
FT                   /db_xref="HOGENOM:HBG202769"
FT                   /db_xref="InterPro:IPR003101"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="UniParc:UPI00003B62FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT5"
FT                   /transl_table=1
FT                   /translation="MSLDVSVRERTRNMNQLMRILMDINHLNGGDSGVLEKLRLSARNF
FT                   ESAIYEKSSTKQEYMASMREKIEGMQQTLQQKKHTPATPSQQVPPPQQQQQQQGSQPRI
FT                   TLTPQQQQLLLSKMQLAVIPQQLLSKIPNLPAGVSTWKDVTELASKNMLDQRTMEIVRG
FT                   VYKVHQQLLLKASFEQQRKRQPPQQQQPQQPQQQQQQQQQQQQQQQQQQQQQQSPQNVT
FT                   NGNLFHILLRLFQDEFLSSKYQEQLSKLFKMEEIKHIIQQAIEVGKKYATQRYQLGHML
FT                   TNEERVVFFKKFLNHVILKKMEETKGSNKTDATMMNLTDNHTQMGTGQESTVPQQFNTD
FT                   QVISNNQMPVNNFNMNMNNNQMPQQPFQQQMPQLTLQQQQNLFQQQLQQQQQQQQQQQQ
FT                   QQQQAQIQAQQQQQQQQQQQQQQQQQQQQQQQLLMQNLAATKLDIEEIRNISMKAAKLQ
FT                   LQLTDLTNTLTNEEKDAIRSRLKTNQKLFVQVSNFAPQVYMMTKSKNFLKEVFQLRIFV
FT                   KEILEKCANGIFVVKLETVDKLIMKYQRYWDSMRVQLLRRQSQTKQQEIQGALQQMQRV
FT                   EAQNNNNNNNYNNNNNNNSTNNNTNNNPQMPNLNNSNIITNFSTPFQVPIATPNNITNA
FT                   VKKESRKPSVSASNASTPGTTSGKAKPKSRSNRQNSRSNSINEVSSDSTKQPQTTEAVS
FT                   KEEAAKIHEANVRKSEILSRFKHRQKLFITSPADLFLSTLGDCLGLKCEEIETSYKIPK
FT                   NMADFINGVKISKTEQRIRTQDTVVTSVVDNKLLMQSKTGGDKRTYGIDPAALSAVFKG
FT                   VQGTTNMNTLQLFSSSSLSPVTEENA"
FT   CDS_pept        91832..93283
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438851"
FT                   /locus_tag="CAGL0F00825g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="glutathione synthase activity"
FT                   /protein_id="CAG58934.1"
FT                   /db_xref="GO:0004363"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG412445"
FT                   /db_xref="HOGENOM:HBG439248"
FT                   /db_xref="InterPro:IPR004887"
FT                   /db_xref="InterPro:IPR005615"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR014042"
FT                   /db_xref="InterPro:IPR014049"
FT                   /db_xref="InterPro:IPR014709"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI00003B62FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT4"
FT                   /transl_table=1
FT                   /translation="MTEPIVPQALTNEELEKQILPETYQWALSNGLLMYPPDFQLTQAQ
FT                   IAPFTLYPTPIARKNFEEAIEVQQSFNELYAEISRDQGEHWLSQETEKLAHSDEGFTGK
FT                   LWDLYKSVRNEGIAQKLRLGIFRSDYLIDKNIDQIKQVEFNTVSVSFVGFSTRVGEVHK
FT                   YLNDSGAYGKSSYADKDIPVPTSVQEMTKSFADAFQKYDALNDEKKIILMVVQRGERNV
FT                   FDQRIIEYSLQKDYGIRVIRMTFDDIISRLTSDNADKNRLFFKETGDEIAIVYYRTGYT
FT                   TTDYQNEQDWEARKFLEKSYAIKAPDLLTQLSGAKKIQQLLTDDNILSQFVKSENSRRA
FT                   LQKTFVKIYPLDDSELGNIGKKLAFDEPHRFVLKPQREGGGNNVYKEDIPSFLSTIGES
FT                   KWDAYILMEIIDPLPYENNVIIRGNEIFKESIISELGIYGSILFDDEKIHFNRNSGWLL
FT                   RSKFTTSNEGGVAAGFGCLDSVVMY"
FT   CDS_pept        join(complement(94301..94456),complement(93453..94160))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438852"
FT                   /locus_tag="CAGL0F00869g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58935.1"
FT                   /db_xref="HOGENOM:HBG124629"
FT                   /db_xref="UniParc:UPI00003B62FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT3"
FT                   /transl_table=1
FT                   /translation="MGIAGYLQQYLFTPVLDHAKLRQKRYLFKMDLIKQGFNKDLFLSS
FT                   TYKYPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPI
FT                   GLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSRKTTK
FT                   SRRSIWSAHTIIYSFLSAKVTSLGQSIVLSLVSLIPVLGPLIVNQITAPDRALSYLSRY
FT                   LFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWSADLVK
FT                   KEQKVL"
FT   CDS_pept        complement(94950..95597)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438853"
FT                   /locus_tag="CAGL0F00891g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58936.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="HOGENOM:HBG124632"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI00003B62FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT2"
FT                   /transl_table=1
FT                   /translation="MTMVYSLFLGPIAIALVIVQVILVSNYLALMDTRRDTDKLGALVL
FT                   GNVFTTLNLNQFVVFTQTINIFQGDTNIRLWRRITSAEFLVDTLPNFLIDRSIEILDYI
FT                   FIVACFFIPFFGITIVQLIFAGQNGFAYFQPYFKELRKMDEKELRKVYYQNYSKWYLYG
FT                   VACAVIESLPFLSGYLQPSLFVGASLWSARELKEEVKLRTKKFGPIQPQEST"
FT   CDS_pept        97023..100643
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044841"
FT                   /locus_tag="CAGL0F00913g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="signal transducer activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG58937.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058503"
FT                   /db_xref="HOGENOM:HBG396821"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT1"
FT                   /transl_table=1
FT                   /translation="MPYAGTSDSSRAAFKAFQEKHITKDTIFNKKFDLASIPSSASASD
FT                   TSLSFKNISRGNSYVDLQRPSPFYRHENGSSESVKSSSEKFDYKELISLPNESTHAYSC
FT                   NPLSPISLYVRLSILKRALDIMANDPDMLEESKAVEPLKRMKASNTADVTHVAHLQEMI
FT                   NEKNNEEDMVTLPKRGSVTKWNSHAATLEAFVSNSMDKSAQPNSKYGDLTNEDSQIPER
FT                   PVQMQRAVSLAVLPQSISNHSNNSPFKKDFNFRGTQSGTKFRHNKDILEGLRKLLDDTL
FT                   EKKSMSNASKLHKLSLLNIDKLDLTSVPTDGNDDTINDVEEKGNKLKRALLDSLAEPFI
FT                   EFGRENDNMQDDQYKKLNEQDLNINMSEVVRQYRYNKVLHPFTSGKNSAPQAIFTCSDQ
FT                   HPWNFKAANDLACLTFGINKNVLKALTLLDLIHTDCRNFALNKLISIQDDQDIVFSGEI
FT                   IAIVQPNSENKAGLIWATIWARRIKGSLVCVFEKIPCDYADIMLNLDDFSVENINDSTG
FT                   LLSNLDQNTENDITVTESDELEKKKTVKFANEVHDIKKVSKSLSKLIKDVCTGNYDMDE
FT                   DDKLVPLSIRVSNEINRRRYFTLNHSNYNISCAVSSSVLENELKLKIHSAAYQVGLFII
FT                   ERETLKLVSCNKSICKNMFGYHTSEIINSDITTLIPDLAKILAFIQYQYPILDFSAEEN
FT                   RGLVLTEHFFRKIVSEMHSDPGSFYSSVGLDGLHKDGNNIKVDFQIRVLDENIFLLWIS
FT                   QTRDLLFENYDSNPSQLSMLKESELSLVSSRSSSSSSKRPTECLALSALKRIDSLAIAD
FT                   QGIEDETCEHNENRCNSIEKQSVAISNSNKEAHPPKNSELKNTVDIIDNDLISDPTIRA
FT                   NIELARRYTNNKSDFVKEDNFKLDEEMIKKIVNTEIPEVANADSNLAPEELLKVLNIKE
FT                   PIVIGAQKRKKKYSDFVVLQKMGEGAYGKVNLCIHKEKKYIVVIKMIFKERILVDTWVR
FT                   DRKLGTIPSEIQILATINKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEF
FT                   KSNMTEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKS
FT                   GPFDVFVGTIDYAAPEVLGGNPYEGKSQDIWAIGILLYTLIYKENPFYNIDEILEGELR
FT                   FNDSADVSQECKALITKILNRCVRKRPTIDEICQDVWLQI"
FT   CDS_pept        101230..102354
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349212"
FT                   /locus_tag="CAGL0F00935g"
FT                   /product="Similar to uniprot|Q08215 Saccharomyces
FT                   cerevisiae YOL044w PEX15"
FT                   /protein_id="CAG58938.1"
FT                   /db_xref="HOGENOM:HBG124639"
FT                   /db_xref="UniParc:UPI00003B6301"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUT0"
FT                   /transl_table=1
FT                   /translation="MQLKEDTVNMSNVLPESTMTTVQNLLDDDDFSDEPAMSPYQNDDN
FT                   TSDEYYNCLDLFIKGEPKQCLEAMLSCGLLNESQIFQNMDSVELFINACSRVSDLATLG
FT                   ISLQNKIIQLFIYSEILEFVRRNSPAASALALITKLHGNIIRAIGLMRGSRDERYQIIA
FT                   DEKDALIHDIGFHVKKRTNESRRQYNVEMLMLAELYLFDVQIQLEGKKKSPKLYEDLCD
FT                   KVLQLKSVFDETVLDEKPLSQIILAKLEQKKDSVEKKKSSSRKSLRESTKVLQAIPTPS
FT                   DEVRDQIKMDNLALSKGAFSSITSHIPQKWLKALTTQKWIYKNMKQLSLVLVVAVILLV
FT                   KRYRMITKWFGEIPSTLSQLKPAIVEILRLLSSL"
FT   CDS_pept        102956..104791
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349213"
FT                   /locus_tag="CAGL0F00957g"
FT                   /product="Similar to uniprot|P31383 Saccharomyces
FT                   cerevisiae YAL016w TPD3"
FT                   /function="binding"
FT                   /protein_id="CAG58939.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG021800"
FT                   /db_xref="HOGENOM:HBG526812"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B6302"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS9"
FT                   /transl_table=1
FT                   /translation="MADNQNGNEGDLHPLALLMDELKHDDIANRVEAMKKLDTIAIALG
FT                   PERTREELIPFLTEVAQDDEDEVFAVLAEELGKFVPLVGGSQYINVLFPTLEILAATEE
FT                   TLVREKALASLNKVVKDMTIEQLLHDYVPLLDRLANADWFSSKVSACGLFKVVISRVKD
FT                   DTLRKNLLALYSQLIQDDTPMVRRAAARNLPSIIDQLRENPGLSCEDDWEYVSEMFKKV
FT                   ITDNQDSVKFLAVESLIAILKFFNAKGDSSHTEALLAYALKLAKDEAWRVRYMVAEKFE
FT                   DLADEISQLDKVVDHLLEPFLSLCEDNEGDVRKAIAGHVSGFSKHIKDASIIEAKIIPA
FT                   IYTLSIDENETVRASLAQSITGMSSLLPKESVTENLLPIVLNMLKDEFPDVRLNIIASL
FT                   KNINKVVDTKILSESLIPAINELAKDINWRVRMAIIDYLPVIGEQLGKSFFDEQLIDLC
FT                   MTLLWDPVYAIRNATVKILTKLTEFFGSDWCRDEILTKLLTVDAETLENFIYRFTVLSA
FT                   LRELTSAVSSDITLEHILPYIVKLSDDKVPNIRFNVAKAYTVICENLKNNKTKNLKEIF
FT                   EEKMLPSFKKLQGDSDVDVKYFANENLEKCQLLIN"
FT   CDS_pept        complement(105064..106242)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196031"
FT                   /locus_tag="CAGL0F00979g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="CAG58940.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG459731"
FT                   /db_xref="HOGENOM:HBG464473"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI00003B6303"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS8"
FT                   /transl_table=1
FT                   /translation="MVPRKRTRRYLEVDVEGNPAEGVVQSKYFKKEETVTVKHEPVSDY
FT                   KDFVDEVDIEWIKSLDTQAFFDYIDDRTSEDPQRWLKPLDEDSLGLKPLEIAKLPKSFI
FT                   PIYNRVRLMRAQLKTPVDKVGCALMPIFIAENCGLHKEQILPKNYRFQLLIAVMLSSQT
FT                   KDEITAEAMLNIMRYCLNELHDPNGMTLESVLMMDESIIDEKIKSVGFHRRKATYIYKS
FT                   VRMLRDNFDSDVPTNVNDMLSLPGVGPKMTYLALQRAWGKMDGICVDVHVDRLCKMWRW
FT                   VDAKKCKTPDHTRKALQTWLPKCLWYEINTVLVGFGQVICMARGKRCDICLANDICNAR
FT                   DRKLLSKLQFEEDIDEAFWKLSKTTRGNFDEYILYLKKKLKSDKYPIKAEGP"
FT   CDS_pept        106796..107875
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438854"
FT                   /locus_tag="CAGL0F01001g"
FT                   /product="Similar to uniprot|Q08213 Saccharomyces
FT                   cerevisiae YOL042w"
FT                   /protein_id="CAG58941.1"
FT                   /db_xref="HOGENOM:HBG058501"
FT                   /db_xref="HOGENOM:HBG202773"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003B6304"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS7"
FT                   /transl_table=1
FT                   /translation="MLARQFIPIGANVLKNSAKPLFTLLSYNLLSPSYMWPQVYTYVPE
FT                   KYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYSNFWKKALQTNMNYGSNYIAKTPP
FT                   QYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLGVFSNNELEYLEKKPVTLTDGAG
FT                   NQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINTHLYWKYDDVKLTQCMIIMREL
FT                   ARIIEKHLVGLENVTDDKIKILFTGDLNSTSDSLVINFLKGQIVSHDNLNVINPMKPYL
FT                   EHCVYDDVPEELFTHTCYSGKLKGIFDYIWYHDTDFKLRRILSGREVSHELAALNQFGL
FT                   PNENHPSDHIPLFTEFEIL"
FT   CDS_pept        complement(108155..109345)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044842"
FT                   /gene_name="NOP12"
FT                   /locus_tag="CAGL0F01023g"
FT                   /product="Nucleolar protein 12 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG58942.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG124644"
FT                   /db_xref="HOGENOM:HBG512123"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUS6"
FT                   /transl_table=1
FT                   /translation="MNLFPETVATDDKVSQLFKTSNALDKKATPLIKVQKIEVIKKTDK
FT                   DADGDEKMEDAASDDAKVKKPSKKKLAKKNKETKTPEQVPEEPEKLVEEGKESKKSTKE
FT                   DEIEKASRTIFVGNLSNEVIISKSTYKLFQKLFNNIDDDDENKKLPIQSIRFRSVSFED
FT                   ALPRKVAFVQQKLHKSRASVNAYIVYKEQSPLLNKLIKRLNGQVFSNRHLRVDSITHPA
FT                   PHDKQRSVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQS
FT                   VSKALLLNEKPMISQNEHLKKRKLRVTRCKNIRKVEPTLKSGKYMTDGQKTKLGRAKKI
FT                   LNKAERSKLLKELTVEGIRATKDDSKPVLKKGKKERSKTGRVTKRSQAFKKSQQKK"
FT   CDS_pept        complement(110519..110950)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438855"
FT                   /locus_tag="CAGL0F01045g"
FT                   /product="Similar to uniprot|Q01855 Saccharomyces
FT                   cerevisiae YOL040c RPS21"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG58943.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG307515"
FT                   /db_xref="HOGENOM:HBG382195"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniParc:UPI00003B6306"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS5"
FT                   /transl_table=1
FT                   /translation="MSQATGAKSKRVFKTHSYRGVDLEKLLEMSTEDFIKMTPARVRRK
FT                   FSRGVSGKPNGFMKKLRAAKLACPENEKPAVVKTHLRNMIIVPEMIGSVVGIYNGKVFN
FT                   QVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
FT   CDS_pept        112286..113305
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044843"
FT                   /gene_name="SIL1"
FT                   /locus_tag="CAGL0F01089g"
FT                   /product="Nucleotide exchange factor SIL1 "
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="CAG58945.1"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124646"
FT                   /db_xref="UniParc:UPI00003B6308"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUS3"
FT                   /transl_table=1
FT                   /translation="MVAKVWSRVILIFIATVMVFASSQQGDANKVNTASPPGANGIAYA
FT                   SVVAGGSNHVSAAGSVTGDGVQLPNAEVDIDWLEEHLEDSHDYEKGYDLVEQHFNKLLV
FT                   GNNADASFKVRELASRLILGTLRNNPPVKRLIWDQHPLFVSQVFDLYIGNALKQGSGNP
FT                   LKYPLLKRYLSILLELIPFNRDFRFEEDYKDILDKLYTESDVPSDIKIKVLELITLDYS
FT                   NIKGASGWIDRITNVLTDSEMGLDELHKRTFFNAMHALKSEDPKLKLPTNFLNWLAQET
FT                   KERAHNLKLAQAQADDNDLKVRDLEQEEFDQRLVDSRHSVFGNPMAARMKDPYIVDEL"
FT   sig_peptide     112286..112348
FT                   /gene_name="SIL1"
FT                   /locus_tag="CAGL0F01089g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUS3 "
FT   mat_peptide     112349..113302
FT                   /gene_name="SIL1"
FT                   /locus_tag="CAGL0F01089g"
FT                   /product="Nucleotide exchange factor SIL1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUS3 "
FT   CDS_pept        complement(113528..114250)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438856"
FT                   /locus_tag="CAGL0F01111g"
FT                   /product="Similar to uniprot|Q08202 Saccharomyces
FT                   cerevisiae YOL032w"
FT                   /protein_id="CAG58946.1"
FT                   /db_xref="HOGENOM:HBG059213"
FT                   /db_xref="HOGENOM:HBG737086"
FT                   /db_xref="InterPro:IPR008493"
FT                   /db_xref="UniParc:UPI00003B6309"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS2"
FT                   /transl_table=1
FT                   /translation="MFAAIASGNPLQMSEEVPNSNGMQHTIVLSSTKPKNYSHISLFIL
FT                   PNVTFPAEYIATVYFKLTPTEDFKLFGYLSTEKPSAIFKVKLPQSQTTPTPNDGLGEID
FT                   MGDDDDISMPANGPTTNHNISQLIIGISIENRNEGMTKIMEWKQQQQLASSTGTNSLVL
FT                   ARGNNNLGINTVGQLAKVYPLLTQELAGKIVQHAYNYLTGFLDDNGNVSIKRFDGWWDK
FT                   FKNRLANDGSFLDEVTAT"
FT   CDS_pept        complement(114888..116486)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000252720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438857"
FT                   /locus_tag="CAGL0F01133g"
FT                   /product="Similar to uniprot|P48525 Saccharomyces
FT                   cerevisiae YOL033w MSE1"
FT                   /function="ATP binding"
FT                   /function="glutamate-tRNA ligase activity"
FT                   /biological_process="glutamyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58947.1"
FT                   /db_xref="GO:0004818"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006424"
FT                   /db_xref="HOGENOM:HBG457900"
FT                   /db_xref="HOGENOM:HBG628189"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniParc:UPI00003B630A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS1"
FT                   /transl_table=1
FT                   /translation="MLLIKRIESCRQYSSTVLSSILKSKKTSILPKHPSKGHANHVCEP
FT                   AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSL
FT                   KWCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTN
FT                   VSYDRHCAHLSEGEIKSKLDQGIPFTVRFKAPEKYPPFEDLLHGKIDLQPQQNPSDIRY
FT                   DDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKHIALYEAFGWEPPKFTH
FT                   LPLLTTTEDKKLSKRRNDMSVMSLKEQGILPEALVNFSVLFGWSPPRELASKNHECFTL
FT                   QEFENLFDLDSLTKGNAKVDMKKLWFFNKQFLGKKLEDPTFIDAVLPTIVKTIKDKYGN
FT                   VTELEEKVKTILIENGKVLSNINEFDTVFYYFFEKPNFESNEQSQEFLSKYDNKVASTI
FT                   LQYTRSILSEGSLTKDLVNDLSSKFNVPKKTIFQTLRFALAGSHPGAAVPVLFKVLGVS
FT                   EAQERIANAIQILEQ"
FT   CDS_pept        complement(116762..120079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438858"
FT                   /locus_tag="CAGL0F01155g"
FT                   /product="Similar to uniprot|Q08204 Saccharomyces
FT                   cerevisiae YOL034w SMC5"
FT                   /protein_id="CAG58948.1"
FT                   /db_xref="HOGENOM:HBG059270"
FT                   /db_xref="HOGENOM:HBG202776"
FT                   /db_xref="UniParc:UPI00003B630B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUS0"
FT                   /transl_table=1
FT                   /translation="MPTINLASYVDDVDDLTPSRKRLKIKPVDYDVFKPGSIVKIRLEN
FT                   FVTYNYTEFNLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNGQD
FT                   TSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRRTQE
FT                   YSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRPEKLLDETIRAIDSEL
FT                   LSMFEVLKKLQLQEIEMSNEIQTNTDSLKKLKTDEENFQQEVQLLNEYQETLDTLDKHK
FT                   KLLPYLKIQDHREKLLTYKRQVEGAKKQLQEFQKEREPYMQVLASLNESDAQLNIEKEN
FT                   IEEKKVSTKRKLEKTVSKLNALREEIEKKNLQIEYYKGRSNKLKIKIETKKEDIDNIKR
FT                   KISDIETPEESEVTELERKRNDLIERESQVNSEIDEVDTQMSTQNHNLAILERKMVDKK
FT                   SSLTSTDNIHLLDQLNDRDLKRAVLFLRKNNEARKVVLEPPVLTVSVTHKDFAPYLAQC
FT                   IDYNTSKAFTLINEQAYNTYGKEILKHFTANTRQLTGRTNSPPVSRERLRQLGFEGYLS
FT                   DFVKGDSNVIKMLCEFQGIDQIPVSRKKFSAEQLEALIKPQSNNQPLFRKFIHGTNMLN
FT                   VRYSNMTKQMYSVEIVVKPTNLYQGYVLSSDEKQRINNEMNDLKKQIEGIKNTMNQSAG
FT                   KKAQLKMQLNEISTAMNDINKKSRYISNLKRQRSQYEEQLRFEKEKLEEYKKDIRKDTA
FT                   PKIQQIEKLIGESLKSEIDCTIELENIGRSLRHIQIKNLQADIAIFEHNNKKTVVKSFL
FT                   QSFEEKKNELRAKYDELKNKYKELRDTEEYRQWRRDIDAYNQETKQVLNDLAEKYRDED
FT                   KFNLIYVEQIVNKLESKIQLSNHDRSAVALLEQTKAKIADLEDKLPTQVRKCNTIRKEM
FT                   SDKQKVLEPRLESIVSGIGRKFSELFKDVGTAGGVTLNRKSKLFSDWKLEIMVQFRDEG
FT                   KLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQN
FT                   ACEEGTSQYFLITPKLLTGLNYHEKMRIHCVMAGSHIPNPSEDIHMAHLGEVSNYDI"
FT   ncRNA           complement(120376..120432)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR50"
FT                   /db_xref="Rfam:RF01190"
FT   CDS_pept        complement(121015..123471)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196032"
FT                   /locus_tag="CAGL0F01177g"
FT                   /product="Similar to uniprot|Q08206 Saccharomyces
FT                   cerevisiae YOL036w"
FT                   /protein_id="CAG58949.1"
FT                   /db_xref="HOGENOM:HBG124647"
FT                   /db_xref="UniParc:UPI00003B630C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR9"
FT                   /transl_table=1
FT                   /translation="MTNPMSNEVPAATSSPTSGLTAVNSHLHDIKEEKEDHENTVIHHS
FT                   PVDYIPEIEEETRLDDTGDVSIESQDMINDTAEGDAEEEEKKLTNSFDELSLLPPLPHN
FT                   DLSFDVIRAQQLENMENAAALQELDQRGMLLPEHTRNGLDALAESPESILRAHSSNSPD
FT                   RSASPPHRMPSLRSSTPLSPIVVPSAVKDSRTSKMILDDLVSNNDELINIQSSLDYNLK
FT                   NSQELNVEEIQYPLENPNTSFDLSKALEIPNSSSSLGNKGSSPLNTTQESNISVPPSPK
FT                   ITSPKASLKKKFSNTLLTTGGELPNINTNTNGNINGILTSQKHSPTEFPQLSKVATATS
FT                   NTSLASHSATPVQARTSISSRPRRSTSITNSVQRLVLETANNDTKKPLTERKPSLKRYT
FT                   SSINTPNTDLDNVSRLEAQLYNLPAVTGTISRAPSVNSGRARSQSQSVQQKLGSTDMQP
FT                   LGLAISTTDLNSIDSKTKRPPFLRRASSALMRKASMKMGNENASSPMSPVTPLPTPVTA
FT                   IDKKPYIRSTLGRQLSSTSIATDANIDYSGKTGRNVSTPLMRTSSFSHKMKRGLTRIMS
FT                   TNGSSARISNKPPAEVVPSRHSQDFLRHTVPDNNSTIDNYTLRNGSNGDNSDNSVLYMA
FT                   VDKRYNGAVPKSNSADSANMDYFNFPKTEIIDPNFKTMAIDMDAWKSQVPVINVTDGTS
FT                   INMPARPRFDTECSKVFCLENVNVPRHNSNNSTPLSVSTNSSQAKSNTKEENQPDSIKV
FT                   MDLKDYIKFLFKQKTLEDSTYEKIEKQFMESGWCSNSDLVNIRHKRYSVNKKWDDVINF
FT                   YQSKVG"
FT   CDS_pept        complement(124304..125068)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349214"
FT                   /locus_tag="CAGL0F01199g"
FT                   /product="Similar to uniprot|P40303 Saccharomyces
FT                   cerevisiae YOL038w PRE6"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAG58950.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI00003B630D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR8"
FT                   /transl_table=1
FT                   /translation="MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLG
FT                   CERRSTLKLQDTRVIASKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPV
FT                   TVEYMARYVAGVQQKYTQSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQ
FT                   AIGRNSKTVREFLEKNYNREEPPSNKEECIRLTVKALLEVVQTGAKNIEITVVEPNNQV
FT                   RALTNEEIAKYVETIEQEKQQEQERRKAKSQE"
FT   CDS_pept        125516..125893
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438859"
FT                   /locus_tag="CAGL0F01221g"
FT                   /product="Similarities with uniprot|Q08176 Saccharomyces
FT                   cerevisiae YOL026c MIM1"
FT                   /biological_process="transport"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG58951.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG124648"
FT                   /db_xref="InterPro:IPR013262"
FT                   /db_xref="UniParc:UPI00003B630E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR7"
FT                   /transl_table=1
FT                   /translation="MIRENSVLSTSTSSSDLRELEEVEASDVRGVRWVLRYLVGSSINL
FT                   VLPFLNGLMLGFGELVAHELCWQYKWFYHGRDSAHKIFPVSRKLQAPAQTHEQDQEHIS
FT                   KAQHGYARLRERWTSMKSKFL"
FT   CDS_pept        126136..127767
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044844"
FT                   /locus_tag="CAGL0F01243g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58952.1"
FT                   /db_xref="HOGENOM:HBG252587"
FT                   /db_xref="HOGENOM:HBG395478"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI00003B630F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR6"
FT                   /transl_table=1
FT                   /translation="MMISTVLRVRAPVYASVCAPRTIAIGYRRFYSDKKLDAVKKAPET
FT                   KVKEKEPLWDRVKHEVKHYVNGTKLLGYELKISTKLLAKSMQGYELTRRERNQLKRTVG
FT                   DIFRLVPFSAFVIIPFAELLLPVALKLFPNLLPSTYESTSDKQSKRKKLIEIRQNTSEF
FT                   LHKTLEESQFISYKNIENEEKKKTFLNFFQKLYALKESNKSTGPIIFTHQEIVTIAKMF
FT                   KNDTVLDNLSRPQLAAMCKFMSIRPFGNDPMLRYQIRYKLKSIMEDDKTIDYEGVKSLT
FT                   PEELYQACVSRGMKAYGVSKEDQIDNLKVWLDLRLRKKIPSVLMVLSSTFTFGGPQQSR
FT                   SEDSSCSLHLTATEPEVSEDGKCLIFEGEKSNYEKLLDLYYDGILQVLSSIPDPVYNVA
FT                   KLDLNEVVKPVETISEVESVAEEGPSKQEESIAKELREIAKEVAEEPTLSNSAKETREV
FT                   EVDMENKASEEAGLAEGSSKKDDNEFKLNVLKEQEELIKKEQEEAEARATRESVSDDIT
FT                   LDEEEEVSQPPVPLDQAAKTSITKKN"
FT   CDS_pept        131725..133596
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196033"
FT                   /locus_tag="CAGL0F01265g"
FT                   /product="Similarities with uniprot|Q08182 Saccharomyces
FT                   cerevisiae YOL028c YAP7"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG58953.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124649"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B6310"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR5"
FT                   /transl_table=1
FT                   /translation="MSDRNWYYQTPYDDSARMYQVVQAPYYVYPRVIYDSQGSPSGASP
FT                   NGANVPGTSVSSVSGAVPNVSGALSGVSNANGASSGVRTQSTGDYLYSYSNVPNYINSR
FT                   PMLLSKDQRGSTGSIASLPHAVGSASEGTMHSVTSTGTSMSGPTTNVSMNGNAATSTMS
FT                   DDMGSKKVSKLKFKSSVMKDGDVEKNEYTLDMSDTAARRRRQNREAQRAYRERKATRIN
FT                   ELEKTVSLLQDTIKEYELQMNTIHMRLQTLQEKNDILEKINQELITNKGSQSIPQEQLQ
FT                   QLQQQMQAQSTQGNPPPSTHIQHVGYQHVVQADQPNRNLMESINEFKPMTAVTLKREDQ
FT                   VNKITEDNESQKRSADKAFLQLNPKFQKQLSTPVSPDVNSLLLANNETVNVEENEIDMN
FT                   YMAKKAKTVKEGKCSGSSDCCSKKRQEAGVDPKNSNWKPGSCGTCSSDPYSKAFCQSMF
FT                   AERRKLNQGREPNLTPDEVQKLRSDMMNAASETPTDQNIYAGTPAEDNVKANVERQSAN
FT                   ASNVNDNAAGRGNAVTPISPPSVADTASATTKERKQSIEKLEVTSERDVSNWENRSNSD
FT                   GSATSAQDQPTRSTFDRIKKHMEYKRNFPTNSGNSPSNLDNILAKPV"
FT   CDS_pept        complement(134033..135475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438860"
FT                   /locus_tag="CAGL0F01287g"
FT                   /product="Similar to uniprot|Q08193 Saccharomyces
FT                   cerevisiae YOL030w GAS5"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG58954.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B6311"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR4"
FT                   /transl_table=1
FT                   /translation="MVSVKQLFAVALASTVFAADSKNGSTPVIEIKGNAFFDSSSNERF
FT                   YIRGVDYQPGGSSNLTDPLADKEICSRDIPVFKDLGINTIRVYTVDNSQDHSECMQMLQ
FT                   DAGIYLILDVNTPDSSISRHNPSCSYNADYLQNIFATVDEFAKYDNVLGFFAGNEVINM
FT                   VNNTATATYVKAVVRDMKKYLKARNYRQIPVGYSAADIASNRQLTAEYFNCGDDADARI
FT                   DMFGVNDYSWCGDSSFVVSGYKTKVDLYKGYSVPIFLSEFGCNQVPGARPFTEIKSIYS
FT                   TQMSSVFSGGLVYEYSNETNNYGLVQIDSPTNVTKLQDFANLKSEYASVSNPQGDGGYS
FT                   ESNQHSTCPPYQEGIWEANNTLPEMPSAASVYFESGAGQPFGTGIRTQDSCGKDDDDIE
FT                   NQSDDDNSNANSTDTSSSSSMANSSSSSTQSSSSATTLSTSASSTSASSSSSKAKKAKN
FT                   GAAALEIPAVFRALFEVANFVL"
FT   tRNA            complement(136462..136534)
FT                   /gene_name="tRNA Thr (AGT)"
FT   CDS_pept        complement(136707..138878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438861"
FT                   /locus_tag="CAGL0F01331g"
FT                   /product="Similar to uniprot|P32606 Saccharomyces
FT                   cerevisiae YOR017w PET127"
FT                   /protein_id="CAG58955.1"
FT                   /db_xref="HOGENOM:HBG124650"
FT                   /db_xref="HOGENOM:HBG202801"
FT                   /db_xref="InterPro:IPR013943"
FT                   /db_xref="UniParc:UPI00003B6312"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR3"
FT                   /transl_table=1
FT                   /translation="MMGYHGLRNSLPNGRALILKGYQFSNFQIKIELISKIRVRNYSPS
FT                   KYVRRSNNKRTTTVSEISAKDSSQQGILPSQTQSINTWNKKHDQRIDFRLNISDINHET
FT                   VRTDEFKDSKLPFKRPPSLGHGLKSVLHQPVSLHSLRDSRTGIYNYSKILNDIKPEHLE
FT                   RQIENESEPLFITPHKDTRLLVLAKECGKKYASSTSSMTSILSQLHFLLSSNRKLNITN
FT                   SSISSNFPQKGTDYSQSAHYPASVILRKVSVPNKGDIISIDSDKSLDREIILSILGHSL
FT                   ENFLTDNKTNKFTDSYIYSMVDKFLLRSQLDAHDDSLPNYGTFDLKTRAASAIRHDLAF
FT                   IEKGKNKTNYQMNKVWGEFESLEREYYDLIRTTLLKYSLQARIGKMDGIFVAYHNISNI
FT                   FGFQYLPQEELDCIIHSYLDKDFEKLVKLRKSKFMSIYGVEEYLLNYERNEQAIASAVA
FT                   SAEFKFSMTLLRKLLGIIEHELERTIGPDWACCKLFFKTEFESKRGSTWKKPSLTVIAI
FT                   PLDKSYEDKPLHIKGLSDFEIKRKLLDIENEMSKTLAKSDGKLIGLKCQVVHDYKLNPE
FT                   SVVIPDFAKDNSQVLPRNLRKFVKDELRADRYSSYCKTGLETPNFFHEMDVKTWKVHAI
FT                   TEPITSQAEISDVYKKFTREKLDALESQSIVKLTRDHNDKKEIYDRIEKAWAQSVNGKI
FT                   SKKPRKATDTGEYASDFQHILRSYGNRTT"
FT   tRNA            join(complement(139203..139239),complement(139131..139167))
FT                   /gene_name="tRNA-Pro (TGG)"
FT   CDS_pept        complement(139522..141711)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438862"
FT                   /locus_tag="CAGL0F01397g"
FT                   /product="Similar to uniprot|P38903 Saccharomyces
FT                   cerevisiae YOR014w RTS1"
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="CAG58956.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG067378"
FT                   /db_xref="HOGENOM:HBG602178"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR2"
FT                   /transl_table=1
FT                   /translation="MMRGFKQRLIKKTTGSSSSKKKDKEKEKEKESKHATPTRKSSSSS
FT                   IKSGSEKSNKATGNSGVSSSHGSKSHTSSGLTSRSPTVSATTSSSSISSKTGNSQGADD
FT                   TQTETPNQHQKVSHETPSITISDDNTAKSTPKAHPTLLGAATAISPSSPQSPGSASFGH
FT                   GVSSGINDDNNSPSYGGSSPGIDIPRSSHSFEKLPTPTKLNPDSDVDLIRTPQRHYSSR
FT                   FEPSRYTQLTKLPNFDEVSPEERIPLFLAKVDQCNTLFDFNDPSFDIQGKEIKRITLQE
FT                   LIEFIVTNRFTYTHEMYAHIVNMFSINLFRPIPPPVNPIGDIYDPDEDEPVNELAWPHM
FT                   QLVYEFFLRFVESPDFNHQIAKQYIDQEFILKLLELFDSEDIRERDCLKTTLHRIYGKF
FT                   LSLRSFIRRSINNIFLQFVYETERFNGIAELLEILGSIINGFALPLKEEHKIFLVRILI
FT                   PLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVVMGLLRYWPKINSTKEIMFLNEIEDI
FT                   FEVIEPLEFIKIEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPII
FT                   FPALYELTSQLELDGTNGEESISDPYMLVEQAINSGSWNRAIHAMAFKALKIFLETNPI
FT                   LYENCNSLYLSSVKETQQRKVEREENWSKLEEYVKNLKISESASGQNLDSASNEGSTEQ
FT                   MTIDVEQKDTHMSSLQSDDDYHETNAVLANDAAEK"
FT   CDS_pept        complement(142623..146819)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044845"
FT                   /gene_name="CgAUS1"
FT                   /locus_tag="CAGL0F01419g"
FT                   /product="ABC transporter"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58957.1"
FT                   /db_xref="EMBL:BAF79877.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B6314"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUR1"
FT                   /transl_table=1
FT                   /translation="MSLADYFTPVPNASVTFEGTTVNLNETATGSAHSHAEDPEFGEKL
FT                   PLPSVSPCENGQVVDLTFQATAGEMVLVLGAPTSGIFKSLFHAHKHLSYSPQGSIRFKD
FT                   NEFKAYSSKSPHQIIYNNEQDVHFPFLTVNQTVDFALSCKFDIPKEERENMRNELLREF
FT                   GLSHVGDTIVGNDYFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLTI
FT                   LQKMARTTRSVNLVRISQASDKIVEKFDKILMLSDSYQVFYGTVDECLHHFRDNLGIKK
FT                   DPNDCIIEYLTSILNFQFRTKSLDITGSSEDLDLKDTDHNEQTFSGIASSLCSEVDLYT
FT                   QWKKSSYYQDIKEQIGAFNVENKADGNHINPEDVTKTFDIPLKKQILYCTKRAFQRSLG
FT                   DKAYMISQVISVIIQSLVIGSLFYDIPMTTIGSFSRGSLTFFSILFFTFLSLADMPIAF
FT                   QRQAVVKKQTLLHFYFNSVETLATTLFDYCFKFCLVVIFTIILYFLAHLQYNAARFFIF
FT                   LLFLSVYNFCMVSLFSLTTMFTPTISLANLFAGILLLAIAMYASYVIYMKDMHPWFVWI
FT                   AYLNPAMYAMESILANEMFNLKLDCTESVVPRGPTYQNVPVTNKACAWQGATLGNDYVR
FT                   GKDYLKNGLSYKYSHVWRNFGILIGFLCFFIAMNLFASEYIKPLFYNDGPEAVQHFINR
FT                   WFRRSATHSTTSSSSPENIKLKEDVVVKSASLSSTSSLSSSETAKSNPFADKTVQAQKH
FT                   VISWKNINYTVGGDKRLINNVSGYIGSGLTALMGESGAGKTTLLNVLSQRTESGVVSGE
FT                   ILIDGKPLTNENAFRRSIGFVQQQDIHLELLTVKESLEISSELRGDGDMEYVESISELL
FT                   KLPLDSLVRELNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSL
FT                   QGQAIFCTIHQPSKSVISYFDNIYLLKRGGECVYFGPTSEACGYFMSYDKSLTYDPESD
FT                   NPADFVIDVVGNNESMEEMDDKADFAIREENPWSTRWENSHERKNIDETVVRLEQEAAA
FT                   SGVDFTTAVWEQPSYMKQLIMITKRQYTCTRRDRSYIAAKYLLNGGAGLFIGFSFWKIK
FT                   HTISGLQDTIFFCFMALCVSSPLINQVQDKALQSKEVFIARESRSNTYHWTCLLLAQFI
FT                   IELPLAMSSSTLFFVCAFFCCGFDNSGKVAGVFYLNYILFSAYYLTLGLWLIYTAPNLQ
FT                   TAAVFVAFIYSFTASFCGVMQPYALFPGFWKFMYRVSPYTYFVDTFVSTLLHNRKVICN
FT                   TGEMVPGQPTGGKTCGQFFKAYIDEYGGWLKNPNTFTVCAYCTYDTGDDFLKQQNMSHS
FT                   HIWRNYGIEWAFVAFNFFAMFAGYYLTYVAKVWPKVFKFIMKLIPTGIKSRASKD"
FT   CDS_pept        149905..150570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501391"
FT                   /locus_tag="CAGL0F01463g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG58959.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG049900"
FT                   /db_xref="HOGENOM:HBG429408"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniParc:UPI00003B6316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ9"
FT                   /transl_table=1
FT                   /translation="MAYTKTALLVSALAAFAVAQDATQLAELNAILQDFSSHLSDYTGL
FT                   LANPNSGITAADLPAGVLQLGLAIQTATDKSYTSLYPSVDFKGIEALLPKLPWYSSRLL
FT                   PAINAALSSATPAPSSSSAAPSSSAAPSSSAAPSSSSAAPSSSAAPSSSARPSSSAAPS
FT                   SSAKPSSSAAPSSAAPTTTKAISQIGDGQIQAHQTTNGAGKVAAGMGAGVLAAAAMLL"
FT   CDS_pept        complement(151321..152334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044846"
FT                   /locus_tag="CAGL0F01485g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG58960.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG429408"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniParc:UPI00003B6317"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ8"
FT                   /transl_table=1
FT                   /translation="MKFSTVAPLAFAAAVAHASNPTPMQLAELNAVMEDLKTNLQDYMN
FT                   LAMDPNSGFSLADMPSGLIQLGMAVGTATDDSYTSMYSDVDFAGVDKMVTMVPWYSSRL
FT                   KPLIDSLYAAENPAPSTSSASQATPAPAASSSAAPAAGSSTPAPAPVSSAAPSSYAPAP
FT                   MVNSTMPMANGTTTQTTTHLSTKTSTICDEECHKSMSTATAFKNVTDTQTTTYCPESSL
FT                   FKNGTSTVTNMHTTTSTVCETCISKPATSSAKPATSAKPASSAKPAVSSAKPAVTSAKS
FT                   SAGKTTVTTSTIKVSLTSSKAAAPSSVVIQHQTVNGAAKVAAGMGAGVLAAAALLL"
FT   CDS_pept        153593..154864
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438863"
FT                   /locus_tag="CAGL0F01507g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58961.1"
FT                   /db_xref="HOGENOM:HBG058685"
FT                   /db_xref="HOGENOM:HBG202796"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI00003B6318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ7"
FT                   /transl_table=1
FT                   /translation="MMMLLILAVLAAVTRAQSDYTYMNCYVSLPSDFSSDNTYAYQTSS
FT                   YCYSRCQQKGAAYFALFNHNQCFCGNTSPSSQTSSSCNTYCFGYAQEMCGGNSAYSVFQ
FT                   IGNGNPSQSSSNTNSNSNTNTNTNTNTNSNSNSNSNSNTNTNTNTNTNTNSNTNTNTNT
FT                   NSNSNSNTNTRPTSTLSSSRLVALGTGLSIEPSSSVEPTTQATTIASSTVNNGVTSIVY
FT                   STSLKTISGSVIYRTSTIVQSAAPTDAGNSTSSDDDSSGKNNSGKHKKKANVGAIVGGV
FT                   VGGVVGACVVAVAALLILRHINLKREQERMEKEYQEAIKPVEYPENNELFPSPYSSNRD
FT                   PSSGSFDEELRNKAMYPPATGTDPYENNDLMAMPDRKPSTNNHLAVANPFDDSRRISNG
FT                   SLVPGSPPLGNNNVLTVVNPDETD"
FT   CDS_pept        156044..158317
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501392"
FT                   /gene_name="MEF1"
FT                   /locus_tag="CAGL0F01529g"
FT                   /product="Elongation factor G, mitochondrial "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG58962.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="HSSP:1ELO"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6319"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUQ6"
FT                   /transl_table=1
FT                   /translation="MLLVPRVPVVMQGKCGLLKISRPLQGSLSRGFHFSRAHRSEYDEE
FT                   KVVIDEINKKLTPVDIQNQQKLRNIGISAHIDSGKTTFTERVLYYTKRIKEIHEVRGRD
FT                   NVGATMDFMDLEREKGITIQSAATYCSWDKDKNSYHFNLIDTPGHIDFTIEVERALRVL
FT                   DGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGANPFKAIEQLNSKLKLP
FT                   AAAVQVPIGAESELKGVVDLLDMKAYYNKGDNGEIIESGPIPEELKSLAEEKRQVLIET
FT                   LADVDEHMAEIFLEEKEPTIQEMKDAIRRATIARKFTPVLMGSALANTGVQHVLDAIVD
FT                   YLPNPSEVLNTGLDIAHEEAKVNLIPSVQQPFVGLAFKLEEGKYGQLTYIRVYQGRLKK
FT                   GSYITNVKTGKKVKVSRLVRMHSNEMEDVDEVGSGEICATFGIDCSSGDTFSDGTLQYS
FT                   MSSMFVPDAVVSLSITPKSKDSTNFSKALNRFQKEDPTFRVRFDPESKETVISGMGELH
FT                   LEIYVERMKREYNVECITGKPQVSYRESITIPSEFDYTHKKQSGGAGQYARIIGDLSPV
FT                   EGGNKSNVFETHVVGGRIPDKYLSACAKGFDEACERGPLIGHKVLNVKMLINDGAIHSV
FT                   DSNELAFKVATLTAFRDAFLKAQPVIMEPIMIVSVTSPNEFQGNVIGLLNKLQAVIQET
FT                   DNGHDEFTLRAECSLSTMFGFASSLRASTQGKGEFSLEFSHYAPTAPHVQKELIAEFQK
FT                   KQKK"
FT   CDS_pept        complement(158675..159133)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349215"
FT                   /gene_name="FYV7"
FT                   /locus_tag="CAGL0F01551g"
FT                   /product="rRNA-processing protein FYV7 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG58963.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG355491"
FT                   /db_xref="HOGENOM:HBG397273"
FT                   /db_xref="InterPro:IPR013730"
FT                   /db_xref="InterPro:IPR017265"
FT                   /db_xref="UniParc:UPI00003B631A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUQ5"
FT                   /transl_table=1
FT                   /translation="MAEFGRNKKSNGKKFTKEYKVKAIQQNITRKARLKKEYLKALKEE
FT                   GYAVPEKETSRREVNVKKLKEDKRLEGKKKIDEKKELKKQRKREQREKLEERRRKEEEK
FT                   VKIIRQKEQEREQKRRKMTKRTRSGQPLMAPKIEDLLSKIKNDDTYTL"
FT   CDS_pept        159685..162543
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196034"
FT                   /locus_tag="CAGL0F01573g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58964.1"
FT                   /db_xref="HOGENOM:HBG124653"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI00003B631B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ4"
FT                   /transl_table=1
FT                   /translation="MKLPLVVPKIAKTCVPKVLPAAMDQSIRSMICKQEKNMSQTEMAT
FT                   LTSYFTDTFPIQQLSAGNRQLVMKWLAKRNAYEVLAKLETDYLYSASKLLKDERESPQA
FT                   TLQEIRLYLKALARLRRYDELDHLMSSLIKKYALTKTRDMLLLIGTVCHECCSPALGKN
FT                   SSDVIEFYKRWPAWMKLLTGHADFSQKKENRYNIGTIISTINVVKKLDGQIYKVFDYLK
FT                   DTHGPTLCSEFGSTLMSILNRDKDTKMIQLIWEYKHAHQLPLSSYDLTRIMQTKIVERD
FT                   YKGAVNVYINNPSAHLDVKQFDYLLIALSKTYDWSALQDQFNALFGIGKLPSIEQYGIV
FT                   MAALATQGELESVDQLYQQLLRRGLIPNFMVIRALLEVHFRSGDYRGCFEHFELFDKYG
FT                   ISPSMGTYTVMFNVYKKINDIDGALRFLRKITNTNKSMIREKHFLVLMQLCSKFTNHLI
FT                   AEELFNIMQTNYDITPSASSVAVLIKVYLDSEQDMKALSLFKKFRKETENPFKYIEVFN
FT                   AILPYFIKTHQIQECESLFKEMSIHCERLDAEYMRNFIKYFIDAKKDVDAAKDLLFSLI
FT                   KSNRSLVDETLFERVMEKYDELENDQMIIELYRLTNEIDMPINSKILLYLMKASYRVHV
FT                   IQEENLNKFLELFEQTLTSVSSGTLNITTNSIHPSIINWFVRSLSKSHLTDRAIELLNK
FT                   YTNILFDDKSPDKLRFDNQFTTMRSKLVYYGECEQWDNFEDIFEDFLNRIEYLENRPSR
FT                   TVKNLRMKSIFNGILTYRLRNLVARKKFEEIPKLIEYLHKHEFTITNQFLNEAVSYMFL
FT                   DSRTIEEALRISNDKLIHGFNLLNKKKHLQANEYRYNRHDTSWLLAQVKKNPGKFSTDM
FT                   HMTWATFTDATCAIDRYLNKFSLEKKDNILRNFIEKYPYFMKSYLMKERELVKDWKQIE
FT                   SNHANYFKKLRDTKRTVFVSEF"
FT   CDS_pept        complement(163020..163679)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438864"
FT                   /locus_tag="CAGL0F01595g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAG58965.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG175022"
FT                   /db_xref="HOGENOM:HBG621848"
FT                   /db_xref="InterPro:IPR007653"
FT                   /db_xref="UniParc:UPI00003B631C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ3"
FT                   /transl_table=1
FT                   /translation="MYSLSQRINQVFNVAVLYGGVIVVLVALVSQWQLIHDNAFGLSSS
FT                   IGGVSPSFNVRTSRYYGSVKGQPKENMRIEFDLDADLSPLFNWNTKQVFVYLTASYNGT
FT                   EKARGHTVNTVTLWDKIIKTPKEAELHLEHAKGKYPVWDLEDKFSGKDLTFELQWNIQP
FT                   WVGILTFGQTTGSEVVKVEPKKKPSPTPNADASQQEQQQQHQQPKKKKRVPKNANA"
FT   CDS_pept        163924..164445
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196035"
FT                   /locus_tag="CAGL0F01617g"
FT                   /product="Similar to uniprot|Q99382 Saccharomyces
FT                   cerevisiae YLR065c"
FT                   /protein_id="CAG58966.1"
FT                   /db_xref="HOGENOM:HBG124654"
FT                   /db_xref="HOGENOM:HBG395448"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniParc:UPI00003B631D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ2"
FT                   /transl_table=1
FT                   /translation="MAGKATKKQAASNSNTLNTLHKVAGPVLVLAFLRTVLGSNNTYIK
FT                   FVMFNLPMCACLYILEKTGRPQYDSKGKVVREGMDLSQAGGMTEYMFDLIYLSIIANVG
FT                   RIIFNTNKWWYLLLLCPIYVGYKLYSLKQQYFGSTPGPVIPDKMPEETKSKRQMKREKR
FT                   GDDKVKYKYR"
FT   CDS_pept        complement(164750..165544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438865"
FT                   /locus_tag="CAGL0F01639g"
FT                   /product="Similar to uniprot|Q12144 Saccharomyces
FT                   cerevisiae YLR064w"
FT                   /protein_id="CAG58967.1"
FT                   /db_xref="HOGENOM:HBG058274"
FT                   /db_xref="HOGENOM:HBG202431"
FT                   /db_xref="UniParc:UPI00003B631E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ1"
FT                   /transl_table=1
FT                   /translation="MARQRSVAPFLTVLQSRIRQPQFFWFLGHFMVLYHGLKIHLRLFG
FT                   VKNTQYHYRCCLAYLTVTYGIVLYQFVKSGQLDFQFATIRRRLLELDTLQYFVLLTSLY
FT                   ILSYGGFIDLNILNSLHIYSFFHCLNYFKENLLPFISLIPVQTRTTLNQSITFFIESSN
FT                   RLCLRIAHDFEMSCVFMLSVRAIFYALSAPLYPTKCRLIGALIYIWFFKLRYIQNEQLR
FT                   KDVDDKIAMVEKAPFMIQNPQLQHLWFSVKNTYLYVLKAMPV"
FT   CDS_pept        complement(166126..167058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044847"
FT                   /locus_tag="CAGL0F01661g"
FT                   /product="Similar to uniprot|Q12291 Saccharomyces
FT                   cerevisiae YLR063w"
FT                   /protein_id="CAG58968.1"
FT                   /db_xref="HOGENOM:HBG058473"
FT                   /db_xref="HOGENOM:HBG397866"
FT                   /db_xref="InterPro:IPR021463"
FT                   /db_xref="UniParc:UPI00003B631F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUQ0"
FT                   /transl_table=1
FT                   /translation="MSKQLPITFDGENLPPQETVDLYATTFENELSPLNEETLKSQIQA
FT                   VKGLLYNRDYLNAFDDQINRAAYVSRWSPSRSLCYTTLFTHLKPVYELLSQGSSHVLCV
FT                   GGGAGGELVSLANIFTMANVSDNAFDGTMKVDLIDIANWDDIIQRLVTSINTKWLYQAD
FT                   RSQRFMVNFQNKDALMMNDIELLGDLDLITILFTANELFTEQRAPTLQFLQRLSKHCKP
FT                   GCKLLIVESAGSYSHITMPSGKKFPIQFLLDTVLVGTSSSQKSKKQDREGDWDLLEQDD
FT                   STWYRGDTKVMYSLKLENMRFFYRLYQHK"
FT   CDS_pept        join(complement(168286..168297),complement(167401..167751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349216"
FT                   /locus_tag="CAGL0F01683g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG58969.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG124655"
FT                   /db_xref="HOGENOM:HBG716459"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="UniParc:UPI00017BD637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP9"
FT                   /transl_table=1
FT                   /translation="MAPNTARKQKVVKTFTVDVSAPTENGVFDPASYAKYLIDHIKVEN
FT                   VVGNLGNAITVEEDGSVVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNSYR
FT                   LAFYQVTPEEEEEDEE"
FT   CDS_pept        complement(168842..170629)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000105095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438866"
FT                   /locus_tag="CAGL0F01705g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="RNA binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58970.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="HOGENOM:HBG023052"
FT                   /db_xref="HOGENOM:HBG497667"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniParc:UPI00003B6321"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP8"
FT                   /transl_table=1
FT                   /translation="MPTVSVNKQQLFDLLGKNYTNDEFDELCFEFGIELDEDTTEEALK
FT                   TGEEPELKIEIGANRYDLLCIEGIAQSLNEYLGRSSTPTYKLTAPTTKLYIEKSTEQVR
FT                   PYATAAILRNFKFTEKNYASFIALQDKLHSNLCRNRSLVAIGTHNLDSIQGPFYYKGLA
FT                   PKEINFIPLNQTKKFNGEELIEFYKTPEQKNNIGRFVHIIENSPVYPVILDSNDVVCSL
FT                   PPLINSEHSKINLETKNIFIEITANDKTKAEIVLNQMVAMFSRYCDEPFTVEPVEIVSE
FT                   HNGESRMAPDFSERKMDVSIPYINSALGLQQTPEEIIQCIKKMSLHGEASKTDEAVLHV
FT                   TIPITRPDVLHPCDIMEDAAIGYGYNNLPKGEKLSNANFIASPLPINKISDIFRVASSQ
FT                   ASWLEVLPLTLCSHDENFKFLRLEDDGKQVVKLENPKTLEYQVVRTTLLPGILKTVKEN
FT                   RKHSLPIKVFETGDVVFKNEALERKSYNERHWGAIYAGKNSGFEIIQGLLGKIMQTFRT
FT                   QWVADYGKASTGRGYWIEQDDTLATYFPGRGAKIMFRSKEGEQAKQIGHLGVLHPEVMS
FT                   NFEVPYAASYVELNAEVFL"
FT   CDS_pept        171213..171965
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438867"
FT                   /locus_tag="CAGL0F01727g"
FT                   /product="Similar to uniprot|P54964 Saccharomyces
FT                   cerevisiae YLR059c YNT20"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58971.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG000349"
FT                   /db_xref="HOGENOM:HBG448545"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI00003B6322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP7"
FT                   /transl_table=1
FT                   /translation="MFRSGIGRALSYLSRTQAKSQPYLLKPKLRKMETSNTKPLVWIDC
FT                   EMTGLDHVNDEIIEICCIVTDGELKNLDTETKEQCYESVVHCPKEKLDAMDQWCLDHHG
FT                   SSGLMDKVLASKKTKEQVEEELLNYLQKWIPEKRVGILAGNSVHMDRLFMLKDFPRVVQ
FT                   YLHYRIVDVSSIMEVARRHNPSLTAVVPKKEAAHTAKSDILESISQLQWYMDHYLKSEE
FT                   ETKEFVESQNEKRPSEEPIDQPQKKQCQ"
FT   CDS_pept        172820..174229
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196036"
FT                   /gene_name="SHM2"
FT                   /locus_tag="CAGL0F01749g"
FT                   /product="Serine hydroxymethyltransferase, cytosolic "
FT                   /EC_number="2.1.2.1"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /biological_process="one-carbon metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58972.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG301263"
FT                   /db_xref="HOGENOM:HBG420026"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI00003B6323"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUP6"
FT                   /transl_table=1
FT                   /translation="MPYALSDKHLKMVSGHLSETDPEVEQIIKDEVDRQKHSIDLIASE
FT                   NFTTTSVFDALGTPLCNKYSEGYPGARYYGGNEHIDRIERLCQQRALEAFHVTPDRWGV
FT                   NVQTLSGSPANLQVYQALMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPY
FT                   RVNPETGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAH
FT                   ISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGIRSVNQKTGKEIPYDLEN
FT                   PINFSVFPGHQGGPHNHTIAALATALKQAATPEFKEYQTQVLKNAKALENEFQTLGYRL
FT                   VSNGTDSHMVLVSLREKGVDGARVEYVCEKINIALNKNSIPGDKSALVPGGVRIGAPAM
FT                   TTRGMGEEDFHRIVRYIDQAVKFAEQTQSSLPKEANKLKDFKAKVDEIADQLAPLKKEI
FT                   YDWTAEYPLAV"
FT   CDS_pept        complement(174544..176967)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438868"
FT                   /locus_tag="CAGL0F01771g"
FT                   /product="Similar to uniprot|Q12205 Saccharomyces
FT                   cerevisiae YLR057w"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58973.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124656"
FT                   /db_xref="HOGENOM:HBG202430"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI00003B6324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP5"
FT                   /transl_table=1
FT                   /translation="MALHKSLFRRLKNVLPLSITIVLLFYYTFRNEIDILNSFAETNHV
FT                   PTTVETLQTSAKGTHEELSVDDLLDKNRFYPLLVSNKDIDPFQDPRLLTSKGRMGARIY
FT                   PVLNKVEVPVHMISSEKVAPIQSDKLVQEGAAHDMLDRVRNLFLKSYSQLKNQKNLYEN
FT                   PLNWPIDLIDTLDTLHIMNLTNEFDDLVDNVIAKINFKNPTISMKEDEITFIDVADISQ
FT                   RVLSSMISAFDLSKNQVLLNKARDLADYLLTIFDTPNGLPLIDYPVNSKLVNRFPYREI
FT                   NPARLTSMTVEFVRLTHLLKEDKYFNAAYHIYKTIAESTDQFAINYLFPNIVDPSGCEL
FT                   LTDDEIKQGKHLKSNILKTIDENYKFAFCKQTNGLARSEVKVVRDVDKVIKTQKRKQVI
FT                   TLDGTTIPLYQNLIKIMPMLKNHDILRLHEITFEEEDGVIGKRDKIVASKEDNSLLQEK
FT                   NDVRLLSSKGLFFGLMQHVRDLMIYRPITPLKLDNGEAPLFLSSIETYTRYIPTSNELE
FT                   IEMLRQFDHKSDACSFASMMIYGAKLFEKEKDFDFQLLGKEVNHIAAELAESCYKLSKE
FT                   FKGYSPSHILFDPCLMKEKEGRCIFDENEKIQKIVGGYYKSDIASSSDEEDVDTDKDHH
FT                   LAVKVKNDKNSNTKANSKDPQKEYSRRVMLFSKKESPGHLLKDVNKNSIDVGSKKWKNH
FT                   PDWPLWLNKMDQKHLLASDTILSILHMYRITGDSIWRDRGFDLFEELERSIDLKAAGPK
FT                   GLWKLTEEGHTQGEYPSTWLSQTLKFYYLLGSKPDDISLDNYVISMGGHLIGIN"
FT   CDS_pept        complement(177696..178790)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044848"
FT                   /gene_name="ERG3"
FT                   /locus_tag="CAGL0F01793g"
FT                   /product="C-5 sterol desaturase "
FT                   /EC_number="1.3.3.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sterol biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG58974.1"
FT                   /db_xref="EMBL:AAB02330.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG028850"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000012A143"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50860"
FT                   /transl_table=1
FT                   /translation="MDLVLETLDHYIFDDVYAKIAPVELQRGIDDSLVNALSLNKIVSN
FT                   STLLHETLSITNSLKRVNKDVYGLTPFLFDFTEKTYASLLPRNNLIREFFSLWAVVTVF
FT                   GLLLYLITASLSYVFVFDRTIFNHPKYLKNQMYLEIKLAVSAIPTMSLLTVPWFMLELN
FT                   GYSKLYYDVDWEHHGLRKLLIEYATFIFFTDCGIYLAHRWLHWPRVYKALHKPHHKWLV
FT                   CTPFASHAFHPVDGYFQSLSYHIYPMILPLHKISYLILFTFVNFWSVMIHDGQHMSNNP
FT                   VVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPEDSLFDPKLKMDKKVLEKQARET
FT                   AAYIQEVEGDDTDRVYNTDKKKTN"
FT   CDS_pept        complement(179470..180414)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248360" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501393"
FT                   /locus_tag="CAGL0F01815g"
FT                   /product="Similar to KLLA0D01243g Kluyveromyces lactis and
FT                   DEHA0E07447g Debaryomyces hansenii "
FT                   /protein_id="CAG58975.1"
FT                   /db_xref="HOGENOM:HBG199391"
FT                   /db_xref="HOGENOM:HBG518911"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI00003B6325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP3"
FT                   /transl_table=1
FT                   /translation="MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDF
FT                   YVKHPAGFPDHPHHGQETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIP
FT                   VQMESGEACHGLQFWVDLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVD
FT                   SVRDLAYTPIHMYHYLTNKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFN
FT                   TDGDAVKGEFATDDAQFAIMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFER
FT                   AKGWQSSIIHGITEKQVRENEAKGLYKLDHERD"
FT   CDS_pept        181178..182980
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438869"
FT                   /locus_tag="CAGL0F01837g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58976.1"
FT                   /db_xref="HOGENOM:HBG059415"
FT                   /db_xref="HOGENOM:HBG397353"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6326"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP2"
FT                   /transl_table=1
FT                   /translation="MDEVDDILDQNLEEEEDDVDVDVDADAEQDDSDEDGEEGEEGEEG
FT                   EEGEDEDADGDEDADGDDGDGEDEADGNGNGNGKKEQTDDSDNHVVHDNDKIYNYYKQM
FT                   RLNSKLAQSYTISPFAAIPIQTDVNALAVSKGLRNLFLGGADGYIRKFDLLGTLEGKTT
FT                   LTIIQKHSLAESIEYAGILQSYWENEIPQKKSQITPTANGKEYIPKVSPVNSLAVHDEC
FT                   LFLLSGLENGGITLQGVRYMEGKIGHYFYPGGPKRNGHSNVVNLLQLGADQTKFLSGSW
FT                   DKKILEWDLNGTGSISNEFKGANSELSSLEFRPLFSSVVVEDFGKPEEQYPMPSAEGDN
FT                   KSTIGNGDAEAEEDDEMNSLFGDDEEEDEEMKDAVENIEDLNERQESKVAEQEDQQANS
FT                   NSPKTEKQDSKSPTNLSKSELEEISKSSLKIEYDESVFMTSGLNGSVQIWDRRINTAPV
FT                   LNMMKSSTTPPWCQSACWGTDGDTVYAGRRNACVEEFSLRMPSEPKSTLKLPSISGPVT
FT                   CIQSMPNNSHILCASRDNIRLFDIRQAEQKSKSPFLIVPGHHGGAISNIYVDPTCRFMI
FT                   STSGNRGWQGTATDTTFIYEIDLE"
FT   CDS_pept        183385..185772
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438870"
FT                   /locus_tag="CAGL0F01859g"
FT                   /product="Similarities with uniprot|Q12202 Saccharomyces
FT                   cerevisiae YLR054c"
FT                   /protein_id="CAG58977.1"
FT                   /db_xref="HOGENOM:HBG124657"
FT                   /db_xref="HOGENOM:HBG202429"
FT                   /db_xref="UniParc:UPI00003B6327"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP1"
FT                   /transl_table=1
FT                   /translation="MSKENVCLVVGDTPATQFLAWRLNSAGSTTILIGPYVSSDGLIAW
FT                   KTTKLGANFYTPKVFTRNIDELPYKLENYRKYHTLGEIHAMIISAISFEDLAKTCTVLS
FT                   QFSNENTTIFVNGSYGVELEEFVLRYFENKCKCVISIVCEMECRQLSLGSYALVNDEHC
FT                   LVSIGLSYTPALSSKNEVLLRNSISAEAELSKGKGSVTSIIIDQLKDINWVEIKVYKPE
FT                   EQLALKIWEVVIPKISLVILSIVHEELDYEKMLLNDSVRTIFENVSQELFKVCQLQCNE
FT                   KSTCFYNSNSGIIDNNLILQYCMKQTKALNDTTSSEYPEYLSLPFEAYCFYHRLEYPAE
FT                   ILLTQPINLAKRYDVGYSNLNFLFSVYSRLLSMCGLSIKGGRADKSHISFFDTKVGISP
FT                   SKIEDSKVKSVINDTSTKGNSKKNNKKNNKKKRKLKKKDHQKDKHDSKNSNAVTSTHSL
FT                   PIISSALEEGSGILPPDLENLYLDSQRFNLISPKSPGLPPTFNKFQQQGTKITTNEVKA
FT                   NNGSQIDLDGKNQIASGTEVKSTRSGSISTTSSDSSSVTTSSDEYEEAQDMLCRDCGVQ
FT                   LNQNSSNRVRACGYDDVVSVNNEIEDDSLSIFNDRTKFEKSRDQLTTLESIGTISLPHF
FT                   FKRFTPNTSEKKKRYQGLSFDKATTMNLELQIRQRDSFFLTHYEAIGKDAPNTITLDKD
FT                   LSRQHHLEQGQQFWKLKRHYNIYRGSVTIPRATPYDNMLEHLELLNRANAGGILNFTTT
FT                   RYGEVDTYFNFLKQRKNLAHILKDAHYRFKTLKDNEVKHIDL"
FT   CDS_pept        186169..186711
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438871"
FT                   /locus_tag="CAGL0F01881g"
FT                   /product="Similarity"
FT                   /protein_id="CAG58978.1"
FT                   /db_xref="HOGENOM:HBG124658"
FT                   /db_xref="UniParc:UPI00003B6328"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUP0"
FT                   /transl_table=1
FT                   /translation="MKDLLDYSFSMEDLSVLETEFHGNSSGDTELVDFDEFLNIGDGLQ
FT                   LMTPPDVVTNSKEHSVTGDNSEPRGNALKNYQIEQKHAGKINENSEENIDLSTFLSLRS
FT                   KNLQMKRSKSAQSVLQRSRSRSYGPSTLQTPPSSSSSMNYSATKVKRNPFYSPSGKVLK
FT                   LIEKEKKKQQVSQESEK"
FT   CDS_pept        complement(187276..188118)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349217"
FT                   /locus_tag="CAGL0F01903g"
FT                   /product="Similar to uniprot|Q12345 Saccharomyces
FT                   cerevisiae YLR052w"
FT                   /protein_id="CAG58979.1"
FT                   /db_xref="HOGENOM:HBG124659"
FT                   /db_xref="HOGENOM:HBG202427"
FT                   /db_xref="UniParc:UPI00003B6329"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN9"
FT                   /transl_table=1
FT                   /translation="MSYEELIKNDLQLQYARNAVRYYKSNTVPEFLEKDPHKKSVIQRL
FT                   SDTVNSQASSVNVSRNSTPAPSLGPMSTAGSASANTTSNGPGGNVRRHIISVDDSLKIN
FT                   YEMVKNVPGNFPSRIGIRTPDEMDMHEEELQDKLALENEANTVKTKIYKQKLFDDNDTV
FT                   LELVGTQLSHFQDPHTPSDQSKPRLSLREQLECLQKIQDNLLQDYKDSQKEEKKWFVLK
FT                   ELLLEANTELDLFSSQDYPNKVINLGDGASTSQHSDTALVFNRNKRQKLSNGSYSSIF"
FT   CDS_pept        188438..189094
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501394"
FT                   /locus_tag="CAGL0F01925g"
FT                   /product="Similar to uniprot|Q12035 Saccharomyces
FT                   cerevisiae YLR051c"
FT                   /protein_id="CAG58980.1"
FT                   /db_xref="HOGENOM:HBG059610"
FT                   /db_xref="HOGENOM:HBG396881"
FT                   /db_xref="InterPro:IPR014810"
FT                   /db_xref="UniParc:UPI00003B632A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN8"
FT                   /transl_table=1
FT                   /translation="MDEIDALFEQLKEVSSKENGTSKTKVDELNEDKVIFDDEDSKEKE
FT                   FLRIEKELRRLPKLETGFDSLAQTKKGEVKKHEMGLTEEERRKREKMIKDAQKKKTSEE
FT                   WFTLPKPDDKAKREIQRDLLLIKHRAALDPKRHYKKDRWKVPDRFSVGTIVEDKTEFYS
FT                   SRLTNKQRKSTMLETLMTDDTTNKYFKRKYSQIQEQKMSGKKGHYKKMKAARHKK"
FT   CDS_pept        complement(189377..190858)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044849"
FT                   /locus_tag="CAGL0F01947g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="dihydrolipoyl dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG58981.1"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316802"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI00003B632B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN7"
FT                   /transl_table=1
FT                   /translation="MFRAVSRRGFSSSSYLAAIKKQHDLVIIGGGPGGYVAAIKAAQLG
FT                   LDTACIEKRGSLGGTCLNVGCIPSKALLNNSHLYHQIKSDTKNRGIDVKGDVEINVEQF
FT                   QKAKDTVVKQLTGGVEMLFKKYKVNYYKGVGSFESENSVKVTPVEGIKGTVEDETIIEA
FT                   KNIIIATGSEVTPFPGIKIDEERIVSSTGALSLKEVPKRLAVIGGGIIGLEMGSVYSRL
FT                   GSKVTVLEFQPKIGASMDGEVAATSQKFLKKQGFNFKLSTKVVSAERNGDVVDIVVEDT
FT                   KSGKTENIQADVLLVAVGRRPYIEGLGAEKLGLEVDKRGRLVIDEQFSTKHPHIKVIGD
FT                   VTFGPMLAHKAEEEGIAAVEYIKKGHGHVNYGNIPSVMYTHPEVAWVGKTEEQLTEEGI
FT                   KYKVGKFPFIANSRAKTNMETEGFVKILIDAETERMLGAHIIGPNAGEMIAEAGLALEY
FT                   GASAEDVARVCHAHPTLSEAFKEANLAAFDKPINF"
FT   CDS_pept        complement(191278..192624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501395"
FT                   /locus_tag="CAGL0F01969g"
FT                   /product="Similar to uniprot|Q12110 Saccharomyces
FT                   cerevisiae YLR049c"
FT                   /protein_id="CAG58982.1"
FT                   /db_xref="HOGENOM:HBG124660"
FT                   /db_xref="HOGENOM:HBG202426"
FT                   /db_xref="UniParc:UPI00003B632C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN6"
FT                   /transl_table=1
FT                   /translation="MMEQYVPPGKRLFQARHRVSRRDLQHYGETDWTTVKDEVVKDDDL
FT                   LGYAVPIIDNGDPRIARPFKQAKQLPYKAKAGSLAAPLAYPAQNRSALSIDGTGSPASS
FT                   TSSIFSVQNSCPEVGDRYSSSTMDSLVEGLDPTLKFNMQRNISVDSLIQDNNKRISEHR
FT                   DSLALLKEYEYNERKESNRSSKDYYQSGIDRIEHETKRELRRLRYENRALLQREDALAK
FT                   VWRSIRNCKDDGALLLALRKHHVYWFGIPSDLRLKVYKLCLYQDGVAPPVHSLGAALCK
FT                   RLGDVNIVKQIIANINKEVPWLLRISGTGSKSQDSRTSPSEKSQAAVLETKMYGSYPGL
FT                   YYHLKDKLHLDICEQFMKPLLRTVLLRILYQCPHDVATLELLDIVVVSMHYHELQTVLL
FT                   DQMLNAILQECHFKFFHESLHAINNEIKSTELDVFRFLETLRKPHAEHL"
FT   CDS_pept        complement(193057..193596)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501396"
FT                   /locus_tag="CAGL0F01991g"
FT                   /product="Similar to uniprot|Q12155 Saccharomyces
FT                   cerevisiae YLR050c"
FT                   /protein_id="CAG58983.1"
FT                   /db_xref="HOGENOM:HBG191663"
FT                   /db_xref="HOGENOM:HBG397819"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="UniParc:UPI00003B632D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN5"
FT                   /transl_table=1
FT                   /translation="MISSLSVFEEKFYYYYCLVHIPITVLVDSSVAVPDKWVLLPGLVQ
FT                   WHIRQNNDFLLHEKPMWLQLFVWWELVFQLPLFFYFAHQFKKIWALRSKDTKNAKAERA
FT                   TTKKSLYLWLRVYGLNAALTTWICIVVILYRGYYPFTLDASRIAGTKLEVRDTLALMGL
FT                   YLPTFLLPLRLCMLQQ"
FT   CDS_pept        194261..194989
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438872"
FT                   /locus_tag="CAGL0F02013g"
FT                   /product="Similar to uniprot|P43582 Saccharomyces
FT                   cerevisiae YFL010c"
FT                   /protein_id="CAG58984.1"
FT                   /db_xref="HOGENOM:HBG124661"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI00003B632E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN4"
FT                   /transl_table=1
FT                   /translation="MPQSKDDPPNVPSGWKAVFDDEYQTWFYVYLATKRSQWEEPEGTT
FT                   WNKISKPPMPPPSYKSKEEYARGSVSPPHSARRAQPAPPPQTTYRSQPPAPVSPQPYYS
FT                   PQVPQQQPMPMYPPQQPMPMPMYAPQQPVYGGAPMPQPVYQQAPVAQQKSSSGVGKKAF
FT                   FGSLAGAGVGVLGAEAISHAFDHHHDQDTTVVENNYYDNGPGGYDNGYGGGGGYDNGYD
FT                   QGYNDGFDDGNYDGGDGGDW"
FT   CDS_pept        complement(195254..196375)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438873"
FT                   /locus_tag="CAGL0F02035g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58985.1"
FT                   /db_xref="HOGENOM:HBG124662"
FT                   /db_xref="UniParc:UPI00003B632F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN3"
FT                   /transl_table=1
FT                   /translation="MEFTSDLEQRKQQDKSSSSIFASSTTENEVSSSDSEGINDAVERS
FT                   RISEDELKKLELIEKKNELLEKRNQLLTEVNQLERESVEMIDKANKTIDKNALDVLNDL
FT                   LSFSQKQSQDLEVNKLINGESLERLSSSVNVHGDTSVDDELKNKYDSLPLLNMKLRLKY
FT                   LSQYLYKDIKIIITSNSKNEGSNVSLNVELYFQRFENITFSVTIKIVYDEVNEVMKDFT
FT                   IISVSDQVRLAVQPLLQVRNPSFFLLACFEFDKIRQRRFKILRRLRDKFIKRVKTCELP
FT                   RSGEYILLHTHDSLKERDISLRIDFQVFFEAKKLSYSPFPTSRLTYELKKNGKRMLDNM
FT                   VENIADGLIKEYGVEKGLEELCNACLFADLYKH"
FT   CDS_pept        complement(197149..199689)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349218"
FT                   /locus_tag="CAGL0F02057g"
FT                   /product="Similarity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG58986.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124663"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniParc:UPI00003B6330"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN2"
FT                   /transl_table=1
FT                   /translation="MSKTPPYKTGRGIHDIDHITAHAVYLLKNEVDRIISYNPWSISWV
FT                   REHDKPILSRGAKKFIDFKNSDLFSCDVDYRNIVQKEAHKLSKVIYRPPEDICSSDSDA
FT                   RHLILNQREAEKWIQIANATTLIAYSVVNAHLDLEVDPQVRTTPLPDVKSSISKRKRTT
FT                   NHSKSKEGSSSSDTVTTAATSTVAPTAPTAPTAATPTNIPPNPTVTDRTVTALAVLLAF
FT                   TAAAQGHPILDGVNTNFKINDSAAESADKELGDSSEENGQIFSSDNKESSTSISPEGTP
FT                   PNPTLVGKLPVEIQAPEVTVRRPRTTKAELQTKKFDASITLEAYLVRGLSLPPEPLAAF
FT                   VGISYYHFHRSFKKYVGVTIADYTSLCRKVFYHNQDEMENYRNYKVGFNMITLGHGSVV
FT                   RDNKFLRDELFTSIPDRNIEKTDVLLSECIIALDVKKDNDGNIIKTKKGEENDRGNKSR
FT                   RDRRQNINKLSVTLRKFSAADLFLGKHRKDKHGYNSDLSSSRYLFDSNTIGRTVDPQPI
FT                   NTFVATNSEDTNKNPKENSGVKSTTQNHVDSKDNTTIAISENSNVMVTSSVALNSHNDS
FT                   TVLSEDDNDRLADKHNETDTGKDNSKDVSLETMRTTQTDNINLSLVEIMPTFPNSIACE
FT                   NNKLDGPSTKPLAEQNFIYSQRDQITPPILSVNNYFLLPSSWETPKDLINCNNSEQGMD
FT                   KALLATPPSSTEAQNIPLNSSSNESNTEQGTSSNSNSFRESPSFDVSANEELMDFDSLF
FT                   DFSMPFLANQDFLPEDYMNLNENDLDALNEINFNLDNITENNGDNDINMHLAINENDAD
FT                   IDITNKIRIEDIWEDHDITLVDDFVSNSDPLTLT"
FT   CDS_pept        201002..204673
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501397"
FT                   /locus_tag="CAGL0F02079g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAG58987.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG505437"
FT                   /db_xref="HOGENOM:HBG559513"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI00003B6331"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN1"
FT                   /transl_table=1
FT                   /translation="MGRLVGLELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDA
FT                   ISFVLGIRSSSLRSSALKDLIYRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVE
FT                   LMRLISRLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLGL
FT                   TKLIEEVSGSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYR
FT                   KYVQKKKRVQTNLSLWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKA
FT                   LSKEAVLLTKKKNHIRSISKEKEKAESDLKVVKIPQNASINRLKNLDKRVDSLQKDLER
FT                   EEANLEKYKHQLKVVTDSKNAFEQEILSKSKNNNKFTLSEDDLKLYDELKGEYLNNGGI
FT                   EIEDTLNLLDNKKEEITADLKIINDKVEISKQRIEDELVTKKEEQDAKIRDSTLLLNEK
FT                   NDLHSHKLDELRKTQKDIEYWNNKEFDLNHKLRDTLVKLDDLNATQRESNKERKLRENV
FT                   AMLKRFFPGVRGLVHELCKPKRDKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQR
FT                   AGVISFIPLDTIDAATPRMPVPESETYTLAINTVEYKDDLVRAMYYVCSDTIICDNLDI
FT                   ARDLKWNKNANVKIVTLDGALINKTGLMTGGITSDSANRWDKDEYQSLLDLKDKLIVDV
FT                   EEAANKSRQSTLIARELEISLSSLTSEISYIRTQITQTKRAVEETETEINHHNNLIDRE
FT                   FIPQVKDLENKISGLEDEIRDWNTKREALQEKCFARLTEKVGFTMKDYESHTGEMIRKQ
FT                   TKELQILQKQILNLENKVEFETGRCNATKDRLQNVQETKNSVQHELNELVDQEKSIKLS
FT                   IETLEGELDGKNEELKSIKAAFDSKQKDASATEDIISEYNNRLASIESDRNEIKDDITR
FT                   LDLEKMSILKNCQVSGIIVPVVSEVGLEELPASKVDDEAIEIAKKIEIDFSKLPRKYKE
FT                   ATSAAVKQDLNNQIRDIDDVLEELQPNARAVERFDDAKSRFDEVDKETEGLKTEERKVF
FT                   DEFLKVKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFN
FT                   AGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNV
FT                   QRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTLDLNQYAT"
FT   CDS_pept        205206..211595
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044850"
FT                   /locus_tag="CAGL0F02101g"
FT                   /product="Similar to uniprot|P43583 Saccharomyces
FT                   cerevisiae YFL007w BLM3"
FT                   /function="binding"
FT                   /protein_id="CAG58988.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059873"
FT                   /db_xref="HOGENOM:HBG203599"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021843"
FT                   /db_xref="UniParc:UPI00003B6332"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUN0"
FT                   /transl_table=1
FT                   /translation="MTDNIHAPVPSKKGALAQMKIMETPQRPASGGDVRNRIKSPRGGM
FT                   LAAAARNLRARSETPTLLDERSFNGMDSEKVMSQRLEAYGLDYVTDERLHRENIYDPDS
FT                   RWYSRKVKPKFIIADYLPYNVESHLDQAKYLCHVIVNLYIAIKSLDIEGLISISSKDLA
FT                   EFKGSVDDLAMKTDMFRLSGDTVHVEDAGYTTDQLDDDDIQGEFYGESIYSDIDRPGSG
FT                   KITASSATIININHWTNELKNCLQFDFPVHLRKALATVYYYVSLCQGQNIHRKMFVEMF
FT                   EALVDTDDQGTDFTVMLKEDGMVLDYKALYDLLWEFLPYPDSDYCRYDLSSKEDLQFFR
FT                   LLLRLSLSCRPFFDESDDTILENIMKKLLSNLAPSTMSAVLPILSSSVPFHYNDKAKIT
FT                   DYFSLCFSLWGSVSANVAIDTHMYDLTGMVSEDAHVRLLKEDGSWKTDYINFGKFGIFT
FT                   EDQLNFMFNRLQGHLRSDGQIHSYTRTARPFIHSINGKFADEFFEKLDELTSAIETFVH
FT                   PSNTGFWTSPIAKFIHSFVKMYHARYSEEKAANFHTEFCLTPYCHVKLTDSLLNIINIG
FT                   SQNKSSDVSNYYISCLAYLLDLNPKNRHLIFNKIINDLNDALAGEYVNSRHRIISSLKQ
FT                   FTRTVRYMVEDSLYRIHVTNIISNLVSKLDTNDIELTGQIVNALATVFCFVPIKNLVSK
FT                   DEFMTFESTTLPFLTEHYYHMKLNDTQDFKVDEEVLLNAFRASTTIFETMIKVFVDKLY
FT                   DFVDVDIEGSLVTKMNQTTIIMQESMDNEMFEKFFKFYSDKFWTNENFKGNEPHHELIT
FT                   IPLAAFVRRDSSLAKSLVPMLVYHIKDQIEKGAGSLRSSTEVQARDVKLVLYLTALNDV
FT                   LRQTHATTLDLSNDIMDFLDFIYENITNPPIDVLTSIILHNMLFTLIATEVVDTRLFPE
FT                   SSAIPDIKRWGGLQFSDKKYEEENLNIKWHVPTDMEVELALMVIEKYTNLAFTKLDEII
FT                   NGANKSKGYKDEIEKYLLLLTHCLSGASLLFDPDFNKNKVNESKGFSYGETLLLLKQIR
FT                   DSNCDSEELDIDLEQIRSDKGDDEYISYKDSDDERNEHSDTIEIRDDDPELILDDQTSE
FT                   APSGVSTPVPGFHNDFTSSINAGVAFRELDMFQYNYHYGSSVTDKFRNPGYFKVHKIRS
FT                   KVGLTLHKVLKFLVKNAENNTYLFQILLHAIKVWFTDVGQETVFNEDPTAFLSLDFIEN
FT                   IQYLAHLDEPYTRTFLAVRADVFHQNRVLLRSTNRKPSKIEVQLLRDVLDLAMSIYPDI
FT                   NKPAQGTMVHCMKQIIGSYSIIMKKLLTEIHVALKASEFKQLAVLLQILRIKKINKKLF
FT                   SDYKNIETVFINLVKCLDIDEYDVGTLAESILDDLISGLKLPSSICLLDETTGSSIRPP
FT                   DPHISIQVEAVLSAKSKKRKDYYRIITHLQNSMSKVLGNNQGYSWKRSLLLVRFLTKLQ
FT                   SSMEMVPERDTIKVIFDQLSLNHPKVTHLTIKSLIMIANRILSLSDYNYDTMNAYKTSF
FT                   LPGYMTKIETSDPTFSQSFSKEMTNFKDSNYFIDAKCFVGWLSWGSSMYVVKTSKYPIN
FT                   LRENEEGILSDFGKYLSVDLLRELCHGFVEDNESKNVFSSSNVSFFVLVLLLISDELCD
FT                   LKICDICGLCREFYKRDSKASMIMSAEIFGALVSGSKFMTEVEKKDRDVFLDEFLPECL
FT                   VNDLNHDAFEVWSTITWWLPAVVDIRRCEPFYKHFSNMSNLKDIDSAFYQSSRIYMWRG
FT                   ILMGLEYRMPSICSDFSYLAFDHQYDQVRSAIGKTFSTIIQNVSNPGYESTYLLLNQKD
FT                   KSTDGLNLQLKRVPKYIDDIIKKIFSDVFSEAAKLDDKMTPQEVLKTRYFYLTSTVIYW
FT                   MTEMLRGPNKILLIPYLFGYIVPFLALLMKNKEMCFLAGIDPSKIFMRLAFVPVGHRIL
FT                   GDIVDIICSDEYLHTTNQIKLQLTFVEHFESLQLLQLSKEDKKKILDFVVGHLYNSQSI
FT                   EIRTTAGKVLSGIVHNLADRKQLERLISKFDDQLENHSYKEKKELSRNDINVHGSVLGL
FT                   SAIVSAFPYAFPLPKWIPAQVSILASWARTSGMAGSTAKETLSNFKKVRADTWQFDREA
FT                   FTYDELEDLEGVLWKSYYA"
FT   CDS_pept        212117..212764
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438874"
FT                   /gene_name="SEC4"
FT                   /locus_tag="CAGL0F02123g"
FT                   /product="Ras-related protein SEC4 "
FT                   /function="GTP binding"
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="transport vesicle membrane "
FT                   /protein_id="CAG58989.1"
FT                   /db_xref="EMBL:CAA12071.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0030658"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000006AE70"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42819"
FT                   /transl_table=1
FT                   /translation="MSALRTVSGSSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKF
FT                   NPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTD
FT                   ERTFANIKQWFKTVNEHANDEAQLLLVGNKSDMDTRVVTYEQGEALAKELGLPFIESSA
FT                   KNDDNVNEIFFTLARLIQEKIDSNKLSGPNSGKDGNISINANKGDSSKSNCC"
FT   CDS_pept        213561..216011
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209413" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196037"
FT                   /locus_tag="CAGL0F02145g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58990.1"
FT                   /db_xref="HOGENOM:HBG052918"
FT                   /db_xref="HOGENOM:HBG333008"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniParc:UPI00003B6333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUM8"
FT                   /transl_table=1
FT                   /translation="MLFGVRLASEVYPPWKQSYIDYDGLKELLKEDGKSWSESDESRFT
FT                   EALDKELEKVYSFQMKTYHEIMDRLNALEKSTNTEEGLQNLDTEQFQRTLEESLSEANE
FT                   LDNFSRLNYTGFMKIVKKHDKLHPKYPSVRSLLEVRLKELPFHSEEYSPILYRISFLYN
FT                   ILRSNFNTVSTSLASVPKLSSVNENDELDVSFKSFKFWIHKDNLMEVKTRILRHLPVLV
FT                   YASAPTENDDLIDRFESEVMNADEHVQSSDSASDNSFDGIHHQHKSYDPVITTIYFDNE
FT                   FFELYNNKLLKRNCCPTLRLRWTGKFSEKPDIFLEKRMFIENKDTGNSDFEEIRLQMKP
FT                   KFINGFIFDDDKSYKKNVLRKLTESGTPESELKKIENNFNEIQNFIQEEKLEPVIRTTY
FT                   TRTAFQIPGDDRIRITIDSNVTYIREDAFDKDRPIREPKNWHRTDIDSNVANPMRFLRP
FT                   GEYSNFPYSVMEIKIKNPSANLSSESNIDFSGVQLPKKHGGWIQELTNSHLVKEVPKFS
FT                   LYIQGVAALFAEEEKLDILPFWLPELNTDIRKDPKQAYEDEQKKINKQKDIHSKIESMR
FT                   RLSRVPKPSSDITSSTVTEVSTNRAADLEDHESSDEEDSLSTRERITGQKKKSKTKLTF
FT                   LQILGAGRDSKLIGVDSEDEEIELPEGVKKPTSYIKNAGPVKVEAKVWLANERTFLRWL
FT                   SVTVLLSVLTFSVSNSVRRAEFPNLAKRLADLYFAATVFTALWAYYSYKKRLRIISERS
FT                   GEYLDAPFGPQLVAFFLFFTLIINFVSVFRETGRKQATAEVDLESLHPHLESIFNFVYK
FT                   IVKE"
FT   CDS_pept        complement(216080..218767)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196038"
FT                   /locus_tag="CAGL0F02167g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAG58991.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG124664"
FT                   /db_xref="HOGENOM:HBG203600"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="UniParc:UPI00003B6334"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUM7"
FT                   /transl_table=1
FT                   /translation="MSEENLSSFLNPRIFESKTGSRMTHSQNLNEKKTKCSSPGNSTYS
FT                   DGKKFAMSGKRKLPASNSYPKTKQSRYCQSPSYTNTISGLEATVSTNRTTRTGNKSIKS
FT                   VFSVPDTVIFSIYESSKEVDTTIGISLINFSTGEIILTEYVDSQLFIRTMNKIQLYEPT
FT                   DILIPCHSVRPHMSKLATILKLNINHEIKIHIAKSSCYNNRRSIEFIKASSINKADGIQ
FT                   ILLAKLYEKRHCLFSLAAATEFLQSKNSVKGLTPKKNKVLSDYSRFRIRYEAIENTLLI
FT                   DSKTVTNLELIRTLEGDEKLSLFGTLNTTCTKMGYRNLRGAILQPLTDLNGITNRLKSV
FT                   EELTECEFLNGIRLVLRQLPDLDIVFSKLLTAGKKSIGVTQKINYALLIKDAIKTLEDI
FT                   RQILLKFHPKSTLLSEIRNSFVNCTLQDFGILIQKYIKPDSSWASNSLELQNQRLYCLN
FT                   EESNSLLGTLRSLYSKISEEILNDISCFGEKHCIHASPNFRTGVGFFIKVSDSDYIKIE
FT                   KNRVNIINKVNKRGHVEFTTLPLTKKNIRLNTLITEIETLSESLVTELLYTLSKSVEEL
FT                   FILTESSALLDLLCCFAHNAIEYSYCFPKFSDKIFVIDARDPVMERLIKNYIRNDISST
FT                   LYSSRLQIITGANMTGKTAFLRQIPLLCIMAQMGSPIPAENAILPVYENIHTRLCNDSM
FT                   EMTSSNFSFEMKEMAYILECCNAESLIIIDELGRGTSIGDGFAISLAILNYLSKLESTT
FT                   FISTHFDVIPMILKNKPSIRHLHMKAQIINCNEIIKEYKASSVEITSIPKIDGISCVRN
FT                   IFDEDIINSAINMSKAINKMGSFSTLSEQHYLGSATTSETEVLFMKKIMDMVEILKELN
FT                   KNNGNLSHNAIKRIQYEFLENFTK"
FT   tRNA            join(219170..219207,219231..219267)
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        complement(219504..220955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000008763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501398"
FT                   /locus_tag="CAGL0F02233g"
FT                   /product="Similar to uniprot|P43590 Saccharomyces
FT                   cerevisiae YFR006w"
FT                   /function="aminopeptidase activity"
FT                   /function="manganese ion binding"
FT                   /biological_process="cellular process"
FT                   /protein_id="CAG58992.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG445006"
FT                   /db_xref="HOGENOM:HBG545079"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="UniParc:UPI00003B6335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUM6"
FT                   /transl_table=1
FT                   /translation="MVGPNDIPEALKGHKYPAKSHNKKVKDILLKTRDDLKSDDVAVFI
FT                   AGEEVEGWKYCDTDRDFRQNRYFYYLTGCDIPGSALLYNFKNDNLTLVLPNIDWDDVIW
FT                   SGLPLSLEEAKKEYDADDVVHMKDLENVLQKQLSDVSKFKIYTTDLDNVHNETLKKHLI
FT                   PSDKDFFFALDEARLIKDWYELEVLKHAAKISDTCHLAVMSALPIELNEVQIEAEFSYH
FT                   ALRQGARSLGYDPICCSGPACGTLHYIKNSEDLEGKSSILIDAGAEWRQYTSDVTRCFP
FT                   INGKFTKEHREIYETVLDMQTQAMELIKPGANWDDLHILTHKVLIKHFLDLGIFKKDFS
FT                   EEEIFQRRVSCAFYPHGLGHLMGLDVHDCAGRPNYEDPDPYFKFLRLRRTLEAGMVLTN
FT                   EPGCYFNEFLIEEFLKKFPERVEVVDQEVLKKYMYIGGVRIEDDIIVTETGHENMTKIT
FT                   SDPDEIEKIVSKGLERSRSEFHALV"
FT   CDS_pept        221723..222163
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438875"
FT                   /gene_name="YPI1"
FT                   /locus_tag="CAGL0F02255g"
FT                   /product="Type 1 phosphatases regulator YPI1 "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG58993.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059881"
FT                   /db_xref="HOGENOM:HBG395575"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniParc:UPI00003B6336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUM5"
FT                   /transl_table=1
FT                   /translation="MNQVSEGSRTVSVEEMPRVLQLRAANTNITEGESTSQSRNVRWEE
FT                   DVVDNENMNKKKTKICCIFHPAQEEEDPEQLCPSDHEHSSSSSSSSSSESDDDDKYNSE
FT                   QRRQRRIERRRRRQKTNRPASPNAYEIQPDYSEYRKRMNANV"
FT   CDS_pept        complement(222382..224904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438876"
FT                   /locus_tag="CAGL0F02277g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAG58994.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG059880"
FT                   /db_xref="HOGENOM:HBG396067"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniParc:UPI00003B6337"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUM4"
FT                   /transl_table=1
FT                   /translation="MTDLQSSNNVAFPDANGNNTSKLVQSLLESAKNLPSSSSELGSIQ
FT                   LSVNEVRRRVSQLRSKKPSTNDNTGAYYLLAGDGLVLEDINSVVNELKGQKSKRPRPIE
FT                   IDNEIVEVGFTNREEDILSSIEKQLLFAAHDFDNSINKTLKLDWSHKKQKIEDNFRALI
FT                   QRRKQSKHVHHSLSAVENAESTLGLKTPTYNINSNYDERIKFEQYAKIIEKFNQSCLDK
FT                   SNHSTTLLGEMLDNFQKRGLNNGNNLQFMDALSVLVDHQRGANYDHKVSMKYLESELWS
FT                   YIVDLGHHNYNSQLLENTVDYIKIFIDKKLKNHDGTWKVPNLVMANEDPLWMIAFYLLR
FT                   SGHISECIEYLNSMKTFLKKIEQPIITYLKAKAANENGQLTGDFLNKIQMEYNQHIKSS
FT                   IDGDPYRNALYRIVGRCDLSRKNFSSITFSIEDWLWLHLCLVTNEPKKLEKSTQYCLSD
FT                   LQNLIVSYGSNKFANSYLKILVLTGLYENAADFAFALSSIDAIHFALFLKDNCLLKLPP
FT                   SEDSISTSESGYLTSVKDKYYFNTSRMLADYIDQFKFSDPRVAAQYIIHMKSPDSVSSI
FT                   ELCKSFLENLVLDTREYALLLGKVNEDGSKLCGLIEKLYPLVDNTDPQDFILHVADAAS
FT                   RRTSSDSKDFDNIQLYMLLNQPGKIFDMLNKQISDVLSATPYNQEIAGLEDFTGFDPIL
FT                   LAYKLINSYKSNSEQFVERARDVCVTLTSIFEIKGLVTKKLWTEALNAIKDLDIIPLKD
FT                   EVLSREKANEYPIIDSNIAKCIPNLLVLTMLTLKNKHVLSGTSTSDKNSYIEMAKSLMV
FT                   YAGLIQYKMPRDTYAILNKYDISRLVMT"
FT   CDS_pept        complement(225354..225965)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196039"
FT                   /gene_name="LOC1"
FT                   /locus_tag="CAGL0F02299g"
FT                   /product="60S ribosomal subunit assembly/export protein
FT                   LOC1"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG58995.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG059879"
FT                   /db_xref="HOGENOM:HBG396584"
FT                   /db_xref="UniParc:UPI00003B6338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUM3"
FT                   /transl_table=1
FT                   /translation="MGSIKKTKGKSQSTKRVVTPEVFADQQARNQLANAPNLTEKSERR
FT                   KANKLQVKKEQARARLYGKKKKESTYSEKDLDLPSLNKAVNPGVKLRRGKKGKKFIDDH
FT                   DSLTLHRLIKTIGDKYDDITESKLEKDRRLEVIRELKRQEIERKEAAKQSQLEEKKDEL
FT                   KKKSSIARSMRRKNRRDQERDLHTTSNDKVQRKKKSVSFA"
FT   CDS_pept        226725..227762
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438877"
FT                   /gene_name="YFH7"
FT                   /locus_tag="CAGL0F02343g"
FT                   /product="ATP-dependent kinase YFH7 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /biological_process="cell killing"
FT                   /protein_id="CAG58996.1"
FT                   /db_xref="GO:0001906"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG059859"
FT                   /db_xref="HOGENOM:HBG203601"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="UniParc:UPI00003B6339"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUM2"
FT                   /transl_table=1
FT                   /translation="MVDVNRLKEEVIASYREICKENYRLLVFIVGPPGSGKSTIAEKLK
FT                   DAINTSYLDYLKEIDRKTLRCENYNHINIDQFVQGIEGETISSALEDERHENFDSVENV
FT                   DFICKKKRLKDGSYTITGRGGQLNAIKVRQPTSQEKNLEGNTTIAEVLPMDGFHLSREC
FT                   LDHFSDPQWAHLRRGSSLTFDSNNFLKLCEIMAKTSRIFPSIGYDGDDFTAFDAISSSF
FT                   DCSVPSVEVPGFDHSLKDPQPSQHTISFKSRIVIFEGLYLLYNKENWSKIYNIVSNSNA
FT                   KLFYKILACEDQIESRVAKRHLKAGLVASIEDGKDKFRKNDLLNARDVEKNSISSEDIR
FT                   LIRND"
FT   CDS_pept        228030..228725
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438878"
FT                   /locus_tag="CAGL0F02365g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG58997.1"
FT                   /db_xref="HOGENOM:HBG059125"
FT                   /db_xref="UniParc:UPI00003B633A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUM1"
FT                   /transl_table=1
FT                   /translation="MYLLNDFTLLYKLSEKRSNRIKPQIIKDIMEGNVPPQAPQQLYMT
FT                   PQSENLTHLYKLLEQLIQQLATNNEKKENILVAVDTLSNRVNSSETSVNDHYSSSARLI
FT                   QQFLDRIDPVPDSQSSKDKNRVEETLRQQNKQLKEILLNSQSITRESYDILKYHEECLH
FT                   EVIGHLRADILKDQRKVVNEIRTRFNKDVKALEDIEFQSYIDNVNEIQKLMDISYVYRT
FT                   LLRLVTQTS"
FT   CDS_pept        complement(229207..232065)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438879"
FT                   /locus_tag="CAGL0F02387g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG58998.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051521"
FT                   /db_xref="HOGENOM:HBG329859"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniParc:UPI00003B633B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUM0"
FT                   /transl_table=1
FT                   /translation="MRFSHFLKYNAVPEWQNHYMDYSELKNLIYTLQTDELKNGPIGNQ
FT                   PPERGPVVEEEDEVIASSSKHFAEKLKKKFFSKKPSSNTTGSHLATEQSSSHAIHHSKN
FT                   KDGNKEASVEEETYELKDINQASAITNAGSLAANNNSKEGKNSKSSPLRKVKEKFFESR
FT                   RSSLSSEGQTLFNTYDAFVTSLTVEKFKVDDFYKRIEAKFYERFETLSKDLEKEGMVIV
FT                   TRHPSLSHTENVDSPFADAMNKDTQVDEHGNVAPITSIDKNNSYLEVSEDGEDEDDFVD
FT                   EDVFSESGDNTALLNYSQFNVKSQRKSILKQSIINLYVDLCQLKSFIELNRMGFSKITK
FT                   KSDKVLLLNTREELIHSGEFFKDTYVFQDSTLMILNGKIAQLVEFYAMITGHERGNIAQ
FT                   AKQELKSYLHDHIVWERSNTWKDMLGLLSQSKDITTDIDGAVANAHSISKLDLEYYEYP
FT                   LPRPIPLKFTTIYKLQVPKLFFTLKAFKIAFIFVATAILLAVPTFHDPAQHRCMALVEC
FT                   VAFLWASEAIPLHVTAFLVPLLVVLFKVLKDSNGHVMKAAEASTLILSTMWSSTIMILL
FT                   AGFTLGEVLAQYNIAKVLASWLLAFAGTKPRNVLLMAMSVVFFLSMWISNVAAPVLTYS
FT                   LLSPLLDPLDASNQFAQSLVLGIALAANIGGLSSPISSPQNVISMQYLKPYGIGWGQFF
FT                   AVALPTGILSMLLVWGLMCMTFKINLTKLDKFTPIRTRFTLKQYFIIVVSIGTILLWCV
FT                   ESKIEGAFGSSGIIAALPIVLFFGTGLLSTHDLNTFPWSIVILAMGGVALGKAVSSSGL
FT                   LSTIARALQKRIDHDTALAVLCIFGVLMLVVGTFVSHTVSAIIIIPLVQEVGDKLNDPK
FT                   AAPILVFGCALLASAGMGLASSGFPNVTAISKLDKKGNRYLSVGTFLSRGVPASLLVFV
FT                   CVITLGYGIMHSVLKAPTQSAT"
FT   tRNA            233357..233429
FT                   /gene_name="tRNA Thr (AGT)"
FT   CDS_pept        234061..236418
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438880"
FT                   /locus_tag="CAGL0F02431g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG58999.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG025113"
FT                   /db_xref="HOGENOM:HBG295973"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00003B633C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL9"
FT                   /transl_table=1
FT                   /translation="MFRAVGRRNLATVSRNIPSVPENLRAYTPPYAKLLNNLDKVKQIL
FT                   NNEPLTLAEKILYSHLCNPEESLTSSRVADIRGQKYLKLNPDRVAMQDASAQMALLQFM
FT                   TTGLSETAVPASIHCDHLIVGKDGETKDLRNSIKTNQEVFDFLESCAKRYGIQFWGPGS
FT                   GIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPWELKAPKV
FT                   LGVKLTGKLHGWSAPKDVITMLAGKLTVRGGTGYIVEYFGEGVETLSCTGMATICNMGA
FT                   EIGATTSTFPYQAAHKRYLEATGRGFVATAADAALANYNFLRADEGAQYDEVIEINLSE
FT                   LEPHVNGPFTPDLSTPITKYAERSLEEKWPQNISAALIGSCTNSSYQDMSRVIDLVNQA
FT                   EKAGLKPRIPFFVTPGSEAIRATLDRDGLIKKFEDNGAIVLANACGPCIGQWDREDVPK
FT                   ESSETNSIFTSFNRNFRARNDGNRNTMNFLTSPEIVTAMSYSGNAQFNPLTDAIPLPNG
FT                   GEFRFNPPVGEELPSKGFEHGRDKFYPAGKLSADPNVEVKVSPTSDRLQLLEPFKPWNG
FT                   KELRTNVLMKVEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLD
FT                   GTAYDIPGLMMKWKEDGRPWTVVAEHNYGEGSAREHAALSPRYLGGQMILVKSFARIHE
FT                   TNLKKQGMLPLTFADEADYDRISGGDTLETVGLIDLVAQDGNNGGFLDVKVTKPNGESF
FT                   IIKTKHTLSKDQIDFFKAGSAINFIGEQRRNH"
FT   CDS_pept        complement(236632..238476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000036066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438881"
FT                   /locus_tag="CAGL0F02453g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59000.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG124547"
FT                   /db_xref="HOGENOM:HBG202224"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B633D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL8"
FT                   /transl_table=1
FT                   /translation="MEEVINLNNIFYKSYSVDPNTGHSIYVFDSTYLPSAAELGVNDKN
FT                   DYDEMITELMDMLVKKLPQAPFSLVIFSSGFSAKKISWVYGVKMYSKLPKLFKKYLQET
FT                   YIVHESFFVRTVYQVLSNAMNFKFLTNNKSEQNGTVEDESRNGNAIRHVSTLSELACMI
FT                   DITRLRISLNVYLHDSEVTGEYFLSLPDYYTEKLSPTSKRQYRQIIFDKIFNRLKYDAL
FT                   TNELVFQRPGSYKKVNILLSIIERNNYIDLSQWDIYSLASIFTNFLKNKSKPLIPIDLI
FT                   ELPIHDNFEYTFQVFKEIVRYNNYYDILCAIFPLFISILNAGDITRHDSRSLSRALTPT
FT                   LCKEKVSMMSSDRLAIGNKYIRNLFEHFHDIIKVLETNEKRNEKISKSDIAELANLTIN
FT                   THININSRSSSGSSDLLLDINSDRSGSVSSSPKIPPKLPPRRNASSELKLAKEESSIQR
FT                   PVRAISLSHTNSEDESNTSLPSVNSTFSKASSSTDSTNIEQENKNTDINNDNTNDKDSP
FT                   VKTERNNNDIQNMITDGFADVDVSQVVLKKDKIQEFDKELQKKKKLAGEENTVKTIKFS
FT                   TESYSDIKTNKVSKLAALYEERLMGLQVMNEIRHQNSV"
FT   CDS_pept        complement(239243..240391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438882"
FT                   /locus_tag="CAGL0F02475g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAG59001.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG124548"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR022030"
FT                   /db_xref="UniParc:UPI00003B633E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL7"
FT                   /transl_table=1
FT                   /translation="MTVNDIPQQTKEDINKTVEYLRQYGPEFLEKLRGDVRFEFIEENS
FT                   PYHSYFISQYQDNNNSHLPDSVLSSNGEADEEGKEVEEPYEFRFSRYSRSLTKRDFEII
FT                   RQVALLCAINEDVKYLDKIRQAYGSDEKLSFLNKQHPLNSVFFDLLQQYKLIIKQDIIP
FT                   PAIAFPKNNKKNKKHIDLKQIVLDRCFRRAEYAEYTKKLQDVKHKIAHERKIHFAAIKW
FT                   TEFKVIASMAKLHREPKPAIKFNELIISTIDGKNSALSVFDTATGKEIPLLEQREEASA
FT                   EKKTNKKKMKIRAAGETRLNKRKASEAPSDDHPAEKKGKRMVRCPITNNLIEEDKFDQH
FT                   IRTILNDPTIYAEEKKKYKQSHSLSNLTSDEVYQNIKRLVKR"
FT   CDS_pept        240801..243302
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057145" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438883"
FT                   /locus_tag="CAGL0F02497g"
FT                   /product="Similar to uniprot|P39531 Saccharomyces
FT                   cerevisiae YJL204c"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59002.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="HOGENOM:HBG059676"
FT                   /db_xref="HOGENOM:HBG202213"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI00003B633F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL6"
FT                   /transl_table=1
FT                   /translation="MINDLDANATVVEDLFKVPSITVYIASLLNTKDYINFRQVNKRVY
FT                   HEVLTDDLDRTIWMDKLAVIGLFKSTEAGEVDKKDEIEQQQELLIEVTDQNNDIDATNV
FT                   FDRLSSFTDKNAKDVFKLFFDLLEKFCSKLYHNNMSHFFPAKYEKDPLSQAKILNNIQR
FT                   YNKCNINDIDYYTKIEQNLVILKEIFINSVLQEAERTYQNADYKSTATFISVLLLLNEE
FT                   VYAVEFYKSKIDYTDFENWLPEGLLVKKEEKSNTSLLESETELSKMETSSSNKGDDQVI
FT                   FDYDKLSDALEKLQNYLNDNIDTIDILFGNKYPMILNIIETFIQEVILTPINQLLGDNE
FT                   EYIVLFFPRVYTMITKMLCEDLHDSINGGETFHKVVKEFLNIYLTDNIVKYLNLTPMYV
FT                   RNEISKEFKAHDEKVRSEEMQKNEEIYNSLRNQSEIGTDIGTDKNDFLSSFTKLFKMSN
FT                   AQSDRQNMEDQLKLAYNLNTISNNLKNIKTLVSLDLCYKVVQLVKEKIDEVNYFTEIDT
FT                   IANIVKTKCQALFKILVNELCEAHVKPAFEKGTKLLQQYDPNEIDKIDINLQAFQTAKV
FT                   EPLVNFTELMNICDIILQMISIFYKNELLGKNIIDKNRDFLNDVVQAKKKFETVVDDYV
FT                   AEGLNIGISKLMDKINFVFNTVQLPDDFNPEVGSSGASTLEIKPTQCAMQVVELLENHC
FT                   FLLNGATDKGTVDVYQQEIGERFFNEVVKHIKGSLISEDGGIILICDLNYYYDFFSKKL
FT                   RQKSLVRLYQGLKNIGQLYIISGKDSKDLGKMISDLGKFQGLFTQEEIYEFVQRRADWI
FT                   RVKRDVEKVMYGLGVKDCVIM"
FT   CDS_pept        join(243506..243534,243602..243725)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438884"
FT                   /locus_tag="CAGL0F02513g"
FT                   /product="Similar to uniprot|Q02820 Saccharomyces
FT                   cerevisiae YJL205C NCE101"
FT                   /protein_id="CAR58020.1"
FT                   /db_xref="HOGENOM:HBG398807"
FT                   /db_xref="UniParc:UPI00017BD6F5"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ6"
FT                   /transl_table=1
FT                   /translation="MKPAPYLIGRIADPTIALIFGISSYYLYERNTGRPENYKLNNLLR
FT                   EKYLK"
FT   CDS_pept        245120..247618
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196040"
FT                   /locus_tag="CAGL0F02519g"
FT                   /product="Similar to uniprot|P39529 Saccharomyces
FT                   cerevisiae YJL206c"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59003.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202200"
FT                   /db_xref="HOGENOM:HBG252638"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B6340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL5"
FT                   /transl_table=1
FT                   /translation="MEKKNNLSMKPKLFVLSPDMTTNQLVARTQRLSRACDLCKKRKTK
FT                   CQGGNPCQSCRKANIQCIYREIASHDKSHDLILGSPNKIKKRSGPLLAVKVKKSLKVNN
FT                   GDTIHSANYQQDVPKLSQSKPKHNLNGNESAEIESFSPESVSTSPERYYSQSKSQIDNS
FT                   LYQDIVKAIFPPLQLDKILNSPSFDRESFINIISSHISNSSLNINSVINTYIPSRARVP
FT                   LPPKDVALKLIMKTWDCVCILFRFYHRPTIVKLLESLYEDNDSQNKTYNNEQLKVLPLI
FT                   YSVLAVGALFCKDDVNGKDVSTREFYEDEGQKFFLEAKRLIDIANADDIYSIQTIFMMT
FT                   LFLQCTAKIKICYSYVGIAMRALVKNGFHRTTSLIGPTPIIDETRKRLFWSVFKVDMYL
FT                   NCIMGIPFGLSDSDVNQDLPADVEDENIREDGIIYKKCQFGLSSAGANNQHTKLILIMS
FT                   HICKALRNLHHSNYSLSAVEEKVKYFENELFGWYASLPNVLRADDDQLIKTRCGERCLK
FT                   AKKLLYLDYLLTKLLLYKPFSHYIIMHPSQYPTVSFHFGNAIKCFETAHAIIKLAEEMI
FT                   KEGFLNGSYWFSVHTIFYSVSCLEFFSFQYNKGNISGNPLSFSVQETSKIGMEILLHLR
FT                   QGSDASNTTFNVLKPLFEELNQRTSEASTRTLLQMKSHIATFQDRESDYQDGRNEFNHR
FT                   TNNLTTTPLYHEWQDSKTNSTEKQGGPANNMTGFYGMTSRRTSNNIERGQGSHHLLSLD
FT                   GTPSSRNVTEQFTVSADNNYPYEENYYDASTSLLKPEDFFRKFLDDYANESSKSANIDI
FT                   KSLLSSSNHDENVNSMTAQF"
FT   CDS_pept        248281..250173
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501399"
FT                   /locus_tag="CAGL0F02541g"
FT                   /product="Similar to uniprot|Q04177 Saccharomyces
FT                   cerevisiae YDR398w UTP5"
FT                   /protein_id="CAG59004.1"
FT                   /db_xref="HOGENOM:HBG059557"
FT                   /db_xref="HOGENOM:HBG203282"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniParc:UPI00003B6341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL4"
FT                   /transl_table=1
FT                   /translation="MTDTSPIIRSCYNGDGQYLCYVSVELDKQRVSVVPTSSYDSSVEL
FT                   PSLLIDESGLRVTQLCWFGAQDIQCVLIGLSNGEIWIYSPLANEIVTKLSTTNGHAITG
FT                   MDVNSAYIWCCDANDMLYQFDAKSYQLLKHFKVDNVKALTQLTIFNDEQLLLASHSIYL
FT                   VSLSDKKVLLTYPGHITPVSKLTKLNNQYFISSASSDRFLNIYDVQSGETKNILVSNSN
FT                   IVNYRADKENDIIVTTESGSVEVFKDVLVSSDITSTKKRSRVKKSKQPDNIINLVSEQD
FT                   QKKSFPVLDVFIKSRLLSLVWFSNVTIPRFVDLNLENIPRDYQHPVDSKLRQKNFNDSR
FT                   SLYGNDVASTKAYKEGNATITSGDNYRHVTQAIQDWEKELQEKEKAGEDTSGDLSLQDK
FT                   LEASNFSKLSNNFAKNKISTSSDKLTKSAIVAGTVTTVLAQALQSNDHSLLETVLNNRD
FT                   ERVIRDTILRLKAPLAIILLERLAERIARQSHRQGPLNIWVKWCLIIHGAYLVNIPNLM
FT                   SSLASLHSTLRKRAELLPKLMGLEARLNNVVISPTSKEDLEDEVTVEFDEDEEDVEYNE
FT                   ELDDAGLIDDGEEEYETGSEEEDDDSEVEGDDKQALEEDDDSEAEEEGYSDVEV"
FT   CDS_pept        251143..251790
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438885"
FT                   /gene_name="hpt1"
FT                   /locus_tag="CAGL0F02563g"
FT                   /product="Putative uncharacterized protein hpt1 "
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAG59005.1"
FT                   /db_xref="EMBL:CAL07959.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG327482"
FT                   /db_xref="HOGENOM:HBG507301"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI00003B6342"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL3"
FT                   /transl_table=1
FT                   /translation="MSDEDKQYISYNNVHQLCQIGAERIKNFKPDLIIAIGGGGFIPAR
FT                   ILRTFLKEPGVPTIRIFAIILSLYEDLHTAGSEVEQVGVKVNRTQWIDYEQCKLDLVGK
FT                   NVLIVDEVDDTRTTLHYALHELEKDAADQAKAKGIDLEKNPEQKTNFGIFVLHDKLKPK
FT                   KADLPAELLNDPNRYFAARQVPDKWYAYPWESKDIVFHTKMAVQQGNDIFMD"
FT   CDS_pept        252513..253526
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501400"
FT                   /gene_name="urh1"
FT                   /locus_tag="CAGL0F02585g"
FT                   /product="Putative uncharacterized protein urh1 "
FT                   /protein_id="CAG59006.1"
FT                   /db_xref="EMBL:CAL07958.1"
FT                   /db_xref="HOGENOM:HBG493695"
FT                   /db_xref="HOGENOM:HBG714567"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniParc:UPI00003B6343"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL2"
FT                   /transl_table=1
FT                   /translation="MTATEIPIWLDCDPGHDDAVAILLACCLPAFKLVGLSTCFGNAPP
FT                   ENTDYNARSLLTALGKTDVPVYLGAQRPWIRKPHYAPDIHGETGLDGTSLLPVPVVEVN
FT                   KEVNFIDAIEKAILESDGELSFVSTGATTTIATVLREKPYLLEKIKYISIMGGGLGVGN
FT                   VNKGLSAEFNVWIDPHAAKFLLTDPGIKRKCILIPLNLTHKALATDEVMKRVLGDGKSN
FT                   IRRLFYDLFLFFKKTYEHAQGFESGPPIHDPLTLLPLLELYGWETKEVINFSYRRLDID
FT                   VDIDIHSDHAGKLIILNEYEQEEVQKGVIVGYELNFDYFWDKLYFCLEEAEKTSTI"
FT   CDS_pept        complement(253736..255232)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438886"
FT                   /gene_name="dit2"
FT                   /locus_tag="CAGL0F02607g"
FT                   /product="Dit2 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAG59007.1"
FT                   /db_xref="EMBL:CAL07957.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG055448"
FT                   /db_xref="HOGENOM:HBG398007"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI00003B6344"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUL1"
FT                   /transl_table=1
FT                   /translation="MLNILVFGFICLVLCWILTICFPPISFPNNIPTIPFYSVFIPQYY
FT                   NIDQVQFYNLYIREKLEKYGAVKFYFGSRWNILVSRPEFLNNIFKNEDTFAKSGNQQKI
FT                   PYSVLAAYTGDNVISAHGVNWQKYRKPIKDGLQHFDIGILLKNAMKFCELIKEDMRPFK
FT                   YHCNFKIIPYIQRLTLDNICRVGLGFEFGAIDEDNNSLHRQLIQIKKQIFDPFYLNFPM
FT                   FDRLPIPSRLLAFQNVENFRSSLVDKVQKQLIKTYKFEQANTSGSALVRAYNNGELTYK
FT                   QLTDNIVILLVAGHENPQLFISNLIYLLGKYHDTWQVDIRNEILNNEENNLSELPLLNS
FT                   FLYECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCHDSNFWGHTSDIF
FT                   DPTRWGKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTRIIIAEFLSSFEWK
FT                   LSPLWVEQMTHAGPLCPKDLALDIRVRDTSMQIQKLNKYL"
FT   CDS_pept        256597..258162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501401"
FT                   /gene_name="dit1"
FT                   /locus_tag="CAGL0F02651g"
FT                   /product="Dit1 protein"
FT                   /protein_id="CAG59009.1"
FT                   /db_xref="EMBL:CAL07956.1"
FT                   /db_xref="HOGENOM:HBG059558"
FT                   /db_xref="HOGENOM:HBG398008"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI00003B6346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK9"
FT                   /transl_table=1
FT                   /translation="MTLGSSIDIASTPKGDSETESNHSTFNKIIAIYTRDFYGKLYAIE
FT                   IKKECTIEREWQEFYELFACLDGKSSMITNDVIEFHISKELAKRYIHDLQTPIKISEYQ
FT                   KEGEQQIRGCVSKVEVASAFNDWFIYHVLDGCRLENNSFPLISHDIKYDEMFTSFFEQQ
FT                   LKNSVVDEKWYETGREYFKSRVRYFTQRYRRIECILPAFPCKSSNKNKVFSTIPDKGEE
FT                   LALKRLIFATQQVRSFYPPGMKVWIVSDGHVFSDCIGVDDEVVSEYTSQLHTLYKNLSA
FT                   QEPDAIGFCGLKELLFEGKSAKLFKSEWVAEVEMEHHTGTNICKYSDLCRQILMCGCDT
FT                   DAGLLKKQISTPGHPRLFLFRGFSKFMMEDLALLPYFQNSSRKAFKKTISKIAFNMIKR
FT                   NDAYSNLVELVFPNHLRISIHAHVNSGPKFGIKVIAPEQCRTIKSLENIDEPKFEDLLH
FT                   IPTPWHNCIVKIEKDYDNGNELYMIKSKIIKDVIDQGKYVGYWEPGNIEKGKGGHFILR
FT                   KTKP"
FT   CDS_pept        complement(258826..259341)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158201" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196041"
FT                   /gene_name="rpb7"
FT                   /locus_tag="CAGL0F02673g"
FT                   /product="Putative uncharacterized protein rpb7 "
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="RNA binding"
FT                   /protein_id="CAG59010.1"
FT                   /db_xref="EMBL:CAL07955.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG328752"
FT                   /db_xref="HOGENOM:HBG347513"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B6347"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK8"
FT                   /transl_table=1
FT                   /translation="MFFIKDLSLNVTLHPSFFGPRMKQYIKTKLLQEVEGSCTGKFGYI
FT                   LCVLDYDNIEIERGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVG
FT                   PMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDIITIKSRIRVKIEGCISQVSSIHAIGSI
FT                   KEDYLGAI"
FT   CDS_pept        259987..260601
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246534" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044851"
FT                   /locus_tag="CAGL0F02695g"
FT                   /product="Similar to uniprot|P32387 Saccharomyces
FT                   cerevisiae YDR405w MRP20"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59011.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059559"
FT                   /db_xref="HOGENOM:HBG203283"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI00003B6348"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK7"
FT                   /transl_table=1
FT                   /translation="MPRLVGKSVSDHILGLAQKGIEENAAHFKVGGKKLYFPKARVILL
FT                   RPNAKHTPYQAKFIVPKSFNKLDLRDYLFHVYGLRAMNVTTQLLHGRYERAGNIASPRY
FT                   RGPQIKKMTIDMNEPFIWPEEDTENSLWDHKFAQELNKYREETMMKLGSDKLKPHKAFD
FT                   GALGPFNDNMIAQPFIPKQLKRRMLNQKPQDPDYLKINQFL"
FT   CDS_pept        261361..265989
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438887"
FT                   /gene_name="PDH1"
FT                   /gene_synonym="CGR1"
FT                   /locus_tag="CAGL0F02717g"
FT                   /product="ATP-binding cassette transporter CGR1 "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59012.1"
FT                   /db_xref="EMBL:AAC31800.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B6349"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74208"
FT                   /transl_table=1
FT                   /translation="MNTPDDSSVSSVDSHQPYMGFDDNVEKRIRELARSLTQQSLTSSN
FT                   RSVNKEAPADGSAPLDRVSTRASSIFSADFKGVNPVFSDEEEDDYDARLDPNSDEFSSK
FT                   AWVQNMAKITTGDPEFYKPYSIGCCWKDLSASGESADVSYQSTFLNLPVKLLNAVWRKA
FT                   RPARESDTFRILKPMDGLLKPGELLVVLGRPGSGCTTLLKSISSTTHGFQISKDSVISY
FT                   NGLTPNEIKKHYRGEVVYNAEADIHLPHLTVYQTLVTVARLKTPQNRVKGVTREDFANH
FT                   VTDVAMATYGLSHTRDTKVGNDLVRGVSGGERKRVSIAEVWICGSKFQCWDNATRGLDS
FT                   ATALEFVRALKTQAHIAKNVATVAIYQCSQDAYNLFNKVSVLYEGYQIYFGDAQHAKVY
FT                   FQKMGYFCPKRQTIPDFLTSITSPAERRINKEYLDKGIKVPQTPLDMVEYWHNSEEYKQ
FT                   LREEIDETLAHQSEDDKEEIKEAHIAKQSKRARPSSPYVVSYMMQVKYILIRNFWRIKN
FT                   SASVTLFQVFGNSAMAFILGSMFYKIQKGSSADTFYFRGAAMFFAILFNAFSSLLEIFS
FT                   LYEARPITEKHRTYSLYHPSADAFASVISEIPPKIVTAILFNIIFYFLVNFRRDAGRFF
FT                   FYFLINVIAVFAMSHLFRCVGSLTKTLQEAMVPASMLLLALSMYTGFAIPRTKMLGWSK
FT                   WIWYINPLAYLFESLMVNEFHDRRFPCNTYIPRGGAYNDVTGTERVCASVGARPGNDYV
FT                   LGDDFLKESYDYENKHKWRGFGVGMAYVIFFFFVYLILCEFNEGAKQKGEMLVFPHSVV
FT                   KRMKKEGKIRDKTKMHTDKNDIENNSESITSNATNEKNMLQDTYDENADSESITSGSRG
FT                   GSPQVGLSKSEAIFHWQNLCYDVPIKTEVRRILNNVDGWVKPGTLTALMGASGAGKTTL
FT                   LDCLAERTTMGVITGDVMVNGRPRDTSFSRSIGYCQQQDLHLKTATVRESLRFSAYLRQ
FT                   PSSVSIEEKNEYVEAVIKILEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLV
FT                   FLDEPTSGLDSQTAWATCQLMKKLANHGQAILCTIHQPSAMLMQEFDRLLFLQKGGQTV
FT                   YFGDLGKGCKTMIKYFEDHGAHKCPPDANPAEWMLEVVGAAPGSHANQDYHEVWRNSEQ
FT                   FKQVKQELEQMEKELSQKELDNDEDANKEFATSLWYQFQLVCVRLFQQYWRTPDYLWSK
FT                   YILTIFNQLFIGFTFFKADHTLQGLQNQMLSIFMYTVIFNPLLQQYLPTFVQQRDLYEA
FT                   RERPSRTFSWKAFILAQIVVEVPWNIVAGTLAYCIYYYSVGFYANASQAHQLHERGALF
FT                   WLFSIAFYVYVGSLGLFVISFNEVAETAAHIGSLMFTMALSFCGVMATPDAMPRFWIFM
FT                   YRVSPLTYLIDALLSTGVANVDIRCSNTELVTFTPPQGLTCGQYMTPYLNVAGTGYLTD
FT                   PSATDECHFCQFSYTNDFLATVSSKYYRRWRNYGIFICFIVFDYVAGIFLYWLARVPKT
FT                   NGKIAKNGKTAKVNFIRRLIPF"
FT   CDS_pept        complement(266337..270113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142077" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501402"
FT                   /locus_tag="CAGL0F02739g"
FT                   /product="Similar to uniprot|Q04183 Saccharomyces
FT                   cerevisiae YDR407c TRS120"
FT                   /protein_id="CAG59013.1"
FT                   /db_xref="HOGENOM:HBG058038"
FT                   /db_xref="HOGENOM:HBG203284"
FT                   /db_xref="InterPro:IPR013935"
FT                   /db_xref="UniParc:UPI00003B634A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK5"
FT                   /transl_table=1
FT                   /translation="MDFLSSNLSFVNPCKVRTLVVPIGKWKKRDFLNQFETLRANNEVR
FT                   LLDITPIDCPLFTPQAFPNGRVFYDFTISQHADALDLFLYDFEPFRKIFVIIGLVNDKS
FT                   DPVDNMNILKERYPTVISHNLLYTDKSLINSDVENQDISNIFHYNSDKLENYETILCDI
FT                   TRNFLVALNHYYSSYKHVTLRSPGAIGGNAVRKTSLLMSALPGNQSRGSGSLYNSNSTN
FT                   TNKRLSSFEMTTNNIKRSASLKLSTSLASTDNKIQTRAQGRQYKILGNFQLLAGRVSDA
FT                   LNSFNEAVILLYRVRDLLWLGSALDGVAICAVILSYLQMPFKIPHIVALICPMESPNNS
FT                   IEALSPRNSLTNSVQSPRNSLTLATSEANIDVDMSNLPVLVKAILDKALHYYDESLSHN
FT                   SEYAPQIVYSQFLSRTLSFMLCCNSAVVQSQNVASSIINCNYSNKPLKDCENLSFSNSD
FT                   VYSFCGKVLLLKIDDMELEEQSSIFSLLSKAYASLQLTRKQAFTLRLLLVSISSHAEGL
FT                   KWQHSFQNFLDTVMRLYDIHESADSNEVKSNSLEWRELQKDIIELCLQISVSMKAESNM
FT                   RDYGLLMLNKYNDMLSETEQKEILQVILKPLIQNLKIKEYWDPFILRGVTISRLETDSA
FT                   SYDTLRIPNENSIATAQKINPHEVFNPFKQANSLNLKTSGSSDSKPKLFLVDDRAEFSC
FT                   TIQNPYGFDITISDIHLPDEITDYCELDTRSSVKDNPYVIGAKSVRNITLPIKIKKSTA
FT                   DDFLFLRYLRLSVLDLPLSRFDVYPMPQNGGIISPLNINLRTTPPLESEALTFKILPEQ
FT                   PELEVMNNGKVTGNSWMLLDGTKSQFTILIRNKSLSKSIDQLNVTAVTNIEHALKADYW
FT                   KKMQPDDLNILESNIMWMKNECIKILNKPEHVQPNEIFELKLEIDTVRAPFEFESFIVV
FT                   VEYGMQEEDKSCFYMKKLKIPYEVTLRRSIEVPNMDLIPLNHMNFTNTSDSSWIAYIQS
FT                   LSNKSNDAFSYSAKDYMLLLLDFRNSWIDGIHIEVTYEDFVSKGHLVESNRNLRIIVPI
FT                   RKIDVEKINFSNKPIPRIFKERQFLQSGMDENTEITMRECFWTREYILERLSCRWELST
FT                   DSLIRGEVDFRKYIEKFDNRTVANLYKGKLPFSITLSSSSKSSTTGELNRISCQISPQT
FT                   VQRQHSRIQQTALLNFFIFEHFSSKLLPKSNRRLLYNGSLSQKFSTNSESTVCLDVIPI
FT                   EPGCYEICVCISETESVDKVLQFNPDSILVEVN"
FT   CDS_pept        complement(270750..271382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349219"
FT                   /locus_tag="CAGL0F02761g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="methyltransferase activity"
FT                   /function="phosphoribosylglycinamide formyltransferase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAG59014.1"
FT                   /db_xref="GO:0004644"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG061800"
FT                   /db_xref="HOGENOM:HBG649382"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniParc:UPI00003B634B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK4"
FT                   /transl_table=1
FT                   /translation="MKRVTVLISGSGSNLQALLDAEREGKLPGISITHVISSSKKAYGL
FT                   ERAAAAGVPTTIHSLYNYTKSIPKEDVAQKKLARRQFEKDLAQVVLESKPDLVVCAGWL
FT                   LILGPDFLAILKGIPILNLHPALPGQFDGTTHAIEMAWNKCQEDNKPLKAGCMVHYVIE
FT                   EVDKGEPLVVKELEIVPGKETLDQYEERVHKAEHVAIVEATLKALAN"
FT   CDS_pept        271798..274317
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438888"
FT                   /locus_tag="CAGL0F02783g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG59015.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124550"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B634C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK3"
FT                   /transl_table=1
FT                   /translation="MDYNIPLGDDRCLVCNACNRLSLLDLDGLDALIRYLSEYKALKVD
FT                   LGTGNSENVGIADKRNGLCLFLLRYLKKDRSKSYEIRAVIRAIDAIYRKQKLPSMMELT
FT                   MLVRKYTNKYDPYGYWDNVDEFNPMDVVTKQMIEFMNISNNPKSPNFVRSPFYEILSII
FT                   PDTTRRLPAIEVKNVAECKFKFEKNVWTKLTDEKYPLKLYLFSRKDSKDPETGDYIPNK
FT                   DEDTPIAFPTPIEVWVNNEKIKANFKGLKNRDGSVNPVDLTPFLKSWRAQNVVKIIHVF
FT                   NKECYSSYCALIKPIAPQEILTTILNKPVIPYTSALENVKKLFGEQTDNELITTSTIIS
FT                   LKCPISYTRMSYPVRSKYCEHLQCFDGLWFLHSQLQVPTWMCPVCQISLKPADLYVCEF
FT                   SMRVLNSCANNVEQIELAPDSTWKPIYEKEDQSDCSDEEDTSKDTMTEVLKHEMVTDTI
FT                   TNKTSRNNSQLNVVSLLSDEEDDTTTTKSKDRGSKLVPTSKNYNSSSTGNVVRKSIGNE
FT                   KNGAVSQSIAIAASTTLHNDTNHDDEDDDLPLSAVARKRGSPREFSYGSYEINGTLASL
FT                   SNNATLPQNSHTHKKPHLQRLAPKLLAKEPLKNTNGADANPIFGINSKFKNDNQLSKKT
FT                   LDPKATSQPTINPSFDSAQQYSMRISSQAGLGSRSILSSNSNLTTSDCNPFVSEQQLAY
FT                   EGKNGRASSEIMQKPIRNENRQSQQRVTPDLKHVNDYKRTNKKGKIKNIVNDQKAEELT
FT                   QLANGRLKTDKAPELPILPKLPQIAGQSHSTSKIASEPSLDKINRVSIKTKPPSALPIV
FT                   NPFLTSKSKPNNTKGAEIVKGNSPWFV"
FT   CDS_pept        complement(274470..275234)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044852"
FT                   /locus_tag="CAGL0F02805g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59016.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG299304"
FT                   /db_xref="HOGENOM:HBG737603"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI00003B634D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK2"
FT                   /transl_table=1
FT                   /translation="MTGSNKSEKFVPDAEGLPVIINGKAYPDIRRNPLDDIAVTSFALG
FT                   ILLGIFVGLLTFTQFRNFNVYIIALSIFHFLEFYVTAKVNPGKVNSDSFLLNNGIGYLG
FT                   AHMFGVLECLVESIFFPNMKKISNSWVAIFLTIIGVILILLGQVSRSMAMYQAGKSFSH
FT                   ILKTEKLDDHTLVTTGIYGYLRHPSYFGFFWWAIGTQLLLLNPIALIVFVGVLWSFFNK
FT                   RILIEEKYLIQFFGEQYINYKKRVKVWIPLID"
FT   CDS_pept        complement(275536..276567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065932" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438889"
FT                   /locus_tag="CAGL0F02827g"
FT                   /product="Similar to uniprot|Q12743 Saccharomyces
FT                   cerevisiae YDR411c"
FT                   /protein_id="CAG59017.1"
FT                   /db_xref="HOGENOM:HBG203286"
FT                   /db_xref="HOGENOM:HBG252487"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI00003B634E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK1"
FT                   /transl_table=1
FT                   /translation="MAGNIHSLGNTTPRNGNGPSSEGPATFSSFWYSVPPVSRWLVTCC
FT                   ITVNTLCHLHLIGYQHFAFTWFQTFQRLQIWRMLFSSLILPANLMPALMEGYNLYVRST
FT                   ELEQGFYYSSKRISLSSHNFAFYLFSCLVVMTTIAGFLFGTMVPLYLTSAFTACLTYTW
FT                   SLYNTDKKVMFYGLIPVWGRYFPVLQLFTGFVLGSRFDFYLSLIGIIAAYIYNCVDTWT
FT                   LGPLYGLLIKTNVANYGYEPRGKVQAPGWFIKIYNLFSGETTPSIVTDGNILKSTGISS
FT                   ILKTGGQRLGTRTEGDNPSPSLAGQSASIRSSSSVRTSGASRTQTSMGSRMFPGKGKRV
FT                   GDD"
FT   CDS_pept        277229..277975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248508" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196042"
FT                   /locus_tag="CAGL0F02849g"
FT                   /product="Similar to uniprot|Q04031 Saccharomyces
FT                   cerevisiae YDR412w"
FT                   /protein_id="CAG59018.1"
FT                   /db_xref="HOGENOM:HBG058042"
FT                   /db_xref="HOGENOM:HBG395819"
FT                   /db_xref="InterPro:IPR019186"
FT                   /db_xref="UniParc:UPI00003B634F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUK0"
FT                   /transl_table=1
FT                   /translation="MAVKSNREILTRGKNYATKQAKKFGADEVSFDKDSRLDFLTGFHK
FT                   RKVQRQKKAQEFHKEQERLQKIEERKKIRDERKQQIEEQLKQFKSKLDIELEEVAGDQD
FT                   WEDNTKKKKNQKSEVKEEEEEEWEGFQSDQDTKIDEDDKDESGVKPILKKNAVASEYSD
FT                   NTVVEIETLEPNENFAYLAEVNNVKLEQSEKVLKQSITRATKYAKFLGMGDDEDNKKKK
FT                   KKKFRYLTKGERRVNQMKANANKRRK"
FT   CDS_pept        complement(278122..279228)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438890"
FT                   /locus_tag="CAGL0F02871g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59019.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124551"
FT                   /db_xref="HOGENOM:HBG203287"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniParc:UPI00003B6350"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ9"
FT                   /transl_table=1
FT                   /translation="MIILEEEKESISLLRYLVNVPPAQLINVLLLLAAFLWAWIVRFLL
FT                   RHSIDIGAVVQLSHPWDQFAANNARLKTQSTRFTTYLARVILPLTLLTNILHSYIEENK
FT                   DANALVVLMYTLLPLGQAAFLILSILKTCGVVRYCVKRCLVIESSPRALRNVYILFSDT
FT                   VTSFNKPIIDFALYLTYLLGIQITHFDLFLAVIPPLIRLCQCLKEYKTTKEFTLLANAL
FT                   KYSCHLPVVLCLWYSRVYGDDSLTIRDYNILKVMMFIQSTYSYIWDVRKDWTITSISSI
FT                   RYQKSRVLFPKFYYHIAIVMDGIMRYWWLWIIILAPYDVSGKPTALFFEKEAQFIELIR
FT                   RAGWVVFKLESEYSTRDSDAINYQKESR"
FT   CDS_pept        complement(279526..280659)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196043"
FT                   /locus_tag="CAGL0F02893g"
FT                   /product="Similar to uniprot|Q04033 Saccharomyces
FT                   cerevisiae YDR415c"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG59020.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG054432"
FT                   /db_xref="HOGENOM:HBG328999"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00003B6351"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ8"
FT                   /transl_table=1
FT                   /translation="MLLKNLVYIGSVAALPWSSSWSSLLQDDDSVRTIDVGDGQLRQVT
FT                   EYDKLKLRRRGIKFFDVTDVLFFRSEEDPVVADYNYPMQMHQRDTVHGVLDKIDKESMY
FT                   ADLSKLTSFYTRYYKSAEGVKSADWVLSRITNITNGLEKDLVQIEQVSHKGWDQYSIVV
FT                   RFKGTSLPDNIVVIGSHHDSINLLLPSVLPAPGADDNGSGTTTVLEALRVYVEYYIKQN
FT                   QRPMNTIEFHFYSAEEGGLLGSLDVFTRYARDQKKVVAMLQQDMTGYVRDPAKEHVGLV
FT                   TDHTTPKLNNFLKLVMNEFLSIPYVETECGYACSDHGSAVKNGFPAAFVIESDFKKTNR
FT                   YIHSTMDTLDRLSLDHMAEHAKLVLGTVIELGQWLGF"
FT   CDS_pept        281010..283517
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065931" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438891"
FT                   /gene_name="SYF1"
FT                   /locus_tag="CAGL0F02915g"
FT                   /product="Pre-mRNA-splicing factor SYF1 "
FT                   /function="binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG59021.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058043"
FT                   /db_xref="HOGENOM:HBG203289"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B6352"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUJ7"
FT                   /transl_table=1
FT                   /translation="MADIDQYILDDSDIAFEYELQKSPSVEVWQRYIAHWEAQVCEDGV
FT                   RSARHILWLYERMVTQFPTLTVWEQYIGWFRRQYKLDQYLDTFKLYERCINSVKGPLGV
FT                   FAVEVMLFCISTFDLDIIMKGLQLVLHRCNKDEVERIWNIVLGFALEHVLPSEEGPNNI
FT                   DFSAFNDRNYEDLRLDIYKLLFLGGDQTEIEDDEEDEDVDKWTASLLRYYLQVANEDKY
FT                   DETLRLLIRTKDIKIIKECFDLYIFNDKTGKNNRESKKEYDFDLYIYYLDTLDKLRLDK
FT                   DYKSVFDNLLEKYPQHRVLLTLKLADFHMKRADFDKMEKVLTKALSETVKTNEFIAIYT
FT                   YHVNFEQAYVETIFDEMRDDPEIQVQKKWKSEMDDHLIILGDLTSRYHLLVNDLKIRQN
FT                   PNSVSNWLERTTLFEDFDKKCEVFVEAIKTIDPIKVKDKEYGMLGKLWCDYAKVYWSNK
FT                   SYEEARTIYESATKVPFPDLQDLEIVWHTWAVNEFQIHNIERALKILRKALTVPPSYES
FT                   IIDRFKSENRRLPSQTILFTSKRLWNYYIDLLESIPTIDANDVIRAYDTLMTLKLITPV
FT                   GILNYATFLKQNNNLHGSLQVYEKGINMFPPEICYELWTLLLDEVMEPAHQATKERIRE
FT                   LFEQCLQQLGNTDININSIYVKYSDFEIHNKLFSRAIDLLMSGARRPYTNKEQLKQRVD
FT                   LWESAISKCEEFLGPDSLRQLLSECIQELPNSKAITYVLKFTKLEMSLSDYTRARELLQ
FT                   YGAQLLPPIKNEELWGLWEQFELEHGDKSYYKEMLLLKQKLEKEMKVDTEEVSKGQGNV
FT                   QFVASSVKNQEAKTNPDEIEIDI"
FT   CDS_pept        284659..285156
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349220"
FT                   /locus_tag="CAGL0F02937g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59022.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG023340"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniParc:UPI00003B6353"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ6"
FT                   /transl_table=1
FT                   /translation="MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGED
FT                   IAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKDKNVKHSGNV
FT                   ALDEIIEIARQMKEKSFGKNLASVTKEILGTAQSVGCRVDFKNPHDIIEAINAGEIEIP
FT                   EN"
FT   ncRNA           285699..285858
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR80"
FT                   /db_xref="Rfam:RF01269"
FT   CDS_pept        286337..288244
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349221"
FT                   /locus_tag="CAGL0F02959g"
FT                   /product="Similar to uniprot|Q04049 Saccharomyces
FT                   cerevisiae YDR419w RAD30 DNA repair protein "
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59023.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058047"
FT                   /db_xref="HOGENOM:HBG396195"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI00003B6354"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ5"
FT                   /transl_table=1
FT                   /translation="MGHSKFTWKDLIDLNNKDKAYLSNLACLAHIDVNAFFAQAEQIRC
FT                   GYSKDDPVVCVQWKSIIAISYAARKHNISRMHTIQEALKKSSDIIPIHTAVFKKGENFW
FT                   QYHDGYGSWNEDPAKQLPPEEYKVSLEPYRRESRKILKIFREFCDHVEKASVDEVFLDL
FT                   GRLCFRDLMFPNVEATDDDDYNIVAENPLRELFVNGDYKLDMPLPPVPEALKKLSYCGL
FT                   VYNHEEAPVIQDWDDVIFALASKNTQLIRKTIQDNLGYTTSCGIARNKILCKLGSNYKK
FT                   PDAQTVIRNNDILEFLDQGGFEITSFWTLGGALGRELEGLLNLPEKDTIKHIRETWPAN
FT                   HKQLRDYIETELDEAENKKKYPVVAGSKLEVLSDKLFSMVRGTFSTPITPKPLIQSMMS
FT                   NKNLRGKSCNSLVDCISWLEVFNGELTARIVDLEQDYNKIVVPRTVSLNLRSYTGDVRR
FT                   KSGPLVINNSKYLSRDLLKTCVKLMQEIHDKFAAKDPSKFYPLINLNVIISNFDILDHQ
FT                   KTVLDMFGNQKQVFNTKTISPKIEPVTEVEDKDEDAKKFSCEKCKVHFDNLKEYDEHKD
FT                   YHAALKLSESLNGVESTSKNLSIGEKRLLFSKEKRVKKKPISKNKVNSSGNIYNFFNKK
FT                   "
FT   tRNA            288415..288496
FT                   /gene_name="tRNA Ser (AGA)"
FT   CDS_pept        289923..293480
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196044"
FT                   /locus_tag="CAGL0F03003g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59024.1"
FT                   /db_xref="HOGENOM:HBG124552"
FT                   /db_xref="UniParc:UPI00003B6355"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ4"
FT                   /transl_table=1
FT                   /translation="MRKLLLLVRSLLLVAVTATTSANDTPVPNPISEDISSVLSASIQP
FT                   EIPSAQPSVQSEIQSIPSVQSEIQSVPSVQSEIQSVQPSEVQPSPVANSIESNTNTNTN
FT                   TNTYPDAGSSIQPNSVSNSIVSQPSDDINTDDLNFLDDGSSQQGPSSILSINPSVQPSS
FT                   IDYHSSSKINVESSSSVIPVFAPSEARAPAKPPAFEISSSASSVQVSSQQQQPSIQPSS
FT                   VEPVQSNSPSPSSVVPSPSSVIPLVPPEVQVSPSSAAPLIPPEVQVSPSSVLPSSSISQ
FT                   LGPSILVSPPVSSPPTSSIPSQQISSQEINFSEFSGSFNVPSWLLSSNAPSSSFSEQLS
FT                   PSSLDYSQAIHSRVADSSTTTLPLIVPPTTTTTPTLVSESSTLSNFLKPSADREFSVHF
FT                   PVLSPSSIENEPPSSIQSVASSTILSQAAPLSPAQAASIPSSILEPTGSSVASEYISSN
FT                   SLSQIPVEAVDAKQAPSSSSLSSILSNTDNIEAISSNLEQATPSRPVDNNATPTANSGT
FT                   VLDSASQINSQSISRDDASYAEIAQSSVNVQNSASNFANSVPSADSSNTIPQPEDNTPT
FT                   TSTVSEFTASNVDVSSVHIASKDADSSPNSVSNHDALNSVAPSVDVDIVSSNSIPTQVL
FT                   TEPSSAVPPNVGFDISSDINIPSENIESDSNLVVTSTSRPSQGTFQNNPTNSRTITNQI
FT                   PSSASPPPATPTGPKTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKM
FT                   TVKSPNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLI
FT                   DDNALAFLDSNLFNASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNS
FT                   SLYSNPNDSLSALARLIDPSIPLTGLISGSSIESTSNSDADYNSDQSGNTRQSRKGKGL
FT                   PSNLSIVGSLDNYDKNPEKEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKG
FT                   NATIEKSNIKVDNTSGYHDNGRSNYKDNVYDGILDEKHYSSSEGVSNGSTMAGLAYAFN
FT                   NFVGGPNMYSSYDTGALADSTLYSSSNQLQIPRENSSPWPAQYITAPSRKSQHSTEEVS
FT                   PITLVPRIDSDVYNLQKQEMMAESVSGTFSLGSDIFIDDDEDENVKDLQIEDVDEFDEE
FT                   LYKRLSKFTDYRDVNNISL"
FT   CDS_pept        295783..298569
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438892"
FT                   /locus_tag="CAGL0F03025g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59025.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058780"
FT                   /db_xref="HOGENOM:HBG395384"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B6356"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ3"
FT                   /transl_table=1
FT                   /translation="MDNKIVKPVPKKKSRSTTPVGGSSSSQGQKHKNTFGACLRCKYKK
FT                   IKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDSQGLQSSQSTSPTSAS
FT                   MLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSPNTALIEACDRVKSD
FT                   TAWKLELTSMQSALEFLAKATKLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDNGNES
FT                   DSTTNSTSKDTSTRSSYPSIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNF
FT                   MHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKL
FT                   WTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVSSSKE
FT                   DPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLK
FT                   PTLGESLVSIDGGMKEFEIDNPKSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDK
FT                   LKEENPDLIIDLETEFLNDEYSINYLDENSSFLKNPIPYTTYQKAQLELLRIVTITYQT
FT                   IYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKF
FT                   KRTANIRGESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEIL
FT                   KSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILV
FT                   DDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDP
FT                   SLESQTTHKESLEASNHDTISSDAQEPPSENDSSHDTTTQGTANSTRKVGPNSIDEIGQ
FT                   FTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGFQDFDQLFDEFAIRPS"
FT   CDS_pept        complement(298906..301140)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044853"
FT                   /locus_tag="CAGL0F03047g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59026.1"
FT                   /db_xref="HOGENOM:HBG124553"
FT                   /db_xref="HOGENOM:HBG203291"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="UniParc:UPI00003B6357"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ2"
FT                   /transl_table=1
FT                   /translation="MHSLFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALHI
FT                   SSPGPSNATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVAEA
FT                   AAAKRKNLPFRTINNVMDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPRSEDGRRSS
FT                   NRLVNSKPYLYNYEPSGVPVGDPDGGMLQGTDVVLNQELLEQALKRDMKRKRADTMQSS
FT                   TVELNKKVDTNTSKNSNHTEIMKNPPETAEPTSATAAMMMRLYGDRTLLNQQITKQKED
FT                   ENKYSHTITNAAYKKLKPFSGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHV
FT                   HSESPSPDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNS
FT                   QFNKIPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFE
FT                   VLRGYDRIEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQ
FT                   APAPSKAQASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEF
FT                   FPPIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDAL
FT                   FGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINH
FT                   IIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESKE"
FT   CDS_pept        complement(301650..303110)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196045"
FT                   /locus_tag="CAGL0F03069g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG59027.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124554"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniParc:UPI00003B6358"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUJ1"
FT                   /transl_table=1
FT                   /translation="MSKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLR
FT                   ALEETIVVLKGMNSKKNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKADDL
FT                   KSVEVVPEQPSATNFMNSPTNITTAGSDKQADKTSSKKSSPHVKLESNTSSVSVTSEER
FT                   GVLSHTPTTTNTSFDTSPSVINDLQRTAANRLESTGSWMDSIFDQDSKLSNLMNDQSFY
FT                   PFDNISFGNSPVITNNWGENDMVAKQAGLESFNFAISNSNSTFGLPAIATDISDINDIN
FT                   DTTTRIEPQLAFPGEDIKYSRENMVMRRESSAMNNGGILDTVINSPIPMLDDNSEDILG
FT                   DFTCSCQNKANSCPTRQLENEAKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTV
FT                   LQLLKRTRHERDARSSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDG
FT                   DGTDIVPKRHVVIKAGDLQRTLAKHISS"
FT   CDS_pept        join(complement(303953..303962),complement(303484..303734))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438893"
FT                   /gene_name="DYN2"
FT                   /locus_tag="CAGL0F03091g"
FT                   /product="Dynein light chain 1, cytoplasmic "
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /biological_process="transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="dynein complex"
FT                   /cellular_component="microtubule"
FT                   /protein_id="CAG59028.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG051569"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="UniParc:UPI00003B6359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUJ0"
FT                   /transl_table=1
FT                   /translation="MDQVIVKASDMGDEMQQEVFRIAEEAMREHTLEREIASVIKKEMD
FT                   SRYGHTWHVIVGRSFGSYVTHEKGKFVYFYVGPLALLVFKT"
FT   CDS_pept        304124..306067
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438894"
FT                   /locus_tag="CAGL0F03113g"
FT                   /product="Similar to uniprot|Q04053 Saccharomyces
FT                   cerevisiae YDR425w SNX41"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAG59029.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058776"
FT                   /db_xref="HOGENOM:HBG203293"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI00003B635A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI9"
FT                   /transl_table=1
FT                   /translation="MKNKSRKRGGRDEDLEEEDNNPFVGTTHMFASGIASAPGGQQAVL
FT                   KLAQPAPGEQQGASTPDGAGVVAGTAAGATGATGAAGEGEDEDEDSNENSDIRDEDVDI
FT                   LTQTLYKAAEEPFVSVPVRATGTDSLFKIPVDSSGPIQIKEAGDYKDPWGKHAIGYVIE
FT                   LDGFKTVRRYSEFYSLRKNLTLLLPTVVVPPLPPKHSIMNYIFKKSIDTRIIDSRKRTL
FT                   CRFLNECYEVPDIANHIVFKKFLDCEIIWKDVLNSAPILILPHDNRLAPPLNPTKPSPL
FT                   HLLLPAPNSKVATNTSILNPLIPTNTELENKFNKLEKKFWEYKINYKNLHKTVKQLENH
FT                   LKLIGGLHSELGVHYNSFSIENAIISSDGNENEDRSSSMLIEKVGHAFDVSYVTDEILS
FT                   ERHIVNLEEPLYEFIQLLEDCKRVLGFRKAKYLQYEIVEITMDKNKKRLRALLDLDDHI
FT                   KTMTNVINQSTILESRKYSNQEPISDVPDSPYSKVDYTSEGEESAHDETHADHDTPQQE
FT                   HHKSDDEENIEQLSSSLHASTINANKIKVRKKLSRRRDRSARELDPSLLTEAERKQEIK
FT                   ILQRELDKLEDVQKLVLRDIEDVNESTLRSLEHVSTKLEQRWGNMLRQVTKAMIDFSRE
FT                   SLNAWRQVRKDK"
FT   CDS_pept        306549..307736
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349222"
FT                   /locus_tag="CAGL0F03135g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59030.1"
FT                   /db_xref="HOGENOM:HBG022402"
FT                   /db_xref="HOGENOM:HBG396073"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B635B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI8"
FT                   /transl_table=1
FT                   /translation="MVGHEVDTILSTLRIEADPELSYLFDKFEHDYENKLWHQLTQNLN
FT                   VFFMDERSKPLRLRIYDTFIVKFQENINELSLVQYLLVALQTISDSDEALKYLTHLKQT
FT                   LEDIDSKKTRNDGLNNHDNAFLFIDIEIARLYLHKKELLKARDMLDVLEKTLDFKDNVP
FT                   LLLTSSFYSANAEYYKLKEDFSSFYYTSLLYLSTLEDDNELTIINKEPSFELAYDLCVA
FT                   ALLGEKIYNFGELLQHPIMNLINERKDYHWIADLLNALTVGDLEKFDKLISVQMPKTLI
FT                   LAQNETFLRQKIRLMSLVECIFAKNIRLLSFQDVADATQIEKDQVEHLVIKAISLKLLK
FT                   GSIDQVNELVTVTWVQPRIINEEQILKMKNRLVDWDEQVRALAVRLEERGKPIWV"
FT   CDS_pept        complement(307854..310826)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000008829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438895"
FT                   /gene_name="CYM1"
FT                   /locus_tag="CAGL0F03157g"
FT                   /product="Mitochondrial presequence protease "
FT                   /EC_number="3.4.24.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG59031.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG092242"
FT                   /db_xref="HOGENOM:HBG413876"
FT                   /db_xref="HSSP:2FGE"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniParc:UPI00003B635C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUI7"
FT                   /transl_table=1
FT                   /translation="MLRFQRFASTYNQRAVLRKYPVGGIIHGFQVRRAVPVPELKLTAV
FT                   DLIHEQTGAEHLHIDRDDKNNVFSIAFRTLPPDATGVPHILEHTTLCGSEKYPVRDPFF
FT                   KMLNKSLANFMNAMTGPDYTFFPFATTNARDFVNLRDVYLNSTLRPLLKEQDFYQEGWR
FT                   LEHSEVTNPKSDIIFKGVVFNEMKGQVSNADYHFWSQFQQNIYPSLNNSGGDPQKITDL
FT                   HYQDLVDFHHANYHPSNARTFTYGSFPLEDTLKKVNEEFRAYGKRIINKKLPKPLELIE
FT                   TKELTLEGQIDPMLPAEKQTKTSLTWKCGEPTDLYETFLLKILGNLLLDGHDSIMYKGL
FT                   IESGLGHDFSVNTGVESMTAANFLTVGIQGSQNVEEFKSKVFDLFKEFIENDVDSNKVD
FT                   AIIHQLELSKKDQKADFGLQILYSILPGWTNGIDPIEGLEFDELIGRLKSDFKENGTKI
FT                   FKNILDKYIIDQPYFHFTMKGSEEFSSKLAAEESTKLDKKLKELDETDRKAIFERGLLL
FT                   EAAQNHKEDLSCLPTLGVADISRKVDTYDLNTNANITVRNTATNGISYIRGKKLINDMI
FT                   PLELYPFLSLFAASLTHLGTKTTPYGAIDNEIKLHTGGISTNISVNADPTTLQPNLYFD
FT                   MSGFSLNEKSDYIFNFLKTILMETDFSTHKDKLKVLINSIASSNTSHIADSGHTVARSF
FT                   ASGHLSTVAAIQEHISGVEHYKLISRLCSIMNDDKLFQSEVIDKLVMLQRIIVNSQNME
FT                   FFASVDCQAQENKIRKEVDYFVSTLPNTSSDISGAIQTACVPRYSDSQVLNLIKFPFQV
FT                   HYTAQAYNGVSYTHKDGAALQVLANMLTFKHLHKEIREKGGAYGGGATFSALSGIFSYY
FT                   SYRDPNPLASIQTFEKSASYVLNDAKWTQSDLDESKLSIFQQVDAPISPKSEGSTFFNL
FT                   GVTDEMRQVRREQLLDTSLLDIHRVAERYILPNKSIATVVGPGIDGETVSPKWHIEDIK
FT                   V"
FT   CDS_pept        311261..312862
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438896"
FT                   /locus_tag="CAGL0F03179g"
FT                   /product="Similar to uniprot|Q04080 Saccharomyces
FT                   cerevisiae YDR434w"
FT                   /protein_id="CAG59032.1"
FT                   /db_xref="HOGENOM:HBG190019"
FT                   /db_xref="HOGENOM:HBG203296"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniParc:UPI00003B635D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI6"
FT                   /transl_table=1
FT                   /translation="MSSTIGFRKAVGVCFVLLYLAVGVPLWYKLTNIYRAPLPSQYIES
FT                   LHDNVFQDVHMVIPVYLKSDLYKFPDLHDAVQVQVNHLLNTREHDVAWSLQVLQYDEKL
FT                   MKGLEEAGDDVYMVDLVLDESCGFVPGFGTKHVTVLYDDESVATNDLPFFVAQTLVEHV
FT                   FGMEWDVFSNYWNRTQNSVAVLYKPDIHISISLLNGGSQPVSWEIDEVLKEYFTPFRQF
FT                   ITSLVNFTVDTSIIYHNDLNLHSLNNSAEVSVSDLSHHIDLSDLSAMNDFKESSSVNLA
FT                   IVYPDPEFSPNGLNYIQGHERADDVLHPWNSFIVPQWGVVAINKYPLKKHSVISKEYLK
FT                   PIVYQFANDMAKLLGLVDINDDFNTPYITVESFKRVMILNNIEKSVETLWSLVKLSKQF
FT                   QQMSIPKEVMGNVTEALDLRLEIVDLLNNPEKGTDLDWSYALSMSNQLVALTECAFFHG
FT                   EMVQQNFFPQEHKVAVYLPLLGPLTIVIFLGAVSLFKEVPSTDKTDEDSDEKDVNIDSE
FT                   TEGPELTNEKAEMKHD"
FT   CDS_pept        complement(313074..314030)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196046"
FT                   /gene_name="PPM1"
FT                   /locus_tag="CAGL0F03201g"
FT                   /product="Leucine carboxyl methyltransferase 1 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAG59033.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058770"
FT                   /db_xref="HOGENOM:HBG203297"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016651"
FT                   /db_xref="InterPro:IPR021121"
FT                   /db_xref="UniParc:UPI00003B635E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUI5"
FT                   /transl_table=1
FT                   /translation="MELAVQRTDTDALSSKVSAIHTKYLSGGISQQFAYEEVYGEYLAS
FT                   LRQVSRRVFGKCRYSGASFPVMNYGTYLRTVAIDERVLEFLQCNSGSQVQIVNIGCGSD
FT                   LRMVSVLAKHSNVKYIDLDFKESVELKRQVLEKSSTLSSYLKNDNYVLRSCDLRDVPDT
FT                   LELLNEECKPELPTLIISECVLCYMPEKETQSLIDGIIRLFKNGSWVSYDPMGGSDKND
FT                   RFGVIMQQNLRDSRQLEMPTLLINNSPEIYASRWTPNSDEQFERVVTDMWTYYNDKVPA
FT                   EEKQRIKRLQFLDELEELKVMQSHYVIFFCKWNANPN"
FT   CDS_pept        314696..316759
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044854"
FT                   /locus_tag="CAGL0F03223g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="cofactor binding"
FT                   /function="magnesium-dependent protein serine/threonine
FT                   phosphatase activity"
FT                   /protein_id="CAG59034.1"
FT                   /db_xref="GO:0004724"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="UniParc:UPI00003B635F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI4"
FT                   /transl_table=1
FT                   /translation="MGNTSSKTKTSIKKKGKKLSNVAVPPALSKSDTTQSTKSVRSQSS
FT                   RHSDVSRPTHSRKSSIHNFGASSEALNTEEPPLASTNDTRKGTENMSANNSISNNIGGL
FT                   SNSGGNNTEGNNYLTAGTSMNNARRASSSRRSSYNHGELPPSMIQIEPKPPILRNSKTL
FT                   SSANSFAYDENALTDDDENNNSISNNNDNSIVHTFGRDRNLSATEFQRTSSMSSSSRMR
FT                   RKSDNSGIDRGDTPIGKSSLHRTNSMASSLLSRKSSFGSNGNTEYSTPLHSPAAVLDGN
FT                   RGDYFGAQPGENNNLDTIGGNRDKLAELNNDKYRKSSMSSNQSGHSKLQIDAYPSISSD
FT                   VAIAEAQTEIGIDTKKKKPVKPIDIDETIQKLLDAGYAAKRTKNVCLKNSEIAQICQKA
FT                   REIFLAQPALLELSPSVKIVGDVHGQYGDLLRLFTKCGFPPMANYLFLGDYVDRGKQSL
FT                   ETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKTFIDTFNTLP
FT                   LAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSPNEWEDN
FT                   ERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDN
FT                   WGAVMSVSEGLMCSFELLDPLDSAALKQVMKKGRQERKLAAQQQHQQQLQQD"
FT   CDS_pept        complement(316924..320034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438897"
FT                   /locus_tag="CAGL0F03245g"
FT                   /product="Similar to uniprot|P32361 Saccharomyces
FT                   cerevisiae YHR079c IRE1"
FT                   /function="ATP binding"
FT                   /function="endoribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="mRNA processing"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59035.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0016891"
FT                   /db_xref="HOGENOM:HBG058835"
FT                   /db_xref="HOGENOM:HBG203762"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006567"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010513"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniParc:UPI00003B6360"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI3"
FT                   /transl_table=1
FT                   /translation="MGKFWFWPKHDHDNSTFANQDAKDSEQINSSNSLLEEDFSHILTY
FT                   EGLEIDPTGAIVDYNIDINEVRRKSQLNTVETPKDTIKEYIPEEYVTNQSKVSHSRYTI
FT                   AQIILVTDVDGNIHSLNKNNGELQWTLPGSIFPPLIKVEADASLENEIFIIEPFDDGNI
FT                   YYADVSGGIQKLPINVKQLALSSPIHLRMNSRMGADNESKIDDRIYISSRRSVMYKIDL
FT                   LSGKILSKFGFESQHDNQSFYSMHEDDQESDLDNSSFNVLLTRTIYEIRTYTKEGASYN
FT                   ITYSAWDENSIQSSNPQFQMLKSDTNKVDYIPLSDKSIVARNQLNGDMKWRTEIPNIAI
FT                   GVFEILRDTTNGEHIPIQYPLKDVDVPKPDDIKNQVYFNRVDGSSWYALSGTNYPSLVG
FT                   SASLINNEQDNNNYSVLGSISGVHTLQNPDYNVFYENNRGVLGLPAMSRNTLLLDPPNS
FT                   VVDSGLPSDLQPPYIDGSYNDEISEQEMRMQLNRLRNVSHGYYEELMSKLSQIIVLSML
FT                   GVFALSTFIFIYSRVTGMPVKHMWWNIVNIFRANNNTITAKKVTEEGGQVEKRKRKRGA
FT                   RGGKKNKKSAFISNNDDELSNRVLQVSDKVLGYGSSGTVVYEGKFQERSVAVKRMLVDF
FT                   YDIASKEIELLSESDEHPNVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQR
FT                   LKDYELVDILAQITQGIAYLHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIM
FT                   LSDFGLCKKLDFEQSSFKTNIKNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYD
FT                   PYLRRRLTKAIDIFSLGCVFYYVLSGGSHPFGDKYTREFQIINGKKDFKGLKENMKDKS
FT                   LVYEAVNILNQLLNHDPSNRPSAEVVLRHPFFWSKAKKLDFLLKVSDRLEIETRDPPSE
FT                   LLTKLENRSRRIIPHHDWCKYLDPEFFENLMKYRKYQKEKVVDLLRAIRNVYHHYNDLP
FT                   EHIREKMGSIPNGFYDYFSEKYPHLLMEVHFLINKTIKNENLFEEFF"
FT   CDS_pept        join(complement(321323..321432),complement(321019..321214))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438898"
FT                   /locus_tag="CAGL0F03261g"
FT                   /product="Similar to uniprot|P89114 Saccharomyces
FT                   cerevisiae YHR079ca SAE3"
FT                   /protein_id="CAR58021.1"
FT                   /db_xref="HOGENOM:HBG512048"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniParc:UPI00017BD7B5"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ7"
FT                   /transl_table=1
FT                   /translation="MMTDIEGQIRELKAHLVELQLQRKYLDEKFIQLFKSAYQNSVDKE
FT                   PDMESPVKIIAKHIKSLKTYNELRDVGLKLAQCVADEKNVSIGQIFEEIGISMKDE"
FT   CDS_pept        complement(321809..325801)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196047"
FT                   /locus_tag="CAGL0F03267g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59036.1"
FT                   /db_xref="HOGENOM:HBG253191"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI00003B6361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI2"
FT                   /transl_table=1
FT                   /translation="MTGLTKLLHLDKKKQKRKSSASASASASPTSKPDVSPRKIHTPEP
FT                   VPHAHRPTVVLPDVSSLKSTPMHKTRSNSTYNSNGNNSHGLDPAEPGFLNIPIFMDITN
FT                   VSDQETHAGDKAPSAAGDAKLVRPEIVTQLTSKQGSITPGHTDNQFFDTLVKMAHEASV
FT                   SAGESATSALRNVTNNVAHLALPADAKDSHSQQNSRENSQVNLQEHHQQNQQESHSKSD
FT                   AHSKSDAHSHLSVASHETDDASKHSKRNSREFLKSLDNMLAENGQAAGAVPGNFPNESR
FT                   DLQRAVNEQDQKENVDAAVAPEVTEDGHRVAKVEPLREKELNNSPLANKSRQQTTDNGK
FT                   SKSCFVEAMFNTPNIDPAAKAKEEHMKSHRAQTEVNRSTGDISIDSRGALRAATTSSPR
FT                   RHSSSISSEKNNGHSNHSPHYHSPLHDSGAEIEQRHSIDVPSNAGGGDHRSRSLSKTIL
FT                   GRRSFSPNSMGMNSLPSSAIRYSISKVKNAIDITDSSSGKPRSSFADSIKSSSSTGTNP
FT                   DGTRVDLDTESNQGPIKLKNMKYASDRKNKEFHSMFKNSNINPEEKLISEQSCALSRDI
FT                   LLQGKLFIAEEHLCFYSNILGWTSTVVIAYKDIDQIEKKTTAGIFHNAIAIDTPDAKYL
FT                   FASFLSRDSTFDLLTDIWNQIVIGMRLREKGNKGSMSDDSDSDYDDSMSESELSDGEMD
FT                   STANNDQQTEQTELDSTPSGTIDKPKKSKSKTKSGSSSFGPEQHEPTTADYQPASGEKM
FT                   INKTIIKAPMGKVAHILFGDDTSYLVSILKAQKNYDISAIPKILETKKRDYQYTKPISG
FT                   SIGPSKTKCIISETLETYDLDSSIKMVQMTKNPDVPSGNSFVVKTTFLLNWAADNSTEF
FT                   RVYVGVEWTGKSWIKGAIEKGTFDGVTDTTKTMVNEINKYLPKLTSSNAEEESEPSEGE
FT                   EEEVEEVIEILDLPHQGPLVHEATKANVEKTKDDVVIEQNVKLPAPLGTCFELVFGKDT
FT                   SYIKRITENQNNFDLSEIPGFSNNKREFTYTKRLNNSIGPKQTKCLITETIEHMDINNY
FT                   IMVKQVTKTPDVPSGNSFAVHSCIYMSWGPGNSTLLTVVSKVVWSGKSFLKGAIEKGSI
FT                   DGQKGSVSILIKELKDIISSAGTTKKKIKSKKSKKSKKAPKATEPAPVVESPEEEATEE
FT                   TQESESSLVSSIMDKLMDFDITSPFGIASVLIILVIVILFFKAIFWRSSIEPRMQFMRP
FT                   GRIIIDGSEYNYVPSFKTLYEMYEDDIRKSIKNKQYYKNNIILESEKTIWDWVNDRGNE
FT                   STHTNNAHASTYDKKKVEELEETIKLTELQLEQMKQLLKKQAHGLL"
FT   CDS_pept        326515..326964
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349223"
FT                   /locus_tag="CAGL0F03289g"
FT                   /product="Similar to uniprot|P38801 Saccharomyces
FT                   cerevisiae YHR081w"
FT                   /protein_id="CAG59037.1"
FT                   /db_xref="HOGENOM:HBG191739"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniParc:UPI00003B6362"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI1"
FT                   /transl_table=1
FT                   /translation="MSEEIKSIRPYIKQLDKRLAELTELVQDYASPLEETLVKETDELK
FT                   RLKTTNNYAYILASLMFSYVKLLSGHDTQHLNEKVMVELQRVRGYIERTKKLENKLKNK
FT                   VSEQELKQETVKSQIRKTLGQPTISKQNFKNKHIKFEESSKVSKK"
FT   CDS_pept        complement(327599..330736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501403"
FT                   /locus_tag="CAGL0F03311g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59038.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058841"
FT                   /db_xref="HOGENOM:HBG203765"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B6363"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUI0"
FT                   /transl_table=1
FT                   /translation="MSLDYEIYKEGGTLNDRYQKIEDLSEGSYGYVSLAKDLKLKRLVA
FT                   VKYIFKLDEDDDNNDCNDADNSRIEELPDGDINKNNEFENNKEKENSSREKKNMMKYKK
FT                   SLISSKIRSRLSNNICLEAMYEVDIQTKIGFHENIVQLYDFFDSYIIMEYCSGGDLYEA
FT                   IKDDLVPKKTKEITHILTQILDAIEFVHNKQIYHRDIKPENILITSLIDWKIKLTDWGL
FT                   ATTDEKSYDRNVGSERYMPPELFESNLDIDERKEPYDCSKVDLWSIGIVFLNVVFYKNP
FT                   FRIADQSDKSFCYFASNREALFDVFSTMTYDFFQVLRYSLTIDPTNRDIQKIRAELKNL
FT                   SQYTLDDNYYNEELDREEEEEEVEDIFDKPQAPPSSAPVSLPTPVSSSKPLPKLQDDFT
FT                   FLQSSPTDVDDGISYDPHEENERDNQFQHDEKPDVIQPKVEDSHGEVKERAKSVPKFRF
FT                   QKRSKKPIKNNNNNFYSVGGSKAIKIEPRRRSKIIKNSRKPLGIPTPNTHINNYMSEYE
FT                   SKRDEFFHTRQFFTPPSVQNRYMEGIFNKGYNNSRYQNKQGNGKHWNNKYFSHHNGQHQ
FT                   NGKSNSRRRPSSAGINYNGNVKNVFPRFVHNSNLNPNSGRRSSVHTVQHSPGTYIPPNA
FT                   RHDIKNNATGHKYSTSHSAVSNGLPYSSHNNHVPDISTVLDSHHETAKVDLGNLTAQAY
FT                   RQHIGRETDHFNMRNGFEMDDHEHDSDDILFSLDENEHDSFVDDMQHLSLSSHTDHPEP
FT                   DSHTSNGFIRNDLPPLTINGIMNSISTRTSTPSSTRSRRSNGGNDLPDLLKSPVLAETP
FT                   LSSIHNGDPRPAINVNGNPLLENIKHPQHMRTYGVKIPSLETPSKQSQERQFKPGVYVP
FT                   PHQRRSFNLGAGTGMNNRAHIINGTNEATLSVTPNSVQYGGAYKNRRGSLPASAFGGYN
FT                   RRYTTGNSAHRPNILQHDIYDRMDNDALEFEDDEPPFQNRNHHRRHNSKRKEVPDMSNT
FT                   SNTPEEKTMFGPYDIYSKTNGQNYPNARKSSVLQEDMVGSLEQYKNYWLMLQQQQD"
FT   CDS_pept        complement(331850..333100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501404"
FT                   /locus_tag="CAGL0F03333g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59039.1"
FT                   /db_xref="HOGENOM:HBG124556"
FT                   /db_xref="HOGENOM:HBG203515"
FT                   /db_xref="InterPro:IPR019622"
FT                   /db_xref="UniParc:UPI00003B6364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH9"
FT                   /transl_table=1
FT                   /translation="MFDTSDNSFVGDHTINSDFNETHISSEQDTQNDLYLGGQGTANGL
FT                   GDATENGDSDPTSKDKNPKLSKELKTIISNANSLLTSLEEEHRHDLAIHLYSSYLLRKL
FT                   LYQAHEKKHFQEVDIFIRTQIREGWASWPNPNTTIDPQLDRVYEDNFMAERRVDVSDEM
FT                   RNEIDAFDKKEYRKISDYSMKHARNMLRMELNSHWQHRLQQAACKTGKTLDVNSIDIPT
FT                   DISNEIMNKLDHFLAGLNTKIAKINKFDVKQSDSEKKLTLIQKDIGQLKSNRHIEFDYH
FT                   DIISRGCEMGIDMRNIYMKSLELYNDIPSKFDKSQFKIPKQILAKYKPAAADPSKDKFN
FT                   EIVSRMKDDYVLFDNLISDKRLTSTSKLPWKKLYKKEKDLLLAKKVFFYVKGYQEEESS
FT                   EDEYSAEDCIVKIPRRH"
FT   tRNA            complement(333388..333459)
FT                   /gene_name="tRNA Gln (CTG)"
FT   CDS_pept        complement(333955..335097)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000023981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438899"
FT                   /locus_tag="CAGL0F03399g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sphingolipid metabolic process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59041.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0006665"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG155463"
FT                   /db_xref="HOGENOM:HBG329706"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR014430"
FT                   /db_xref="UniParc:UPI00003B6366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH7"
FT                   /transl_table=1
FT                   /translation="MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLK
FT                   DHPEEADAVHKALDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVE
FT                   VKLNADNTFDSTTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDF
FT                   YLDQIHRPRHYGKGSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLAL
FT                   FLFGLGIFVWTLIEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPP
FT                   ALFVVLCAPIYKLVFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKY
FT                   HLEHHYKNYQLGFGVTSWFWDKVFGTYLGPDAPLSKMKYE"
FT   CDS_pept        complement(336157..338610)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438900"
FT                   /locus_tag="CAGL0F03421g"
FT                   /product="Similar to uniprot|P50111 Saccharomyces
FT                   cerevisiae YMR273c ZDS1"
FT                   /protein_id="CAG59042.1"
FT                   /db_xref="HOGENOM:HBG123642"
FT                   /db_xref="HOGENOM:HBG203517"
FT                   /db_xref="InterPro:IPR013941"
FT                   /db_xref="UniParc:UPI00003B6367"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH6"
FT                   /transl_table=1
FT                   /translation="MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDMLP
FT                   YNNGYRNSWSTQLEQGDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVE
FT                   NTKKQPGSPKSLTRRGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHP
FT                   NVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPS
FT                   LLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDA
FT                   VTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHS
FT                   TLKRSKYTYHIRTQEDKDPTIPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQ
FT                   VAPENENKKRTDTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWL
FT                   WSSKTSEKVNVTSDKHENEDIVPESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAID
FT                   KKISNIFRRKHHTRRANQENSLAGLKISQLQWRNNDHKEKAVEATNNTEENNGSEKVLA
FT                   EAVEVRTHSSYTPQGNVHVKNEYQTNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQ
FT                   QKSTARPAHSSKFRITEKQTQGQDQGQDQGQAHGSDIGGVSLQPAVNVTSTKNQEIVIQ
FT                   NVTVTATPSQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLP
FT                   ELTYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLY
FT                   MEQKS"
FT   CDS_pept        complement(339175..340113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349224"
FT                   /locus_tag="CAGL0F03443g"
FT                   /product="Similar to uniprot|Q03530 Saccharomyces
FT                   cerevisiae YMR274c RCE1 modulator of RAS2P "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59043.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124558"
FT                   /db_xref="HOGENOM:HBG203518"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI00003B6368"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH5"
FT                   /transl_table=1
FT                   /translation="MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLK
FT                   NVLMVSILNTAIVPLLHSIIVPQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKNLC
FT                   LVMLLYIGPLTDMVLYYISNKESSILSAFREEFMNIWGLRNYIFAPITEELFYTSLLLN
FT                   TYLTLEPRKPKLTTLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIF
FT                   GAFTNFVFLRTGGNLWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWN
FT                   KVYYILLFMGILFFKDGLWRLTSCPEHNLIH"
FT   CDS_pept        complement(340640..343438)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196048"
FT                   /locus_tag="CAGL0F03465g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59044.1"
FT                   /db_xref="HOGENOM:HBG058302"
FT                   /db_xref="HOGENOM:HBG203519"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR007520"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="UniParc:UPI00003B6369"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH4"
FT                   /transl_table=1
FT                   /translation="MSHIGTPTKSGSGIMERERGRKKQQSPALSSPSSWLRSASTSSIR
FT                   RLRREHPASGLNVSHTPLKNLSPVRRPASSSVERRPATVQPFSLTTPNSSASLSRMAAS
FT                   VPPNKPNLLKRNSESRVVDVLPSFEMYNTLHRHIPQGNVDPDRHDFPPTYQEIESQSST
FT                   FGRPNPAVNGDSSQVSYDIDRNQTLLADNDPIDSRALNNLQPLRTEHHNINSTLSGVHS
FT                   RSSVDLINPIQDDLNDAKCVFVDKLYTLPKLSTPVEISIKITKHAPSPNQKPEEESILK
FT                   EYTSGDLVHGYCTIENKSSQPLQFEMFYVTLEAYTSVIDKQKGKRTLKRFLRMVDLSAS
FT                   WSYSSIEVSSGIEIEYGGVDYDNSIIGLNNNRILEPGKKYKKFFMFKLPTQLLDVTCKQ
FT                   EHYAHCLLPPSFGIDKYRNNCKYSVIKVNHVLGCGHLGTKGSPILTYDMVDDHLSINYT
FT                   IDARIVGKDQKTQKLNIMKEKEYNLRVIPFGFSSNLIGERKSMDQLNDLIRLIQERLDA
FT                   LKKVFKRLSKNEAILPGDILGTDISGTIDPSTKLDSEEIINRKMEQLTVKNRMEGAVSL
FT                   PGFTPAYNPMAPRKKEEMVETEINYKLKNKSGSHLTKGLFSGFRAPSPTTPPGTNDKAE
FT                   KSGLILVRAAVPRKGLSYWSPSLLRKTNKFDVKSPDDQTNWLSLLENLPEEEREPLKQL
FT                   DISLTCIQSDNSAAHSPPGIQSVTTDFICVTAKSDNSIPIRFTAEMLMNSEKLQNLKST
FT                   FKTFQGTIKDYEKRFNENYMKLNELYNKENTSQTPRELKFTDFITNQINNDVDSLCNIN
FT                   VNCLVLNDVFKKQMHTLKSNAESSSANSSSPAISHSGSSSKLTKFTEQIIHQWEQTGSS
FT                   QYERNVTVNLEYNPELRETIVPSFESCLCCRFYCVRVTIKFDNHVGSVNLDIPVSVRKI
FT                   EA"
FT   CDS_pept        343997..344335
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438901"
FT                   /gene_name="GON7"
FT                   /locus_tag="CAGL0F03487g"
FT                   /product="Protein GON7"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59045.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058967"
FT                   /db_xref="HOGENOM:HBG395430"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniParc:UPI00003B636A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUH3"
FT                   /transl_table=1
FT                   /translation="MELCAEYVSPDQRRSFVAGPHGTTDGVTTGPSAYVLNAGQVDRDR
FT                   PAEARSVAGKVTYLGQLRNQLTGLQDDINEYLTLRMEAAKSKKLKTADEQRIEKEINTL
FT                   LDGGDDEE"
FT   CDS_pept        345084..346856
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349225"
FT                   /locus_tag="CAGL0F03531g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="mRNA transport"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59047.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG397973"
FT                   /db_xref="HOGENOM:HBG435159"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI00003B636C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH1"
FT                   /transl_table=1
FT                   /translation="MMMAHNVNNINTMAQQQMNDNRVRVSVRGWQKGTVQDLLNFVSKN
FT                   TRISIQDANVEGPLLIGYVNTRDDANRLLKWNGARFAGSSLKFEILDQGGSTSNTVVFL
FT                   RSCLFKRYDAQNKMLNLSALHSDPELVSKGLFSSLSTQSKLFAAMLKLASKEPQLIVES
FT                   VNLSDNQFKDVTAVTTLAQTFPKLKNLCLANNQISKFRSLEIWKNKFRELRELLMTNNP
FT                   IVNENLYRTEMIRLFPKLVILDNVVVRDTAKLDSIYNLPVKIQQFFFESNDLGPSSTDF
FT                   VTNFLNVWDGDRSQLLGLYTPQSQFSISVDSTIPPTTVRDADTAPSFGHYLSQSRNICK
FT                   LSSDKSIKQRLAMGPEAINELFKTIPKTKHHLQDRAHDYSMEALAFPALNGFVITLHGF
FT                   FEETGKPESDKKGNQTNSKHRRYNHGHSAPSSFKLGTKSFDRTWIIIPMNNTVIVASDM
FT                   LTIRAYSCGAWIPDEQITPPVNSNVGQTPPPVNNGQPPVISSVNATPLGVHHMPQQPQQ
FT                   PIQLAPTLQLPPDVQMNMNNIQLELLNKLHLETKLNAEYTYMLAEQSGWNYENAVKSFQ
FT                   SSVNNIPREAFVPF"
FT   CDS_pept        complement(347237..347695)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349496"
FT                   /locus_tag="CAGL0F03553g"
FT                   /product="Similar to uniprot|Q12091 Saccharomyces
FT                   cerevisiae YPL170w"
FT                   /function="heme binding"
FT                   /protein_id="CAG59048.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG265461"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI00003B636D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUH0"
FT                   /transl_table=1
FT                   /translation="MSFLKNLLFGGVKTSEDPTGITDSGSGNAKASQDVNEPIVEGRFT
FT                   PRTLSKFNGHDDEKIFIAIRGKVYDCTAGRQFYGPSGPYSNFAGHDASRGLALNSFEME
FT                   VVPDWDKPMDDLKDLTPQQIDSLNEWEQHFANKYPVVGTLEAEPGVNV"
FT   CDS_pept        complement(348058..350325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501656"
FT                   /locus_tag="CAGL0F03575g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59049.1"
FT                   /db_xref="HOGENOM:HBG058092"
FT                   /db_xref="HOGENOM:HBG203862"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="UniParc:UPI00003B636E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG9"
FT                   /transl_table=1
FT                   /translation="MVGTGRRDYSRLPGDDVEVGSISDGGREAMLPSEPPEYDNISPME
FT                   FKDVEPFSVSFPNKMIQWRDAINMKVIWPVQENVMDPLVEYWRLLSSKVDLCLSKVGNP
FT                   LILSRFIYMLLMSLVAFMIWKSGLFPNNKARGENGKFSDHRILLDYARRSVDLSKLEKD
FT                   WEYLSSMPHSSGTRSDMALSEFIHDTFKNNGISLLEKYQYETLVNYPGSSYLSIKVGEK
FT                   VLNFELTEDNFNPLSPNGEVKDARLVDGGYGTLKELEDLKNGGNLHSNFVLLLKYGNVV
FT                   SEQVLAAQKYGASGILFVSNSWNDNNDIVEKRSVALPQYGLGNPLKPSWDRNPADPNSP
FT                   QARPSIPSIPISNKQGNELLSLINDKSVSVTASLKVDAVIKEEQPIVDIIAKINGNEQA
FT                   DRSIIIMASRNSIDNGAAYPNSGTASLLSLVQLMQELRYKFNWEPLRSIYFISIGGSEF
FT                   NSAGAAELIKEKYQSIIDGVYSIIDISEFNVWDSSKELNIETHPLLFSLFNEEEVKRGY
FT                   NLDVHSVHHYGDWVPYLAAGVPVTVLTSKSLRTKSAPIFTKEDTYSAFKDSFEKAAKEG
FT                   IIHDNLLFLVNLVLQVGDKPLIPLDITEFAKYIFSSLKELNERYDNRLDLMHVMSGMSS
FT                   WMAIGKQWAEGVEAWKVVVIEHDGGFEPTLIYLDRTQWNIQVSNVARYLVSWEGVPGRA
FT                   HYRNLFLGPELWTQLDDDEKSWVLPGLKDLLHNGQIDEANDHLKLIGKVLNDAAVMFAH
FT                   SS"
FT   CDS_pept        join(350747..350763,350897..352244)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501657"
FT                   /locus_tag="CAGL0F03597g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /protein_id="CAG59050.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="HOGENOM:HBG027797"
FT                   /db_xref="HOGENOM:HBG315887"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013234"
FT                   /db_xref="UniParc:UPI00003B636F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG8"
FT                   /transl_table=1
FT                   /translation="MGYNIAMVCDFFYPQLGGVEFHIYHLAQNLLRLGHSVVIITHAYK
FT                   DRAGIRYLTNGLKVYHVPFFVLYRETTFPTIFSTFPVVRNILIREQIQIVHSHGSVSTF
FT                   AHETILHANSMGLKTLFTDHSLYGFDSMGSILVNKLLTFHLTCIDRVICVSNTCKENMV
FT                   MRTDIEPDRVYVIPNAVVSKDFRPRSPQEERLKSNDRITIVVISRLFPNKGADLLVRII
FT                   PIICQEHSDVDFIVAGDGPKFIEVQQMIEKYRLESRVTLLGSVPHEKVRDVMCKGDIYL
FT                   HASLTEAFGTVLVEAASCGLLIVTTMVGGIPEVLPEHMTVFAENTSVSSLIDATMKGIQ
FT                   LIKNKSVDTKQIARDVSVMYDWMDVAKRTVSVYQGIFEDSSPTDKDWVKMVHRYYKRDG
FT                   SWAHLLYVLCCIVSYLMVNILDFCYPREDIDLAIKWPRPQLNDDDGHVEITKKGL"
FT   CDS_pept        complement(352409..354565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501658"
FT                   /locus_tag="CAGL0F03619g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59051.1"
FT                   /db_xref="HOGENOM:HBG124560"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniParc:UPI00003B6370"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG7"
FT                   /transl_table=1
FT                   /translation="MASIGDNVIVNGHSATVKFIGTTDFATGTWYGLELDQPFGKNNGA
FT                   VQGRQYFTTSKSDGNYGLFCRAHQLQLSATQSETHRLKNIIAVLEAKLSQYIEQVRDRE
FT                   ELQAVATKRGEQCRELQDIVEKLTLREQDSLDKTSQLSHQLQLLKVENDRLTKLLSYYE
FT                   QKYSLNAAESEHILSVFDVKEENRRLREEVDKLEKVIKSDNASKESLTRDNLNTSDNDT
FT                   TEIIDQSFESVSNEHIVTRLTIENTELIDLVDQQATEMDKLKRLQTLADEIEVESQKQI
FT                   TELKQELFNSHKHNSEIMEERDLLRQSVLTYEMELKGLKGNAVSDFNNNIIELMNTLYG
FT                   ESNIFDTCLTRLYATVYINRIKENTADDDYKAIVLVLILIKELCQIILLSNNVDKVLVS
FT                   QISDLRVPYRVYNALSSGQVIAFESLNFLMNRMMAISGRCESINLVNAIFKTLKAFSDS
FT                   IEDFDLKYQIDQDFDNLDLALEGQTSLSLSWKDVGMIFKEFDAYLARKCSLPTITEKFL
FT                   HMLITVNNSNSSKNTPITIMHNNSDFEEESQSSLGDSKDNSLKQRLLSMEERLEKEQRE
FT                   TKKLLIRNKLLEQKYENINRLESEIKSSKIETRKYLDNISALEDRVTRLQIEKQNLLKT
FT                   VTAYKTQKYQLIPEKMDNNIITKSELLSVKHLEDLNIVINQSRTKKRLLCDLTWLKEHN
FT                   DEPIDKCSMKGYHEALNFVNSIVS"
FT   CDS_pept        complement(354791..356059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176279" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349497"
FT                   /locus_tag="CAGL0F03641g"
FT                   /product="Similarities with uniprot|Q03730 Saccharomyces
FT                   cerevisiae YML018c"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59052.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124561"
FT                   /db_xref="HOGENOM:HBG396812"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI00003B6371"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG6"
FT                   /transl_table=1
FT                   /translation="MPCPKREMCQTEGGGRVLRVVLLCCCAVVRRCLCVFIGVSLEPQR
FT                   SISPREKVWWSPHLFIYNHRQISEIAITATIITTTSIITTTTTTIITTTITTITMSGLA
FT                   YLGVVVVSWVMSSFVTGRVMDVYQKPFLMTYINMSSLVLYLPLYFIWTPSHSPKDCDEE
FT                   SCLMEKHTYGTILQEPATNNNGRLILLTFLFAILWFLANFFTNSSLAYTSVASQTILSS
FT                   TSSFFTMAIGALVGIELFTGRKLLGLFSSFIGVYLVTMSDFQLPSASTGRSFIGDGLAL
FT                   AGALVYGGYTTLFKSRERLVQKYNMNLVFGLIGLFTLCTCWPLYFVYNKYIQQEPLELP
FT                   PTSAIYMLILFNCALSFISNFCWAKAVMTLKSPLVVTTGLTMSIPLAMLSDVLFNSQPF
FT                   SWRYLVGAFYIVQGFIIIDGFSK"
FT   CDS_pept        356462..357349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439967"
FT                   /locus_tag="CAGL0F03663g"
FT                   /product="Similar to uniprot|P36534 Saccharomyces
FT                   cerevisiae YPL173w MRPL40"
FT                   /protein_id="CAG59053.1"
FT                   /db_xref="HOGENOM:HBG058089"
FT                   /db_xref="HOGENOM:HBG203864"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="UniParc:UPI00003B6372"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG5"
FT                   /transl_table=1
FT                   /translation="MPRYDHLSKAGSRFLKHLENVPKRGQRRAEQFMNKALPEFVRPNN
FT                   RTVPEEQRFADETHWKFVPGDRVVITHGKYKGTVAVIKDLEVATNSFILDGNGPSRKVP
FT                   VAKQYWLENQSTHMLSLPVSLKRKHLKLLADIDDPANPGQTKTVAVKDVTFDAGTYYDK
FT                   DRKKVMPYRCVVGRPDLVVPWPTPEPKPDGVLGTEPKLARQQTFWVDTIVRNSIPKNAF
FT                   LTLRNPHSKYKKKLLTAKDIAKLVAPKMPLSDTKKKFLEEKEMLAKREKPQLTEADIEL
FT                   IGSRVKEFLETAKQ"
FT   CDS_pept        complement(357731..359086)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439968"
FT                   /gene_name="COX10"
FT                   /locus_tag="CAGL0F03685g"
FT                   /product="Protoheme IX farnesyltransferase, mitochondrial "
FT                   /EC_number="2.5.1.-"
FT                   /function="protoheme IX farnesyltransferase activity "
FT                   /biological_process="heme O biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAG59054.1"
FT                   /db_xref="GO:0008495"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0048034"
FT                   /db_xref="HOGENOM:HBG058088"
FT                   /db_xref="HOGENOM:HBG397306"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR016315"
FT                   /db_xref="UniParc:UPI00003B6373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUG4"
FT                   /transl_table=1
FT                   /translation="MLVRTLYISSSVGSSNMLCNHGLKVIGKYSAIHEATRKIIVRSYS
FT                   KETIKKHNKQAILNTAPIEFIANNSPLVGISDVNTIKEAAKRTLRCTDDVTDDQTDEIH
FT                   PHLPFNVKPVDGKARAALKKEKNSMSLDIKKTMEAYVQLTKPRLTILVMLSAICSYALS
FT                   PYPATVTELLCLTVGTTMCSGAANAINMGREPDYDRQMIRTQARPVVRGAVTPKQAFSF
FT                   AFGMGTLGTSILYLGVNPTVAALGLSNIALYSWIYTSLKRKHIINTWVGALVGAIPPLM
FT                   GWAAASPLTHPGSWCLAGLLYAWQFPHFNTLSHNIRNEYKNAGYVMTAWKNPLLNARVA
FT                   LRYSLLMFPLCFGLSYFNITDWYYQIDSGLVNAWLCLWSFKFYMQQRLNYSSKIKNDRV
FT                   KFNEGLATANVYARKAFFASVLHLPAVLILAILHKKNRWDWLFEDSENPKLK"
FT   CDS_pept        complement(359839..361665)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349498"
FT                   /locus_tag="CAGL0F03707g"
FT                   /product="Similar to uniprot|Q08732 Saccharomyces
FT                   cerevisiae YOR267c HRK1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59055.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124562"
FT                   /db_xref="HOGENOM:HBG396713"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B6374"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG3"
FT                   /transl_table=1
FT                   /translation="MPNILTRNPFHHHHNHNHSGSNIDNYANGVNGSTQDANDTSSMFS
FT                   EATGTASTIDNDNGKRRKPFLNFMNVGSSNVGQTTSNDSDTQSSVLELKRFLRPSLLHN
FT                   DTNRSGFFSGSKKKEIKRPMSPGSPVSPPKHDYIHNDTRNAIHTQTAIPPSTDSVLSLA
FT                   NTSSIYQDDTILAQKYGKLGKTLGSGAGGSVKILKRPTDGATFAVKEFRPKKPTETSKQ
FT                   YAKKCIAEFTIGSTLHHVNVIETMDIFSDAKKQRYFEVMEYCPVDFFAVVMSGKMSRGE
FT                   VNCCLKQLACGVKYLHSMGLAHRDLKLDNCVMTENGILKLIDFGSAVVFRYPFEQEVTL
FT                   ASGIVGSDPYLAPEVLGKISRADGDESEEPHQTIKIDKKTGLSLYDPQAVDVWSIGIIF
FT                   SCMMLKRFPWKAPKESDPNFKLYNMPEDEEHDYDESAKRHERLMRERRERRAAADANDN
FT                   NDKATPPERKNTDQDINANKESDVESVSKKADQNEVKQKDSHEQQPITKNESNSKKEEA
FT                   GEAKHTSPSKRVIHGQYRLLRLLPHASRPIMSRMMKVNPAERATMDDIFNDEWFKSIPM
FT                   CTIKEGQKVLRAHGHHHTVVKDNDGRTETYKV"
FT   CDS_pept        complement(362972..364057)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501659"
FT                   /locus_tag="CAGL0F03729g"
FT                   /product="Similar to uniprot|P25303 Saccharomyces
FT                   cerevisiae YMR214w SCJ1"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG59056.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B6375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUG2"
FT                   /transl_table=1
FT                   /translation="MKLWICLVFFALIQHVLSQDYYAILGLSKDASDKEIKSAYRQLSK
FT                   KYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTYDVHGADAFKNGGQGQRGGGFHDP
FT                   FDMFEQMFGRQGGGFRQTQRSQNYQVRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSGS
FT                   ADGKVKVCPACQGRGVVVQVIRMGPITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRK
FT                   NKPFHFEFPGGIPRNHIDKKSGESDKSPDMESGDIIIEYNESEKENLGYRRRGNNLYRT
FT                   EIITANEAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKNFGD
FT                   LYIDYVVLVPKSQTSPIDDEL"
FT   CDS_pept        complement(364329..365954)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439969"
FT                   /gene_name="CEF1"
FT                   /locus_tag="CAGL0F03751g"
FT                   /product="Pre-mRNA-splicing factor CEF1 "
FT                   /function="DNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG59057.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059206"
FT                   /db_xref="HOGENOM:HBG203489"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00003B6376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUG1"
FT                   /transl_table=1
FT                   /translation="MAPPIYVRGGLWTNIEDQILKAAVQKYGVHQWSKIASLLQKKNAR
FT                   QCEIRWNEYLNPTLNFEEFTKEEDKKLLELVRTLPNQWRTISELMGRPSQQCIERYNIL
FT                   LETELSKTDGEATTSANSAISTSFGFKPNEIHPSAETQKAKPDNDELDEDEREMLSEAR
FT                   ARLLNTQGKKATRKVRERMLEESKRIAQIQKRRELKQAGINTSLKKSKKKYENEIDYNA
FT                   DVVYEIVPPAVLYDVTRENERTQKALQDFERNIAKKGKRKFKDDGEKESSPRKRSRDKR
FT                   PNKEDNKETSMSITSNDSVLLNDMKKPVLNLSAPRADGENLSVSSNNTNDAVLVKKYLT
FT                   ECFSALPTPKNDFEILWEDSDDDDEQEIVSEEDDNSIKVQESEQLYELPMETFDIVDSS
FT                   MIPSIIADPKNEFEEEYNKLIKDARTRAKPTISKEHLQIWDDLNEEIQKDISGRTSLTN
FT                   PEVQISTDTNLDELRAQIQKYQQRISNYDEQLHIIKPLVENNEQICNTIIRSLIPELKS
FT                   KQLKYYTRYYMFMKEQKHIKKRTK"
FT   CDS_pept        366503..368752
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439970"
FT                   /gene_name="EFR3"
FT                   /locus_tag="CAGL0F03773g"
FT                   /product="Protein EFR3"
FT                   /protein_id="CAG59058.1"
FT                   /db_xref="HOGENOM:HBG059205"
FT                   /db_xref="HOGENOM:HBG203488"
FT                   /db_xref="UniParc:UPI00003B6377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUG0"
FT                   /transl_table=1
FT                   /translation="MQLGHIFTPKHQKLVNQCYPSGRAPDKKPKSSETSYLIYYVNSRS
FT                   SKLEKVSNYLIKRTNTDLSRRRVGNVCVTLELMAKIVDHCKENLNVFVKEFLTLMNMVL
FT                   TNNSINNDVTVIELLEITFGTICRNLDGAYYGGDTEFIKMFKSFVDLLFEVVSKRLNND
FT                   DLMLKVCIDISTIIGIASDPQLNYLVPKCVETAIDQLQARYPQFKENSLLEQPSLTKRL
FT                   SKTQTRAQEVLEIPTADNDLCVATLHNYFNTTETDKLNLSIRSLIKKLQSTPNKELLEF
FT                   ISNDIPVQLRYIVVLLLTRQVSNYERNQVSGSQGNPDGALNSLKLISCLLVSKISIVGL
FT                   SVLDIMRKVLAVQLKSKESMPLVHQCRVTIKDLNNKIYYSEQTSDMLYDLVVKIKNVQN
FT                   EVEKRILVDDMKYIVDDISQPVINVDLLTELVPFMKGSVIQLLNITEEHISGGSTLSRL
FT                   FQMVRDIEDRNLQSKAMSIIFDKYKKIILLPGLNYFQMNIKEPEYTYYLYHFNAAKTLG
FT                   VTSYYSETQQKLDNGELFTKEELMKYYKNANNTQFGEKGMQILMSYDNQISNSDLLNDR
FT                   PLSPVFSSKPLSSPMGLISPQAQTNTQLNQPMRFVSDDVHSWKVSRPSIPKVSDLKKAM
FT                   KNGSSTKNKPLRGSQSVKSRVTNITFLLSELRSTTAGDDSHIIDPDEEEVVGIDKMEIA
FT                   RSLSGRGRNSVVVEDVSTNRASFVPATVNEDDEFRDAVEDVEAYSTSRGKIFANY"
FT   CDS_pept        complement(368904..370358)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439971"
FT                   /gene_name="DML1"
FT                   /locus_tag="CAGL0F03795g"
FT                   /product="Protein DML1"
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="protein complex"
FT                   /protein_id="CAG59059.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0043234"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG059204"
FT                   /db_xref="HOGENOM:HBG203487"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR019605"
FT                   /db_xref="UniParc:UPI00003B6378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUF9"
FT                   /transl_table=1
FT                   /translation="MHEVITISVSQRANHLATQFFNCRETLLYDNTKDKVNDPKIFLNP
FT                   TIDRISKTVSYSPRALLWDAKTGNGSLGSYQYSDGSDYYFKNDDDKPSDGDLMQTHPVI
FT                   PKSDYQRALDAGLPEPKLNNSNTKYWSDYARLIYQPSSFNILRDWYHDTDNPNRPDFKS
FT                   LKDRRFDKFIIGEEEFKSNYLVDFFDTNLHHELEQCDTLQGFNIITDIDNGWGGFSSAL
FT                   LVELRNELPKNTYFSWAFHESDPYTVSYTRNTKVQFNKKTAEQISNKIRATTSLSQESD
FT                   LFIPVYSDPEYSNWEIGSLVCPLFDGLNSVLDGTDTEKRRNMQYLSELLQNGDNNRKII
FT                   SSANMIRKDRIIDYLYYSRFPTQSRKSSSAVSEFHVFSKCNISRSNKEMKDNAEIKNVT
FT                   NKQINTYGYKFADTVSDQFKEDSNYKLCLTSDERCRNVFKEYGDFVSKYIKYDDDREDM
FT                   KNSLENTASAYEFGWYDDSDSGDDNY"
FT   CDS_pept        complement(370647..371978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439972"
FT                   /locus_tag="CAGL0F03817g"
FT                   /product="Similar to uniprot|Q03649 Saccharomyces
FT                   cerevisiae YMR210w"
FT                   /function="carboxylesterase activity"
FT                   /protein_id="CAG59060.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG058437"
FT                   /db_xref="HOGENOM:HBG396520"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="UniParc:UPI00003B6379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF8"
FT                   /transl_table=1
FT                   /translation="MVGYYWLNSLEVTQVTPDHAAKINVGGSSTTIPEFIDKNIPELAN
FT                   GATDTLSPLLFNGHLQTAYTALASFESIDQVNYKRIMLKYPDGGVGALDFAMKEPDNKT
FT                   EYVPEGQTPLDALNSHMPGRFYTYMDPNDARLRSNDSKPLLIALHGLTGGSHESYVRSM
FT                   VRTLQNKYDFEACVLNSRGCCNSAITTAQLYNGGWTNDIRHCVKELREMYPNRKFYMIG
FT                   FSLGASILTNYLGEQGDKSDIELAIAFGTPFDLSHSAKCISESRIGSRVYSPKLTQNLL
FT                   RLVKSHEEELTKNEKFRIKYESYAANLKSVTRFDDLFTGPMFGYRDAEDYYQNSSSYKR
FT                   LLGIRTPYIAINSADDPIVGYQALHENMFRANPYTTLIRTSIGGHIAWFKDMKGDRWYT
FT                   EPACKLIADYHSKIVSQDHAINVNINDLPKESIEPVKTTYRDDL"
FT   CDS_pept        372239..373561
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501660"
FT                   /locus_tag="CAGL0F03839g"
FT                   /product="Similar to uniprot|Q03648 Saccharomyces
FT                   cerevisiae YMR209c"
FT                   /protein_id="CAG59061.1"
FT                   /db_xref="HOGENOM:HBG191985"
FT                   /db_xref="HOGENOM:HBG203486"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR016853"
FT                   /db_xref="UniParc:UPI00003B637A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF7"
FT                   /transl_table=1
FT                   /translation="MGDGTATIVVTIAVICMSLLRRYKPFREWVAKAAERSLRVIKNKD
FT                   ELYLTTPELTLHKSRPSASARPFEEYVNALESMKGYLKSSQKITSMVNNRAKELSRKEL
FT                   SQLKDIGYFSKLDYITSATIKNSAVIEDIIKCTLKELALKNHNNVDLKADLELACNKLG
FT                   YKLDSEGNISKLNTIKLLSSATSRSNSVTESLNHLCRDWSDYYKCERDPLTEYIIERIN
FT                   SINIKGKDILIVVPGSGVGNIAYNLSQKFPEAKVDSIELSSYMFICNRYALTSSNDISI
FT                   SPFALYYSGQTSAKNQTRELNVNLSNVSERENLYPYWADFRLYPSTLEKKYDYIIVCTA
FT                   YFIDTAENLFEYFNSIENLSEHCNKDLHWINIGPLKYGTRPKVQLTVEELTKLRKLRNW
FT                   KDLHTQTVLDYDEKLNGYLTDYEGLYQGYYGLTKFHTVCRK"
FT   CDS_pept        complement(373691..374983)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439973"
FT                   /locus_tag="CAGL0F03861g"
FT                   /product="Similar to uniprot|P07277 Saccharomyces
FT                   cerevisiae YMR208w ERG12 mevalonate kinase "
FT                   /function="ATP binding"
FT                   /function="mevalonate kinase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59062.1"
FT                   /db_xref="GO:0004496"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG410874"
FT                   /db_xref="HOGENOM:HBG713457"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B637B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF6"
FT                   /transl_table=1
FT                   /translation="MTVERDLPFLVSAPGKVILFGEHSAVYNEPAVAASVSSLRTYLLV
FT                   SPAGSNAEDSIELSFPDIGFDHVWKRKELEPVLRETALLQAAREDTKNLNEELVGLLNV
FT                   ILEPLKESLHYHAAFCFLYLFCTLCPSATNIKFSVKSTLPIGAGLGSSAAISVSLAMAM
FT                   LRLGGKLVTGESLSGEDKALINEWAFIGEKCIHGTPSGIDNAVATYGNAVLFKRSADGT
FT                   TDFEFLDKFHELKIPMVLTYTRIPRSTKVLVSSVRDLSNKYPKVIQDHVIKAMGELALE
FT                   SVDILNSGIGGNDSNYERLLDLVNINHGLLVAIGVSHPGLEIIRNLSITNSIGATKLTG
FT                   AGGGGCAFTVLNKDVPQTEVDKFKEELSKKHGYLSFTSELGGAGSCMTPTLVAEQYNLV
FT                   APLFENTENNKEELDKTLLPATATNSLFWIH"
FT   CDS_pept        375906..377477
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439974"
FT                   /locus_tag="CAGL0F03883g"
FT                   /product="Similar to uniprot|Q03655 Saccharomyces
FT                   cerevisiae YMR215w GAS3"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG59063.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B637C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF5"
FT                   /transl_table=1
FT                   /translation="MKLSAALLLLAAGQTVNALLPIHIKDYRFIKPASPNSTESENEVF
FT                   YVKGIDYQPGGSSGYDPDSDSDVLSDPEQCARDAFVFQQLGINTIRVYTLNPDINHDKC
FT                   MTILNNAGIYVILDVNGPHYGENLNRADPVGTYNAWYMSRVFRFIDAFKNYPNVLGFFA
FT                   GNEIINDESNYAEIDPQFIRAIQRDMKEYIAKHSNRTIPVGYSAADNVDLRLPTLNYLQ
FT                   CNSLTGGNITKTMQESRSDFFGLNTYEWCSGSSDWKSSGFDKLNSSFSDAVIPVIFSEY
FT                   GCNKNKPRTFDEVSEGLYGGLKAVFSGGLVYEYSEEANEYGLVTIDPEDGSITFKEDFE
FT                   NLKNQLKNSSLPTIKEKDVPKSEIFKCNASLITSEFSDFGVKNFSIPEQSKDTAYVIKW
FT                   GANGTEGQILKNYTAPTTFKYEIKNVDGSVIPATITYPSSNLINELQTSSTMSVSSTSS
FT                   ASVTSSAKSSSVSSSTKKGKSSKSKASKSTSSGNKKARNGAEMISTPGFGTGFAAAVAA
FT                   AVAALL"
FT   CDS_pept        complement(377962..380088)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439975"
FT                   /locus_tag="CAGL0F03905g"
FT                   /product="Similar to uniprot|Q03656 Saccharomyces
FT                   cerevisiae YMR216c SKY1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59064.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B637D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF4"
FT                   /transl_table=1
FT                   /translation="MDSDKGFFHREKVTRSNGKKSNLSLAIQESESRQISGSDAEEAKL
FT                   VPVPGGMMDLSGSSMKSGHSGGASSGADIDLQDVINNGSLNSAINNNGNSSNSNDNGVC
FT                   GSTFPTVTARMYNDGGNGEDEDDDDCSSCDERNEESLKDYKPGGYHPAYKGEHYKEGRY
FT                   VLVRKLGWGHFSTVWLAKDVTTGSHVAMKIVRSDKVYTEAAEDEIKLLQKLTDGQDDQL
FT                   GAKYTLNLLDNFVHTGPNGRHVVMTFEVLGENLLALIKKYEHRGIPLVYVKQISKQILL
FT                   GLDYMHRKCGVIHTDIKPENVLMEIGDVEAIVKMVELLDEQKKNLKRLQRSGSVLDHNQ
FT                   SFEFQRTIGHGANHSQTGMNDYTRSNEGTPLQRIPSRKPRRNTIITGSQPLPSPISSSN
FT                   FNDMKTQLLGTSISNTMLTTNITSTQYPISNTPQRGSSINIHQGPIASSLQSSISNRSI
FT                   KNNLMSHMSESSTSIANDLNGQQQQLAHSLSSFEISNIDETQDMDGNDTNIIQVKIADL
FT                   GNACWYDEHYTNSIQTREYRSPEVLLGAPWGCSADIWSTGCLIFELITGDFLFEPNEGH
FT                   SYTKDDDHIAQIIELLGDFPSYLLNNGRYTRTFFNSRGQLRNISKLKFWPLKDVLREKY
FT                   KFDKEEAQEIADFLLPMLTLDPRKRCDAGGLANHPWLNDTLGMENVSVPERKLYGNGSD
FT                   IPGWYNEVPSHQRH"
FT   CDS_pept        380625..382202
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196318"
FT                   /gene_name="GUA1"
FT                   /locus_tag="CAGL0F03927g"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /function="ATP binding"
FT                   /function="GMP synthase (glutamine-hydrolyzing) activity "
FT                   /biological_process="GMP biosynthetic process"
FT                   /biological_process="glutamine metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59065.1"
FT                   /db_xref="GO:0003922"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006177"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="HOGENOM:HBG049690"
FT                   /db_xref="HOGENOM:HBG391775"
FT                   /db_xref="HSSP:1GPM"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="UniParc:UPI00003B637E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUF3"
FT                   /transl_table=1
FT                   /translation="MSSIEQVNEVFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQ
FT                   KIADLHFKPKGVIMSGGPYSVYAEDAPHVDHAIFDLGVPILGICYGMQELAWINGKQVA
FT                   RGEKREYGPATLNVLDKEDALFKNVDHSTVWMSHGDKLHGLPTGFKVIATSDNSPYCGI
FT                   VHESKQIYGIQFHPEVTHSSNGKTLLKNFAVDLCHAKQNWTMKNFIGTEVQRIRDLVGP
FT                   TAEVIGAVSGGVDSTVASKLMTEAIGDRFHAILVDNGVLRLNEAATVKKTLVDGLGINL
FT                   TVVDAADEFLDNLKGVTDPEKKRKIIGNTFIHVFEREAEKIKPKDGKAIEFLLQGTLYP
FT                   DVIESISFKGPSQTIKTHHNVGGLLENMKLKLIEPLRELFKDEVRELGELLGISHELVW
FT                   RHPFPGPGIAIRVLGEVTREQVEIARKADHIYIEEIRKAGLYDKISQAFACLLPVKSVG
FT                   VMGDQRTYEQVIALRAIETTDFMTADWYPFEHSFLRKVASRIVNEVDGVARVTYDITSK
FT                   PPATVEWE"
FT   CDS_pept        complement(382447..385737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439976"
FT                   /locus_tag="CAGL0F03949g"
FT                   /product="Similar to uniprot|Q03660 Saccharomyces
FT                   cerevisiae YMR218c TRS130"
FT                   /protein_id="CAG59066.1"
FT                   /db_xref="HOGENOM:HBG059210"
FT                   /db_xref="HOGENOM:HBG203490"
FT                   /db_xref="UniParc:UPI00003B637F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF2"
FT                   /transl_table=1
FT                   /translation="MSVESVEMEHWPVCLSYFDPFDVFGAVQSEFSSIFPLDVVRWKTN
FT                   DGSVRTIENLPVKLTVEDDQQQSNIKFEEPYIRLIVVTCISVDEYRTKVRPLLHQWLPT
FT                   VHDSSGPFTMPLILLYANSEVTDTSIFKTMSVMDKLNKDFPDVQALELKSVYKSPAEKT
FT                   EFWLKLSNKLKAFLIEVFQHRIRILESKLTRQFTENEELEIREQLFKIYAEFRRTEDAK
FT                   GQLSMIKNLMDKRIKNVETGKLEVPFEMSLSGKESTKQLLSAKNLTKFTLYRSNFLREL
FT                   MLLQLYDDDISKYTQIYELTKDFIRKIEKEFAADTRLLEFKFDFCKKMLDTIPSTSRSE
FT                   WLPTINEIKADIYLIKRDAWIHGLMINHGYQLLQKNYSNKTLYSFGLDKEAAESEDAFQ
FT                   KSFALQTKELLALYSQCNGKRQRMADILSLEVGLLHYQRKEYTKAVQLLMSCNEYYTES
FT                   KWTVIGVNILEIFVDSLTNCVGIETIDFDGESVPVSTILRNSYLNLIKYYNSTSEKKIF
FT                   WNKFLELKNDDMTELVYPSEDLIDFSVDGNVFLHAPNVYGINVEIKGNGFPDVIDVTQF
FT                   KITMKNSNNEFNEFIERDFLLEMESKSYCLKSKNITFGEFGIESIELCIGSTTIIKAFE
FT                   DTTNKVIIEPLFHENNVWFEIRESNELKLGKYELEIADFNFGHTNDLELYLEVGKSEVT
FT                   QINPVSFDSEIDQATITLDKESLSESKKIKYFFNEQQEQFTLFAKLTYSLQKNPDVIYS
FT                   ISRVIHIDHYLPLSVSVEDIFKKDKFFFKFLLNSSVKEEPVLIFGSELQCFELEHSYEL
FT                   SGPFIPDSPLTITGTGGESCINCFQISTKQTFNNSDIFHLMIKYCTLRDFLKSYVTDAV
FT                   LLEGDVEFFQKYETWKLYWLSNILSELEFDYNLYEKNMILKLNGQSLDIFKVGVRLKYM
FT                   KVDPVVRSKFLSCLKRLSEGIDLTEMEINEYMKVFNVKTLTVPVQLPELERFYEVSFAR
FT                   QDCKRHQTPNKVGEPLAFHIKIKNSSDKWGIQRHDKLAYTFEIINNNDWLVHGRKRMIL
FT                   KDDFEEMDIDLIPLRKGYLTLPQIEITSSVGNPVRVDNSNTYDIVLVF"
FT   CDS_pept        386224..390591
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045102"
FT                   /locus_tag="CAGL0F03971g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59067.1"
FT                   /db_xref="HOGENOM:HBG124563"
FT                   /db_xref="UniParc:UPI00003B6380"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF1"
FT                   /transl_table=1
FT                   /translation="MGDQEEERVPDAGSPSRKLELKVPSRGLGSRMRPLSGTKLRTRHV
FT                   SGRALFGGRYNETPVLNISTLDDHRKSLQYIKSLISKGRQILKSASEDDKKAFTEIREF
FT                   QRRETIRNKIVDKILTTDYDTLTRTTNTENHVAFDSSDVVIPDENDSQNLLEDDGEQGN
FT                   INDGRSGSESEMEMGYHSEDCDDYEGVINDVEGDAPIKKLETQASNESIVILTDDESVV
FT                   NESFEYAEDIQSTEFQSDTDQKKLPSDYEAQSNDGHQHVNNEDNDHNMYDDLFEEEGPS
FT                   FGSNDNRALKVNSERLLEYEDSKHLTDILHDPLSYHFHTENHTDIQNEDDHDNQDISEE
FT                   NMSVSDNGDSDTSQNNIDFKQYMQPRNKSLLNDNVHSSSEQEFDHPSDKYSNVELIIDS
FT                   EDGSDQHVADKFDSDIDDNHEYGELVSDNSNSESATEDDNRIENMEYIDQNRAYSDLED
FT                   GKDFPMASDHQYRTEAIDYEKMSQKEDELKQFLHEMADFQSIANDALNEIQASNNGERI
FT                   ELTKTDEIDSDRNSSNSTNDEDSDNDQTQYHSFIHEYNINSQSASNHTKENLLNYKEAK
FT                   NTSNITVNEELGEENEHKDDIEQDNSTITDNVNTESSFNSDDKKEKDKKLVALLIHDSE
FT                   YSSSSEDELNESENPIVYTSAFSTNPFTLETDSIRDLDFSKYIQSDSGNESNAGDSTEG
FT                   LKIQKPQVYTEFDRTHLFNHNSETASDQSHSQTKCISQEEGNVSHIEHSSSIGNTENLL
FT                   KYSPLYDNSINSGLQIKEDNHSGQDLDLNVEVGVEEESIPENSELHTTSIPEMSSKHFN
FT                   MANELEILNDTELAKQNKPYMSLSPQPLEESNQQEISRSIHIEDFSSLKTSERGQLSAN
FT                   LEINIDSNSPSPVIDQKLDLEGSRSGSNSDIEDNTKFEEVPETQRVENEIDSRYKNSIN
FT                   SDSGVEDFRSISVLSNMELPNNLEDNITSKDTLVIEEFNKSDLFLEKETSNSGDNIKLD
FT                   TVDEKTVSSTNSLKRKREDPDFIMSNEYHDRSPLKLRKLSSTSSSFFSTVKSVFSVAKL
FT                   FFKKMELEELIDITDNTTADEIMTPDQYQTESEVENYLSSDKESRTTSNNDMIKSSDDS
FT                   INNDLNSTDIPSSIEHTEDNKENGNNNVILKQLQILERLSNGISGQYDSIDIDDTQLDD
FT                   IEEEPDLIESDSSIEIPLNPSKLYNLESDTNVVLNDISITDSGITTPFESDIEGETDIS
FT                   GTIANNDINSTFDNGGDQGIEPKVIDQVEGDQPAVTSNITEESIGQSDSTDLNGITENI
FT                   KESGENRGAAGSSEEPEKIVNGENVTNANRKTEELNLKDDINNSSEPIAVRVHREVDSE
FT                   LKYIDHKPEPLDTTAKIEELKEMHSGENNEDTNKIVISSPKQVKKKKRNTKSRTRSKSI
FT                   TNSPKRVNSKRNSRSSKAESNVNPSIGEGTSKSKSNKRTTRSTRRMYTRSQKK"
FT   CDS_pept        390873..392219
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196319"
FT                   /locus_tag="CAGL0F03993g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="CAG59068.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG061846"
FT                   /db_xref="HOGENOM:HBG737076"
FT                   /db_xref="InterPro:IPR005916"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR016005"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6381"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUF0"
FT                   /transl_table=1
FT                   /translation="MKNMERAYSAPGKVLLVGGYLVLDPKYDSYVVAVSSRMHAVVSEE
FT                   KYNETLDGFHIQFTSPQFNNECWNYSVNSQNGYVPVEVSGNRNPFLEKTVLNVLSFIGP
FT                   ASGKTFPNVIKIDIYSDAGYHSQNNSITRSNGLKSFQFHKTGIAQVPKTGLGSSAGLVV
FT                   VCTTALLSCFLNDNPLLDELDLIHNLSQLSHCQAQGKIGSGFDVAAAVYGSIKYRRFQP
FT                   DLISRLPTLSSDNYREYRFEMSKLIKSNWNIKHESIVLPAGLRLVLGDVRGGSETVELV
FT                   KKVKLWYTNNYPRSEEIYNNINEANLSFIDAMLQLQQLQKADNDKYKGLLKAINTGNDQ
FT                   QFKEILHLKAAIAKIRENFRLITQESGADIEPEAQTKLLDACSQLNGVIGGVVPGAGGY
FT                   DAVSIISTEDTNLNENTTSSEFDSVTWLDLKQEAVGLKLENPEYYRDLN"
FT   CDS_pept        complement(392293..393825)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439977"
FT                   /locus_tag="CAGL0F04015g"
FT                   /product="Similar to uniprot|Q04991 Saccharomyces
FT                   cerevisiae YMR221c"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG59069.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054403"
FT                   /db_xref="HOGENOM:HBG326531"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B6382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUE9"
FT                   /transl_table=1
FT                   /translation="MTANKIKIAQVVCACIWCLFSAGIIFGFAALKPVLLQEGIYSDLC
FT                   LKQDDLEVPEPCTKQDLKLNSMFAISAAVTNMMALPIGNILDNYGPRVTGIIGAGVLLS
FT                   AAFCFIGSNSLQRLFDPYMTGYILLAMGGPFVFISSFQLANTFPKRSGSILALLTGAFD
FT                   SSSALFLFYRLFYQNITAVSLKRFFTIYLCVPVFIFLCQLTIMPSQSYKSVAAMTKMAV
FT                   EHLDEEGQLLSGDDGSTLITDPNDRRALLIESEHEIEQNMTDASEIRRKSVLEVYVEHN
FT                   LQEKSGGVFGILHHYSLREQLKSLWFLLILIFSIVTMLRINYFIATIRSQEEYLLGDIE
FT                   DAAKLNGIFDLLLPLGGVVSIPFIGYLLDSLDSLSTLSIVCAMSLFISMVGLLKSSYWL
FT                   HLIGIIVFVVFRPFYYTVVSDITSKVFGFDNFGTVYGLMICICGICNIGQKWLDELTHT
FT                   YFNMDPTPVNMALFIATLISCFSMLCYVYKQTENRGPEDNECQEQLLPSDGQ"
FT   CDS_pept        406151..407998
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501661"
FT                   /locus_tag="CAGL0F04081g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59072.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124566"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI00003B6385"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUE6"
FT                   /transl_table=1
FT                   /translation="MEGIRLTSYQPDNNSQLQHNSGPQIRMQQMPNTNQLLGRPEYESV
FT                   RVANNYNENVSFGQMGRSGAPDNYSQPGLIPAGNNRWLPSVNVAPLPAQAMYMPGQVPR
FT                   YSDPFGPTYFPYMYGHDKWPYRVESAFTSALRLIIKNGTSKIKIKNKNYGRNELISIYI
FT                   KYHTGETRTKKQISSHIQVWKKSILNKLSTNVRLTPLDKEILELIERGPNQTEDALRLF
FT                   YSVFEKIIEACPKEDIEENPNVLSTSNVVKKDQYYQSEDRNVSSGQEINSPQRSVNNSN
FT                   SCTPPKSNLDIKNMANSEPMSALSKNRTRSPYAHSSEYSGNDVGIEGDSKVASISYVSP
FT                   GYMKAVQDNSAWSSNNTISPPGTTSNSVFSSTPTDSTTSVSINNRVAAHTQKVERDFID
FT                   AYDNHLPSSRDLRKGAEPFIAALRDDLGRGAVYTTYADNSMIQQAPAYTVISPQIGYQQ
FT                   QTNVAVSQPFDHQPDYNRSNTLPAYKGVPYDNLSQRVVSTSYPPVSNQYPQTSAYATAT
FT                   QQQPQQIGQHANLTQGQFYSAPLQYTERKIQPNNGFGMNNTTENRQLNPYGAGYNGASY
FT                   PINSLKQEDVPANRLSISHQGSYPTSSLNAVLNKNNSGN"
FT   CDS_pept        410151..410486
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349499"
FT                   /locus_tag="CAGL0F04103g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59073.1"
FT                   /db_xref="HOGENOM:HBG059120"
FT                   /db_xref="HOGENOM:HBG396711"
FT                   /db_xref="InterPro:IPR019434"
FT                   /db_xref="UniParc:UPI00003B6386"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUE5"
FT                   /transl_table=1
FT                   /translation="MAKSLRASSHLNAKSVKRQAVFQKIVDARESRIAEKLKNELIQQK
FT                   LKELREKEGEDAIIDEDAIIAEIENKPKKDAAEKVSTSGWRDARHHLYKKAKKIKKSKK
FT                   KGSFTRF"
FT   CDS_pept        complement(411161..412378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439978"
FT                   /locus_tag="CAGL0F04125g"
FT                   /product="Similarities with uniprot|P38201 Saccharomyces
FT                   cerevisiae YBL029w"
FT                   /protein_id="CAG59074.1"
FT                   /db_xref="HOGENOM:HBG124567"
FT                   /db_xref="UniParc:UPI00003B6387"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUE4"
FT                   /transl_table=1
FT                   /translation="MFTSDLYSFDINLDVTSGQDNDVSITFSAPSADSNDLLAVPFFSN
FT                   QENAKNIESVLDEFQARDLNLKFGSAMADISSFNNNDNSISKNMLNRSTTNSSGSTKVQ
FT                   DISPESLSGNDSPLTPLAKSNLFNFNWSDELLNGSGVIQNEINEITSNTETINCATLTS
FT                   TEFLNNFLKNDLKLHGEGIFRLNTPITPPLDDAQGFVQSTENILLNDTDIFEDVTADSS
FT                   SFSSLLNNAKFNNTIPTSNLDFLRNDSPMNTTSILLENLQESPEQRHERRKPVKRDSVV
FT                   DFSDSSSSDQGKPKKCSDARLSAVGLAKKLNLSSPQEALEREKYILSIFQNELHYPLGY
FT                   KTWIRDTDKETRKQLIEQLHDIVRVKYPEYDKNILETIIRRATYSMMQSRLRRERRAKT
FT                   KGKTTI"
FT   CDS_pept        417993..418265
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501662"
FT                   /locus_tag="CAGL0F04191g"
FT                   /product="Similar to uniprot|Q3E756 Saccharomyces
FT                   cerevisiae YBL029C-A"
FT                   /protein_id="CAG59077.1"
FT                   /db_xref="HOGENOM:HBG059122"
FT                   /db_xref="HOGENOM:HBG398333"
FT                   /db_xref="UniParc:UPI00003B638A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUE1"
FT                   /transl_table=1
FT                   /translation="MFLFIPLVCGLNSWDKPYTKVQTAPLYCPHCHNYSVQPVKRRQFF
FT                   SVWFIPLVPLHVGKQLHCNICNWRQDFHSKEQLEKVIAEQGNIKA"
FT   CDS_pept        419473..420393
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439979"
FT                   /locus_tag="CAGL0F04213g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="binding"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG59078.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG610399"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B638B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUE0"
FT                   /transl_table=1
FT                   /translation="MSETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEM
FT                   IKQGSLDHRYKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFG
FT                   FKKEEGYAKWFAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVD
FT                   VYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLG
FT                   WVVTTGASTASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANIL
FT                   RGVAGAGVISLYDQLQMILFGKKFK"
FT   CDS_pept        complement(421104..421952)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439980"
FT                   /gene_name="SHE1"
FT                   /locus_tag="CAGL0F04235g"
FT                   /product="Mitotic spindle-associated protein SHE1 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spindle"
FT                   /protein_id="CAG59079.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124570"
FT                   /db_xref="UniParc:UPI00003B638C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUD9"
FT                   /transl_table=1
FT                   /translation="MNENDSNEIIEQLGISKRLGNSILDELNQRASETNPLLRKHEDTD
FT                   NEEERPAESTPTAHNLVFNKVHNLNFENLTDKDPDFTIHNDPLHKKKYKYSPIKRVPEV
FT                   NEITKKIRRLKLRSSSNLSSSGGSPEKRTTNASNVEQKTELAPLKTPNFLRPTFNSMNR
FT                   AKDTSHKVESSRRTYGNLLPPTSRAIPAVKEAVRQDYTKRSISIQLPRKSPAPPKIPEQ
FT                   RSISDSSSNVFERLYKQTTMSRSNSMAFDQQNRKQLPKSRTITGLSSVVGDKHRTFPSK
FT                   H"
FT   CDS_pept        complement(422678..423727)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196320"
FT                   /locus_tag="CAGL0F04257g"
FT                   /product="Similar to uniprot|P38199 Saccharomyces
FT                   cerevisiae YBL032w"
FT                   /function="RNA binding"
FT                   /protein_id="CAG59080.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG159228"
FT                   /db_xref="HOGENOM:HBG204258"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00003B638D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD8"
FT                   /transl_table=1
FT                   /translation="MPVSHRILLSLKEAAKVIGTQGNSIQSVRDNNNNVKIGISEKVPG
FT                   CSDRVLTCSGEVEDVCSALGDVVTLLNKPSENEEETDNHHFYFLNHLLPVPTLDDLKAT
FT                   DPEASEEALHEQLQNIGYLRLLVFNSQLSSIIGKGGNQIKSLIEKHGVKLVASRAFLPD
FT                   STERMLEIQGVPSAIKQVLLDICEIIAKEEEEEEKARAENNNGESTGRKRFERKYYPHL
FT                   QRNNTNSSSNNGSVGNSANSQEYTATVMIPESYVGALAGKKGNRLANLRKFTKTKILME
FT                   SRPNDLDNEHEDENDMEEDDGRLRKFTIIGSSSRSVNLAESMLQRNLATEIERRKERLR
FT                   NLSENNESA"
FT   CDS_pept        424682..425569
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115443" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439981"
FT                   /locus_tag="CAGL0F04279g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="CAG59081.1"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG364806"
FT                   /db_xref="HOGENOM:HBG735778"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="UniParc:UPI00003B638E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD7"
FT                   /transl_table=1
FT                   /translation="MSLPVVQCIARARIPTTHGPDIFLHLYTNDRDNKEHLAIVFGEDI
FT                   RSRTLFRQYPGETQQDRMVRGAYVGKLYPGRTVADVDERLGFRLEFDAEGNLLTNSATT
FT                   WSEENDTLVRIHSECYTGETAWSARCDCGEQFDRAGKLISLDEEPETHIKGGCGHGVIV
FT                   YLRQEGRGIGLSEKLKAYNLQDLGADTVQANLMLKHPADARDFGIGRAILIDLGIKNVR
FT                   LLTNNPDKIQQVSYKDQLRCVERVPMIPIHWTDESKGIDSKEIEGYLRTKIERMGHLLQ
FT                   KPLNLHTPQEQETI"
FT   CDS_pept        426122..430573
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439982"
FT                   /locus_tag="CAGL0F04301g"
FT                   /product="Similar to uniprot|P38198 Saccharomyces
FT                   cerevisiae YBL034c STU1"
FT                   /function="binding"
FT                   /protein_id="CAG59082.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058535"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B638F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD6"
FT                   /transl_table=1
FT                   /translation="MPLNTGINADELPTLFAKYNELSTEDKLELLTSFKGHVKKELVDA
FT                   SAIELYFRVLLDTDTEIPESDAVDENSSKLSQLKHSSLCYLIKRVTMQAPSIFHDSNMV
FT                   NRIILYLLLHAPSDTAPQSLERKKFWVPSIKAIESVYQISSSQVIKCLSGALEEIPSDG
FT                   SISNEKKWQNYRNIVSATIEITKDSGSSALKDFLPVIARTLHQDDANESLSKEIQITTE
FT                   LVADLWITEVKKPSIPIQTVDFKDFRVRQYFQTLIDKKKSDANTPDSIKSLDSKDTSFN
FT                   AIFDVESELSALINESIPPNFNDSYANANRAHSSVIIYETQSHFRADFEKLLIPFRDSK
FT                   ETEQNWKSRQTNVYQFRALIAANNNEESILKRDPDGVIETLKDIQFIEMISKAVHSLRT
FT                   TLSFASCLLLRDVLNAFSSSLSNYMIESIFNVFKTLLSSTKKISSQIAFHCIVILLSNL
FT                   TSFNNKQFQNSFVLINSKHIFSRQSSCLFLRVFIIKFANDSKFDSNTVYIEEWLKKGLT
FT                   DPQTSVRETMRLTFWYYYKCYEKSAKRVMSNGITPQLKKAIELAIPPHLNVNYHQHTSL
FT                   SSSSSTNSSRRSSLVGQRRFPSYAQPTQSSTHLRNQSTSTASNMRSASAISTRDSVLNK
FT                   NSVSGYQNTTNIRKISTPLPTSNAKFVADSSTHTINLDGSFSQKVHNGIDIDLSEEIRS
FT                   LESHTNKKKHMGNALQDHDNNQKSAHDCDGSSTDNQILLRLRRLADKYNNNSNLTAEEM
FT                   NSFLIEFLEYASKNSPKSDAIDKFIKPLRGIMIALPSQTKKLMRSDWFMRNFKLTYLIE
FT                   LCAINETSISSLMEAKSDILSLLKCCTEILNNLEISNADEGKNDENSIGGLTTLSLYYL
FT                   KFRRIFYNYCFSVVKEIIAGKKLQIGSSTPIIQNLIEVFCKINGKDYDSSLYYDVLYSI
FT                   YKFDRGIFIAHLKEMPLFPTVFKVCNELKERHSDFVFNEILEEAESQVNGITKEISVGA
FT                   QSNKEDEYKQYMEMTMVNPFAKKQDERIPSTGSVVHNPDMVTAFGDNSTVENSNDKKRP
FT                   YSDDTENISLGNDTMRLTEMTKIVFPSLQATKKMKTPSSEEKINKSIEISDLFQDKEAT
FT                   EKPEKLLSDNANSSIASNNTIATVNDSPSVEVKVEELKKSPTNTININYEKDGDSRDIP
FT                   IVSLGSESLNSQLTEIKDDLTDSVSEIDLKPDMLQMSVTCSPAILLEYYALLFKSEGAG
FT                   KDCDADLSRLKKSLQRIKTKGFTIKHIDQIIKPLLFLESNEPLKVWLEDGGGYQDLLDL
FT                   VAMILQSLGESDQLPLKLIGKSMALLFSLIAFIPLLKDSASLRSMSLQTIWENIVTIVG
FT                   NLNVQESEIYGYFAEVRNQLVKQGFFDSKSITRMLNILMVEIDDEKVTKKIFLIETMKE
FT                   IIRSKPPWTDKTYRLMEIVQTLAYLIESKTSTVRKACFECLILIFQLSNGKSKSFKQEV
FT                   VELFQCIPDNVNKLIEHYCSFI"
FT   CDS_pept        430854..432839
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248502" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439983"
FT                   /locus_tag="CAGL0F04323g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAG59083.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG058534"
FT                   /db_xref="HOGENOM:HBG395852"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR013627"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniParc:UPI00003B6390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD5"
FT                   /transl_table=1
FT                   /translation="MTVDGELITQFGPEAREASIASILESLMKLHSLDVEELYIRWEQF
FT                   SYQRHEKQTDLNLKNLDSFKEFLQQQIEKKALQVSSASRKTGPMKKNKVVRGSTNNSAF
FT                   GFSIPNTPTIKKRKLQVSSSTKKENGHENSLHFSEGTSVERTQQLGSSPLLNSDANRDV
FT                   GVSTPIKLRESGKILDSLNPENIEIAGGIDPNVETATKVSIAPYFDAKKYKFRTMRQKI
FT                   QDAADVLDEQIEAFHELIKGHYKLSTTDFADPTVQSQSEIYAIGRVVPDSALSEGFPNI
FT                   DAIALETSRNQGIGRRIRLDLEHVSETSLFLGQIVAIKGKNATGEYFKVEEVLSLPYPD
FT                   SPVSTANEIQEVQLSMDNAPMKAVITAGPYTADDKWDFSILSDFVDRINSDIKPHTIVM
FT                   FGPFLDITQSCIKEANIPQFPNMKTQPKTLDEVFYKVVVPILKRIDSNIQVVLLPSTRD
FT                   VLSRHAAYPQDSFDRKMLQLPRNFKCFPNPSTFQLNEVFVGCSNVDIYKDMKEITKGGS
FT                   TSMRNRFDRVSEHVLQQRRYYPVFPGGLKKSLKFKDKTGKNIYEHISGADLDVPYLPLT
FT                   EFVGGFAPDIIVIPSELQHFARVVRNVVFINPGRFVLAKGVNGTFVQLTVNCPDIESGD
FT                   LTRIEDDEPTFLHNVWKRSRVDILTS"
FT   CDS_pept        complement(432980..435769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439984"
FT                   /locus_tag="CAGL0F04345g"
FT                   /product="Similar to uniprot|P38250 Saccharomyces
FT                   cerevisiae YBR086c"
FT                   /protein_id="CAG59084.1"
FT                   /db_xref="HOGENOM:HBG124572"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI00003B6391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD4"
FT                   /transl_table=1
FT                   /translation="MVESLEQLDPNCVIVFQNTEQNVTQLVSELNLKGMPVVTRPGSDK
FT                   TSLFAFTRIDPTRYEDIHSCFHNLKATIPSIINIFPIYDNETTKRVDTLYKKNVKGQYL
FT                   SLPMDADLIELFNLTGDAEQALYFSFFRHYIKWLLPMAFFGLFVRYTSGNNPWEFNPYY
FT                   SGALLIWSITFSAFWIFKKKPYYNKIFIKSQTFSTLFSKQSTNFETPSNLLLKKIAFAP
FT                   IAVVFALTLITCQLTCFAIEIFFTQLYAGPLASVTSLIPTVLLAVLTNIINMLYNKFFV
FT                   ERFIAWENGPNPKRSKMEKNFVLLFFVNYTPLLITLFLYLPFGYKFNSTIKTSVVSWAN
FT                   SHHLQTRNDDFKINTTRYKNQIFYFMVTNQIVAFALDNIVPTIIGKVMPIVQSKVAEKN
FT                   EKRSSIANIDIVREEYPAELKRWKKVGSYSTGPWGEFDVDENYRKVIIQFGFVAMFSVL
FT                   WPLAPSLSVFFNVLTYKADMWRALKKCKPKYLPILSEYLEEEEDAEKELSTDSWNVLLE
FT                   IITWLSVIVGPTITYMYINCNIPGVGKETVLEKRDLWYASSPFSFSWTSLLLFSIFIEH
FT                   VSIVGYIFISSFLQSTEAPHFRGFVPPAKSPREVKTMHKGSIDLSEVIEQTKTFKAMAD
FT                   VTPEPNESLPVPNVTDVFQSKNSDAKDKSVSPGVTDEIKDTTLNSIPTPSKQSTMKRDN
FT                   ESPATFSGSTSTNVPAIDDDSVAGATLPDTIPTSKNYDSRTNKTPSNTNKTSNMTPANG
FT                   IAHDKNSMSINEKVKQSESSNSTMPQKENIDPTMVKSSNISGNLHSDVPLAAAAASTAL
FT                   YNVPVHANNDETERQAKTSLNANGIRHISSHRSLQPPAATQQFGRDYQPAAKPITPASR
FT                   RYSRPDSRISNSGQNSMTSSNMSEAYSSDRAGVNRQSSTSNSSHKKKKGLLHKLKKKL"
FT   CDS_pept        436654..437451
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045103"
FT                   /locus_tag="CAGL0F04367g"
FT                   /product="Similar to uniprot|P38197 Saccharomyces
FT                   cerevisiae YBL036c"
FT                   /protein_id="CAG59085.1"
FT                   /db_xref="HOGENOM:HBG001447"
FT                   /db_xref="HOGENOM:HBG289671"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI00003B6392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD3"
FT                   /transl_table=1
FT                   /translation="MSLRRALYTVMSGVAKREVAYDSVRQKQLVSQFLEVENRVQSEVN
FT                   GSKSVLLLAVSKLKPASDVQILYDHGVRDFGENYVQELIEKAELLPTDIRWHFIGGLQT
FT                   NKCKDLAKVPNLFSVETVDSLKKAKKLNEARGKYQPDANAISCNIQINTSQEDQKSGLV
FT                   DEDEVYEIVKFFLSEDAKFVKLNGLMTIGSWEVSHEEGEENKDFSKLVEWKSKIDSKFG
FT                   TDLKLSMGMSADFKQAIRQGTSEVRIGTDIFGTRPPKNEARIL"
FT   CDS_pept        complement(437622..440642)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501663"
FT                   /locus_tag="CAGL0F04389g"
FT                   /product="Similar to uniprot|P38065 Saccharomyces
FT                   cerevisiae YBL037w APL3"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAG59086.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG204256"
FT                   /db_xref="HOGENOM:HBG354594"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI00003B6393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD2"
FT                   /transl_table=1
FT                   /translation="MDRKKTFVGTSNNGSSSIKGLQLFIADLRSAPHLQDQERRIQSEI
FT                   TKIKQNFDTQHQKQSKGQDKQGGYQRKKYIAKLAYIYITSNTSKLNDIIFGLDQTMELI
FT                   QSSVYSEKFIAYMTIELLYEHKTVMDKINDALQYQILLDLRSNDENFVSLALNCVGIVG
FT                   SLSKTLSNDEDIVAEVFQILRSPTSSMNLKKKSSLAFLTLLKKNNAILTNEPQRKQIWI
FT                   QRILSLLDNRDNYRLTLASLPLIEYIAVHVDPAACTRLVPQLTQTLYSCLMNESSSNID
FT                   NPQLDFRFANMPNPWIITKTVSLLNMLIISSNEKSSAQNDHLLHTSTMNKEILNTLRTC
FT                   ISQAIQLGERSFSDPMERIVQNTILFSLINFAPKLDPSDDAITDSVTALCKLLSSSQIN
FT                   IRYLALDSLIKLCSVLGTSAMNAVRLQNLDMISQLLYDERDASIIRKLADLLYIFTDSS
FT                   NVKKTVDDLLQYITSSKQLADPNLKSDIAVKIAVLSEKYATDSNWFVTVSLKLLSFTSL
FT                   TSINDDEIWQRLCQIVVNNPALQRTACEQLLYYFKNSQTSEPLIKTGAFLFGEFIDQIT
FT                   DLISVADLFNIFTTKYFTVTNFTKAMILTTVMKLYRCSDSIYTGAVKIYQMELSSLDIE
FT                   LQSRSYEYLNILRIARMENNPNLINILFHPIPPFNSSTNPLLKRLGLLQTSDNDLTIEA
FT                   LTSNPSSKDSSNPFTQPTSTDTSVTENGKNMVTQEELYNSQILAASWRDGFSRMLSFKR
FT                   GILFSSSLLKILYRLDYPSPEEPYQQKISLTFINESEWDMTNFSTNIIPFRTDSNPEYV
FT                   VQEISLLSALDIAPRRRTEQTLDIIIRRQFNAEYSPIISIFFKCGASTNTINLKLGVGL
FT                   NSTLRTTEAPKQQLTLAQFFSRWKALGDALGTEGECIITKLRLKSIKNISHSQEESILQ
FT                   VSLILKRMGFDIVEQSNLPNSLFFAGIIHTKTDGNYGCLIRVSCEDEEYFTLTCRATIG
FT                   SGLATNIASCIKLAAFA"
FT   CDS_pept        complement(441222..441860)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045104"
FT                   /locus_tag="CAGL0F04411g"
FT                   /product="Similar to uniprot|P38064 Saccharomyces
FT                   cerevisiae YBL038w MRPL16"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59087.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG286097"
FT                   /db_xref="HOGENOM:HBG341023"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniParc:UPI00003B6394"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUD1"
FT                   /transl_table=1
FT                   /translation="MLRTVSRFMPLRFGVRYSHEYAPRYKEQQKKQKGRVPVRTGGSVK
FT                   GSTLQFGQYGIRLKSEGVRLTAEQLKEADNAIMRYVRPLNNGQLWRRLCTNIAVCIKGN
FT                   ETRMGKGKGAFDHWMVRVPTGKILFEMAGDNLHERVAREAFRKAGTKLPGVYEFVSRKS
FT                   LTRVGLHSFKNPEHDPKVDHFKEQEQKPTKKYLNVLKSQEPEYKLYRGR"
FT   CDS_pept        442206..443942
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439985"
FT                   /gene_name="URA7"
FT                   /locus_tag="CAGL0F04433g"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /function="ATP binding"
FT                   /function="CTP synthase activity"
FT                   /biological_process="glutamine metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="CAG59088.1"
FT                   /db_xref="GO:0003883"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="HOGENOM:HBG523338"
FT                   /db_xref="HOGENOM:HBG597806"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI00003B6395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUD0"
FT                   /transl_table=1
FT                   /translation="MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMNI
FT                   DAGTMSPLEHGECFVLNDGGETDLDLGNYERYLNVTLTKDHNITTGKIYSHVIAKERKG
FT                   DYLGKTVQIVPHLTNAIQEWIERVSRIPVDNTGMEPDVCIIELGGTVGDIESAPFVEAL
FT                   RQFQFRVGKENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLVPDMIACRCSETLEK
FT                   GVIEKIAMFCHVGADQVVNVHDVNSTYHVPLLLLEQKMINYLHQRLQLQEITLSSEDIQ
FT                   RGENLLSKWKSMTGNFDSSMETVKIALVGKYTNLKDSYLSVIKALEHSSMKCRRKLEIM
FT                   WVEATDLEPETQDTEKAKFHEAWNKVSTADGILVPGGFGSRGTEGMMLASRWARENHIP
FT                   FLGVCLGLQIATIEFARNVLGVKEGNSAEFFPELDESNQVVVFMPEIDKETMGGSMRLG
FT                   LRPTYFQQGTEWCAIKKLYGSAESVEERHRHRYEINPNFIERLEEHGLMFVGRDETNKR
FT                   CEIFEMKDHPFFVATQYHPEYTSKVLDPSKPFLGLVAASSGILDDVIAGKYEFNGDGKS
FT                   DF"
FT   CDS_pept        445495..446151
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439986"
FT                   /locus_tag="CAGL0F04455g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ER retention sequence binding"
FT                   /biological_process="protein retention in ER lumen "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59089.1"
FT                   /db_xref="GO:0006621"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046923"
FT                   /db_xref="HOGENOM:HBG145091"
FT                   /db_xref="HOGENOM:HBG332839"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniParc:UPI00003B6396"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC9"
FT                   /transl_table=1
FT                   /translation="MNIFRLLADLTHIASILILIQTIKKTSSISGISIKTQVLYALVFV
FT                   CRYLDLLTFHYKSFYLTVMKIFFITSSVYTVYLLSTFKQKNPIAYQEMIMADAFKVQYL
FT                   LAPCLVLAFVFNHGFDFLSLNKSFSMWLESVSIMPQLFMLSKSGKATALTTHYIFALGL
FT                   YRALYIPNWIWRYFYEDRFDKLAFVTGFVQTLVYSDFFYIYYKKIVKGLGFRLPK"
FT   CDS_pept        complement(446420..447148)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439987"
FT                   /locus_tag="CAGL0F04477g"
FT                   /product="Similar to uniprot|P23724 Saccharomyces
FT                   cerevisiae YBL041w PRE7"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAG59090.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG318170"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI00003B6397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC8"
FT                   /transl_table=1
FT                   /translation="MATTVSSEYSTDTSNVPIEHRFNPYSDNGGTILGIAGEDFAVLAG
FT                   DTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKRFKNSIKWYHFDHNDKKL
FT                   SISSAARNIQHLLYGKRFFPYYVHTIIAGLDDEGKGAVYSFDPVGSYEREQCRAGGAAA
FT                   SLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLSLEEVIKLVRDAFTSATERHIHVGDGL
FT                   EILIVTKEGVRTEFFELKRD"
FT   CDS_pept        449923..451815
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349500"
FT                   /locus_tag="CAGL0F04499g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59091.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051000"
FT                   /db_xref="HOGENOM:HBG333533"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI00003B6398"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC7"
FT                   /transl_table=1
FT                   /translation="MRDVSTSEENQYSTLTSDEILKHRSDADTSGEDEKYYKEETVNII
FT                   DTNDVEPSSDEEDHDDKHEKFKRKGTFAYLWYRIVDFLEVKQIDDDGKVTESQSVLQTF
FT                   LYNDDLKPVDKARRVWTWKEYIFFWISGAFNVNTWQISATGLQLGLNWWQTWICIWVGY
FT                   SFVAVFLVAGSRIGNIYHISFPIASRVAFGTYFSIWIVLNRVVMACVWFSTLAYLGGDC
FT                   VQLMLMSIFGNNLNKKMGDTIPNPNLTNFQFMCFMLFWAVSLPFLWFPPHKLRFIFAIK
FT                   SAITPFAAFGFLIWTLKKAHGHLALGSLNGGEKISQSVLAWSVVRSIISALDNFSTLIL
FT                   NAPDFSRFAKTPKSSIYSQLFILPICYAVISLIGILSASAAYKLYGVNYWNPLDILNRY
FT                   LEHYTSGNRAGVFLISFAFAFDQLGANLSGNAIPAGTDMTALLPKFINIRRGSYLCACI
FT                   ALVICPWNLMASSSKFTTALGAYAVFLSAIAGVISADYFVVRKGYVNVFHCYTNKLDSY
FT                   YMYNRYGTNWRAVCGYIVGIAPNFAGFLGSIDVHVPIGAMKVYYLNYFIGYLVAGLVYL
FT                   VLVYYFPVKGVPHNAKLTDRVWYEEWIEVEDFRNQREAFEKYGDASMSESKLSA"
FT   CDS_pept        complement(453083..453943)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439988"
FT                   /locus_tag="CAGL0F04521g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59092.1"
FT                   /db_xref="HOGENOM:HBG124573"
FT                   /db_xref="UniParc:UPI00003B6399"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC6"
FT                   /transl_table=1
FT                   /translation="MLAIHFNNSLSLQDQYSLASKARTKLMRCAKDAQKANKEYNLRVL
FT                   VGHANLLDRITENVERMNLIKRQQQNVADDLQLSKQNSNVVEGYTHAGEVSAQNKTSTS
FT                   DYYYYSSESESESESDSESESDYESETEAQGDFTFKVDESIDCKENTEVVDSEVSVAEE
FT                   CNYVVGAGAHYAGHNDSSNKHFTTIWEEPSEGDNTTEEKTEICLSSSITSTGNDCDEKA
FT                   KDYKETTDVCSGSDSDEHSLNSPLDDNDAFESYDDICKSSNDYGVHYHKNHDNYFNIPQ
FT                   HKTLV"
FT   CDS_pept        456591..456866
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501664"
FT                   /locus_tag="CAGL0F04543g"
FT                   /product="Similarity possibly noncoding "
FT                   /protein_id="CAG59093.1"
FT                   /db_xref="HOGENOM:HBG124574"
FT                   /db_xref="UniParc:UPI00003B639A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC5"
FT                   /transl_table=1
FT                   /translation="MHRILCRGGIQFPPTIITISEKGNFISNVARSYISMKAIFSGMLP
FT                   CRNSLTFFFTDFLDGYNELRNVCNEKPQYRLKNFQDPYPIQQVAQT"
FT   CDS_pept        459464..460825
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439989"
FT                   /locus_tag="CAGL0F04565g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG59094.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG407991"
FT                   /db_xref="HOGENOM:HBG476859"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00003B639B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC4"
FT                   /transl_table=1
FT                   /translation="MLRAVASKQLRRGLATQVSGSLAPEISQLSNGVVVATEPNTSSST
FT                   ASVGVVFGSGSSSENPYNNGISNLLSKTYKSTENRANAATKGVEVVSKVGREYQSYLVN
FT                   SLPGQLSKSFDILNSTVLGNPTGSDKVFEQTKSNVLKQIEHFEETNHKGRVLEHLHATA
FT                   FQNTPLSLPIRGTTESVDGLLRGDLEEFVNQHFISSNAVIVGTGNISHQELCELVEKSS
FT                   LKFNSTTKAKPEANKKSTFLGSEIRLRDDTLPKAWISIAAEGEALTSPDYLVSQVAAQV
FT                   FGSYNAAEPNSRLQGIKLLDDIQEYQLCDDFDHFSLSYRDSGLWGFVTTTQNVGSIDDL
FT                   MHFVLKQWNRLTISVTETEVARGKAMLKLKLANEACKKNCHIASDLGNLVLNQGVKFNQ
FT                   DEIFRKIDAITVKDVKAWAGKKLWDQDIAIAGTGQIEGLFDYMRLRNDMSMMRW"
FT   CDS_pept        complement(461459..462667)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439990"
FT                   /gene_name="PSY4"
FT                   /locus_tag="CAGL0F04587g"
FT                   /product="Serine/threonine-protein phosphatase 4 regulatory
FT                   subunit 2"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59095.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG124575"
FT                   /db_xref="InterPro:IPR015267"
FT                   /db_xref="UniParc:UPI00003B639C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUC3"
FT                   /transl_table=1
FT                   /translation="MDSASIDAIHMNGIKSKYLYDILKGIVREKNYDVLETINVSEFLA
FT                   ELLDHMVNTIPNELFQTKVNNGRHTVGRKEDSEENEEAVYGTDIDDANDVHTRQLDDLK
FT                   RISTHLTTNFKDKSQLPFTIVRICELCFDPFHYFKTYELDKFVNALQKCCLVRGAWRRY
FT                   ELKDVRELSNSQSDKEHIDCDQNDVALSKIPWLDEKMVSELTPFIKEIDTIMSVNLSFE
FT                   DDEMDDDDDDNLKNQNNDRIITHQDDNIIVEEYYENEDQDDENTGFSNQVINDNNDSQE
FT                   DDDEDSDYIEEDEGDEDEDDDDDEEEEEEEDGDEDEDEDKHFDIKVEEEAVKEDANTTR
FT                   NELMNVSNNSDDSSLQNDTGIAISSQNDTRDLSKRRLPLSDENDGNYANPASFSKRNKA
FT                   SES"
FT   CDS_pept        463702..467637
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045105"
FT                   /locus_tag="CAGL0F04609g"
FT                   /product="Similar to uniprot|P34216 Saccharomyces
FT                   cerevisiae YBL047c"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG59096.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG058241"
FT                   /db_xref="HOGENOM:HBG204251"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B639D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC2"
FT                   /transl_table=1
FT                   /translation="MAAIVFQTPLTHEESDFYSQKFRQLDSEELGVVTGEAVKPLFAAS
FT                   GLSSQILSQIWALVDIDNKGFLNQNEFNAAMRLIAQMQQFPGQSVTTTLYDHPPSRLPI
FT                   LSDPNTVQSTGNSRMGSTSNASIPHISANDISKYSQLFDRSAGASPTIPGDKAKDIFLK
FT                   ARLPNQTLGEIWALCDRDASGTLTKQEFIMAMYLIQLVMSNHPSTQPLPDHISNEIWDS
FT                   LNQLPATSLPMEQPLSASSTGLSSNPPLVRQNTLSRVSSGAFTNAANNWFLTPEKKAQF
FT                   DAIFDALDKNHAGALGSQILVPFFLSSKLSQETLASVWDLADIHNNAEFTKLEFAIAMF
FT                   LIQKKNSGIDLPDVIPNELLHSPSLGLYPSQAPQTQANAQPPLPPSRNTKPQMNLPVQP
FT                   QHSNNGSLNDLMALNGSFSPQPTTAKPLNHTDSGNSFENSSVANTMTAKKFNPSSTFGQ
FT                   SIIKEEDERNVALASNTATMGTTTPATTASNLPAVPTMSNVPGTNNTQAPPATQTQHMN
FT                   KATSPVQRQSTLPKVPNFGGFTNAAGSGINAITGATGAVLGGAIGAVAGAATGTVSGAI
FT                   SGANRDIFADGESSRQLSTATTDLANLSNQANSLSNQAGIASEKKSKVSQELQRVNEMK
FT                   ANIESKLATLRAKYDQDVKATEEMETQLTQTNREVETLNQQLGVVEANYHATESKLNEL
FT                   KTQYEEAQQKNSKLKEDIANFNTMIASMEAQLNEKKQVAKQELSVVDVNMKQLELNQIT
FT                   VAGIEKEISGLDEQVNVYVNKRKELDEYKKTIEDQHAQLQAKYQEISDKNNELTERQNE
FT                   LDERNQQIEEQEKLYHEHVAKLQSLFDDLTNRQQQFEKAEQELKNRHVEYAQKVQDLTE
FT                   RQMNLAMGEIPSDAKEIVEKHKQSSGMGAGAAMGIAGAAGAAVATAGAAIAHAMTSNKD
FT                   DDEKTESDVFDRDVPTVGSQSEPDENAETTNHRSEAEAVNMADRFEGDLNEYGIPRTQS
FT                   LTSSVANNAPQSVRDDVELPETLEEKEMSKPSTAGNTITPNAHMPGEWDNTGANTMTNT
FT                   QEDSGQMNDSPADQSQEHSESDTSIQKSLDQEVPKKKMTIDEEFPPIQELNIDESDSSS
FT                   DGEFEDTRELPTQVSKNVDDQSMAMTAPPNGVTPSVPQMENTPKDDFDDAFNELEKATE
FT                   EDGNTSDFENLANQGSFEGFEHIDRNEVAASMQQGNVVGAPTQQGQPMAPQGHHNHGND
FT                   EWDEIFAGFGNGVKEPNASQQMQQPIPASTSATAQAPINRGIATTPKSLAVEELMGMGF
FT                   KEDEAVKALEKSNWDLETATNLLLDAA"
FT   CDS_pept        complement(468280..468795)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439991"
FT                   /locus_tag="CAGL0F04631g"
FT                   /product="Similar to uniprot|P38191 Saccharomyces
FT                   cerevisiae YBL049w"
FT                   /protein_id="CAG59097.1"
FT                   /db_xref="HOGENOM:HBG268212"
FT                   /db_xref="HOGENOM:HBG524054"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI00003B639E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC1"
FT                   /transl_table=1
FT                   /translation="MGLRYTSYIESPLASDLNKSFKGSRNSQTDLYQYNEYGTIGNSLY
FT                   SGPILLRQRRRTLSGSSDSSSSSQEKIFVTYGCRRCRTHLSSSSHVISKDYRGKTGTAY
FT                   LMDEVLNVLEGNVETRPMLTGDYVVCDILCHWCKNVVGWKYLQSERKDQRYKEGKFILE
FT                   VKTICKCD"
FT   CDS_pept        complement(470517..471395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501665"
FT                   /locus_tag="CAGL0F04653g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAG59098.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG020810"
FT                   /db_xref="HOGENOM:HBG397841"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B639F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUC0"
FT                   /transl_table=1
FT                   /translation="MSDPQELLKRAEKKGVPSSGFMKFFNGSDSYKFEEAAELCVQAAN
FT                   IYRLRKELSAAGESFLKAADYQLKAGNDDEAANTFIEAFKCFKSSGSFTDAVSSLESAV
FT                   NLFTKKGQFRRAANFKFDLGEIQENDLTDYKNAIESFETAGEWYEQDQSMALANKCYVR
FT                   CADLKALDGQYIEASDLYTKLIKNSLGNRLSQWSLKEYFLKKGLTQLAANDTVAASRTV
FT                   QEGMKDDPNFHDSRECNLLQGLIESVSEGDSEKLSQLVFEFDKFSKLDKWKTTIMLKIK
FT                   ETITEAEDDLL"
FT   tRNA            complement(471651..471723)
FT                   /gene_name="tRNA Ala (AGC)"
FT   CDS_pept        472760..473878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045106"
FT                   /locus_tag="CAGL0F04697g"
FT                   /product="Similar to uniprot|Q06146 Saccharomyces
FT                   cerevisiae YLR257w"
FT                   /protein_id="CAG59099.1"
FT                   /db_xref="HOGENOM:HBG253256"
FT                   /db_xref="UniParc:UPI00003B63A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB9"
FT                   /transl_table=1
FT                   /translation="MSAERYPSVPSLVGDSVRSIKGTGTEPVARSDPRNDVKILNKLHD
FT                   TVANHNQSQQLSGSSYTSVEDLNKEGALLTDEVDLELSHVDGKVQRKDGEVDFNIADRK
FT                   LGESELEKQRKRKLMLLKQKQKNRELSSTSLSRMDIQSSSSQTSLTHLDDETKEELDRV
FT                   SRSQERERQRGSQMVSPTRGSDGLVRNSYGEYIKSTCNRPHLARGDSYQSSSNESENNL
FT                   IDSAATPSERSGRTSFRRRLSTEYLRSLSRSLSRDPSKSTTRTNAITPSHSNNAGNYTT
FT                   SAPPSHHVVAIPGGDFIDNEKTRTVDQSLEDELYSTNNYSISQVELAQAANKTLLNEAF
FT                   DEEEEEGALLDDQGNEEHDRELERAAIKVEES"
FT   CDS_pept        475180..477294
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160890" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349501"
FT                   /locus_tag="CAGL0F04719g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="glycogen (starch) synthase activity "
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="CAG59100.1"
FT                   /db_xref="GO:0004373"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="HOGENOM:HBG083100"
FT                   /db_xref="HOGENOM:HBG330297"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="UniParc:UPI00003B63A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB8"
FT                   /transl_table=1
FT                   /translation="MSRDLKNNLLFEVATEVANRVGGIYSVLKSKAPVTVAQYKDNYHL
FT                   IGPLNRATYQSEVDLLDWNDPSIFSDELKPIQQTLQSMASRGVRFEYGRWLIEGAPRVI
FT                   LFELDSVRGYLNEWKGDLWSLVGIPSPENDWETNDSILLGYTVAWFLGELAHLDSKHAI
FT                   IAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGDFDFYNGIEHVDVDHEA
FT                   GKYNIYHRYCIERAACHSADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVVKFQAFHE
FT                   FQNLHALKKEKINEFVRGHFHGSYDFDLDNTVYFFIAGRYEYKNKGADMFIEALARLNY
FT                   RLKVSGSKKTVVAFIIMPAKNNSFTVEALRSQAVVKSLENTVDEVTRSIGKRIFDHAMK
FT                   FPHNGITNELPTNLDELLKPSDKVLLKKRVLALRRPWGELPPIVTHNMVDEGQDLILNK
FT                   IREVQLFNNASDRVKMIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAE
FT                   CTVMGVPSITTNLSGFGAYMEDLIETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFV
FT                   KKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPEQFKQLVGEELSDLNM
FT                   ESLTGGKKFKISRPLSVPGSPKDARSNSAVYMTPGDLGTLQEANNVDDYFNLSVSGDGD
FT                   DDDENYAEHN"
FT   CDS_pept        478256..479584
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439992"
FT                   /locus_tag="CAGL0F04741g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59101.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020651"
FT                   /db_xref="UniParc:UPI00003B63A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB7"
FT                   /transl_table=1
FT                   /translation="MVDNKDENKDKPAVRKPEQVEGHTVTKFFNKLNGQPESYVSKSNY
FT                   VFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKHP
FT                   NIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYMHSK
FT                   NVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNN
FT                   GHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAK
FT                   NFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRDAIEIVKL
FT                   NNRIKKLRSLYMVETDTDIEENVASVAFNTLASSLNDLRLHSQKRVGQLTAEQRRLKSA
FT                   LTQDTFAQIVRAATKNKERIWGEKTASPTPSQSSTSSTSTNKK"
FT   CDS_pept        complement(479691..481514)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196321"
FT                   /locus_tag="CAGL0F04763g"
FT                   /product="Similar to uniprot|P43596 Saccharomyces
FT                   cerevisiae YFR013w IOC3"
FT                   /protein_id="CAG59102.1"
FT                   /db_xref="HOGENOM:HBG124577"
FT                   /db_xref="UniParc:UPI00003B63A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB6"
FT                   /transl_table=1
FT                   /translation="MDGALKRKRQFTFDDFTTVKVVSRPEKLAKVIPAPSTADGDDKAD
FT                   PEAIEVLSEETEIEHTLRLKQFSKEDTIKSSHVSIDTGTYGEYGNADLMKLLKLNPVAY
FT                   AGRIVKIMAMIDKFDACFDPHLHSLTFRDFEVGLSLVDVGGNTDTDAEDKMDLLLFTFL
FT                   KLLNVQSVKSNFNPPTLHQLKNGNKPYSKMFSKVRTISSTSDWGYPREWRQLADEENPI
FT                   NTLTLSRAGLKVLEPNDRILLLECLSDWCLSYAPHINAEIFRLSHLKEEPSIGIATYMM
FT                   PNYTAKTYDEIRDDYLALCKSERERYELRWKRRHSYKSANFDKKFEIYKKIREKYYAAS
FT                   YTERDNIDIRLYDLWSKLFELEGLDNPLNDPYTNEVYKLRKLESLVMALKDIGEFYVPS
FT                   LSSYKDSNKINTKNGMTIKRRMDSYKYKGFCKDHSIVTKQSGCISEFTLLFFDKVKLAR
FT                   DITQGTDKKGDSYWYALARNDNEFEQLISNLKDLEKLSFEKSDDKMKFLLQNVKEWQDI
FT                   GTAISRSNLQTTSAEESTSGERLRNLRSRKALHEAFDYTESDNEDLDNTSDYDDDVIDS
FT                   VDEFSEADTSVVEDHSLTRAERLQRRKLRRY"
FT   CDS_pept        482637..484547
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439993"
FT                   /locus_tag="CAGL0F04785g"
FT                   /product="Similarities with uniprot|P40463 Saccharomyces
FT                   cerevisiae YIL135c"
FT                   /protein_id="CAG59103.1"
FT                   /db_xref="HOGENOM:HBG124578"
FT                   /db_xref="UniParc:UPI00003B63A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB5"
FT                   /transl_table=1
FT                   /translation="MIADLSRTATNNEQEESPMIFERDVEDPCMMNSTSTISRQTSNTS
FT                   LLHTTSNQRKYSTNSNTGLNLYYTHTVSSSPQVPNSSSNSNNNNQISNASEYQNNFPNI
FT                   SKSSTNVSMDNCVEQEVIYQNPMNHRRTLENFVPPALDEGCSIVTDDATDLEDVDMVFV
FT                   QSRKPSTLGLDMALGRTRSMSTLKPLSNGDELSNVPSNSSEQSTSPRLFRFYSYADMLS
FT                   EDNYLHNKHTTKRPSFTHHSLSSNVLQKSKTAGQPTNHSASNLIGTSPPKTQSFVNPFI
FT                   ISRRYSSNAGPIQTATVPIPTAPGAVGSRSQSNLLRQGSYNTLSPNMTPMSNNSTPSAG
FT                   NIGNNNNNFNNKPADRFMRTSQRPAIFKNYSASGLSEVGSPTSPTLSLSTSPRIGPNSR
FT                   SLTTSPPSVTSPMMIKSGRSNSANIMGTSSRSPRSTTGDKYKISTVSARRKTDQLKKNL
FT                   TKFHIESSGSEGYSTDEEYDGETSCTSGKDAKKKSIDSNVFDDDDNDSDNEQSSGHKSA
FT                   DNEVDPLSEDLNGNGHTFFPSNIKINKEKLQKNLMSSFEKFQSSKIWRNSIGGTNSPKQ
FT                   NSNSSHNTNETPTNSHPNSFLRQSNNSNSCSTITAVINEANSGTTSIPKATKSVSSTLE
FT                   E"
FT   CDS_pept        complement(485300..486685)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501666"
FT                   /locus_tag="CAGL0F04807g"
FT                   /product="Similar to uniprot|P16547 Saccharomyces
FT                   cerevisiae YIL136w OM45"
FT                   /protein_id="CAG59104.1"
FT                   /db_xref="HOGENOM:HBG124579"
FT                   /db_xref="UniParc:UPI00003B63A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB4"
FT                   /transl_table=1
FT                   /translation="MSKAVITGAAAATAAVAAITFNQAVNEQGKRKQTALSITRDHQAC
FT                   SWTRIKEGLWDDAVSFKDALLLRGIYNDNTAKYIERGRDDLAQQISDSVKSSPPPQLQR
FT                   SVKGRNVFSSMDEDRRNERDDSQDNKSIFNWGYNDIEKAKAVAIGEFDAANKKYNDILD
FT                   KWKHSKTSFFSAGDAALKEQVENCKKMLEEKRQALKKASEDFNQYTKQSFNEISNNIDK
FT                   QDVLNGIQNKKQDLWSWLKDDTSKDGKPDVDKLAAASVVGWGERAQEFAEEELEERRRS
FT                   MQIGPSEAQRRLDELKKYKENGWFTYRKGDETEEEMAKRVIKGLEGWGETAAQLAREEY
FT                   EDLKWQAAKTKEEAAALVDDASQKLAEAKSDVDKTASKWWQFGKEKKDEVHEKSLANYE
FT                   AAKRDYENSKKALQKWTDKQRGNFWDMANDSVSSIQGQVDKAHEVVTDKLDDAKSYTKE
FT                   KKN"
FT   CDS_pept        487684..488292
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439994"
FT                   /locus_tag="CAGL0F04829g"
FT                   /product="Similar to uniprot|Q06449 Saccharomyces
FT                   cerevisiae YPR154w"
FT                   /protein_id="CAG59105.1"
FT                   /db_xref="HOGENOM:HBG059512"
FT                   /db_xref="HOGENOM:HBG396736"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI00003B63A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB3"
FT                   /transl_table=1
FT                   /translation="MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASP
FT                   VPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV
FT                   RPAAAPSANLAPPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQ
FT                   PVQQSSAHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF"
FT   CDS_pept        complement(488804..490582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439995"
FT                   /locus_tag="CAGL0F04851g"
FT                   /product="Similar to uniprot|Q12374 Saccharomyces
FT                   cerevisiae YPR155c NCA2"
FT                   /protein_id="CAG59106.1"
FT                   /db_xref="HOGENOM:HBG059513"
FT                   /db_xref="HOGENOM:HBG204005"
FT                   /db_xref="InterPro:IPR013946"
FT                   /db_xref="UniParc:UPI00003B63A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB2"
FT                   /transl_table=1
FT                   /translation="MIIDSQVVLKLDAIDKQLSQALQVLLVQGIEDSQQLQSLQRSLYS
FT                   IKKIVDDLVNRLSRQNSTKVYIDLQKVLDTLENACIDTLGDSKVLDLFKNALVQYTIVI
FT                   AYYDLLSDSLVSLPQAYDALDYYNSISASRAKSWYYGLQCMVPRFIKHSYENKTELLRP
FT                   RMDLIMLRNFQFVGIAKHRNELLTKPWRYLNVLVHLPLSVIRDDLSKKLAVETELVNEH
FT                   TIKLGELLDDFNSSIDTNEDMDNHISRLSSHLNVEGQPVDSLTRLKLIVLNIKELQEQK
FT                   PNTLVKKPNFISRNWPVLLVGLLYGPSSIIAVWQSRYKILEFLQHNVVDFVTGLMYNWV
FT                   YTPLKQVWATVRHDEGSAISVTSQSTLDSEMSSLSRMIVSFVVENSDHRELINENQLIS
FT                   QVEHGDLTQFLKIYETQLSHPIKNIVTGSLVRSLLIQVQKTKVDGSLALNGIDKMLKSQ
FT                   QLVFGILAMSPALAIIYTSFVALKRFVKLGSVWSNIQKYKYRISVSLNNIERIINDFKD
FT                   TETGAISKGKDEYLKEGLLLIEISTLHELGKKIVPKKRISEWCRDVQELMTHSKSSRQT
FT                   HLNVVNRIYHVYGRYL"
FT   CDS_pept        491732..493813
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439996"
FT                   /locus_tag="CAGL0F04873g"
FT                   /product="Similar to uniprot|P32486 Saccharomyces
FT                   cerevisiae YPR159w KRE6"
FT                   /protein_id="CAG59107.1"
FT                   /db_xref="HOGENOM:HBG051981"
FT                   /db_xref="HOGENOM:HBG735630"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00003B63A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB1"
FT                   /transl_table=1
FT                   /translation="MTVRNLTGRDYRSSRSSSFDNNTGNPFLASEEENDDDRSSSSFIH
FT                   YDRDASRQAALEGLDGQRHVSDYKGYYSKNNTAQNLNTGNGNTPNLDNSKRYFSQTSLN
FT                   TGLTRNDILSPPEFDRYPLVGSRVASSTQLHQQAYSSSPVPRMASSPDNSGSSFSSTNN
FT                   NTFLGEQDFSPFGGYPASSFPLLMEEKEDDDYLHNPDPEEEARLDRKRFSNDFKYMDKR
FT                   SAGGLAGVLFLFIGLGCLFILLPALTYTGVTEHAKPVVQEILSAYQYPQLSAIRTKLVD
FT                   PDTPQSALSRQARDGSYWKLVFSDEFNAEGRTFYDGEDQFWTAPDIHYDATKDLEWYSP
FT                   DASTTRNGTLQLRMDAFKNHNLYYRSGMLQSWNKLCFTQGAIEVSANLPNYGRVSGLWP
FT                   GLWTMGNLGRPGYLGSTDGVWPYSYSSCDAGITPNQSSPDGISYLPGQRLSVCTCDGEE
FT                   HPNQGTGRGAPEIDILEGATDTVLGVGTASQSYQVAPFDIWYIPDYDFIEIHNFTTTTM
FT                   NTYCGGPFQQAISAVTTLNTSWYQYGEGSGYYQKFAIEFLNDDEDGYIQWYVGDKATWT
FT                   LMNTALHANGNIDNRHVSKEPMSIILNLGISNNWAYIDWQMIYFPVTMSIDYVRIYQPN
FT                   NSVSVTCDPPDYPTYDYIKDHPIVYNDANVTKWNLAGYSTPKNILTGNCKSSKFKLSS"
FT   CDS_pept        495596..498295
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439997"
FT                   /locus_tag="CAGL0F04895g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="phosphorylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG59108.1"
FT                   /db_xref="GO:0004645"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG338887"
FT                   /db_xref="HOGENOM:HBG444050"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniParc:UPI00003B63A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUB0"
FT                   /transl_table=1
FT                   /translation="MSPTSSSTTNDMITEEPSNHRQVPRLTRRLTGFLPQEIKSIDATI
FT                   PLKSRALWNKHQVKKFEKPDDFQDRFIDHVETTLGRSLYNCDELAAYEATSMSIRDNMI
FT                   IDWNKTQQKLTTRDPKRVYYLSLEFLMGRALDNALINMDNGEDKANEQPRKVIKGALDE
FT                   LGFKLEDVLDQEPDAGLGNGGLGRLAACFVDSMATENIPAWGYGLRYQYGIFAQKIING
FT                   YQVETPDYWLNFGNAWEIERNEVQIPVTFYGYVDRDGKDTTTLSPSQWIGGERVLAVAY
FT                   DFPVPGFKTSTVNNLRLWQARPTTEFDFAKFNNGDYKNSVGEQQRAESITAVLYPNDNF
FT                   AQGKELRLKQQYFWCAASLHDILRRFKKSKRPWSEFPDQVAIQLNDTHPTLAVVELQRV
FT                   LVDLEKLDWHEAWDIVTKTFSYTNHTVMQEALEKWPVGLFGHLLPRHLEIIYDINWFFL
FT                   QDVAKKFPKDVDLLSRISIIEESSNERHIRMAYLAIVGSHKVNGVAELHSELIKTTIFK
FT                   DFVKFFGPSKFTNVTNGITPRRWLKQANPKLAELISEILKDPSEDYLLDMAKLTELNKY
FT                   AEDPEFQQKWNEIKQYNKLRLADLIKRENDGVDLIDRAHISDTLFDIQVKRIHEYKRQQ
FT                   LNVFGVVHRYLAIKEMLRNGASLAEVEKRYPRKVSIFGGKSAPGYYMAKLIIKLINSVG
FT                   DVINNDKEIGDLLKIIFIAEYNVSKAEIIIPASDLSEHISTAGTEASGTSNMKFVMNGG
FT                   LIIGTVDGANVEITREIGEDNIFLFGNLAENVEDLRYNHQYNGHEIPESLSKVLEYIES
FT                   GELTPENPNEFKPLVDSIKQHGDYYLVSDDFESYLTTQDLVDEVFHSQKKEWIKKSILS
FT                   VANCGFFSSDRCIEEYADTIWNAEPVKP"
FT   CDS_pept        complement(499132..501180)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439998"
FT                   /locus_tag="CAGL0F04917g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59109.1"
FT                   /db_xref="HOGENOM:HBG124580"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="UniParc:UPI00003B63AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA9"
FT                   /transl_table=1
FT                   /translation="MGSIMYKRKSESLKNVRFAPELTTVRKFDSDSEPISISSSNQSSP
FT                   ELSFSNTQSNTLNIPEYNLPPILFNPVTNYSLGNDTPLGRSQKLFRLGVDDEDEDIDDN
FT                   DADSFGDYTSTDSETDLGNLDGLDVDSFDIVDCNILDTNLVPFSQKYNLNHYRYDDVKD
FT                   ISKIETMIFNYLNGSNIKLHNLQKKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYA
FT                   TATYNKSITDHIDEFRFTIDVMTFKYILKSKGLIYCDSYSNEDCTYCDLSMDLCCRYDV
FT                   NNETYYDNNNYKNYHISMVVVTAPNSVGIQELRKTTSEPIMSTMSNSNQKRHNSSKHHS
FT                   QQHSFQTDFLTTTTLSHNLFFHNNSYSRRFSDDTDYYNTSPLKHLYHNDTTLIKPTRIN
FT                   EVLNANELESPQDPNYDAGFLETHSYNYTNKPITTNYNSTAAYIQNTLGDMHFHDSMVE
FT                   ESKTGTGVDLKKVYKNNLNFQFLNSDEEESHNPLNASDLGNFNLQRNTRPKTPISILKN
FT                   NNNFEDVESDVHPVVDLSKVRNFTLNPNNSSETLVIHNFATSDESSNQSYYSAENADDD
FT                   VNCTSNNTSPSDTPSSEVASILNSGNSLDISSVSDDAELAGSEYLEAKGFQNTMGKLGY
FT                   TDNMNTLHKNPLDYQSILNSYCFYEPRRESYNSTCYDGDDDYNNGNE"
FT   CDS_pept        503890..506208
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349502"
FT                   /locus_tag="CAGL0F04939g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59110.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008048"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI00003B63AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA8"
FT                   /transl_table=1
FT                   /translation="MSFDRPEIYSAPVLQGESANDDDNTEIIKAFKRFILEFRLDSQFL
FT                   YRDQLRNSLLVKNYSLSVDLEHLIGYNEDLYKRLSDEPSDVIPLFETAITQVAKRIMIL
FT                   NKSSNTNDGLDDIDENSNDLADDEDGITDIPVFQLILSSRANQVSLRQLNSEHVSNIVR
FT                   LSGIIVSASVLSQRATHLSLMCRNCRHTMSLNINNFNSITGNSVTLPHSCQSTNNNSTA
FT                   AYIHDTGDDPTGSGAASKNCGPDPYIIIHESSKFIDQQFLKLQEVPELVPVSEMPRNIT
FT                   MTCDRYLTNRVNPGTRVTIEGIYSIYNSKKRSGAAGQSGSGVAIRTPYIKVLGIQTDVE
FT                   ASSIWNSMTMFSEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVCLLMGGSK
FT                   KLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRD
FT                   PITKEFFLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNS
FT                   RTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIVKDEHNEERDISIANHVMN
FT                   IHTGHTDAQLEANGSELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQFVTIRKQLLIN
FT                   ELESTERSSIPITIRQLEAIIRITESLAKLELSPIAEERHVDEAIRLFQASTMDAAAQD
FT                   PIGGMNQTNSLSDIRRVEQELKRRLPIGWSTSYQTLKREFVDTNKVSQSSLDRALYALE
FT                   KHETIQLRYQGQNIYRSGI"
FT   CDS_pept        join(506566..506570,506700..507027)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439999"
FT                   /locus_tag="CAGL0F04961g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59111.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00003B63AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA7"
FT                   /transl_table=1
FT                   /translation="MSEAIISRPKSELSKEELEQLEEFEFKHGPMSLINDAMITRNPVI
FT                   ISLRNNHKLIARVKAFDRHCNLVLENVKELWTEKKNKQTINRERFISKLFLRGDSVIVI
FT                   LKAPLQ"
FT   CDS_pept        complement(507217..509004)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440000"
FT                   /gene_name="DBP9"
FT                   /locus_tag="CAGL0F04983g"
FT                   /product="ATP-dependent RNA helicase DBP9 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG59112.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG559320"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B63AD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUA6"
FT                   /transl_table=1
FT                   /translation="MTTIASEAYIDDSVNFESFKLDARLLQAIKGSGFTHPTLIQSHAI
FT                   PLALEEKRDIIAKAATGSGKTLAYLIPVIQTILDYKKSRTNGDEPGTLGIIMVPTRELT
FT                   QQVTAVLEKLIHYCSKDIKVLNLAADLSTSVLNTLLSENPEIIVGTPSKILNILERNTD
FT                   TVGIDDLKFLVIDEVDLVLTFGYQDDLDKIAEYLPLKKNLQTFLMSATLSDDIQSLKQK
FT                   YCRSPAIIKFNDDEINKDKTKLVQYYVRVGEFDKFLFCYVIFKLGLIKGKTLVFVNNID
FT                   RGYRLKLVLEQFGIKSCILNNELPANSRQHIVDQFNKNVYHLLIATDDADNIKEFDDEQ
FT                   KDDIQVEEKNDETNTVVAEESTNSTTGIKSKTKNNYKQDKEYGVSRGVDFKNVACVVNF
FT                   DLPTTAKAYVHRVGRTARAGKSGTAISFVVPLKEFGKHKPSMLPSAKKDEKILSRIIKQ
FT                   QSKLGLEIQPYSFDLKQVEGFRYRMEDGFRAVTQVAVREARIKELKEELLASEKLKRHF
FT                   EENPIELKSLRHDKELHPARVQNHLKRIPEYLLPENARTDKKKISFIPFHKPNKVGKKS
FT                   KNSKNKKRKGGKTDALKKF"
FT   CDS_pept        complement(509393..511708)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000203394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045107"
FT                   /gene_name="YSH1"
FT                   /locus_tag="CAGL0F05005g"
FT                   /product="Endoribonuclease YSH1 "
FT                   /EC_number="3.1.27.-"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59113.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG008046"
FT                   /db_xref="HOGENOM:HBG320344"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR021718"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI00003B63AE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FUA5"
FT                   /transl_table=1
FT                   /translation="MDVKERSNQFRFFSLGGGNEVGRSCHIIQFKGKTIMLDAGIHPAY
FT                   QGMASLPFYDDFDLSIVDVLLISHFHLDHAASLPYVMQKTNFKGRVFMTHPTKAIYRWL
FT                   LRDFVRVTSIGSQSSNAEDDNLYSNEDLIESFDKIETIDYHSMIDVNGIKFTAFHAGHV
FT                   LGAAMFQIEIAGLRVLFTGDYSREIDRHLNSAEVPPLPSDILIVESTFGTATHEPRLHR
FT                   EKKLTQLIHSTVNKGGRVLMPVFALGRAQELMLILDEYWSQHKEELGSNQIPIFYASNL
FT                   ARKCLSVFQTYVNMMNDNIRKKFRDSQTNPFIFKNIAYIKNLDEFQDFGPSVMLASPGM
FT                   LQNGLSRDLLERWCPDEKNLVLITGYSVEGTMAKYLLLEPDTIPSVSNPEVTIPRRCRV
FT                   EELSFAAHVDFQENLEFIEQINASNIILVHGEPNPMGRLKSALLSNYASFKGTEDEVHV
FT                   HNPRNCYELDIECKGVKVAKAVGNIVDEIKRTEEEVVKPENDAGQSKEGIEEFTGKTQD
FT                   VRKDAEGEGAIISSILVSDEKNFDLNLVSLSDLREHHPELSTTVIRERQTIQVDCKKEL
FT                   IYWHICQMFGDVSVLIDDDNVTNTKETKLETSRGMLVLQIMGAIRLTVQHNKAILEWTQ
FT                   GLISDTIADSIIAILMSVDSAPVSVKKSSNSCSHGHEHATPILSQPSETDKIKQVAELF
FT                   KTQFGDSFTLILNKDDDNDTAEEKEDDEFVKGLITIGKNTASINFTDMCVVECNSNPLK
FT                   GRVESLLKIGIDMVSSLC"
FT   CDS_pept        complement(512367..512930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196322"
FT                   /locus_tag="CAGL0F05027g"
FT                   /product="Similar to uniprot|Q05863 Saccharomyces
FT                   cerevisiae YLR281c"
FT                   /function="translation release factor activity "
FT                   /protein_id="CAG59114.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="HOGENOM:HBG252656"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI00003B63AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA4"
FT                   /transl_table=1
FT                   /translation="MLFSLIYGRKLADKILRQSNTHSIFTCSTQLIKKNKLPPRPKFDA
FT                   SMEADIEEKFLHGGTGPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNRKIAREKL
FT                   ALELERWQLGQEKDGNSGVQVMTEREQALLEWKRQQKRSKGKKSRLKHELAKQKREEEK
FT                   KKELDELMEVFGDRIGNSSTSDRN"
FT   CDS_pept        513288..514169
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196323"
FT                   /locus_tag="CAGL0F05049g"
FT                   /product="Similar to uniprot|Q05867 Saccharomyces
FT                   cerevisiae YLR283w"
FT                   /protein_id="CAG59115.1"
FT                   /db_xref="HOGENOM:HBG124581"
FT                   /db_xref="UniParc:UPI00003B63B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA3"
FT                   /transl_table=1
FT                   /translation="MRSALRESTKHIRTWRYTPRPKVIRAYHSTPLLQINSTQYLKEKV
FT                   SNKLTNDETPLDFINKLPEQLISQGNGLSPTDAAHQVNTLEYYKRLKYEGGFNSEQSNA
FT                   IIALLLEIIDDEFYKTYNTKFLRDMELNKQSHLFNSAETELKYAIQNSRDTQLNSQHLQ
FT                   MMILQRDLAILHDEINELIINLLNKDSKMDFNNQKLENTLLLKEVNLHLSGSTNKIITK
FT                   LMGEVKSDIENLRWQTTRSGLVAILLLVLMVMGAVSLTKNKASEEKKEAPTRTVYDQSL
FT                   SVASEEPPQAAT"
FT   CDS_pept        complement(514361..515221)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000027948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440001"
FT                   /locus_tag="CAGL0F05071g"
FT                   /product="Similar to uniprot|Q05871 Saccharomyces
FT                   cerevisiae YLR284c ECI"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG59116.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG060041"
FT                   /db_xref="HOGENOM:HBG327837"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI00003B63B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA2"
FT                   /transl_table=1
FT                   /translation="MKYDEKITYVKDGPFFIIKFNSPSTLNSLTGDDYIYIAELLGLAD
FT                   EDKDIYFTVLQSTGRFFSSGADFKSIAIAEQHEAASKKPTTTPNEVARHHDELQKWLAY
FT                   FSSRNVNVTNAFNQHSKVLVCCLNGPVIGFSAAICCLCDLVYVMNEKVYMLFPFANLGL
FT                   VTEGAVASTLPRLVGSRSSFESLLFAKPVTFPEMSRAGLVNKNYSLNDTDKFNDQVLAE
FT                   LKEKIDGLHLPSCLGIKKLMKLEWEDRIERINSLEVNDGVKYWVKGEPQKRFRQVGSKQ
FT                   RKHKL"
FT   CDS_pept        516481..517278
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440002"
FT                   /locus_tag="CAGL0F05093g"
FT                   /product="Similar to uniprot|Q06688 Saccharomyces
FT                   cerevisiae YLR412w"
FT                   /protein_id="CAG59117.1"
FT                   /db_xref="HOGENOM:HBG059073"
FT                   /db_xref="HOGENOM:HBG397309"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="UniParc:UPI00003B63B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA1"
FT                   /transl_table=1
FT                   /translation="MARGIDELNSVIDSYREVIRKSDLFGKTIQCLQSYNISKIRCLAL
FT                   GSFAEEFPAKYQLALLLELLDNINTIKEVSLYDPVFNEVDKLFIKEQSNWHIVEQEHYK
FT                   DTGNCGETLFYMPHAPLDLTEEVIKREKPKLILGNEMSQHTDRYTEKQLYDKYPLLSKL
FT                   VYGSKNYSKVSNPKINVSAEGDGFVRQESKKSRRRKNKWHIEPTVIDYSSVPSYFADGL
FT                   IMITNYKSSSTSEDGENTTVDLIKKGQEQWNHSFSDLSLFEIA"
FT   CDS_pept        519640..521724
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349503"
FT                   /locus_tag="CAGL0F05115g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59118.1"
FT                   /db_xref="HOGENOM:HBG124407"
FT                   /db_xref="HOGENOM:HBG202582"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI00003B63B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FUA0"
FT                   /transl_table=1
FT                   /translation="MKFDKLLFTVTTVFAFTTFILIIIATAGSSSNYKPITNIKIGEAD
FT                   ISHINVTKVVPQVGPILTILGSALTANASLDQIFDALKQVADTPALVPLLNLMSNSKSN
FT                   VTGTIGALTNLAPLALQKSDNTTDAALNSINMVIGDATNVDLLLDGMKEVVNSAMESLT
FT                   SPNFKNLTIMENEVFNLLLDSENVTATTEALIDMNQIPDADKQKLIPAFTLFKDSSNLN
FT                   ATIDSMASLMNYSSALSSIPTAELSTLFSTVSSLASSKSSLISTITALSSKLPSNLAPA
FT                   VSSLTTLLNSTNEDSLNSTLNALQTLILKNNITASVDSAKTSINSIKIMNEYAQNKTLL
FT                   LDSVEDLATQTSVPSNTTTAQLKALDDIFQGSGNASATLRTLMGLEQGLTANPSLIKYV
FT                   PYIFELLDDSNNATLSFTSLLNLTSFAKSNPTTFVPIMSILGKANSITPVTQDQLRELT
FT                   PAILEYLHIPIKFHLSIFTLCKADINDKIISCSKSHAVQNLDFRSIIYDSIAESDFKPY
FT                   LEALKIGKQDLHLDGKMQNRQHEYVPAIRASLSMNLLAIIVSFFLMCYAIFLLVSKNAM
FT                   THMKWCILFFLTMNSALFSGLGGTIISAMINIIKSGTHDDKYGVVFDDNSSILGLLWCA
FT                   FTVAFLSYVAATLSWFQFWRENKNKPVTYLSSGTSSENESVTSRVTEHANNKADEKESV
FT                   "
FT   CDS_pept        523941..524624
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349504"
FT                   /locus_tag="CAGL0F05137g"
FT                   /product="Similar to uniprot|P47032 Saccharomyces
FT                   cerevisiae YJL079c PRY1"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAG59119.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="HOGENOM:HBG124582"
FT                   /db_xref="HOGENOM:HBG395878"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR002413"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniParc:UPI00003B63B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU99"
FT                   /transl_table=1
FT                   /translation="MKVSTIFSVSLIAGALAAPAVVTVTKEAPPARVTVQAVVNVEDGG
FT                   RQSSLSTLEKKTKTKSQKKTKPTPSTDLDKRAQKKRSNLSEWQQKMLDQHNKKRELHKD
FT                   TDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLAVGYDDIDAIDAWYDEIQ
FT                   HYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIVCEYDPAGNWAGEFADN
FT                   VKPLK"
FT   CDS_pept        525230..527617
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501667"
FT                   /locus_tag="CAGL0F05159g"
FT                   /product="Similar to uniprot|Q03388 Saccharomyces
FT                   cerevisiae YDR485c"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59120.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG192006"
FT                   /db_xref="InterPro:IPR008895"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniParc:UPI00003B63B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU98"
FT                   /transl_table=1
FT                   /translation="MSESEQSSDEQELLINTRQRRSNAGNRLQKLLEQEIEELQTRTQA
FT                   LDEDEIDLLFKEDEEDADFEMVDDEDNESHNEEENEIDNADGKEESEVPTESKDSELQD
FT                   EDVMLSDSSSEDEPDNQDDESGEKELIRQERLKKKKLQKLRKKPLVIKRTAPIIDSENK
FT                   TKKRKVSSDVINAEDLLSNNRRTSSRSSVIQNKLQVYEKLSQAEKRRQIIRERMQKSRD
FT                   KEQIKVLTQEDRMRIALETEQANLLSLNKYKEQEVSKKQHRLAMQQRQKMKFKPGEMII
FT                   TELSTTWEVTPVMEIEDYEYWKEQIEKRNKKKKKYPRKPRKKNNEGAESHRNGGDVCQK
FT                   EVSDTHIEISRPIIYDNGNIYLNQSYFNNKCNYQKDNATDLDGNKHMCIPLENNSEPRS
FT                   ILPDDLEQNRQKADYISILDSETNNLSSGIIPQASFIEVNNQDLSENSDIFTGTSIKMD
FT                   VDSLKVEGKNGLNISEENSSVDVPAKMGERWIKNGITVPSDGVNSSVDLNISKFVAGPT
FT                   IDEEINKVTTVANDDNKASTHQRNIKIEECGEDMSLKHAQNEDLDVTASIKNSSDAKTE
FT                   RGELIDQSLNNDVPNENIADTMDSEEQKRIYEGPNQMVSKNFVVAYTVVHDTLSKPTHD
FT                   LLFGSGWKGPPNKSYDTETLFVSKNNNGAVDDITSEIKPDLTFLEKYPAFGEFERKVVQ
FT                   EVSENTAKDLEINIKTAPPTGIFLPSGMRKKCLINNKDCHYFDPKNGVPYSDVEAYKII
FT                   QELQSFDVNPETNHFFKWQGFANGGIFLDVNEKPAEGVPDNF"
FT   CDS_pept        complement(527696..529534)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065926" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440003"
FT                   /locus_tag="CAGL0F05181g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59121.1"
FT                   /db_xref="HOGENOM:HBG058744"
FT                   /db_xref="HOGENOM:HBG203321"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniParc:UPI00003B63B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU97"
FT                   /transl_table=1
FT                   /translation="MDVLRETLGISADFQAKAIIDQDDPYSIFCKEHNQIGTTANQKLS
FT                   DDRNKLEHRREVLHNTIDNIIPPLKEYLNEFKNTLNEHTRDLDNIREKSTYLKTLLEYN
FT                   SDKLKNISPLVNDLIIPPEVIQDILHGKIDQSWQENIDFIMDKQEIYKKYKDQGFDGLK
FT                   PKDFNDLCDILDVLKLVILERSKKYIVFKIKSLRSNTPVPSQKLQYELMNVNKIFQFMV
FT                   ENNLSMALELRQAYAYTMKWYYSAYFGRYIRSLTILSFKNIDNHYVLGNGLSISPPGYA
FT                   NTNNSGYSFSSYLMPTSLSTATVSDDSINQYFQVERRLDLLTKEDNTVMVSQIAEHNQR
FT                   ENYLEIGFKNLNLAILDNCAAEFKFLSTFFKTNHNSEGELNGVLEQIFQPTFNQAIEYT
FT                   KQLIQNTFDIFGILISIRITNLLQYSIIQKSLPSAIDDFFSVQLITLWPKFQQLIDIQC
FT                   QNIRKLNITVRPGKNTGVADILSSPHELTVQFGKMIFSLLTLSVNHKENVDERSEPLYQ
FT                   SIPRLRNEFETVMTKISKTTKSPEKFLAVNYLYLYNLMQQQKLTHLTEESMLSPVVQQG
FT                   TFDQQIGEQQSNNAVPLLIKETEDHFKSLVEAFNKE"
FT   CDS_pept        complement(529892..530626)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501668"
FT                   /gene_name="RIB7"
FT                   /locus_tag="CAGL0F05203g"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /EC_number="1.1.1.193"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /function="NADP or NADPH binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="CAG59122.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053449"
FT                   /db_xref="HOGENOM:HBG668075"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="UniParc:UPI00003B63B7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU96"
FT                   /transl_table=1
FT                   /translation="MLRVRDDLPPFLKNYLPDGHRNGRPFVTLTYAQSIDAKIAKQRGV
FT                   RTTISHIETKEMTHYLRYFHDGILIGSGTVLADDPGLNCKWIGPNNDPDESMEEKSPRP
FT                   IILDPKLKWKYSGSKMEELCNQGMGKPPIVITTKTPKVKEANVEYMIMEPDANDRISWK
FT                   SILDTLRRNYDMKSVMIEGGSHVINQLLMCSDLIDSLIVTIGSIYLGSEGVTVSPPDEV
FT                   KLKDISWWKGTSDVVMCSRLQN"
FT   CDS_pept        complement(530902..531330)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440004"
FT                   /locus_tag="CAGL0F05225g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAG59123.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="HOGENOM:HBG124583"
FT                   /db_xref="InterPro:IPR009730"
FT                   /db_xref="UniParc:UPI00003B63B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU95"
FT                   /transl_table=1
FT                   /translation="MSDSSEDYSTETSSSDEEPVFHKPVLLKKSTIIPNPDTIDNNEQK
FT                   AQDKLKRSIDQANQIAYERDELRRQTELSYSASDKELIRKTLEIDDDDSIDPAKELDLW
FT                   SQRQQNRKERQRAILVRKQLSLEQDEINRINNRDDIVN"
FT   CDS_pept        complement(531690..532601)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196324"
FT                   /locus_tag="CAGL0F05247g"
FT                   /product="Similar to uniprot|P38281 Saccharomyces
FT                   cerevisiae YBR151w APD1"
FT                   /protein_id="CAG59124.1"
FT                   /db_xref="HOGENOM:HBG059050"
FT                   /db_xref="HOGENOM:HBG396546"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B63B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU94"
FT                   /transl_table=1
FT                   /translation="MTLLSDNAKQEIAKNIELIDDSCLNCDCQNEEGLDEIQSGEKVFD
FT                   KLVIDHETELFNSSKIPKVHFIVPTSQMDWQFDACMEKPNSVQYKISTWCSENTERLSA
FT                   ITGCGGVSMNCNVTSMPLNILDIEAMRGTKNNVLVLPFGIWIQDLRSDNVEAILDELVP
FT                   AILDPKTDIKQLIASKEYLYESHKKAFIFICSHKTRDKRCGITAPILKKIFDRELQNHG
FT                   LFRDNSDLRGDGVNVSYINHVGGHKFAANVQIYLKDQHTLVWFGRITPKDIPHIVNHLI
FT                   VPDHGKLPFPEKIRCVKKYDSW"
FT   CDS_pept        complement(533759..534334)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045108"
FT                   /locus_tag="CAGL0F05269g"
FT                   /product="Similar to uniprot|P19073 Saccharomyces
FT                   cerevisiae YLR229c CDC42"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59125.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00003B63BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU93"
FT                   /transl_table=1
FT                   /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVM
FT                   IGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHH
FT                   CPGVPCLVVGTQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSALTQR
FT                   GLKNVFDEAIVAALEPPVIKKSKKCTIL"
FT   tRNA            join(complement(535636..535673),complement(535530..535566))
FT                   /gene_name="tRNA-Ile (TAT)"
FT   CDS_pept        complement(536171..536374)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501669"
FT                   /locus_tag="CAGL0F05329g"
FT                   /product="Similar to uniprot|Q03482 Saccharomyces
FT                   cerevisiae YDR210w"
FT                   /protein_id="CAR58022.1"
FT                   /db_xref="UniParc:UPI00017BD591"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ8"
FT                   /transl_table=1
FT                   /translation="MSQQYYQQGPPPPQQGYYQQGPPPQQGYYQQQPVYVQQAPPQKES
FT                   SCMDQCLKLLCCCFLLELVCGD"
FT   CDS_pept        complement(537631..540165)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196325"
FT                   /locus_tag="CAGL0F05335g"
FT                   /product="Similarities with uniprot|P38994 Saccharomyces
FT                   cerevisiae YDR208w MSS4"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /protein_id="CAG59126.1"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="HOGENOM:HBG124584"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR016034"
FT                   /db_xref="UniParc:UPI00003B63BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU92"
FT                   /transl_table=1
FT                   /translation="MLVLDKGSNSQNVAHQNQAIPNRDGDHKNIGWRRKSEKEDGEEED
FT                   EDLYDRVHESSTPTSIEDMGKPRDLNKDRDAIKVDPSRPAETTGQSEAANKNTGLLIPR
FT                   NGDSSQKINEMNARAKKIDDRPLIKEQRSVNSKDKEGTSESDKKQVILNQQMINDLKAI
FT                   KRKSIEIEKQYHDQEQEELLDLIADENTKLVHTDSYIQSIHEDDDEFKINQNNDTLDQD
FT                   HVTDLPETNHSMGSPNVNDERHSKTGKITNRVTSSGSKQHEVPTRRSSILLNTSTSRRS
FT                   SSRRSTLDSIHIPNLKIQSSNHSQIHPIVTSTSSHRNSKASHSLTLNDVHKYTNHSIIS
FT                   LPTHLHKHVQQNSPAAKTGANHSPIQSNTLTSVSTTSLPPLPAVNTTRNYENNDARNSS
FT                   NDGGMLKRSQSATVEIQKMRELLLQKREMKRKRRSVIVDDDRVLIGNKVSEGHVNFIIA
FT                   YNMLTGIRVAVSRCSGIMKPLTPKDFKFKKKLAFDYHGNELTPSSQYAFKFKDYCPEVF
FT                   RELRALFGLDSADYLVSLTSKYILSELNSPGKSGSFFYFSRDYKYIIKTIHHSEHIHLR
FT                   KHIQEYYNHVKTNPDTLICQFYGLHRVKMPISFQNKIKHRRIYFLVMNNLLPPHLDMHV
FT                   TFDLKGSTWGRRTNVDEKRMEEDPMYRPVLKDLNWLEANQKIMFGPLKSKKFLVQLKKD
FT                   VELLAKLNTMDYSLLLGIHDMERASIEAGVADPEEQLVTSAAILDKLGYKQNTLVPHFF
FT                   KQNDGGIRASDQFNNDLKIIYFVGIIDCLTNYSLIKKLETFWRGLSHDLSVVSAIPPRD
FT                   YAHRFYEFIEESIEPTPSTRYTDNPNQTRYRD"
FT   CDS_pept        541830..543635
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440005"
FT                   /locus_tag="CAGL0F05357g"
FT                   /product="Similarities with uniprot|P39001 Saccharomyces
FT                   cerevisiae YDR207c UME6"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59127.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124585"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B63BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU91"
FT                   /transl_table=1
FT                   /translation="MDTQGDLVPTKCTSAPNNTPVDSYTTSPQPEMKSSSVIDIAMEDD
FT                   DEDDDEDEEEEEANEEEDAQSNDTTPVESRDQDSTAANSDSAASPSDTADPAPVHSADH
FT                   EGVSSVSHTEEEQIGAENAVADPADGTLPNAEGVQVPSNEIPPTGKAADDVPLSNHVEE
FT                   DKSDGNGNEAKENVDTPQVNGGEATEAPVNTEDASTTDTANTDGMKETNGGVAGDANSN
FT                   TVKLEVGDEGYVPPPPPKYINSKLDGLRSRLLLDPKENKQTPRHDEDVAQVLSNMRSSP
FT                   FSPSSNRLTPTSASSSSSSDKHHYHFTSTLSSSSILGRPLLFRSENSSPDFGSPIGTEN
FT                   HIDTSDEKSPNMISETKSEISQNETSSLDDGESSKEAETTVSKPSTDNITTAESASETS
FT                   TGNTVAENGKDEVVKSETDEIEDKEKAEKLTRFRSKIKEAERILREQKTRNITWIKSGK
FT                   RINRESSTHDSSNSSIPKRLKTEPSTTIDKQRKIKLNKAPGADNKPPISAASKVKKEGE
FT                   RKRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDCYYDAFKPDFVADPVVRKQK
FT                   MDEIRMKTKEAKRQAMKKKNARPAP"
FT   CDS_pept        complement(544091..547162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349505"
FT                   /locus_tag="CAGL0F05379g"
FT                   /product="Similar to uniprot|Q03466 Saccharomyces
FT                   cerevisiae YDR206w EBS1"
FT                   /protein_id="CAG59128.1"
FT                   /db_xref="HOGENOM:HBG124586"
FT                   /db_xref="InterPro:IPR018834"
FT                   /db_xref="InterPro:IPR019458"
FT                   /db_xref="UniParc:UPI00003B63BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU90"
FT                   /transl_table=1
FT                   /translation="MNAGTMSESEALVWNTINDFHERLNEILRTNQITHDYALLSGFLT
FT                   FVHSKLLKMTENNLNKQKQLYRQYKEYPSEMTEIFDNHTTVLILDALWGKIYYPIFKWF
FT                   QTLRNFIVPRKAGEQPKYFEFRKMSSKISKFYKEVQAFLNSIISLILMDPEIEATDGVP
FT                   PQVFVFFNLKKKAAKALPKKLRLSLKYNDPLANIVRLVLHRCILYLGSAQRYKIMYEKI
FT                   SNRHSVEDFVKSKEYFDLASLLLPSSGETYLQRGMVYIQTDNLGTAVQEFIKGSLAKSP
FT                   CPAALSNFKTIILENDSTLHLRLDKLILDVHSQDLKGTKIVNREIIELYFLAIFGSYFA
FT                   PDVWTNPKKPGFLRNGLAVKTLELTLYEKIASRYIKNIETIYNDLIIGIGGFNLLQLFG
FT                   NMGPDSRVKILKSNTLTRNQLSYLSFVFTYITRIITDVIKEAWNGNHEVYLYLAMLRII
FT                   GCWIFANESVLEFAKSNVAFCQAYADLLNDFLASGLVSYGPDNSVKPKRSYLFEEDIQL
FT                   RELGFIGDELDDFNDTKIHTSEDCMTRLVGKPHMEDKLSPKEEKLARLSAIIVTGKQIL
FT                   SYNQCDIHFDTEKTQYKIPDSGIPDMKFKNNVQKNGRNKSGKQTGAVRHYQQEVKDTLK
FT                   EKTLTKNYQQSSSNFSNAKGIIPTEQNSSVVYSGISVKAPSTFDIKPSFQMKQPGDTLA
FT                   QDLGNLNLNSPMVNSVGPSYYANTVTGSAIQNSGSEMSTGHINDRSALNAEDEHRKYLN
FT                   EIFRPNMSMSSVESSRRNSSLKGYLSPNLSANMLSSVDQSITTPTSIMDSHRSSYGLPS
FT                   WSGSSHTKGSEVNELNSGNGIMTGNSLYYDGRHIYPSYHSRMMSMNSETTIVPDAPSPF
FT                   ADRNRTSFADSRGSGYAEQLLNSSVFQKQSSNKINARNFPTSAQQLNVSNSHQLNQSPN
FT                   LAQEYGYQNSTNSPYVNSSTNINQNYMTSIGPDSMSSLHEGSQGYWPDQNRKDPQASAS
FT                   SFQAQYPYSIRNGQQPMDNAFINTGFSNVYGPSH"
FT   CDS_pept        complement(547875..550430)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440006"
FT                   /locus_tag="CAGL0F05401g"
FT                   /product="Similar to uniprot|Q03455 Saccharomyces
FT                   cerevisiae YDR205w MSC2"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59129.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124587"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00003B63BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU89"
FT                   /transl_table=1
FT                   /translation="MCPIETCIMNDTLLRTNTRSSFCIQIYKPINSTVYNLISYDSKDL
FT                   VILYFICSISINSKVSEDYCHTFKINCILKSWFCFNKESNYDILNKWASLIGKGNSIKK
FT                   VLDLVKNRSHIIQILFCFMQIMSVQGLLDRIPLLISYPTIILSSNLIIPSHREVLQRGS
FT                   VGIVDYEHTFFNTDHFIRLVLLPIFTASTFICLGSLFHVIESPLGRLNPNHSLKWTDII
FT                   KSYGPIFLILFMLSQLNFIQGSIQSTILSLLVIREYGKMNISNKKLNFSCAIGSVKIFI
FT                   PLFFISLIIAYDPESYYYLFSNLLSYSIVVFIVLVLVPYTKSTAINKEKSQELKLTTDY
FT                   KYQLFFLPLLSLGALLMSSHIYGMYQVQLLMLLVYVGCLSIFFLTVADIKTTELGTNGE
FT                   SNCPSDFYLANISLEYTLSACGFMAILLQYLSFNKIVSNIRGDIFTLVFVLAAECCNSL
FT                   LSEKEQEIVHNHSHSRVTVSEKSNVSLLKQIALNEDTRSIFSFLLLNTTFMFVQLLYSF
FT                   RSKSLGLLSDSLHMALDCTSLLLGLIAGALSKNPPSDKFPFALKSLGTLAGFTNGILLL
FT                   GIVCGIFIEALGRFFNPVHLHGTSELLVVAILGLLVNLVGLFAFDHAGHGHAEGAGHEE
FT                   NMKGIFLHILADTLGSAGVIVSTILIKLTGWTVFDPLASMFIASLILVSSIPLLKSSMN
FT                   GILFKLDDRNHNVVKNALNQISMTPGITGYTTPRFWPSQSSSVSMHGHSHGHSHSHSSD
FT                   HTHEHEHKDEHEHEHQHEDKHVHEVHKEHDETSDTSNEKLTGYIHVQYIDGENSTIIKK
FT                   RVEKIFENNAIRAWIQVEPQSSECWCRSAQVQQPLPMSK"
FT   CDS_pept        complement(550656..551648)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501670"
FT                   /gene_name="COQ4"
FT                   /locus_tag="CAGL0F05423g"
FT                   /product="Ubiquinone biosynthesis protein COQ4,
FT                   mitochondrial"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG59130.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="HOGENOM:HBG059835"
FT                   /db_xref="HOGENOM:HBG326467"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniParc:UPI00003B63BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU88"
FT                   /transl_table=1
FT                   /translation="MLQSTKVTKSVLTNVLRVEQRRGFLLSGAAVALGSTYIFGRDAKL
FT                   ADAMDRGELHNKNEDYAKLRAERTEQRIKALSNNRPMEPRYEGHVPLYLHEKMLLFAIS
FT                   GIRAFFHPENGINIVQLGEATAFPIFLENLKQTMLADETGRRILRDQPNVRTDILDMDK
FT                   LSKLPKNTFGYTFYKWLEKEKVSPDTRAPVTYIDDPIHAFVFKRYRQCHDFYHALNDLP
FT                   IIIEGEIIVKALESANMGIPMATLGWMLAPLRLKKAQRDRLYGTYLPWAIKTGLTCKPL
FT                   INVYWEELLEKDVEELRQELGIKMPPDLRAMRAKRKAMIKRLNEKYQKN"
FT   mat_peptide     complement(550659..551555)
FT                   /gene_name="COQ4"
FT                   /locus_tag="CAGL0F05423g"
FT                   /product="Ubiquinone biosynthesis protein COQ4,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU88 "
FT   transit_peptide complement(551556..551648)
FT                   /gene_name="COQ4"
FT                   /locus_tag="CAGL0F05423g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU88 "
FT   CDS_pept        551974..553005
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501671"
FT                   /locus_tag="CAGL0F05445g"
FT                   /product="Similar to uniprot|Q03956 Saccharomyces
FT                   cerevisiae YDR202c RAV2"
FT                   /protein_id="CAG59131.1"
FT                   /db_xref="HOGENOM:HBG059834"
FT                   /db_xref="HOGENOM:HBG203203"
FT                   /db_xref="UniParc:UPI00003B63C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU87"
FT                   /transl_table=1
FT                   /translation="MTTEVYAYDYFGNKEQCGAENDWEVEVEWLIKEIIKPDLPNIIDN
FT                   FSMCLEMLQSEQEFVMPLSNGKEESKNSGSPIVKGIMVRQGEFIIDFQVMMSFGQFKKG
FT                   KQIVAKMKPSQKYLLVQFSTTIMKLKDILIKLQNLQMIEDIEEFYNVLESALEELNDCI
FT                   DTLQNPPHGLTFPGNNNGPIKQMFDDYDNLFESTHHQIALDITIFRNELCVEFKNLTKV
FT                   TRPPWDQVDLRTGKCFAEKIKEELKEKRNMNLEQVLQSHGLQINQPSLLGNIVSRLSSE
FT                   SVTLPEAQDYLRRSVSFDKRVVMEIEKASLTTSDPSLISISSKLQGLKTCINNHLSNLS
FT                   AHK"
FT   CDS_pept        complement(553078..553542)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154374" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196326"
FT                   /gene_name="SPC19"
FT                   /locus_tag="CAGL0F05467g"
FT                   /product="DASH complex subunit SPC19 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="CAG59132.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG192650"
FT                   /db_xref="HOGENOM:HBG203202"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniParc:UPI00003B63C1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU86"
FT                   /transl_table=1
FT                   /translation="MQSLEQCVNSLEAIVHQLDGSVSRLARNGEASNELCEGILKIKRV
FT                   FELVPEYDVESARLALFEEVDPMVKTLGDKIEKALIRKRRELENLRQTSELNSLRLSGD
FT                   LYFSETGIDNQDMDVSTDAIAIASATDAELDELRALKARRAELQELLDGR"
FT   CDS_pept        553902..555365
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065944" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440007"
FT                   /locus_tag="CAGL0F05489g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59133.1"
FT                   /db_xref="HOGENOM:HBG059833"
FT                   /db_xref="HOGENOM:HBG323805"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI00003B63C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU85"
FT                   /transl_table=1
FT                   /translation="MTTDARNGGKRPMGRNRSNSRSSGSRSVMDIDELSVPTFIPSGNR
FT                   KAQTAINHHELHETVTPETLVKSPGKTHILVLKSLNETFETKFLVIPYQPDGLKLGRPV
FT                   ASGGGKLSSAVTQIRSDNGNFDSRVLSRNHALLSCDAETGKIYIRDLKSSNGTFVNGNR
FT                   IDQTNVELHVGDTIDLGTDIDTKMEHRKISAIVEDISIIPLVNGYKDTNTTNVETKTVA
FT                   TNLPKTIDHTIHNQQQPTLSNKSIGDNNFNLPPESAVSTVTAQRAAFEAAMFGNVLHSD
FT                   LDDNILGVQTEILSGIFVNNSAGTSPNLLNTIKTLSTELALEKQETQKLTAMQNFLVNY
FT                   TSKLDEIKKVMDQNNVKYLAKLQESLRQSLSETHNRVINERLDRRKKLEEGNESFKQER
FT                   DKEIKEKQELLNKLKDELSAAQLNLEQEKKRTKVLMEKKSALTSKKDLLNGKTRSPSSI
FT                   KSNDLSSNKVLITAAITVVVIAAVAKWKS"
FT   CDS_pept        555646..557055
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440008"
FT                   /locus_tag="CAGL0F05511g"
FT                   /product="Similar to uniprot|Q03942 Saccharomyces
FT                   cerevisiae YDR198c"
FT                   /protein_id="CAG59134.1"
FT                   /db_xref="HOGENOM:HBG059831"
FT                   /db_xref="HOGENOM:HBG203201"
FT                   /db_xref="InterPro:IPR016852"
FT                   /db_xref="UniParc:UPI00003B63C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU84"
FT                   /transl_table=1
FT                   /translation="MDDKISSLLEWLRQDDEFYLNECVEIKDTVQSGRGVYLDCGELKL
FT                   NTPIVSIPGDYQLNKVSVLSHISHFNNAIQGSIGNTPIKDASDYYNQTNDDDPRYKAYK
FT                   LLTTSFLEKLSSFQLLSMYILAEWFLLPHWSNGKITSFWKPFFECWPTNEELSTIPTIW
FT                   ALSDNPLTKELLNHLPETSKTHVNRISTLVSKDWEVLQNIFEVWSTLHACPTNDNMYGM
FT                   DEIFNFFLRIYFTINSRCLYAEIPGNGDDTASNFTLVPYVDFFNHTVDPDVHCYPRVKY
FT                   MKKGKCGIGKFEIYCGRYSYKDLDEQLYLNYGAHSNDFLLNEYGFLISNNHWNNLDISK
FT                   ELKCILAKSPETVAFLKEWDYWDDYTISVEDISYRIIIALSHLTTRDNRKVTNLINGYM
FT                   SEDYFRKENYRILKNLLEQLKLNSISKITQLNKLTPYDDLTTLYVWNIANLYEDEIEII
FT                   NTIITSISPGY"
FT   CDS_pept        complement(557208..558329)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440009"
FT                   /locus_tag="CAGL0F05533g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59135.1"
FT                   /db_xref="HOGENOM:HBG124588"
FT                   /db_xref="UniParc:UPI00003B63C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU83"
FT                   /transl_table=1
FT                   /translation="MSSVPRVYFAGSPLATLVGYGIARLPGQGKIPNVVMLMVDQLKLK
FT                   RFMNHESQISLYRSSLMLDRLQLMAGYSVPRYANGDIAPFENLVIGGGDWRYTNSIMRK
FT                   YESAIVPSTELLLLNPSLFTLGLVLEKKRNKEFKIWRERPKVTIGVANKAGVEIGNEEF
FT                   DVRVNNNDIKIKYSHLPETLWANENDSIENSQNSINSLMNQINLHYPTATVGIQTEQVS
FT                   FQEMFTNYCERELVDNTIEALCLLFDCSFIKELKDIKEAIHLTNLLVWEKLKILKSQFG
FT                   FIEAFENSTIIFDDQRILGLIKDKINKSHEPSEFYENYQRFANKDILENVIYMSYLSHK
FT                   LELKFSHVDLISRLIKGKVLAHKNRHLSTKLRS"
FT   CDS_pept        558599..559318
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349506"
FT                   /locus_tag="CAGL0F05555g"
FT                   /product="Similar to uniprot|Q03941 Saccharomyces
FT                   cerevisiae YDR196c"
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59136.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI00003B63C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU82"
FT                   /transl_table=1
FT                   /translation="MLILGLTGGIACGKSTVSRRLKEHYKYPIIDADQIARDVVEPGQS
FT                   AYNEIIQYFNDKITGLTDEDGKLNRAALGKWVFAHKDDLQVLNNITHPAIRKRIFKDIL
FT                   YYYVMGYKVCVLDVPLLFESHMDNICGVSVAVTSTMAHQLERLMVRNPELTNEDAQNRI
FT                   KSQMSMAERVKRADYVIENDGTLSDLYGQLDNLILRIEPTTIRTLIEYFPPLGAVSATA
FT                   VYLTKRWRAKNQVKSDV"
FT   CDS_pept        559705..561705
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045109"
FT                   /gene_name="MSS116"
FT                   /locus_tag="CAGL0F05577g"
FT                   /product="ATP-dependent RNA helicase MSS116, mitochondrial "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG59137.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059827"
FT                   /db_xref="HOGENOM:HBG395779"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B63C6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU81"
FT                   /transl_table=1
FT                   /translation="MLRHCSLGLVTTQISAIAPLRLVGSPLFCRSYQDFAGRDRRSSRS
FT                   REDKPYNSRTRRFDDEGSSNYSSSRDDYRGQNTYGFRGKAPRKNFSSRDNYSSRDNFRS
FT                   SNGFQERGYKNKFSKNTKSYSKGGNTSGSFIPEGKMAKMTHIGKSDSDIVVTLESLLEK
FT                   NVISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQH
FT                   LLNTKIDSQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSI
FT                   RYIEKVSPSIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKM
FT                   LNTLNTNSTEHIRTLLFSATLDHKVQSLSNDIMNKEECLYIDTIDENEPQAHEKIDQTL
FT                   VVGETFADNLYAAIEHIREFGTKTPNYKSILFLPTVKFTKFMATILKRQVKLPIYEFHG
FT                   QIDQKKRTRIVNEFKTMKKGLLVCTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRT
FT                   ARSGKEGSSVTFISKEELPFFEILEDKHNVTIKNIRKFEAQPHVMADLSLRLHVSEDEL
FT                   QEIILSVISFYRACLKDYGINYKNMLPQIAHTYGTLLQNEDKRIPLAGNHILNRLGMDR
FT                   DPIATKMFQIDEMPNQYNRRGPRSNYNRRRF"
FT   transit_peptide 559705..559770
FT                   /gene_name="MSS116"
FT                   /locus_tag="CAGL0F05577g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU81 "
FT   mat_peptide     559771..561702
FT                   /gene_name="MSS116"
FT                   /locus_tag="CAGL0F05577g"
FT                   /product="ATP-dependent RNA helicase MSS116, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU81 "
FT   CDS_pept        562262..564094
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440010"
FT                   /locus_tag="CAGL0F05599g"
FT                   /product="Similarities with uniprot|P49686 Saccharomyces
FT                   cerevisiae YDR192c NUP42"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG59138.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124589"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI00003B63C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU80"
FT                   /transl_table=1
FT                   /translation="MSYTSRTPCKFFQQGNCRRGNSCKFGHFLANDNNRTTSNDDPYKS
FT                   FISPTSIDKHKKQILDDMADAASYALTPLTSAYSLADPCAVNLIQARDISLEELRFKYL
FT                   QAQKAGQLDQYTAEVQARNSDIQVCMQEVKSHPDIAVRFLQKCTQDIKELGHRTIQQDF
FT                   IKFPVGSQNQASSLNKTGNFNNTTTGMFGVSGFSGTGPAAGAGTSSGLGNGLNMTSSAF
FT                   GKPAFGNTATSSGGGFGSSSFGSSAFGAPAFGSGSTGSGFGSLTAGNQSNGASGASGTA
FT                   FGKPAFGSVGQAAFGQTVQANTNQSPFGSISNTSGNSIPNSSPFGALGAGTNNVSNPFS
FT                   GKQSTAFGSPAFGSTQNNASNTQNTATGSMFGAPAFGSSPFASSQNNGQTTSPFGSLKN
FT                   QSSNNNNNSFGSQPNQNSIAGTSTTTFGSSPNNISNPFSSNNNKSTAFGNIGTGTNTAN
FT                   NAFGTATPGNNVSTNQQTPFGSSAFNNANTNTNKPAFGSSGSNAQSSPFGTTNSIQSNN
FT                   SSGPFGNPSAVQGNSFDSPFANSATANQSIASSSQFSQNSNQNSGNFFQGSVEKEDQPP
FT                   DISELAKGTVDTFKAAQFVLGQVPDIPPPMTLIN"
FT   CDS_pept        complement(564202..565296)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440011"
FT                   /locus_tag="CAGL0F05621g"
FT                   /product="Similar to uniprot|P53688 Saccharomyces
FT                   cerevisiae YDR191w HST4"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="CAG59139.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG059825"
FT                   /db_xref="HOGENOM:HBG203195"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI00003B63C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU79"
FT                   /transl_table=1
FT                   /translation="MVAISKDTKMLLTPPSSTKKPVVESNVGKVTPRRLFARGKSGRKP
FT                   RLKSRPAPFTIFSIDDYLSGITSEKHSSDGAAEFLRYAFQYSKKIVAVVGAGISVAAGI
FT                   PDFRSSEGLFETLKGDSVASGKELFDFNRVYSSDEMSKKFHSMIVDLHSLSQKSEPTKF
FT                   HLLLDHLASQQRLVRLYTQNIDGLDTRLENLKTTVPLDKPIPTTIQLHGSVDYMECNLC
FT                   AKIDCFNPEAFENEGEIIPLCPQCKEFDEVRKVAGIRSKGLGKLRPRVVLYNEVHPEGD
FT                   LIGQVSNKDLKQKIDFLLIAGTSLKIPGVLQMCKKFIEKVVKNKGIVIYFNKEMPTQSL
FT                   LKSLGHIDLIVLGDCQNISDLLSL"
FT   CDS_pept        565824..567197
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196327"
FT                   /gene_name="RVB1"
FT                   /locus_tag="CAGL0F05643g"
FT                   /product="RuvB-like helicase 1 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59140.1"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG015017"
FT                   /db_xref="HOGENOM:HBG749829"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B63C9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU78"
FT                   /transl_table=1
FT                   /translation="MVQITEVNESKAGTANRTAAHTHIKGLGLDDTGAARQVEGGFVGQ
FT                   VEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSEL
FT                   YSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVG
FT                   LKSAKGTKTLRLDPTIYDSIQKEKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLEAEE
FT                   YVPLPKGEVHKKKEIVQDVTLHDLDIANARPQGGQDVISMMGQLMKPKKTEITEKLRFE
FT                   VNKVVAKYVDQGVAELIPGVLFIDEANMLDIEIFTYLNKALESDIAPIVVLASNRGMTT
FT                   VRGTEDVISPHGIPADLIDRLLIVRTLPYNKDEIRLIIERRSAVENLALEDGALDILAD
FT                   MATHTSLRYALQLLSPAGILSSTAGRQKITIDDINEAKMLFIDAKRSTKILENSDRYM"
FT   CDS_pept        complement(567360..569354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440012"
FT                   /locus_tag="CAGL0F05665g"
FT                   /product="Similar to uniprot|P22213 Saccharomyces
FT                   cerevisiae YDR189w SLY1"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="CAG59141.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG359924"
FT                   /db_xref="HOGENOM:HBG435256"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI00003B63CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU77"
FT                   /transl_table=1
FT                   /translation="MASEMDSLRDMQVDSLLKMLYLNEEHYPKANSVTEDPNATTAAIA
FT                   NDDAIQDIIWKVLVLDKRTTAIVSSVLRVNDLLKTGVTVHALIDSSKRSSLPDVPVVYF
FT                   IEPTKTNIDLIVDDLKHDKYSEFYINFVDSLSRDLLEHLAQEVVQLGKQDKVKQVYDQY
FT                   LDFVVTEPELFSLELPTAYSILNNPQSDEETITSLCSTIADGLFNTIITLNSIPIIRAQ
FT                   KNGPAEIVAEKLSSKLRDYVINLKSNSSENSNSILNDSLDRFVLIILDRNIDYSCMFSH
FT                   SWIYQCMVFDIFKLRRNTITIPGENETSPEKQYDIEPHDFFWLQNAHLPFPEAAENVES
FT                   ALNEYKNEANEIVKKTGVTSLNDLNIKQFDQNENEDDLGTLQIQQAVKKLPELTAKKGI
FT                   IDMHMNIFASLLKELEAKNLDTFFEIEQQDPDNVKTRTKFIELLEKDGKTDNLEDKLRS
FT                   FIVLYLSAKNTPPQDFVKQVENYFKGQEYDITPLKYVYKLREMMKMSSSMSLQTKSLDD
FT                   GKQDSNKMTTSTLSGLYGLTEGTLQGGVGTLISGFKKLLPEKKTIPVTNIVDAIMDPLN
FT                   SSQKNLEATDTYLYLDPKITRGSHTRKPKRQTYNKSVVFIVGGGNYLEYQNLQEWAHSQ
FT                   IHNPKKVMYGSTDILSPHQFLEQVASLST"
FT   CDS_pept        570280..572649
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349507"
FT                   /locus_tag="CAGL0F05687g"
FT                   /product="Similarities with uniprot|Q04007 Saccharomyces
FT                   cerevisiae YDR186c"
FT                   /protein_id="CAG59142.1"
FT                   /db_xref="HOGENOM:HBG059824"
FT                   /db_xref="HOGENOM:HBG203194"
FT                   /db_xref="UniParc:UPI00003B63CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU76"
FT                   /transl_table=1
FT                   /translation="MNRNKRVNVKPLSSLFLISYSDVRCDVEHLQKYKIHLYIDIPTID
FT                   YYTDELTETKLSKLNKKLKLSKLKHDIWRAFYNGDEQFWDRLKESNHQVKVTVDISSSG
FT                   SLRYVQTIKFLLETIYNSLRELEYVQLQFHLDSTLTSLKWFKTFLDPELMNAGIIKFNT
FT                   IKHTPQQSDNTKTPFKEYYMRLNNKFMDSERYFDKKVMETIVIVTNQTGVKALLTLLSD
FT                   RPLNSYISEESMKALQHMSASATRNRSYSATVPNHSYETDFISHTPLKRVSSSILNFQN
FT                   ESLPLSHEKEARVKSPISFATSPTLTNSRSFTPIDFPGAESYNSRAMSPDDLAMADALS
FT                   DEFDEDEDNYDDEEFEEDDDNDDDDNDPDEGLSFFAPNILSRSGSGFNLSSRAQNNINN
FT                   KLKLPGTSKGRFRSLSLMDPALNRPFMQKGLQMTPANTGLTVKDNRNELRCASPLASTV
FT                   TKFETNSNNNNEDTHDDDNNDLHTKFTNIYIHDGDFDEVVLDDSTQQRILHNKKKLMEI
FT                   HGEDTGTRISNTPNSLIPPEFYSRLSSPSTSASSSNTSLTQLNTLVTPQFTKWLNNANL
FT                   LHSQGNDKQSQIKGGANLFEQKLVKKSMEDLRNEPAKNFINGLINGDIDSTEKNAYALN
FT                   FRNTANYSQHHYEALDDEDRMMSGVTEDHDNTRQSSDLTFESSTTSESEDETATTASVA
FT                   TIKPEMPSAQLFGLSNSHNSRLSQTSKTSLDQIRPSFSFQLYDDLENIDNQVNEQIQQN
FT                   PDSEPPKAYKKAVSIDLYGDEDPDNNDTWLLGWNNK"
FT   CDS_pept        573128..574174
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501672"
FT                   /gene_name="ATC1"
FT                   /locus_tag="CAGL0F05709g"
FT                   /product="Protein ATC1/LIC4"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59143.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124590"
FT                   /db_xref="UniParc:UPI00003B63CC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU75"
FT                   /transl_table=1
FT                   /translation="MKAQSSQEQEDGLTMLHRILKDDNVDMDSALSDMEGPSVNQNLDK
FT                   LEIDYRNQFEIAYRENSFENLEELSDETIGKHVTLDTLLKMDNDVIFKDENIFDDEDRS
FT                   SRKRQRDSVSDTDTLFNEQTDSKKRKDSDMDSCKNAIDSIMTEQILSPISLSPTPSSDG
FT                   SIQNDKTESLEIAKDLPKEPRKPVDKPARAKLKNKYEMSNIIIHKEDIPAANLRNRRSM
FT                   VDNNVIKKISPHSSADHNKTVKKEPVVITNEYTVSQVAQMKRRIIDSHKLLLNFNVIKD
FT                   NYARACVQLKRSVTALKDSEIHRAHLILENEELKKQLQALQQHSTGKEEANSTNIPKQN
FT                   ILKNEADS"
FT   CDS_pept        complement(574414..575037)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501673"
FT                   /locus_tag="CAGL0F05731g"
FT                   /product="Similar to uniprot|Q04004 Saccharomyces
FT                   cerevisiae YDR183w PLP1"
FT                   /protein_id="CAG59144.1"
FT                   /db_xref="HOGENOM:HBG210883"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B63CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU74"
FT                   /transl_table=1
FT                   /translation="MSTSDESINELLEELEQEDERNDDFIDRYRAQRMQEMHDYFGSIQ
FT                   RKKEEGFGKVNYMDNESQVMKITTSTARVVIHFELETFKKCQYMDEKLEEIARNYLSTK
FT                   FISISVENAPFLVEKLGIKVLPFVICYLNGNECERIIGFNKMGNDPNGFRTSKLEGVLM
FT                   RAGILERRPQDADRISNLRIANKNTDLVSKLREKNDSDTSDLDI"
FT   CDS_pept        complement(575499..576965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045110"
FT                   /locus_tag="CAGL0F05753g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG59145.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059820"
FT                   /db_xref="HOGENOM:HBG397247"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI00003B63CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU73"
FT                   /transl_table=1
FT                   /translation="MFKRKKADTMMDRSDDEVELGSVTTGNASRMLKPQCRQWKSVRSW
FT                   RLVLGLWVAWVALIHYYEHTVVVRAMKKCQWNKWEQWENPVGAHHVALFADPQIMDNHS
FT                   YPGRPAIVNYFTRVILDHYLARNWKYVQGYLEPQTSVFLGDLFDGGRYWDDKYWFNEYQ
FT                   RFNRIFPRKPGTTTITNVAGNHDIGFGDTVVKNSLLRFSAFFGETSDYFHIGNHTFVVL
FT                   DTISLSDSADPHISEKPRDFLEKFGEVDPSYPRIMLSHVPLWRDVTKQTCGSRRESSNL
FT                   FPVMKGDQYQTVITEEISNDVLDTIKPILLFSGDDHDYCHIKHEYTPKDGSGTKLANEY
FT                   TVKSCAMNMGISKPAIQLLSLYNPQSEMGIGLTGQTYSTEMCYMPDPYKPLTMYIIAAI
FT                   FCLIILIKTSFFPKRYIRSKYQNFAGKIKKVDETLPMPVSISDAQLEDKKLKASLQSSE
FT                   EQSKFAVFFQKVGSLAALVLATFFYYYCVI"
FT   CDS_pept        577895..579424
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440013"
FT                   /locus_tag="CAGL0F05775g"
FT                   /product="Similarities with uniprot|Q04003 Saccharomyces
FT                   cerevisiae YDR181c SAS4"
FT                   /protein_id="CAG59146.1"
FT                   /db_xref="HOGENOM:HBG124591"
FT                   /db_xref="UniParc:UPI00003B63CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU72"
FT                   /transl_table=1
FT                   /translation="MKIKAEAGSQDSVRLKRQSSDAGVERFDFDAEEYEIDPRKKLKLV
FT                   TRGVSSGNSDAVGTQSPDGINAFEKRATISKMILDIKRNDIFGTAPILNAESALDDRKY
FT                   INYHRRMLRQESRMIQLDITHGENEADRLLGVYDKLNMFNWQPTLLKVTKINDPNDEEE
FT                   MLAKREKTKEYIQTLLNNFDNMKKRTLSLNKKNAKYVKKIGSEKTMLPNSISRSDSSVF
FT                   HGPDRTKIYNYVDRKYYSGYVSSSDEEEECMTVEDIKAHRKASRERQCGSALTVCLSNN
FT                   FNAGYAIVAEPLKKPYIIKCTTQERKHWKNIRGDGDIKKFKVYHPPTTLVANLTQRISC
FT                   ENTLKPKSVNELRNPNEDNEVIDNDQKQYKNADILLPSEDSVLSDVPSSLPRSPSIAPI
FT                   NLLPVKKLLKSTVEETSTLPNYDGNYGELILNSQYQSNDVPHMGYSSEGAGTTTNYLDR
FT                   TIIQNTGNVEAMPNTRQLPPLGNFHLENNMNATEKNSVVLLSQADKYYPSL"
FT   CDS_pept        complement(579968..584380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501674"
FT                   /locus_tag="CAGL0F05797g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG59147.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059817"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B63D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU71"
FT                   /transl_table=1
FT                   /translation="MGSVENYPGENSNIPKRLLEALRIQPLTFLIPKDGLSELVTDSLE
FT                   LNYVAERPQLDNLHKCELGEAISDKPDKQIRIKEPVNESLFFANEENKFNLLSTLSDKA
FT                   KVFLEQTGTPPIAKQVEGPFKNSRKHSFEESFNDPSELDLSYSSDIKRARISTSVSQNL
FT                   TNIGDDYVNEFNKLVNATAFENDIQNEKKNLNSEVWKLLPSGDAVTTINLIQKIHRCLQ
FT                   NIIELPNCWPNIPADSLEQLLDITSNNIIAMKNVSIRNQEYDNILDIGLISTKVIFLVY
FT                   IMNSDSKDLLIDRHVLSPINFINELVLDLKSVDDDIPLTLLSMLYEAISPLPDFLSLKS
FT                   FIDEEIITKFVYVFVDIIFLPFENVHSDLKKVKLLNEIKIIGRSSLQNMFITFPAQRDF
FT                   IIGEVLAKIEELPNKRTTKKSSSNSNDDSISDFTMTLVQFLSSINIFDHCKTIDTWTPE
FT                   KTDTAIRMHQESSNSIMRYCDMIANTLFDKCKDSNPQNKHLLEIYVSDLSKMYAHPTWP
FT                   VTEFLLQSITKRLLMVFRSNKSTNINLETTALQNLGIIFGKVFEIKIELDKSNENENSV
FT                   LKLIENKSDLIKYFNFFDQLLRSSSSNEESIRYWSLNIDFLHSCYTSDIKSNDIKKLIY
FT                   EKITELFLQTRNSSDWRLKAAVPEKNTYNSILSIGGLYRLYDSYLRILLNLISSEKIKL
FT                   RSTSIKNLSMLALKDQSILTNVLVKQTIQRRLSDSSTSVKDAILELVSVGSSYINYYEE
FT                   INANFNDDSPTIRKHVLNLNEKIYNSTNDINLKVYVASRIVFKLEDEEESIVDKATDIL
FT                   FQKWINLEEEMIQDQDNVMIVRKQNLEIISTIFSSEEKLNELISKFFKSYLLNKTIHNS
FT                   AENARIINSITHIIDTLINEVVLLIGKSSDHEAKALQNYLNLLVEFSEFDVITVRKEHL
FT                   LTLFPYLFSEQSNELQLFLLFIFRNSIGRLTNFKSSFLRDLEFSIIENISKIGSQELET
FT                   SIQILWEVGNQTKDYSKLQKMCYSCLTQIRQYVVIANSNPEELRPDGKVQRLIYISSSF
FT                   AKLANHNNDQNATMFRYQDEKIFEFVAKCLLVFSKIEINPIIRRIAIRNLIGISGKHIQ
FT                   LFNSPLVIKIFDYELRENREEIKLVIYQGLHEFFLDNEKISLQEHLLNTSSKKIETVKS
FT                   INKDTTKKKRSAADGLCFSLVSKFLAYILNDCLSSNYKLALSCTRLVNIIIKYGFVNPT
FT                   SCLPVVIGLLLADNEKIKTLSKKTLDIVTENHESLIYPSLTKGIEAAMMYAERTYSENF
FT                   VEQYLFLYDLQQNFIPGKKSNIKFLQHMAKILTNYTRIVTTKGCTIKELNQIGFFCINM
FT                   AQINFQNHYELYILMRELDAISENLKDFILNQIQYKQSPKFKESHITNLIIIQTLIQEL
FT                   VSHILNKYGIKSDILYYDGNFEQELKSKALPFLKKPNTSFLEKFEETKRFWEGKPIFRY
FT                   LYSLDNRDD"
FT   CDS_pept        complement(584882..586189)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440014"
FT                   /locus_tag="CAGL0F05819g"
FT                   /product="Similarities with uniprot|Q03983 Saccharomyces
FT                   cerevisiae YDR179wa"
FT                   /protein_id="CAG59148.1"
FT                   /db_xref="HOGENOM:HBG124592"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="UniParc:UPI00003B63D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU70"
FT                   /transl_table=1
FT                   /translation="MSEIAYNTNSSLVSKLQQQQQFYSAKVNDARKQGKQSPNDQVDKP
FT                   FRCPHDKDSPAYLKSLCKSVYPETVWAQIDATEELDAIQFHALAALLVKNFVSSWYGVK
FT                   VMKLDPKHDEFLAAIFEAIDTTYTGLRRKCQLMDVNSLLLNDLPYVISKHINILRQLRL
FT                   KIKGQKSELYSQLSMLPSENYLIDQYKRIILESFIPNDSKLQLVFLESILRNIIFGSVL
FT                   DSISNPFYILELLNNILFKVNRPRQNKENISLKFRKFLQAITSCFYHHKRNSLIEIDYT
FT                   QILNLIILDICELHLKSPVWFAVVNIIISVSMTTLFFRDLISTIALRNLAMLRQGPLST
FT                   SYLLMKTRNTLFPNDNLMGQRRVIPQGEELDKYKTNLTKLAYNFLSQHHLTTVLMLSEK
FT                   DVGSFIDLISQDSSCNKLFLLLLLEPIVATLISTGH"
FT   CDS_pept        586441..586881
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349508"
FT                   /gene_name="CSN9"
FT                   /locus_tag="CAGL0F05841g"
FT                   /product="COP9 signalosome complex subunit 9 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="CAG59149.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG124593"
FT                   /db_xref="InterPro:IPR016806"
FT                   /db_xref="UniParc:UPI00003B63D2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU69"
FT                   /transl_table=1
FT                   /translation="MDSYKTQWLTSEGDERVRCELLAFGTVEDLERGTLNAQDRNVLVK
FT                   LSILNYVYGKQVVTFDALLKNYAQAGIELTDNDIEMILLELCNHGIMDVSIDSVAREVK
FT                   VLQLSRYRDVYCGERELLVVNPTKVITNIEIIDTLQAYSDKL"
FT   CDS_pept        complement(587212..587703)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440015"
FT                   /locus_tag="CAGL0F05863g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="heme binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="CAG59150.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG175893"
FT                   /db_xref="HOGENOM:HBG734876"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="UniParc:UPI00003B63D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU68"
FT                   /transl_table=1
FT                   /translation="MLPYARVVAKRSFQTSSARQFVIPFLPLLPQKPGGVQGTPNDAFI
FT                   PPKPHKMEGSYHWWLEKSFSYSILPLTTVAFLTTGTLSTVTDTALCLSALGYSYMEFHS
FT                   CITDYVQTRQYGKYHNYALYLLGAGTLASLLGIYNLETQKGGFKGLVKSLWYGEEEEKK
FT                   "
FT   CDS_pept        588828..590966
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440016"
FT                   /locus_tag="CAGL0F05885g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59151.1"
FT                   /db_xref="HOGENOM:HBG058202"
FT                   /db_xref="HOGENOM:HBG203388"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI00003B63D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU67"
FT                   /transl_table=1
FT                   /translation="MSYSYDTCFWDPNDNGVNVLLEHVGNGIKSMDGLTTFFKLRAELE
FT                   KDYARRLGAAIDLYDKSYCEEYGALFKTIQSFFPLERSRALAHSKLSELVYRQVYSELK
FT                   SLQSELSARLTTLSGRIEKLRFDKYDKKKGCESLSVKLRDAEVRLSELNLNKNNIIGNR
FT                   RKIESLEKEQKKWESNVHEFQIQLNVLKQEYKASQKFWINEWHSLSHDLQHLEIKRIST
FT                   IQVLLQSFAQTAIDTSIIEQTKMETLINELATFTPMDDISKFSSEFGTGRLKEKRQRSS
FT                   RLVNGNTSTASKPSMEILSSSHMSRGPDPYVENIRKLSSQLQKTTVTPRVLKVSRTEGT
FT                   DNGKSYRAESNDYQMLNSSASIEHRPSSFIPSSSEPYSNSNGRNTNETLRRRVHEDKED
FT                   RRVSDHLRVGCQPKSIEREPSFVKNIEKSASESGSYSSGRHSFSPSSSSGTSSNPTDFS
FT                   HKIKSHRSMDSLATSVSSMASSIDDSQRFAKSWNSANRKRKSMSHLQSPEINISTIDDQ
FT                   LENSKNTTAQRTTHPSQSTNTFNRDVSSNTILVDPRYQSSKNSMDMSRVRSSRSIDSSR
FT                   RKSMVLDSSVNPISDALNEMERIKSGGSSTAYSDEARRKDLPSGYGRVDDNGMPVTLPT
FT                   ITKEGEEVIKFAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTTT
FT                   HGNGLIPSNFIQILHNQL"
FT   CDS_pept        591411..592799
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440017"
FT                   /locus_tag="CAGL0F05907g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59152.1"
FT                   /db_xref="HOGENOM:HBG058203"
FT                   /db_xref="HOGENOM:HBG396905"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI00003B63D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU66"
FT                   /transl_table=1
FT                   /translation="MAPFKQDSILMIYPRSGSTLVQFGLNDETFMPPTFEIPTVIYRKK
FT                   DNAGNFNYGPKEQFGDLETVEEVRPIQKGAIVDLEAFLHFLKLFYASILADKYSSNTSA
FT                   FDDDLANIPVLLVTHHTWSQLQLEMITKFVFENLEINNLLLLPLSLASTFAMVSLQNSL
FT                   VIDIGTTHTDIIPVVDYTPMEHLTSTINLGGDSINTELAKKLPQLTETQIETLKRSTIF
FT                   EVLSADAREILDTNDGEEMDEGALDVAAIVTSGRDTREVLEERERKKKQRNVKNAELDT
FT                   NSFYDDDGQEITVGKQRFEGTEKLIESISHRVGNVLAHIHDKAKARHIWENIIVVGGTS
FT                   SIVGFREALIAQLYKDHIIMEPEEERQDREDAAKASLSSKKKNKFLDNTLPTTEYIQVP
FT                   TSIKFAKYPDYFPEWKKHGYSEIPFLGAQIVCKQVFTHPKDTFYITRERYDEKGPAAIW
FT                   DIVF"
FT   CDS_pept        complement(593145..594461)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440018"
FT                   /locus_tag="CAGL0F05929g"
FT                   /product="Similar to uniprot|Q05131 Saccharomyces
FT                   cerevisiae YMR034c"
FT                   /protein_id="CAG59153.1"
FT                   /db_xref="HOGENOM:HBG058204"
FT                   /db_xref="HOGENOM:HBG332024"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="UniParc:UPI00003B63D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU65"
FT                   /transl_table=1
FT                   /translation="MLNCARWNRFLDEHPAILRVWNHPITEFLKSQWFFYVLAIFIVIA
FT                   RFAPNFARDGGLIKGEYSIGYGAVAWIFLQSGLSMKTSRLMANMTNWRAHLTILVLSFL
FT                   VTSSIVYGICCGIKAANDKNIDDWVLIGLLMTAACPTTVASNVLMTTEAGGNDLLCVCE
FT                   VFIGNLLGAFITPALSQLYTDRAPFEYGNPANGNSIGSLYGRVMKQVGLSVFVPLTVGQ
FT                   IAQNMLPKPTKIYLDFLKKYKLKIGSYMLLLIMFSSFSTAFYQRSFTSVPHATIIFVCF
FT                   FNLGIYLFFTLISYAMARPFFIPILFNEVPDESSSKFYTTMYKIFRPFYYNKRDTVCIL
FT                   FCGPAKTAALGVSLITSQYGDNKSHLGKLLLPLVLYQSIQVLTASLLVLPLRKWCADEQ
FT                   PDITPIESTDKKAIEQYMLSSSRGSSDIEKNDCIDENAA"
FT   CDS_pept        595030..595545
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000003673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440019"
FT                   /locus_tag="CAGL0F05951g"
FT                   /product="Similar to uniprot|P46972 Saccharomyces
FT                   cerevisiae YMR035w IMP2"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59154.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG450547"
FT                   /db_xref="HOGENOM:HBG596607"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI00003B63D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU64"
FT                   /transl_table=1
FT                   /translation="MSYGRTILRTAVVVGAWLPVYITVTDSVVHVARVDGASMQPALNP
FT                   GLQSDWVLLWKWGVRGSMPPRRNDVILFRSPMDTSKVYCKRVKGIQYDTISTRSPYPKD
FT                   TVHVPRNHLWVEGDNITRSIDSNKFGPISSGLVVGKAICVIWPPSRWNADLNITTGREC
FT                   ILRAPMED"
FT   CDS_pept        complement(595752..597353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196328"
FT                   /locus_tag="CAGL0F05973g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="M phase of mitotic cell cycle "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59155.1"
FT                   /db_xref="GO:0000087"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG124594"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00003B63D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU63"
FT                   /transl_table=1
FT                   /translation="MVNVFRPNDCNSSNTENGKTNHTEAKKNIFKNVQSLFSLKSKINH
FT                   SKYESTHKKAQSDIYDQPQLEPASSPFQFTNDTPELYLNIQNTNEPTDDRFSVFPMENN
FT                   LSKSVNGPRFVQSHDDFDLALKVPDLDNHVSESNFRSSRYDSKSSIDSDTRFLKMDCSQ
FT                   RRNSSTSNSSFSGRVSRSQTIREERRNRSESGRRIKTLYELDQNKNLDISEKVVTLSNN
FT                   FYQSKLTESQINIFQKEECSNPLFPRISAESLSQIILNNTHQPHYKSYHIIDCRFEYEY
FT                   QGGHIKNAININSKDDIEKQFLQKYIEMPALLIFHCEFSNQRGPNLASHLRNCDRILNY
FT                   ENYPDLCFPDIVILDGGYEKFYSKFPQLCFPRAYTKMDSVENLHHYEKELDKFRKDKRR
FT                   VTTRNNSLMKLASISSYHSLVDEDNIPNKEHAPTKSHGKLMFEGLPRPPSVKNHGPLVS
FT                   RSSASSMSSLGLEAPPKLGLAKYMDVNSFNSVGSSDAESYSSRMSRNNSFSGSVQSGKT
FT                   CNQSIDSAGTTPWMLE"
FT   CDS_pept        complement(598819..600612)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501675"
FT                   /locus_tag="CAGL0F05995g"
FT                   /product="Similarities with uniprot|P33748 Saccharomyces
FT                   cerevisiae YMR037c MSN2"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59156.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124595"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B63D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU62"
FT                   /transl_table=1
FT                   /translation="MSVEQEPSSWSTQMENMFSLNIQDQNADVKYQSPLTPNYMSLDIY
FT                   QGHKADIASNRGDANNDNGDDNEIASARGESNGRDTDNGINTNTTTTTNSSTVETNMTT
FT                   TPATLDDFLMNFDSGATTATGKDKNPLVSDKPLGTHLQMNFVDSSSNGALPFSDQKGRR
FT                   ATIYNGFFESMHLDTMLDDYLSTELLLNEKPNGSNNNNDDDETVANERRHSEVVTGNTI
FT                   NLASARNSISHGVDFWNVDSHRKRGSNNGLHRDGHVNKSITRRATGGTEKHLTDDSLLL
FT                   DSDISSHKIDNELSQILSDYNMNFKPGTEESPLKYNTADYYNFDGNSEDVSHSSAGQSH
FT                   RPFMKNPHRASLPILSEATPPEYDLDIKKKQPDVSIFKDIPWESFNAEGADENDLSVAN
FT                   QNFYNPEIISSPKSPNDKFIKPTMILSDASLAEVEMMNNSIKSLNTSLDISIPPDVLNK
FT                   DLKESWQNSQSRKSISGSSGRRRSSAALSMSNFNNNLHFNINASKSNPRRKSKPSISPN
FT                   SSLLSSNIDRNNDIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRS
FT                   DNLSQHIKTHKKSGSTSTTKE"
FT   CDS_pept        complement(601431..602150)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000263450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440020"
FT                   /gene_name="CCS1"
FT                   /locus_tag="CAGL0F06017g"
FT                   /product="Superoxide dismutase 1 copper chaperone "
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59157.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG027548"
FT                   /db_xref="HOGENOM:HBG324056"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniParc:UPI00003B63DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU61"
FT                   /transl_table=1
FT                   /translation="MTANADFYEATYAVPMHCTDCTDDIKKCLNGITGIKDLQFDISQQ
FT                   MMSVNSCVAPSVIINALRDCGRDAIIRGAGKPNSSAVAILETFEDVDLKKDTAVRGLAR
FT                   IVQVSDQKTLFDVTVNGVPFSGKYQAKIHSNGNISEGVKSTGDVYYKFEEPIECSDASD
FT                   LDKSLYSGQNFVSAPLPIWDLIGRSFVIFREGEPAYDIAGVIARSAGVWENDKQVCACT
FT                   GKTVWEERKDALKNNIK"
FT   CDS_pept        complement(602686..603519)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196329"
FT                   /locus_tag="CAGL0F06039g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="transcription coactivator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG59158.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003713"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124596"
FT                   /db_xref="HOGENOM:HBG203392"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="UniParc:UPI00003B63DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU60"
FT                   /transl_table=1
FT                   /translation="MSYYSRYRKKNNNNGGASPGNNGGNLNLAAGLGQPDAIFDLGKNK
FT                   RVTVRQFRNINLIDIREYYMDNATGEMRPGKKGISLTEDLYDEFLRHRLNIDDALRRLG
FT                   SKRPRTKTVRLLSDDEDEEADEKPISSSSEKQEAIRENKDKDSNKNSASTNSKKHKKEG
FT                   EEVEEPKKKQKKPAPPTLLPHEEKIRNLELEANATIIVPSKGKVTPPPTSDAQSQPQLP
FT                   PLATVSDAPAHTESTTGKADIANLVDHHDNSTDEEFAKTLEAEMNRADDDESEEE"
FT   CDS_pept        complement(604063..605073)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196330"
FT                   /locus_tag="CAGL0F06061g"
FT                   /product="Similar to uniprot|Q04212 Saccharomyces
FT                   cerevisiae YMR041c"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59159.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397216"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B63DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU59"
FT                   /transl_table=1
FT                   /translation="MTVDHNDITKVSKIILGGATLNTQYNDNPEEVPIVDMLKHAFTNG
FT                   INAIDTSPYYGPSEIIFGQALHKLKSPDEDGLSFTRDQYYICTKVGRIKLEEFDYSPKA
FT                   VRASVLRSCERLDTDYLDLVYLHDVEFVEFTKSMEALKELRKLKEEGVIRHFGLSGYPV
FT                   KYLAFLCNECAKHPEIGPLDAVLSYCNYNIQNTTLEKYINSIRKDAKVKLLSNASILGM
FT                   SLLRSQGIHSFHPASDELKAKCRQAAEYTHKHGVEIQDLANRYAMFNWHKYGPTVIGVS
FT                   NVAELQDAIIDYQITEKDKLPENDIKLVKHIQEEILGTEHYNETWDSGIPHPELP"
FT   tRNA            join(610507..610543,610578..610614)
FT                   /gene_name="tRNA-Trp (CCA)"
FT   CDS_pept        610882..611406
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022909" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501676"
FT                   /locus_tag="CAGL0F06127g"
FT                   /product="Similar to uniprot|P36088 Saccharomyces
FT                   cerevisiae YKL069w"
FT                   /protein_id="CAG59160.1"
FT                   /db_xref="HOGENOM:HBG370940"
FT                   /db_xref="HOGENOM:HBG704019"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="UniParc:UPI00003B63DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU58"
FT                   /transl_table=1
FT                   /translation="MSEKHHADYTNFNATDRSEALQLLIDSYEALAMDQRNWVCNLANA
FT                   ASLLWHAYKSLNVNVNWTGFYIRNGEKEQLLLGPFQGKVACQTIDFGRGVCGIAASSQE
FT                   TQLVPDVDKFPGHIACDGETKSEIVVPIVSQSGKTLGVIDLDCLDFEGFTDVDKEYLEK
FT                   LALAITKSCDF"
FT   CDS_pept        complement(611537..612466)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349509"
FT                   /gene_name="CSM3"
FT                   /locus_tag="CAGL0F06149g"
FT                   /product="Chromosome segregation in meiosis protein 3 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="replication fork protection "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59161.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0048478"
FT                   /db_xref="HOGENOM:HBG124597"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="UniParc:UPI00003B63DE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU57"
FT                   /transl_table=1
FT                   /translation="MDEDDMLMLGVGAEPTQHAEIEDPLTGGVASDPTMINDDPTAVNA
FT                   KVRRPQVKLTAERLLSPNGLPYVMKHAPKRVRISKSRSTYKNLEHIIQFYQLWAHELFP
FT                   KAKFKDFVRLCNSLGKTDADLRNYRTELFRADMENQFGDGYRSDKQNPANNSQPVTSTQ
FT                   LPNNDANSNDENNNVENDTNQLITGGQETTRHLFARDEEDDDDSDLYRSVPPPSSIAHE
FT                   SATSNTHAVPTSDTTLPISDNNPKGVTNSDGTVIGISEEDELLAMEEELNNYATQKIEE
FT                   LGDDKDTGIDPGEEEDEDALDAMKELGF"
FT   CDS_pept        613189..616296
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000093958" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440021"
FT                   /locus_tag="CAGL0F06171g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAG59162.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG192057"
FT                   /db_xref="HOGENOM:HBG448452"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="PDB:3NF5"
FT                   /db_xref="UniParc:UPI00003B63DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU56"
FT                   /transl_table=1
FT                   /translation="MFGQPRLFGANSQPFGSTNNTGSTGAFGNVQNNNVQSGFSGFGSN
FT                   NNASNAPQSGAFGANTSSLNSPFGSNNNAMGTPSNSTTSGGGLFGMQNPNTSGMAGGNS
FT                   LFGMNNNGNTGTTMMGGLPVGGMNAGAGTGTAIKPFQVVEEKDMTTNAINMYQSITFMN
FT                   EYRNYSFEELRMQDYKAGRKFANSSATSTGFGTGQNQQFGAFGNTNSAQPGAQSSPFGQ
FT                   KPASGGLFGGNGVGSTSTGLFGSNQTSTNTFGANNGSTFGNNAASSGGLFGSTNNTNTN
FT                   TGMFGSASNANSGGLFNQQNQTQQQQSSPFGASSGFGKPPASSGGLFGQTGANPFSSNN
FT                   ANTAFGQTAQQQTPNQGGLFGQSNQSQGTGLFGQSGQQQPQGGLFGQAANGNSLFGSKP
FT                   QPSTGFGQQTTSAGGFGSSGGLFGGQNTQQQGGLFNQTSQTQTGGLFGQNQPPNQAGGL
FT                   FSQTQNTNANSPFGMKSATPAGGLFGNNQGQQGGGIFNQNQNQQQGNTTGLFGGGQSQQ
FT                   TQSNTAGSLFGQKPTGFGSTAQPNTSSFGNTQSSGGLFGNKSTGGGLFGSTNTQNTTPS
FT                   FGSGGTQSLLGAKPAGGLGGLGAQQPAATQTSGLFNKPATSTSFGGTSSLFGNKAGPQQ
FT                   GSTGGLFGSNSTSNIGAGLATSQQFSNNSANQQIGNPSQNNDQEKLQQQQLLVTNPYGT
FT                   NELFSKVQQAAPGSMQVSVQIQVSATKIDADNKKKSDLISAYKHTPKPLFAAALSGKGL
FT                   VAEKTNEIKNDLDKETSTRIMNNEIDANFQQIGSKLFEPDSLMFKQLLKSKGNHRNKDL
FT                   KSKEKLFIANVADSNLNEADKDKAKNEIAKLNASQVVATTLASSVRETEKQEKIETDIC
FT                   NENAISESKLDGIDDLEFVDENYYISPSLDTLATLSKYEIQKVENLVVGNKQYGKIEFL
FT                   DPVDLSDIPLGSICDDLVVFQPMSVLLYNNSTNVPEKGKGLNVRARISCYNCYPLDKST
FT                   RKPIKDPNHRIMERYSEKLKKIPHTHFESYDPASGTYCFTVDHALI"
FT   tRNA            complement(616444..616515)
FT                   /gene_name="tRNA His (GTG)"
FT   CDS_pept        complement(616975..618324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440022"
FT                   /locus_tag="CAGL0F06215g"
FT                   /product="Similar to uniprot|Q04213 Saccharomyces
FT                   cerevisiae YMR044w IOC4"
FT                   /protein_id="CAG59163.1"
FT                   /db_xref="HOGENOM:HBG203396"
FT                   /db_xref="HOGENOM:HBG253296"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniParc:UPI00003B63E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU55"
FT                   /transl_table=1
FT                   /translation="MPNIYQPTDVVLAKVKGFPAWPAMVIPKELIPENVWKIRSRISVD
FT                   KAETKEDQDSTPDEEFGSDYDPNDYIIYSKVLKFKKNKEQPSLYCVKFMCDDSYIWVKQ
FT                   SDMQPLSVEECQEWLASKTKKNKKLIPAYEMAMKGSSGIDVWEFVEYGSMGKPDEDEYI
FT                   EDDFEEPATTRRSRSKNAKIKPMRSSSRQRKKLESSVDEDDIGEAGRRTRTRAKQTNSK
FT                   RDQLHALEDIIETPNKRTRKEQISKKVQTKKTKAIKPKIPEKEYYKYEDDDDWSIVGLG
FT                   PQETEIGKCLSAVVKKSISKKSGDRHSEMKLDLEDKILSINKLLEVSLYKMIKNDQNQD
FT                   DSLKNDLELIADEIAVALNIKGSMTEFLTVFNSNNQLIMNYRLLMNLGKKDLEKWNLWD
FT                   DFQSFFQTIYDCAFIPDSHQWEVPLEEDTNNEVQPPNEVKESIQEEILAE"
FT   CDS_pept        complement(618976..619632)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441082"
FT                   /locus_tag="CAGL0F06237g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59164.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058213"
FT                   /db_xref="HOGENOM:HBG271311"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00003B63E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU54"
FT                   /transl_table=1
FT                   /translation="MSDIDEDTSTPTGGQRERRKIEIKFIENKTRRHVTFSKRKHGIMK
FT                   KAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDDEEEE
FT                   EEEFDTSMQQGQQPQNQHQEQIAEQNKQPHTQKNNAPMDQQHMQVHQEQVAYSHDDKGH
FT                   VPEMNGQGGAPGFANGQDMHLQQQGKGPNQYNHYLNEEQNSVYQQYFQDQQAHYG"
FT   CDS_pept        complement(620431..621027)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441083"
FT                   /locus_tag="CAGL0F06259g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59165.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124598"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00003B63E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU53"
FT                   /transl_table=1
FT                   /translation="MNSQSLFGISPISSSDHINLDPDLGKMPGMPGMPGIQGQRQDQRP
FT                   QRQVQMPAHMPGQRPTVGGGDEVRGTRDYSDKGNGNGNEHEIENEQENENENENDDEDE
FT                   EVSTPSSAVGKRRKAPLKYIENTTRRHVTFAKRRHGIMKKAYELAVMTGANVLLLILSP
FT                   KGLVYTFATPSLQPLIRDDPGKELIRRCLNQDNST"
FT   tRNA            join(complement(621352..621389),complement(621292..621328))
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        complement(621735..624419)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196597"
FT                   /locus_tag="CAGL0F06325g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59166.1"
FT                   /db_xref="HOGENOM:HBG058749"
FT                   /db_xref="HOGENOM:HBG203398"
FT                   /db_xref="UniParc:UPI00003B63E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU52"
FT                   /transl_table=1
FT                   /translation="MKDSDWSGEHILRVGNDVHDVHNVHVRTTSTKTTKSNTTYNTTYN
FT                   TAYNTAYNTTNLSDGKSAERAEGALVMPQIEPQLTSFIFPDMRALYNIGIESYKDVYYD
FT                   EITVQGFEIYIVEQWIAERKLSAVISSYTGNTQDVISAVRVVLNRDPHFWPHRFKRYYE
FT                   ELLPFTQPKFISKGCIFVTNLSAMSSKLSLLHVECGDLRSVWHDFKTNFDLKKLHCTGR
FT                   SALLLSAPASSAMNKFSQLFKIPIKDVVTTDQVGSQQYQDPTTEAHLLSHKRSLEDPFS
FT                   GRGDEEHHPLTFSKRTMQERTPPAASLWKTKKGHDLPGFYSPVVEMVTLIQISLSYFNL
FT                   FKGKDKNIVDGLLSEGTKSAIEQWWLVFGRIYFGVEKPRNEGTLGPTTVASMLSLVLSC
FT                   FYKLILVDCMPAKDPFDEQDFRQGVSNFQKKYSTTTKENEGFLDPPTVEKLFQEEARLT
FT                   KNEFKKLTKTVKCKFQDIGGKGNVVQLANNVLSTDMDNFVKHIQCGSLGLLWKNKGRPR
FT                   RKDVRRICKKEFCGYSYKNGDPEKQLDEETERCNNLNEKLRLAHEEENKKKTSEMFGNY
FT                   MIDIPIIGNDLHMGDPVSSKPWRTSDAGSSEKEDDVMSKGPSAVSLSSMYCNYDKHHYE
FT                   SGLNTNQLYHSEFYRRGSSSNLQTLREESETGVLECTEVLYRSISCSDIQQQIERWTLP
FT                   FDPSVVRLARDLKKIQRETKAEAQIEDMQHGYYSIMTKKTCYMEEKRMQDLLKVSGDLF
FT                   YKYVHAARAFQNKYDGIEIKQNFLLNDMRELNSLCSKLKYDVRILDLRVRDVEEAIQQF
FT                   QRKLDTVRNTMNIGHSTIHIDTADVGTKEEFDQYIIDRYNKAHPCYQSYCLKVISKDFY
FT                   NNLKNDISGWVSWLFDGMFQKDK"
FT   CDS_pept        625184..627916
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501937"
FT                   /locus_tag="CAGL0F06347g"
FT                   /product="Similar to uniprot|P37296 Saccharomyces
FT                   cerevisiae YMR054w STV1"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, proton-transporting domain"
FT                   /protein_id="CAG59167.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033177"
FT                   /db_xref="HOGENOM:HBG022875"
FT                   /db_xref="HOGENOM:HBG629705"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniParc:UPI00003B63E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU51"
FT                   /transl_table=1
FT                   /translation="MAKHEAIYRSADMTYIQLYIPQEIVREVVCLLGKLGNVMFRDLNS
FT                   DLSAFQRGYVARLRRLEDVGRSVDYMKRVSEKHREATARYMPQLFEDEELDDLEFNATN
FT                   DNPGSNTGDDNESLLSQQNLDNLVRPSRRVNPHALFPQLLRSLEVHSMDTINDIIHEIT
FT                   EFESRVKQLDDSLESLRDKLNVLIEKRHIVFECSRYIKFNPGILGRISNSNDANVSGSQ
FT                   LDVTDFTALPEEANDNLSDFSFDIDEDTAEDNQNNNNDDDILMLEQGFHNKFMIAGAIR
FT                   RDKVMILNRILWRLLRGNLFFQNFPVEKPMMENGELVEKDCFLIFTHGDTLSAKIKRVV
FT                   DSLGGSMISLDQISQQTIQELNDRISDLEQVLESTERTLHTELLLINDQLSVWHAVFRR
FT                   ETYIYATLNLFRQETQGLVAEGWIPYEELQTLKNTLKDYSESIGSEYTTVISVIITNRS
FT                   PPTYHRVNKFTQAFQSIVDAYGIATYKEINPGLATVVTFPFMFAIMFGDAGHGFIVLLI
FT                   ALYLVMNERKFDNMKREEMFDMAYTGRYVLLLMGAFSIYTGLMYNDIFSRSMTLFSSGW
FT                   EWPTTFKKGETLEAKQVGTYAFGLDWAWHGTENNLIFTNSYKMKLSILMGFIHMSYSYM
FT                   FSYINYRHRKSRVDIIGNFIPGLIFMQSIFGYLSWAIVFKWSKDWIKDGKPAPGLLNML
FT                   INMFLAPGTIDEQLYSGQAVLQTILLLAALVCVPWLLLYKPLMLRKQHANGETNYSSLQ
FT                   HPTADDTMTSESIIDNEVVITDFDTDESESHGFNFGDVMIHQVIHTIEFCLNCISHTAS
FT                   YLRLWALSLAHAQLSTVLWNMTIANSFSSKDPGSPLAVFMVVFLFAFWFILTVAVLVLM
FT                   EGTSAMLHALRLHWVEAMSKFFEGNGYAYEPFSFDLLTE"
FT   CDS_pept        complement(628054..630723)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045367"
FT                   /gene_name="LHS1"
FT                   /locus_tag="CAGL0F06369g"
FT                   /product="Heat shock protein 70 homolog LHS1 "
FT                   /EC_number="3.6.1.3"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="CAG59168.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG192372"
FT                   /db_xref="HOGENOM:HBG202322"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00003B63E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU50"
FT                   /transl_table=1
FT                   /translation="MKLSILFLFAIAVQAAFLGIDYGQQSIKAMVVSPKAMMEIVLTPE
FT                   AKRKDTSGICIRNVNGVLERHYGNSIGSLVTRFPQNTAMHLRSLLGKSMNDKDTIESYL
FT                   RENPGANLTSTTRNTIAITIDGVEYPVEQLVAMNLQEIIDRANQHIKETDTTGIDFVEQ
FT                   VGIAIPEQFNQAQRQALLDALALTSVKDEAVLVSDGLSVAIDYALKRPDLEINVPQYYI
FT                   VFDVGTSAAKATLFSLTQPEDLSSPIKIEIGAFDSEATVGGSKFIAAIADIVEDKFLEK
FT                   NTKITRKSLVENPRARAKIIQAAEKAKLVLSANNEAIISIESLVDDIDFRTTIARSEFQ
FT                   DIFEDNKHTVVKAIKGAIGNQLWDDNISLEDISGVILSGGSSRVPMVQEEIAKLVGEEK
FT                   ILKNVNADETVINGATLKGLKYFGSFKTKPLDITERSLFDYSVEMSGESSSKTVFEKGT
FT                   KFPNESSILYKAPKKFGKELKFDLFESDTRILSNIVDTTVSSKNWTSACKKGQLYLNVT
FT                   FDLDSNRVFKIKDITVLCDSDGNAKEEEFEFIDVINDVTKATDVMPLSNAEIRQLSNAI
FT                   TSWNRKDRERKRVQESLNVLEAELYDCRSFIEEFEEKLGEEEFETLKSFTAFVKEKLEY
FT                   LEDNSADMSKKDIEKLVRETRSQRDTLSRFYNSLDAALGSKDFQKLVDTASKSIKKYKE
FT                   IESKNLADLENKAEKFNVIGLNVTEKYNSILSKMSFSSIRRSSEENIKTLAGLIDEVNE
FT                   SIKSKAIDDESLENLIKTKLAFEELINTLDLENRQWTYQHQLVMKELKKMYNKKMKAIK
FT                   KQEKQNENEENGDDEGDDEDETKTKKYLKEATSSGDSSTIKEEDSTGSNEAGNKGDEED
FT                   EEEEEDDSSAGNVFDDEL"
FT   mat_peptide     complement(628057..630678)
FT                   /gene_name="LHS1"
FT                   /locus_tag="CAGL0F06369g"
FT                   /product="Heat shock protein 70 homolog LHS1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU50 "
FT   sig_peptide     complement(630679..630723)
FT                   /gene_name="LHS1"
FT                   /locus_tag="CAGL0F06369g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU50 "
FT   CDS_pept        complement(631387..632391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441084"
FT                   /locus_tag="CAGL0F06391g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59169.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG177607"
FT                   /db_xref="HOGENOM:HBG329998"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B63E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU49"
FT                   /transl_table=1
FT                   /translation="MEKFISHPPLLVHTSLSQLRYLILSEGIPVAGNDKRKRSKRGNLS
FT                   GGDEVDSGGSEADTHSQQSIKRLRCYVWSILSRTSMERCSQKYLALLQLGPPETHILQK
FT                   IKNDTSRTLQTDPKFRAQVSEDALLRCLSCFAWEIERKKRQAGEGDTVDVSAYVQGMNV
FT                   LLAPLLYSCPSEAMAYQLFSTMCKRIIPAYLTRSLAGAQNGARLLDACLRIVDPKLSKY
FT                   LGDNLLPAEIYGMPSILTLSSCNKPLDQVCRLWDFMFAYGFHMNVLFVVAQLVSIRSKI
FT                   FESESPMNMLRQLPEFDADEIIRLGVGFVAKIPPDLYDLLIRHLTDPDIVIAE"
FT   CDS_pept        634283..636190
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045368"
FT                   /gene_name="FET3"
FT                   /locus_tag="CAGL0F06413g"
FT                   /product="Iron transport multicopper oxidase FET3 "
FT                   /EC_number="1.-.-.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="iron ion transport"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG59170.1"
FT                   /db_xref="EMBL:BAB62813.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006826"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052425"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000006AEB5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WT3"
FT                   /transl_table=1
FT                   /translation="MMVPLLLSTYFITAVYGATHTFHWTTGWGNRNVDGIKERPVITCN
FT                   GEYPWPDVRVAKGDRIEVYLTNGFNNTNTSLHFHGMFQRGTNQMDGVPYLTQCPIGPGD
FT                   TMLYNFTVDENVGTYWYHSHTDGQYEDGMRGLFVIEDGENNKNFPYEYDEDVMLSIGEW
FT                   YDTTVDVLTRKFLNLNNPTGAEPIPQNLILNNTMNLTWEVQPDTTYLLRIVNVGGFVSQ
FT                   YFWIEDHEMEVVEVDGVYVEKNTTNMLYITVAQRYAVLVHTKNDTSKNFAIMQKFDDTM
FT                   LDVIPKDLQLNATSYLVYDKSKPMPEQNYVDSIDDYLDDFYLVPMDKEELYPEADHVIT
FT                   IDVIMDNLINGVNYAFFNNITYTTPKVPTLLTVLSAGQDALNPFIYGTNTNTFVLKKGE
FT                   VVDLIVNNQDTGKHPFHLHGHVFQTILRDREFDDAKGEKPHSFNDSDHAAYPSIPMKRD
FT                   TVYLNPQSNMVLRFKADNPGVWFFHCHIEWHLLQGLAVVMVEDPISIQNTASQHLTANG
FT                   LQVCGNVKVPTQGNAAANDSDFFNLEGQNVQHKSIPTGFTKKGIIAMTFSCLAGVLGIT
FT                   MIAIYGFSEIPEPEIKVMRNLHLNPEDVLEKTSSSSVISASNSSSLEDSRNQKKKFIFF
FT                   "
FT   sig_peptide     634283..634333
FT                   /gene_name="FET3"
FT                   /locus_tag="CAGL0F06413g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WT3 "
FT   mat_peptide     634334..636187
FT                   /gene_name="FET3"
FT                   /locus_tag="CAGL0F06413g"
FT                   /product="Iron transport multicopper oxidase FET3 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WT3 "
FT   CDS_pept        637000..637380
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196598"
FT                   /locus_tag="CAGL0F06435g"
FT                   /product="Similar to uniprot|Q04675 Saccharomyces
FT                   cerevisiae YMR059w SEN15"
FT                   /protein_id="CAG59171.1"
FT                   /db_xref="HOGENOM:HBG058754"
FT                   /db_xref="HOGENOM:HBG396040"
FT                   /db_xref="UniParc:UPI00003B63E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU47"
FT                   /transl_table=1
FT                   /translation="MSNLTERVRDNLLHFHLWTEVEEVPKQLNWKDDRIINILVGRPPH
FT                   KLSNDDDEEQEGDCKRAKKEYILPVEMSMYKEGYLTLELLDKIFDDLCAASTQRLLLGI
FT                   VNDDGTVLYYFAHKGIYKPKKN"
FT   CDS_pept        complement(637495..638397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441085"
FT                   /locus_tag="CAGL0F06457g"
FT                   /product="Similar to uniprot|P50110 Saccharomyces
FT                   cerevisiae YMR060c TOM37"
FT                   /biological_process="protein targeting to mitochondrion "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG59172.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006626"
FT                   /db_xref="HOGENOM:HBG124599"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="UniParc:UPI00003B63E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU46"
FT                   /transl_table=1
FT                   /translation="MTGSVLYLWGKDRASGISGESIALEWYLKSKALREVEIVFANNTD
FT                   ISPLGRLPVLKVCSNGDYIHGFLNIVDYLEPKRKDEFTDMEKLMELSAMSMLDSNLKTL
FT                   NEYQLYLDKNNYITFTRKELSQLLYFPFNFNAAYEYRNRAKEQCVDLEYLPVEEKEDED
FT                   EDDGPADYELAQSKTFALRGLRKRQRAEELKSVRLNRNYMHKLLEFLDQWDSITDDLPK
FT                   TSPVPILFYSYMYIQLVILPNNNEICKYLKEMKSNGYVDTLKETFTKYNALDFNLNVRE
FT                   PVFRERGDLISTLLNKISV"
FT   CDS_pept        638792..640732
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441086"
FT                   /gene_name="RNA14"
FT                   /locus_tag="CAGL0F06479g"
FT                   /product="mRNA 3'-end-processing protein RNA14 "
FT                   /function="binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59173.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG058756"
FT                   /db_xref="HOGENOM:HBG203401"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B63E9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU45"
FT                   /transl_table=1
FT                   /translation="MSTTNEETQANASKDYSEDALKMSYAAQPLDIMRALKLIEYYESK
FT                   DDYDNSRKLYAELHERFPLYSPLWTMHLQSELQRNEFDTVEKLLAQCLAGDLENNDLSL
FT                   WSTYLDYVRRKNNLITGGQEARAVVIKAFKLVMDKCATFEPKASSFWNDYLGFLHQWKP
FT                   MNKWEEQQRLDMIREVYKKMLCVPFDKLEKMWNQYTLWEQETNTLTARKFIGELSADYM
FT                   KARSIYQELLNVTANIRRTSPLNLRTANKNNIPQYVLPCKKNDHTQLEAWLKWIAWEKE
FT                   NKLELTEDALKDRVTYVYKQAIQQLLFEPEIWYDYVMYEFDNDAARKNILKVALQANPT
FT                   SPTLTFKLAECYEVENKSEEVQNCFEKTIDELLRQYKNDNGNDELSSDIIWERKTLTYI
FT                   YCIYMNTMKRLSGLSAARAVFGKCRKLKKAMTHDIYVENAYLEFQNQNDHKTASKVLEL
FT                   GLKYFGDDGEYINKYMDFLSLLNRGSQMKTLFETSIEKVEDLRQLKKIYVKMIGYESKY
FT                   GNLNNVYQLEKRFFEKFPDTDLIQLFSTRYKIQDDNKIKNLELTYKLPDIISSDGDPSG
FT                   VDKSFKKRQIENDENLPDSKRQKSQPLLPKEILDILAVLPKKQYFKNAFLDPSNLVNYL
FT                   NEQVKLADEEN"
FT   CDS_pept        complement(640833..642158)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000022798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441087"
FT                   /locus_tag="CAGL0F06501g"
FT                   /product="Arginine biosynthesis bifunctional protein ArgJ,
FT                   mitochondrial"
FT                   /function="acetyl-CoA:L-glutamate N-acetyltransferase
FT                   activity"
FT                   /function="glutamate N-acetyltransferase activity "
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG59174.1"
FT                   /db_xref="GO:0004042"
FT                   /db_xref="GO:0004358"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="HOGENOM:HBG001007"
FT                   /db_xref="HOGENOM:HBG284202"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniParc:UPI00003B63EA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU44"
FT                   /transl_table=1
FT                   /translation="MKISKTLLQHGRKVIDKYNLYVPTEGVFPKGYKVGSIASGVKKNG
FT                   NLDLGVLVNTNTSRPSSAAAVFTTNKFKAAPVLTSKKVLESTQGNGINAIVVNSGCANA
FT                   VTGELGMQDAQEMIDLVNRKIGKPNSTLVMSTGVIGQRLQMDKISAGIKNIFDNNALGN
FT                   DFKSWLNIAKSINTTDTFPKLVSRQFELLNGQKYTLVGMAKGAGMICPNMATLLGYFVT
FT                   DLPIASSALQKILRFATDRSFNCISVDGDMSTNDTICMIANGAVETDEITESSEEYEQV
FT                   KSQVTEFAKTLAQLVVRDGEGSTKFVTVNVQNSLTFEDAKIIAESISNSMLVKTALYGQ
FT                   DANWGRILCAIGYAKLDNLKSLNTDSISVSFIATDNSEPRELKLVENGVPQLDVDEERA
FT                   AQILALDDLEVLVDLKTGNESAQFWTCDLSHEYVTINGDYRS"
FT   mat_peptide     complement(640836..641516)
FT                   /locus_tag="CAGL0F06501g"
FT                   /product="Arginine biosynthesis bifunctional protein ArgJ
FT                   beta chain"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU44 "
FT   CDS_pept        complement(642553..644835)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441088"
FT                   /locus_tag="CAGL0F06523g"
FT                   /product="Similar to uniprot|P36009 Saccharomyces
FT                   cerevisiae YKL078w JA2"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG59175.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B63EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU43"
FT                   /transl_table=1
FT                   /translation="MRTFSGARDGHNKKSQRERVSPFKINNVSTKSHYKDAGMHKKNGK
FT                   VNGGPIKHNGKIGREVKFGDEEDEDDEDSYDDNRMMNKADLKKKAQELLRIRSTLPVYS
FT                   NRDEIMPYLLENQVTILIGETGSGKSTQIPQFLLEDLYKQNKRGSIAVTQPRRVAAISL
FT                   ATRVAQEFGSRVSDKVGYSVRFDNATSERTRLKYLTDGMLLRELMMNKDLKEYSVIIID
FT                   EAHERTVLTDLILGLLKTLITTTRKDLKVIVMSATLQAEAFSNFFDKAPILFVEGRKFN
FT                   VTQYYLKAPSDDIIDCAINCCVQINQGEQLGDILCFLPGQEEIDKAVTIMNKIAPVIAK
FT                   ETSVPLMLAYPLYAALSPAQQASVFNPVKGFKRKVVFSTNIAETSVTISGVKFVVDSGL
FT                   RKVKVWRHQLGLASLLTVPISQASAMQRTGRAGRESEGKSYRLFCEDDFSKLPKQTEPE
FT                   IVRSDITSPVLMLKRYGVNDLVNWTWFENPGKEAIIQGLQELYHLKALDDSGKITNIGR
FT                   KMALLPLLPHLSCVLIKASETDCINQVIDIISCLSVENLLLNPQPEQRDEVNEKRLSSC
FT                   NAGKKYGDLIMAKELFDIYFYDLGNGSNATQERKEWCKDLCVSYRGFKNVLKIRSQLKS
FT                   YCKKIFDNTHLKPDDDDEISGEQFKLNANEDEIKTILKCFLSGFSKNTAIGMPDRSYRT
FT                   VTSGETISIHPSSLLFGNKQCPAIFYTEYVFTTKGYARNVSRIELSWLQDIVSSNATAM
FT                   GRRSLKG"
FT   CDS_pept        645359..646099
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501938"
FT                   /gene_name="RIM9"
FT                   /locus_tag="CAGL0F06545g"
FT                   /product="pH-response regulator protein palI/RIM9 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG59176.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124600"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI00003B63EC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU42"
FT                   /transl_table=1
FT                   /translation="MHLFDLRTLLAILVSICVVFQAFPLATVPLNKNLILGQYMGYHFG
FT                   VFGWCFVDKGVTIACHCKFRPDSIETYKYTDQLLFPSLYKVTISTLLVVHPVSFAFTCI
FT                   LWIMALIIRLSRFGRCPIFILSAATWSLAAFLLALLSALVDLLLFVNKLKWPGWLVLAS
FT                   VPLMAICCSWLWSLRRQVSAIFYERKAYATQTYSRFDSMELSHIDTKFSDDQSIYETYT
FT                   LERVPYSKNEAIEEPALTYYTSSS"
FT   CDS_pept        646495..648012
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441089"
FT                   /locus_tag="CAGL0F06567g"
FT                   /product="Similar to uniprot|P32493 Saccharomyces
FT                   cerevisiae YMR064w AEP1"
FT                   /protein_id="CAG59177.1"
FT                   /db_xref="HOGENOM:HBG124601"
FT                   /db_xref="UniParc:UPI00003B63ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU41"
FT                   /transl_table=1
FT                   /translation="MSTSGTTKGIPIPLNIFKRKSIPFGRISRVTPKPEQLLHPFYRPG
FT                   NVSSLGLCMKEGKPALLDSKSIIPSIVQNSKTGNPVLANCSLAFSSVQGVSTWLKQYEN
FT                   LRETRTTPFSTIPFPDLNRYLTSLPKSKVEIIEKAYTNLINNDGSHISKGIILELVHEL
FT                   SSDFELAVFSENILIFFLNDKVSKRSELACVLEAAFDLLDTHIDQPKTIYKFLMAFFAK
FT                   YFEVPVQTDTDLNTLMVKLLMKLENKFHLESMYSKMVPELTEALFSFYTREGNLHEANI
FT                   AINDLIKKGFIPKSEDIENYLTLINTKYPGHNSQDYMWRLFHIAHFEGLIQSSDHPNLL
FT                   KFLVQNCRHREEIETVFTIVAKNKNSKILLEHLTAPVIDSISNMKMHRVPKSSLLSDYY
FT                   KMMKFAFNNELSHQLKLLLLQGYITFGNFSMSAKIIEDNHLNLTVDIANKLIKIIKHNN
FT                   KLFKGIDCPGFSEEALALFLECYIKPFEDELNQHSKKWLIRQQHYCK"
FT   CDS_pept        648302..649711
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441090"
FT                   /gene_name="KAR5"
FT                   /locus_tag="CAGL0F06589g"
FT                   /product="Nuclear fusion protein KAR5 "
FT                   /biological_process="karyogamy"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="nuclear membrane"
FT                   /protein_id="CAG59178.1"
FT                   /db_xref="GO:0000741"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="HOGENOM:HBG124602"
FT                   /db_xref="InterPro:IPR007292"
FT                   /db_xref="UniParc:UPI00003B63EE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU40"
FT                   /transl_table=1
FT                   /translation="MSMSITQPIKDLLSSQFQSYNISEQVKLYDIFPLLKPSCIKEAIT
FT                   DVVEVCTGYGPESLDPSIRAKAAVKLSLCEFEAVGLSIIPQGCYSNSIEEMMDCMLEIE
FT                   HSSHWWTTYSGNYQRLSDVCSTYREYYQEKAIIETFLNITDFMADFHNQFKSSVVSETQ
FT                   EFQSNMKDKFAGVYNQFTHFESLLSQMIQKHSGIINDSIVAIKNKLSTEFVDELQMLKN
FT                   DRYILINQILESDTEIKKTIDSMLVELTEDMKNQISAKSEFLINHMNITRLNESTALHD
FT                   IIEENLQERFKDIAIFLDKFMVEIQTETNKVLLEVNEKLPTLEQQYLGNFAQALSNIDK
FT                   QVLSASLQWQYDYDVVFANLYAALDLLNSNLNSSVKKIEQIEHVIDTIIVDTSFLNDQL
FT                   ANLILIPSTILRAFSFIGVKRVIIAIIVLYFKSTLLCLVHYGQSFRIAALLMSATAGIF
FT                   CSKLLMSYIYN"
FT   CDS_pept        650449..653040
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501939"
FT                   /locus_tag="CAGL0F06611g"
FT                   /product="Similar to uniprot|Q04748 Saccharomyces
FT                   cerevisiae YMR066w SOV1"
FT                   /protein_id="CAG59179.1"
FT                   /db_xref="HOGENOM:HBG124603"
FT                   /db_xref="UniParc:UPI00003B63EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU39"
FT                   /transl_table=1
FT                   /translation="MIRHTLRLIRYPSFSICFRVARAYRSYASSHIPQLKSDQLKSSAR
FT                   EHHRQDLGLKFNDPLKKSGFQEVNTIKHLEETLIQYFDFISNGFKKSKKNLVKLKKDLH
FT                   LLHTDVSAKERFSYVFQFLLAETQMEIARYNSLGPQAIKNLADTASSYKNLKEEAIEND
FT                   DQLESAIMNVIFDDNLKDTTKTVLPYTELLLNLLGNMSKSSWEKNSELLELDNVAEAYE
FT                   IAKLIPLEDMKKRGIFWGGKILYDSRKVRLDPVNESFYIDALVYFGKYKEAFKLFNTYR
FT                   DKVNQRWWLELGMMIALRSNHIKAFQTLLIEHDSNYGLNGYISSKVARLAVKRYLAIRD
FT                   IAKANTMTDRVLNSAKQLGIKTETANNEYNNFNSEADAYKYLNTVEPPTVHDLVSIANY
FT                   HIFARNTEKVYDIFAVYFSSVGNSDPGFEFCITKTRLTMLKNLNELETALKDRIEQNVV
FT                   PSILEVLYQSYEDLRKETNMSEIIAKEIYFDSLRKLGDKKSYTLALEKLVDGADNYPIK
FT                   SEVGDSDHLRNQKIIAGVIKLMLWNGQEEKASRFLTELESSSQNSKSNHKESLLNSHHY
FT                   ALFISHYSNKSKKHRKSLRTKVNDIIDTMHVENIQPTATFWSSLIAFYRRDFDLDAAFS
FT                   IINGILQDNQVSIDDKEIPIERNFYERRVISKKLYNEIWMTYAFYYNLRKVSSVHETFD
FT                   RCHKAFFHASKDICSKMQHFPEISSRCLFRRMITQDNILPEPHLYIRVIKTFLKQGDLE
FT                   GLYAVLLMMTKVHGLSISESVQKYILKGLQNLKKEYISQGEQQTSDKYFDNRSLKKIGL
FT                   NEEEQSDALNENNNVKEHKVFNELLELMQSRNISYKESLSETCQEMGVPYE"
FT   CDS_pept        complement(653273..654562)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045369"
FT                   /locus_tag="CAGL0F06633g"
FT                   /product="Similar to uniprot|P54730 Saccharomyces
FT                   cerevisiae YMR067c"
FT                   /protein_id="CAG59180.1"
FT                   /db_xref="HOGENOM:HBG124604"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR021569"
FT                   /db_xref="UniParc:UPI00003B63F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU38"
FT                   /transl_table=1
FT                   /translation="MSSVHVHHNVSSLKVPVNGSTTLKDVLNVATKHYNLDPERYTLQK
FT                   DYETLDLSVPWRFLNMAQNSKFELVEMQVREDNAIAEPPKTIRIRFQIVDRGSFIKELS
FT                   NNITLDKALQEIIDENQLDFAIHNAHLQCFGRQVPAELLASTTLNSLGIQSASNIKVLI
FT                   TDRDQIAQPHLKRESEESVESPEKIQLVNEKEITEPIKVSKPHELHKPQVYLPPKTSVS
FT                   ERVRNEIDNNIADDDYELTIEHAKLYQSMLAKQTGSLGGPLMTQRMRQMQDNVKNNKHS
FT                   VDECFIRFKFPDLTQIEISFSPEDTMHTVYNIVRELLISTDLNFGLYRTHPHLLLDDSE
FT                   LRLVADLQFGAKTALLFEPNNKSNKGPYLRGSVIDSGESISNIIDPKINTTADTETEKE
FT                   PSPTRKVSAAFSSSSTGPKKIPKWLRLSKK"
FT   CDS_pept        654908..656134
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441091"
FT                   /locus_tag="CAGL0F06655g"
FT                   /product="Similar to uniprot|Q04749 Saccharomyces
FT                   cerevisiae YMR068w"
FT                   /protein_id="CAG59181.1"
FT                   /db_xref="HOGENOM:HBG058762"
FT                   /db_xref="HOGENOM:HBG203408"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B63F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU37"
FT                   /transl_table=1
FT                   /translation="MLEDPSLRLRKAIKEGNLLIVKRLLRRFPDLLTNIDPCNGWSSLH
FT                   YASYHGRYLICVLLIQLGHDKTEVLKTFKGNTCVHLALMNGHEQTTHLLLQHFPRFINK
FT                   AGELGRTPTHIACIHDYYQCLSLLIGVGANLMMKDDKGNTPLHLCLEFGSTNCMKMLVN
FT                   EIQISDDSIRNNDNWRPSDVAKTVELAKFYKKIRKESAATDNLKKPSFQSFKTPVLTSK
FT                   AVFDDGPSPVLSINSSQIGNTGTNNINNSPLPRLQGIFTSRRPSVPTLNEIHNGNDRSP
FT                   LSGANAFGLSKSSSTRSASSPSHIVRNKSLTYLGVKDKPRMGKFEVNTESDSSRSNIFG
FT                   GSDNSALINRYLIPSKSINADDAATSEDSSKDLNSPTSISFNPHRRVSLLNIPISKLRN
FT                   DGSTNDQNN"
FT   CDS_pept        complement(656199..657539)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441092"
FT                   /locus_tag="CAGL0F06677g"
FT                   /product="Similar to uniprot|P08539 Saccharomyces
FT                   cerevisiae YHR005c GPA1"
FT                   /function="GTP binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /protein_id="CAG59182.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG163560"
FT                   /db_xref="HOGENOM:HBG444960"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniParc:UPI00003B63F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU36"
FT                   /transl_table=1
FT                   /translation="MGCIISTSSNEDENDPFIKNKRANDIIEQSLLKERQKEKNEIKLL
FT                   LLGAGESGKSTVLKQLKLLHKGGFSHQERLQYAQVIWADVIQSMKILIVQARKLGISLD
FT                   CDDPVNHPDLFEHKRVLLSAKALNYVDASVAGGSGFLNDYVIKYSETYALKRRSQSTGK
FT                   AKAFEDSFQYPYDDNEKLNLEEISKGLHENDDGSIFINSKQIKSPTVNNKTIAAAISNL
FT                   WLKDRGIKQCFACANEFQLETSAAYYFDNVERFSENNYVCTDEDILKGRIKTTGITETQ
FT                   FNIESTKFKVYDAGGQRSERKKWIHCFEGITAVLFVLALSEYDQMLFEDSTVNRMHESI
FT                   MLFEKLINSRWFKDTPFILFLNKVDLFEEKVKREPIRKYFPDYPGKVGDEKAGIKYFEK
FT                   LFLSLNRSNKPIYVKQTCATDTETMKFVLSAVTDLVVQQQLKKSGII"
FT   CDS_pept        complement(658346..658627)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441093"
FT                   /locus_tag="CAGL0F06693g"
FT                   /product="Similar to uniprot|P87108 Saccharomyces
FT                   cerevisiae YHR005ca MRS11"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAR58023.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00017BD67A"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMZ9"
FT                   /transl_table=1
FT                   /translation="MSFLGLGGGAPQLSSQQKIQAAEAELDLVTDMFNRLVSNCYTKCI
FT                   NNAYNEGDLNKNEANCLDRCVAKYFETNVKVGENMQKLGQTFNAAGKF"
FT   CDS_pept        complement(658958..659539)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045370"
FT                   /locus_tag="CAGL0F06699g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59183.1"
FT                   /db_xref="HOGENOM:HBG124605"
FT                   /db_xref="UniParc:UPI00003B63F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU35"
FT                   /transl_table=1
FT                   /translation="MGRINHKPLINGKRHEFKRKLNDKVEDFVRKSQKTITTRMNKVEK
FT                   KINDVGESENSLLSSVSLTLKTISKSSPIRNGPNPLSYCMSCPTKCREHRQPFKTPYRA
FT                   HQEPKVQYVRSTTQRSRFTAKKFTKSYRSDPLPRLKLRPYNHPWDSPLSKRDKSIQLNP
FT                   YCSERARPITFDIKPPKFTRMPYGKATKFL"
FT   CDS_pept        660254..660766
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045371"
FT                   /locus_tag="CAGL0F06721g"
FT                   /product="Similar to uniprot|P15367 Saccharomyces
FT                   cerevisiae YIR022w SEC11"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59184.1"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG292459"
FT                   /db_xref="HOGENOM:HBG564658"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI00003B63F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU34"
FT                   /transl_table=1
FT                   /translation="MNLRLELKRFLALCFMFSSAYMTWKAMSLVANSHSPIVVVLSGSM
FT                   EPAFQRGDVLFLWNRNQRNKVGDIVVYEVEGKQIPIVHRVLREHSHTANPGKQFFLTKG
FT                   DNNAGDDIPLYSARNIYLNKEKDIVGTVVAYVPLVGYATIWLNESEKAKYAIMGLLGLS
FT                   ALLSGEE"
FT   CDS_pept        661325..663730
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045372"
FT                   /locus_tag="CAGL0F06743g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59185.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058323"
FT                   /db_xref="HOGENOM:HBG398265"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B63F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU33"
FT                   /transl_table=1
FT                   /translation="MDSGSGGNVNGNSGSPNGSDRTSGDLGSRQHFIDDGQSRIEDLLP
FT                   EAHDNKDGGTAEGNDLLGFKENYDSFLSDLSNNGDKTKLHIDDQNPNFAELLSEYDSLV
FT                   NDVFSPEAENKCDGCKKENVKCTTKSDMTGCYNCQEKHIHCSLDQRSPQDLGPVISRKR
FT                   SNQSERSSIDLKRGKSSNFDSPSSFFNDIKSHSPQSVGKQNLNRSSSNKSHQSSVQYSP
FT                   GSTKSQYNMMTQSRQSPQPPIQYPRSSFYLGSSSIYDTKLINSIKLDSIDQVQLSPTVA
FT                   LRRVAPNVQFMLKDDYNQEVYLKQEQEVDLVESLIYPHGKALVEMFFKLVHPYYPILHE
FT                   RVFLEKYSRSYRELTAPLLASIYSLALQWWDFHPGFIGFPKPDVIEKLNSIAFETFLNR
FT                   IERPKLSMVQTGLLLLLCRSECTNNWVISSCLVALAEELGLGIECQEWRLPKWEKDLRK
FT                   RLAWAVWAQDKWTALLESRHSHLILGRNWMVQMLSVSDLPINSPMITENEAESSIDIAI
FT                   GAPMFQITPTMDDFKNGALIFQYYVSLSIILGEIMDTFYTLGSIHINTSIEQVLRLAKP
FT                   LQLKLREWYRQLPPQLSMSKFESKKFNCNATLTLCYFTTEITLHRKIIASIKPDTPEEI
FT                   KKVCRTAARTRLVAAVEFIRDLKSEHTNAFWFPSATGSIMLIGSFAALLYTSSESKEES
FT                   KYLSDLVRHYIWILRVGSKTFDKFGHALTNMHALFVEIPGLLNNDVGDNEPEYKGKAPS
FT                   YGSPPTSNKTFGGSNASSWQGSPSSFSKSHSNGPEKSFSRSDQASPSN"
FT   CDS_pept        complement(664103..664771)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142363" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349770"
FT                   /locus_tag="CAGL0F06765g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59186.1"
FT                   /db_xref="HOGENOM:HBG124606"
FT                   /db_xref="HOGENOM:HBG203020"
FT                   /db_xref="UniParc:UPI00003B63F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU32"
FT                   /transl_table=1
FT                   /translation="MLRTTLRTIVRNTSYGGITSRCASSVAAPAAKKSRFDKSVVKPLL
FT                   VLVVFGSVLTNVMEERRKYSDMERRYQLKINKLEELIERANVGEKNLDIAAELKIIDAL
FT                   FKVSQNQRYTGIIGNTKHHNGPSTPLKSKQDNEESLEDIWQELVSSLEEDELKLKREQE
FT                   LNKAKLSNELVTDKQLLKEQKKKEELEKNLVPSHATHTIVSTPGEVSEAAKDTSLKRFV
FT                   "
FT   CDS_pept        665038..666156
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441094"
FT                   /locus_tag="CAGL0F06787g"
FT                   /product="Similar to uniprot|P40577 Saccharomyces
FT                   cerevisiae YIR025w"
FT                   /protein_id="CAG59187.1"
FT                   /db_xref="HOGENOM:HBG124607"
FT                   /db_xref="InterPro:IPR008402"
FT                   /db_xref="InterPro:IPR016807"
FT                   /db_xref="UniParc:UPI00003B63F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU31"
FT                   /transl_table=1
FT                   /translation="MDSIVPGVELLDGSESQSLLNIALFEQIKEKLNRQQGLRHKNNAA
FT                   HLRGQIGLREGTVNNESEDENQGDEAPYIPPLSAYSATSDEPYLPLRSIKKGCFKVSIA
FT                   AMKYDDFERRMYQIRKTGWHTLKPIGVAKTMAEIRREQRHKKEGSSNPESSQPETATEP
FT                   DVDMLHQENINVAYTATNNRAYSNNTDVGAAIQNQERVLETSVEPQNRDNSFSVQGIGQ
FT                   DVNEGEEEEDEEDEISYDYDAEFARVEVEDEESDFQNRSNFFDSSNISDLNHGVTAGIN
FT                   DNEATGGLSIQQFVETTAPNQNPYDDVYDESESNTRRVHLDPDESIDRISSDFVSDNQE
FT                   FTEMPTVDISDTINESDIMRSSRVSSLQNQQQ"
FT   CDS_pept        complement(666263..667348)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441095"
FT                   /locus_tag="CAGL0F06809g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAG59188.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG058317"
FT                   /db_xref="HOGENOM:HBG588460"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016278"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI00003B63F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU30"
FT                   /transl_table=1
FT                   /translation="MEVTRVLGGIYMGGFTPLANHTPLKAEYNITHILSVIKLDTIPEY
FT                   LVRKGYTLKSIPIDDDDTTDILQYFNESNKFLDHCLYPYEQEYDPALVDFRKKKQDPQN
FT                   AVYVHCQAGISRSTSFVVAYLMYRFGLRLKDALHAVRRKRPQVEPNPNFMEQLQVYAEM
FT                   GANRVDPDNQLYKTWKLAQSIKVDPTGRDILSKDDTYKDSSNEDQELDKLTKEELSQTT
FT                   VIRCKNCRKRLALSTSFIKHDPPSKQSSEGHFIRRAAGSRRIIDIQESSTTCSHFFVEP
FT                   LNWMKQELQGKQELEGKFSCPGCSYKVGGYNWKGSRCSCGKWVIPAIHLQSSKVDHFPL
FT                   AERTLPNMVNFKPSNVPLPKN"
FT   CDS_pept        668173..671451
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196599"
FT                   /locus_tag="CAGL0F06831g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59189.1"
FT                   /db_xref="HOGENOM:HBG191231"
FT                   /db_xref="HOGENOM:HBG203023"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B63F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU29"
FT                   /transl_table=1
FT                   /translation="MNFMKDTLDLDVLNYLDRDEVPADMMDMGMMDMNMDDPVLFNQNT
FT                   DTNVQMSDDYLAEFLQETADTNANTNMNTNTNMNTNTNMNTNTNMNANTNTNANTNTNT
FT                   NTNTNANTNTNTTAKKVNYGRLAPIDTQYVNPADFVDIRSDSLPHMLSVSGLPQVSRVE
FT                   NQLKLDFELSPQANLSDIYLSSDCIARQKFYLEKNIEEYPQEFRNSLIYLDAFLICATN
FT                   RKSIDVCTKCVRREQRRAARRKSGISDNMLWCNNPNRRAVIFNNKQIVKTSVNPQTGNQ
FT                   VFSLTTRIVCYCRHHKSLEGFKILFVLKNSNNDILAKSITSAIMITDRKLFFNNTNGGM
FT                   GEVGMSLSNDGMNTSRQQMGTDNEDTDTSNHNIIYSETAVESSGATSATEFQAMRKDSV
FT                   VQPTPMQNVSTNGLLPPNAQKFPENMSMNIPMDNSFNLSKKKGHIPSPTSMSEDGSESQ
FT                   GLMMSAFGTTSSRVPMVNNERKRSRIHLDNTNMTPSQNISRSMSRTSMSSNYQSAASPS
FT                   QFSTNQIISSMSDINIKNSPNSSTMLSEVPIIHKVIPSQGPINGGIEVTLLGVRFKEGL
FT                   IVKFGDNLALSTECWSDSTIITYLPPALNAGQVYVTVTDPNGTAEQQMISNQLKKAIFT
FT                   YVDNTDRQLIELALQIVGLKMNGRLEDARFIAKRIVGSDGSSPGLQGSNNNSPNNINSN
FT                   GQYSMDNQVKYSDEILITKVVKNLNTTSNLSMCDNLGRTLLHLASLKGYFKLVSTLIKK
FT                   GARIDDKDSFDFTPLHFACVSGDVKIIRILLDCGADKNRKTKHGLLPLELFEINHGYGE
FT                   KEHSDHMTEVVKMFTEDESAESGMGRKLSTSSFNSSIFDSESLQSENANSHDNEIDNEY
FT                   PVYSDGSDYEDSDYEEEEDEDSDLLPIEQAHVTNEQCDEHEPGNETHKTEESAIDNTNN
FT                   ESLWNRVLHRINDDLPKYEDLFPRATDEGETSLTKTEQSRSGAAVLQRDISHTEDSQGS
FT                   SEDEEEALQRGFNKFFQNRQNFQNDKMLLFFWIPLTLVLMTWFIFFNFGWRDNTIQYFS
FT                   NLLTHYVRIGLAKILLGNERMKTAFREQFSNFQSTGILNDLIVG"
FT   CDS_pept        671942..673108
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501940"
FT                   /locus_tag="CAGL0F06853g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59190.1"
FT                   /db_xref="HOGENOM:HBG058447"
FT                   /db_xref="HOGENOM:HBG396948"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B63FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU28"
FT                   /transl_table=1
FT                   /translation="MSRNQFRIVVGSYEHNLLCLSLDLTLETPVFTPIFHFQAHSLSVK
FT                   CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKSTSGKW
FT                   LLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMT
FT                   VKKAAVLKLKKYNQNGQFVRWLKAQGKYFAVSLMTKVLIYDSTTAKVYREIDTGRKTIM
FT                   HMETVVLADVEYIVLGMSDGKVLFYKVEEILNSKETEFTEEPEFSLLGHTNRVKDLKFY
FT                   VNEFGTYMVTIGSDGKVIVWDMDKRDQVAVYDCGERLNCLAVCDETIEKADTMKKRTID
FT                   QIELGEQSEVESDTEELKKVMFGQKKKNQKRNKNKNKNKKKKVEVQLE"
FT   CDS_pept        complement(673222..674340)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000143704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441096"
FT                   /gene_name="LYS1"
FT                   /locus_tag="CAGL0F06875g"
FT                   /product="Saccharopine dehydrogenase "
FT                   /EC_number="1.5.1.7"
FT                   /function="binding"
FT                   /function="saccharopine dehydrogenase (NAD+, L-lysine-
FT                   forming) activity"
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59191.1"
FT                   /db_xref="GO:0004754"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053834"
FT                   /db_xref="HOGENOM:HBG331053"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B63FB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU27"
FT                   /transl_table=1
FT                   /translation="MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIF
FT                   KIDEYRRAGAIIVPFGSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWK
FT                   DVLRRFINGNGTLYDLEFLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSEDLP
FT                   AVSPYPNEKALIKDIGKAYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENI
FT                   IKWDIQETSRGGPFPEIAASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADT
FT                   TNPHNPIPIYNIATVFNKPTVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSL
FT                   EQLPSRHVSPVWVRAEKLFNRHSARAIRESKL"
FT   CDS_pept        complement(675416..676192)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17441097"
FT                   /locus_tag="CAGL0F06897g"
FT                   /product="Similar to uniprot|P40579 Saccharomyces
FT                   cerevisiae YIR035c"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59192.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00003B63FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU26"
FT                   /transl_table=1
FT                   /translation="MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPL
FT                   KALKDTYGDRFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDV
FT                   NAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNH
FT                   FAMTLANEEKAVRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHS
FT                   SIPATVYSKLALNGIPEEINGQYLSFDAEVLKEFQH"
FT   CDS_pept        complement(677473..678225)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI17441098"
FT                   /locus_tag="CAGL0F06919g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59193.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00003B63FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU25"
FT                   /transl_table=1
FT                   /translation="MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLK
FT                   DTVGARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWK
FT                   KLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMS
FT                   LAAENKAIKTIAVAPGVVDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPG
FT                   KIYARLAVSGIPAELNGEYVRYNDSRLQ"
FT   CDS_pept        679960..683502
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196600"
FT                   /locus_tag="CAGL0F06941g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="pyruvate carboxylase activity"
FT                   /biological_process="gluconeogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59194.1"
FT                   /db_xref="GO:0004736"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG185226"
FT                   /db_xref="HOGENOM:HBG717218"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI00003B63FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU24"
FT                   /transl_table=1
FT                   /translation="MPQSGQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHEL
FT                   SMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHP
FT                   GYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIK
FT                   TVEEAEAFVAEYGYPVIIKAAYGGGGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCF
FT                   VERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILT
FT                   DAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIA
FT                   AGASLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGN
FT                   AYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPV
FT                   FISGQYWTTFIDDTPQLFHMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLSTKPNI
FT                   PHLHDEKGEIISVTKVAPPDGWRQVLLEKGPEGFAKAVRAFKGTLLMDTTWRDAHQSLL
FT                   ATRVRTHDLAAIAPTTAHALAGAFALECWGGATFDVAMRFLHEDPWERLRVLRKLVPNI
FT                   PFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGVDAVKKA
FT                   GGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLI
FT                   GSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGADVVDVAINSMSGMTSQASINALLA
FT                   SLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADLKGPDPEVYDHEIPGGQLTNLLFQ
FT                   AQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVVGDLAQFMVTNQLTSEDVKRLAN
FT                   SLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRKLTVRPGLELEPFDLESIREDL
FT                   ENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLPTKNFLAPPSIGEDIEVHLEQ
FT                   GKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRSQKVEKVSKPKADNHDPFQI
FT                   GAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAENVEAS
FT                   DLLVLLEEEIPPQE"
FT   CDS_pept        complement(683862..684500)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441099"
FT                   /gene_name="DUO1"
FT                   /locus_tag="CAGL0F06963g"
FT                   /product="DASH complex subunit DUO1 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="CAG59195.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124608"
FT                   /db_xref="HOGENOM:HBG204308"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniParc:UPI00003B63FF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU23"
FT                   /transl_table=1
FT                   /translation="MSESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSIT
FT                   TQSLLRELETLDKVIATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGY
FT                   AHHIMDSRTGSKTGSNSNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQR
FT                   LYGNSYRQPTGRVTKATALRNARNRPSGIPQISSRLTRPTASSNLKRQR"
FT   CDS_pept        684832..686724
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196601"
FT                   /locus_tag="CAGL0F06985g"
FT                   /product="Similar to uniprot|P53169 Saccharomyces
FT                   cerevisiae YGL060w"
FT                   /protein_id="CAG59196.1"
FT                   /db_xref="HOGENOM:HBG124609"
FT                   /db_xref="InterPro:IPR013877"
FT                   /db_xref="UniParc:UPI00003B6400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU22"
FT                   /transl_table=1
FT                   /translation="MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQAL
FT                   FFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNVEDKALVKAICNCMKLVARVGTD
FT                   DYNFLFGTELLRECRAEDTNIYDDSNDTYILEAFKVRVELLLEEFILPALKTLGQTNPS
FT                   KFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAMANKD
FT                   EEDIVQKILESFWSFSIGRCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSRNI
FT                   IRITNEKLQLDLQKMMEACFEETRKIYELLPPNPTVQDGNDLTEEIYQMSYVNGVTTLE
FT                   EQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFV
FT                   EGICRFWLWSYTLGENRDKNTLQSELMSVPDYVLKVFFQLLLLKTCNEASTLQKRINFN
FT                   LLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLMAKKSDDIHLKEARQVKN
FT                   EPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNNKTQGNLILLQYYINI
FT                   LITLYKQWDGFLLKEINDEIKKLFSQRQEQEFPELEFIRLANDTLSTQLERLNL"
FT   CDS_pept        687174..688631
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501941"
FT                   /locus_tag="CAGL0F07007g"
FT                   /product="Similar to uniprot|P53170 Saccharomyces
FT                   cerevisiae YGL059w"
FT                   /function="ATP binding"
FT                   /protein_id="CAG59197.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG058631"
FT                   /db_xref="HOGENOM:HBG447871"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="UniParc:UPI00003B6401"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU21"
FT                   /transl_table=1
FT                   /translation="MSRLSNMRHLHSVKTPNITQIPDFTKYSPVRPINEELAPYIYETM
FT                   KAFPSRSHYINQQHYYHNKNVLINDYLKKNPTPVSLTQLAQYYDDSTTLTKQKVISSAK
FT                   FVKEEISIRMAHKIHSLQLLPFNVINNFHFVQVYESYYNIFERFRKFPAVRTLDDSIRF
FT                   TKFARDILKDFNTLNLPHLIMGALECTTLDLYPTDKMDKLLSDLLRARISRRLIVEEHI
FT                   SIADNYFSGKKKNTLVLGDIFQECSAKEHILGASKICEKFIQDMYFESIPMPELKINGE
FT                   TDLKFYFLPSHLKYLLGEILRNTYEATIKDYIRKGLPKPEPIVITIIKNEESYLFRICD
FT                   RAGGLAHHHDDNNIWSFGKTKEQAAQSISNFHKLPGLQTVSLYDHLYNNTEDRQVNRAY
FT                   INTSLEPMAHSNIASAVATGYEVPLLKLLKRSFRYKLGIGLAMCKVYAEYWNGDLTLHS
FT                   IHGFGTDTVLKLGNLMIHTKDKQLDRV"
FT   CDS_pept        689331..691133
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441100"
FT                   /locus_tag="CAGL0F07029g"
FT                   /product="Similar to uniprot|P53128 Saccharomyces
FT                   cerevisiae YGL125w MET13"
FT                   /function="methylenetetrahydrofolate reductase (NADPH)
FT                   activity"
FT                   /biological_process="methionine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59198.1"
FT                   /db_xref="GO:0004489"
FT                   /db_xref="GO:0006555"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068938"
FT                   /db_xref="HOGENOM:HBG649727"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniParc:UPI00003B6402"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU20"
FT                   /transl_table=1
FT                   /translation="MKITQKLADRHKEKPDKATFSFEYFVPKTTQGVQNLYDRMDRMYE
FT                   ASLPEFIDITWNAGGGRLSQLSTELVATAQSVLGLETCMHLTCTNMPISQIDEALEDAY
FT                   NSGCQNILALRGDPPLNAPNGWQPIEGGFNYAKDLVKYIRAKYGDHFDIGVAGYPEGHP
FT                   EEKERHKDLVYLKEKIDAGGSFIITQMFYDVDNFIQWCHEVREMGIDVPIIPGIMPITT
FT                   YAAFLRRAQWGQIKIPQAFLDVLEPVKDDDQLVRDKGSELIVDMCQKILNSGYVKHLHI
FT                   YTMNLEKAPLIILEKLGLLPSESEVNANPLASLPWRKSLNPKRKNEEVRPIFWKRRPYS
FT                   YVARTSQWAMDEFPNGRFGDSSSPAFGDLDLCGSTLIRQSGKKSLELWSTPKTIEDVSQ
FT                   LVISYLTGQIKCLPWSDTSLDEEIDPILDHLLDLNRKMIITINSQPQINGIRSNHKVHG
FT                   WGPKDGYVYQKQYLEFLLPNEKVEKLEKQLAGNEMLTYFAVDNKDNLKSNHPDGSKANA
FT                   VTWGIFPGREVLQPTIVEKVSFLAWKEEFYRILEEWKWNFQENNELKSAEFIQHIIDNY
FT                   MLVNIVDNDYISSTDEIYNVLINL"
FT   CDS_pept        complement(691462..693255)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501942"
FT                   /gene_name="MON1"
FT                   /locus_tag="CAGL0F07051g"
FT                   /product="Vacuolar fusion protein MON1 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="multivesicular body membrane "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG59199.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0032585"
FT                   /db_xref="HOGENOM:HBG124610"
FT                   /db_xref="HOGENOM:HBG204282"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniParc:UPI00003B6403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU19"
FT                   /transl_table=1
FT                   /translation="MLSRKSSNWLLNVPSQSEATTSVNLQSTEVGSITHTSSDDNIATP
FT                   QDGIDHIDNDRSSSRAENIDMTASMVSHSRSLASLRPVMSSNFQNESDHIDDSLEFDLM
FT                   RSLNESIYSTDGAISKPFMINEMPQIFDKNSNEDITKNFFIFTSAGKPVYSMYENDKFS
FT                   ASYIGLLTSIISFFQTSNEDNIKTFTSKESNITFVFCNKDPIFYVAMSRCRDESRDELE
FT                   AQLHFLHSFVLSTLTSKQLTKLFQKRDNFDLRSHLESTDFETLSEICSNFTDKLYPEFS
FT                   LNSLQCLKLKKPIRAKIHSIMSSQLNKMEDFPRGTLLYSFIIASNNRLCNVLRPKSHTL
FT                   HPVDLQILFLVIATQFHNLESDKELWIPICFPKFNSNGYLYCYIRTIMNPGDKSSSKFL
FT                   GHPPVLVAISGQKDAFFKMKSYCDELMVILTRNNEIIRELRTSILQPYSITDIPAPLVH
FT                   HFIFKSSKHIQFTMPQLSTSASEPEQRALYERKLKFYYKSLQNSIAQEIASQSNKSLVN
FT                   FVQWSEPAKSNSEETTDHDSFIEEPVNMLGMVWCSPRFELLLLFNNGIVTRKQALSSAR
FT                   RIVRWCVSNESSLFINEGATF"
FT   CDS_pept        694044..694805
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441101"
FT                   /locus_tag="CAGL0F07073g"
FT                   /product="Similar to uniprot|P25443 Saccharomyces
FT                   cerevisiae YGL123w SUP44"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG59200.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG299153"
FT                   /db_xref="HOGENOM:HBG386975"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6404"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU18"
FT                   /transl_table=1
FT                   /translation="MSAPEGQQRRGGFGGRNRRGGNRRGGRNTEEKGWVPVTKLGRLVK
FT                   AGKISSIEEIFLHSLPVKEFQIIDTLLPNLQDEVMNIKPVQKQTRAGQRTRFKAVVVVG
FT                   DSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGS
FT                   VTVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYA
FT                   FLTPDLWTEHPLPLSPLDVYSDEASAQKKKY"
FT   CDS_pept        complement(695417..697012)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441102"
FT                   /locus_tag="CAGL0F07095g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59201.1"
FT                   /db_xref="HOGENOM:HBG058068"
FT                   /db_xref="HOGENOM:HBG204283"
FT                   /db_xref="InterPro:IPR021083"
FT                   /db_xref="UniParc:UPI00003B6405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU17"
FT                   /transl_table=1
FT                   /translation="MSQEQYTENLKVIVAERLKGVPNFNEDITYVAEYIVLLIVNGGTV
FT                   ESVVQELSSLFDSVSPEALQDVVQTTFFALEALQQGESLENIVDKIRMMNAQSAGGNIP
FT                   DQQQQQQQQQQQQEQLMQQQQQQQQQQQQPSQGSMLVSQHATSQTEQSSQPVSAFQDVI
FT                   NASTQNGNGDVSQPQSAFQAVNTQPKFQSRGGGVGKSRRGARGASRGGLRNTYNSRENA
FT                   NTNNRFNPLARALGMVDGKDQNVNFVRTKKEGRCKVFPHCPLGRSCPHAHPTKVCSEYP
FT                   NCPKAPGTCEFLHPNEDEELMKEIEKTREEFQQRKLALLAAKKKPVQTGIVLCKFGTLC
FT                   SNPMCPFGHPTPANEDAKVIDLMWCPNNLTCEDPQCTKAHSSLSKIREAKPMTVKKVSA
FT                   PPAMARPPVEKSLEQCKYGIHCTNKRCKFRHAKSHVMCRDGANCTRIDCFFGHPINEDC
FT                   RFGVECKNAACLFRHPEGRVLPDKKQQPQGGDQQQNQAQFAFPAQGIQTTNRVFALPDS
FT                   SNIEAAPQQDMDMN"
FT   CDS_pept        complement(697508..697930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441103"
FT                   /locus_tag="CAGL0F07117g"
FT                   /product="Similar to uniprot|P53130 Saccharomyces
FT                   cerevisiae YGL121c"
FT                   /protein_id="CAG59202.1"
FT                   /db_xref="HOGENOM:HBG124612"
FT                   /db_xref="UniParc:UPI00003B6406"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU16"
FT                   /transl_table=1
FT                   /translation="MDYKTTYIQYSETTRGNETRSEGLIYQDKGDGSGLAEIMLFTKVQ
FT                   QNLMDVTRELRDVTDQIYSYRESPGSVACTKDTLPTLMAMLMDHRERARRQYKDILATK
FT                   YSEHHWDLENIVKELEAELSRTDELLSLYPHRGTLR"
FT   CDS_pept        complement(698363..700669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441104"
FT                   /locus_tag="CAGL0F07139g"
FT                   /product="Similar to uniprot|P53131 Saccharomyces
FT                   cerevisiae YGL120c PRP43"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG59203.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6407"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU15"
FT                   /transl_table=1
FT                   /translation="MGSKRRFSGSQHEHADPVATSIPEHAAEIAEDLTKKHPIPPEEPL
FT                   VHHDAGEFNGLVRHKTTVEQANKLETGKINPFTGNQFSEKYFGILKVRKDLPVHAQRAE
FT                   FLKIYQENQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQIACTQPRRVAAMSVAQRV
FT                   AEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLKRYSCIILDEAHE
FT                   RTLATDILMGLIKQVVLRRPDLKIIVMSATLDAEKFQNYFHNAPLLAVPGRTYPVELYY
FT                   TPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCG
FT                   PLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVVSTNIAETSLTIDGIVYVVDPGF
FT                   SKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYP
FT                   EILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTALG
FT                   RLASQFPLDPMLAVMLIGAFEFKCSQEILTIVAMLSVPNVFIRPSKDKKRADDAKNIFA
FT                   HPDGDHITLLNVYHAFKSDEAYEYGINKWCRDHYLNYRSLSAADNIRSQLERLMIRHNL
FT                   ELNTTDYESPQYFDNIRKALAAGFFMQVAKKRSGGKGYITVKDNQDVLIHPSTVLGHDA
FT                   EWVIYNEFVLTSKNYIRTVTSVRPEWLIELAPAYYDLDNFQKGDVKLSLERIQEKVERM
FT                   KELKKGKDKKKSKKK"
FT   CDS_pept        701085..701381
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441105"
FT                   /locus_tag="CAGL0F07161g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59204.1"
FT                   /db_xref="HOGENOM:HBG124613"
FT                   /db_xref="UniParc:UPI00003B6408"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU14"
FT                   /transl_table=1
FT                   /translation="MSARKALYYAYCVGGSAKEAIKESIQFGGKSAKQYVNTSIVLRPI
FT                   LSQFQWYHDPAWEEAKSLSKSLRNGQTHVKHSNKAGVRHYSTSSRRSIQVCFH"
FT   CDS_pept        702000..703244
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196602"
FT                   /locus_tag="CAGL0F07183g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59205.1"
FT                   /db_xref="HOGENOM:HBG310934"
FT                   /db_xref="HOGENOM:HBG381628"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00003B6409"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU13"
FT                   /transl_table=1
FT                   /translation="MNAAAEGLSQVSKGQSPNWKSLILSESNIDRITKKFSQMRGAALK
FT                   IGQMMSFQDEKILPRELYEILSRVQNSANYMPRRQLEKVMTKELGDNWEAKFKSFDKIP
FT                   IAAASIGQVHNGELLDGTKIVVKVQYPGVKDSIDSDLNNLLLLLTASRLLPKGLFLDKT
FT                   VANARTELKWECDYIREAKALQRFELLLKDDPVFVVPHVYEEFTTENVLTMSRMEGTEI
FT                   MNLKNESNSQEIRNFISENIMRLCLEEIAVFEFMQTDPNWANFLYNAKTNKIELLDFGA
FT                   SRPFPSDFIKKYRKLLTYATQENRAGAYEMSKELGYLTGLESQSMKDAHVDSVMTLGEP
FT                   FRGSVEDVFDFANQTVSDRIRGNIGLMVNERLCPPPEETYSLHRKFSGIFLLCARMEAS
FT                   VHCAKLFSKYFALKE"
FT   tRNA            join(complement(705157..705193),complement(705086..705122))
FT                   /gene_name="tRNA-Trp (CCA)"
FT   CDS_pept        705576..707186
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196603"
FT                   /locus_tag="CAGL0F07249g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="regulation of transcription factor
FT                   activity"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59206.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="GO:0051090"
FT                   /db_xref="HOGENOM:HBG182997"
FT                   /db_xref="HOGENOM:HBG320214"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI00003B640A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU12"
FT                   /transl_table=1
FT                   /translation="MSMSQKAKTIDDQNEDASALQQSFTIWSPQDTVRDVAESLGLENV
FT                   NEEVLKALAMDVEYRILEIIEQAVKFKRHSKRDTLTTDDVAKALRVLNVEPLYGYHDGS
FT                   HSNRELSFAKVNTAGGQSVYYLDEGEVDFDKLINEPLPQVPRVPTFTTHWLAVEGVQPA
FT                   IVQNPNLNDIRQSQPPIVRGAIVTALNESSSQLGGSSGSNNGTGKGSVGGESVGGSGSN
FT                   LASVVQPGQNVDVKPLVKHVLSKELQIYFNQIISTLTKHVESGDEEGQHMKGAALMSLK
FT                   TDTGLHQLVPYFIQFIAEQITHNLSDLELLGTILEMMYSLLSNTSIFLDPYIHSLMPSV
FT                   LTLLLAKRLGGTPEKDDEASAVEFLEKTNAVRDFAASLLDHILRKFPQVYKSLKPRVTR
FT                   TLLKTFLDTNRSFGTYYGCLRGVSVLEPESIRFFLGNLHNWARLVFEEQGVTVGDAGEH
FT                   TPSRFSKQEVGQLVDAIVSALVVLKKDLPEVYEGQGEAVSEGDKERLVAKCGVTVAHSI
FT                   LEREDAQEITCAIFFGENM"
FT   CDS_pept        complement(707309..709510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441106"
FT                   /locus_tag="CAGL0F07271g"
FT                   /product="Similar to uniprot|P53135 Saccharomyces
FT                   cerevisiae YGL113w"
FT                   /protein_id="CAG59207.1"
FT                   /db_xref="HOGENOM:HBG124614"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="UniParc:UPI00003B640B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU11"
FT                   /transl_table=1
FT                   /translation="MEQWSVVATLPVLPPDITIATDHPRVVHANILPDDVLSEVGNTPI
FT                   YCKHILTDADDKFYVMERYGKEYWVIWIVEMDKHSITKLIDLIEFSDEVTTKEFGSTNG
FT                   YQSIDEINNYGTSKAEWDEIKITKIFNSFAESTKDRKIIGNSSELFMTLPSNNEQNKNT
FT                   RTETCLVSDPKIYFNQRYYSTLFELDNAITYFVKSHLPRVRNLFKANTSTSDYLSQYIA
FT                   LIKSSLIPVRNFDERHTLNGLTTLLSTFDPNSEILELLTASQNLTDDSLGNDLSEKMLM
FT                   LSVLKYRELKIQVVLLLEMMHLLSLDEQFDSFEKQYKNKLEQRSRNVTRSSFMQRRSRT
FT                   RKNPSTSRELDSPKGNDINNNNDNNSNNNVNDGTFKITTQTDTIQNNIFDFYELLDIYL
FT                   DKLLITDILMSSTNLDNNNTDSESDQPEENMVETKKYNFQHYMKRILDKNDEASVVGFV
FT                   NYTLIPYYNRKAPNTIKFIIQKLKGPSMRKQPLKRITTGNTVNESTPLMDNSFNDFSNI
FT                   NNGTDPLRASSVQYASSEKNKEELRSSSPSRKSTFLSQRANSNLTDFIEKEGSVNKRLL
FT                   PISRTTSDISFLEKRQFAVDNSRHLDSQNPQVSTTSDKNTQPKMSNSISRLKQQSFRRV
FT                   GRNKSIFKKSTDATSSFAFSHKSIKEVNETNTIQVLSTPMGKRQSNLKAQEQSPLIIES
FT                   PDAGIIAKSQTNVKGNSENNNTKTSIPPNKKVKRRLFAP"
FT   CDS_pept        complement(710050..712224)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045373"
FT                   /locus_tag="CAGL0F07293g"
FT                   /product="Similar to uniprot|P53134 Saccharomyces
FT                   cerevisiae YGL114w"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG59208.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051029"
FT                   /db_xref="HOGENOM:HBG397627"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI00003B640C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU10"
FT                   /transl_table=1
FT                   /translation="MTSTKTDQSDQQSVRWADKPSINQITVRGTIAGIFIGSLVLISNF
FT                   QFGLQTGWVSMMSLPSALLACAIFKQLWPVFKPDDPVFTDVENVYVQSLAVAIGTGPLA
FT                   LGFVGVVPAIEKFLTYEESGGTREQGIPFTFIQLLLWSAALTYFGIFFAVPLRKQVIVR
FT                   EKLPFPSGNATATLIAVLNGTEIIQEVSKKEVLQMRRRRLEQCPEVLRMDPDSDDSTEN
FT                   ALSPLINAEAQRQYNSTSPSDIQPNNVYLKNITILVQTFTISSIYTVIAYFVPVIKAIP
FT                   FLGNELSKKYLWNLQPSPAYFGQGIIMGLPTVSYMLFGCILGWGILAPIAVHKGWVSNE
FT                   EDVTDWNEGVQGWVLWCSLAIMITDSIVGFLVLLINSLVKFFMLDNRRVIISNMIDDSF
FT                   ESMILEEEAAINHQRSLSSAQSVGTVRLVSRDLEHEVDQKHLVKYTTVLSGIVVSSVIC
FT                   ISFVIYIFGIEVIPVYSMVLALFTALFLSILAIRALGETDLNPVSGIGKISQLLFSFII
FT                   PKTHPSAVLINLVAGGIAEAGAQQAGDLMQDLKTGHLLGASPRAQFIAQLIGITWSMFL
FT                   SSVMYLIYNRVYTIPSIQFRIPTATVWIDCARLVTGKELPYGTLECSLVLAVIFAILSL
FT                   IRNCYRERELRWMKYIPSGVAVGIGLFNSPSFTIARFIGGLAAHMWLSNHKGNIDVKTT
FT                   LIVCSSGLILGEGVCSILNIIFTTLNVPHF"
FT   CDS_pept        complement(713250..714221)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501943"
FT                   /locus_tag="CAGL0F07315g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="catalytic activity"
FT                   /protein_id="CAG59209.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG183531"
FT                   /db_xref="HOGENOM:HBG446629"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B640D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU09"
FT                   /transl_table=1
FT                   /translation="MRELTEEQRENIAIEQKLAVQSIRSFLQSKTSYDVLPVSYRLVVL
FT                   DTALLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYFSNPDKFDIVDK
FT                   LQLDGLKEVEKAIGVDQLDTAYVHPSRPLYDACLKMLESRSGRIPLIDEDEETHREIVV
FT                   SVLTQYRILKFVSLNCRETHLLQRPIGELGIISEQNMKFCHMSTPVIDVIQLLTQAGVS
FT                   SVPITDENGVLINVYEAYDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTKNDKL
FT                   SSIMDNIRKSRIHRFFVVDENGRLTGVLTLSDILRYILLGNN"
FT   CDS_pept        complement(714870..716735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441107"
FT                   /locus_tag="CAGL0F07337g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59210.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B640E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU08"
FT                   /transl_table=1
FT                   /translation="MINKNDNSLASSAKRSALSVASPTKLNIMSSQNGNTKLHKVTKRP
FT                   LERSHSLNIKNGNANEPFGKFSRPKISVQAPPLLKRNSSFFKEKSTSLYSRSDFAFNSP
FT                   SKSQELSKSPMSSSQPLPNDDTITLTDRFLPTLQSGSQNKVQHISLDTELPPPNASPVT
FT                   HLRAQTKLVFKQNVAEACGLEMDNRILQYLPAPPSYSRERPATLMRRHQYHYQNRSSQT
FT                   QLQKKNTELMKLRKVNTNPERILDAPGFQDDFYLNLIDWSKKNILAIALNDSLYLWNGN
FT                   NGEATLLKEYEECQITSVHWSDDDCHISIGKSDGNTEIWDVETSTLVRTMRSKLNVRIG
FT                   SQSWLETLLATGFRSGEIQINDVRIKDHIVNTWDEHTGEVCGLSYKADGLQLASGGNDN
FT                   TMMIWDTRTSMPQFVKKDHSAAVKALAWSPTNAGLLASGGGQTDQQIHFWNSTTGAKLH
FT                   TINTGSQVSSLHWGQSYDTKGNMNVEIVATGGSPDNSISIYNYETRYKVAEVVHAHDAR
FT                   ICCSKLSPDGTVLATIGGDENLKFYKIFEPKRKYKQKSKGNVVEELMTNNTPYYRERLD
FT                   ASRKLTNNDDSDYESSSYHHESVTRTVINSKSPSSAAKATDFLIR"
FT   CDS_pept        complement(717856..718650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441108"
FT                   /locus_tag="CAGL0F07359g"
FT                   /product="Similar to uniprot|P53133 Saccharomyces
FT                   cerevisiae YGL117w"
FT                   /protein_id="CAG59211.1"
FT                   /db_xref="HOGENOM:HBG124615"
FT                   /db_xref="UniParc:UPI00003B640F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU07"
FT                   /transl_table=1
FT                   /translation="MMQFNVRSPVVKAREETYLKKIERVFNVDKISTHDLLRLETVHLC
FT                   DPLQFFTNGLLESLMYPDGKFLVHHVATSKKLVQDSISIDQALQLGHPKMLELIYLRDR
FT                   IGSIRGKMDVENSKLNQTIIENLQEVHALVMAIYTEFKEHLKVRLYKDFYGFVLKEQKE
FT                   NFHTVLQMIQKYINIVEKTKQAITPESLLSSMKSFNVELSIVADKLVKNSRCFKEYTDV
FT                   INAGSENLLFNANDQFDLADVEFQQFYKERLDRLKISARRLF"
FT   CDS_pept        complement(719330..720934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441109"
FT                   /locus_tag="CAGL0F07381g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="regulation of transcription factor
FT                   activity"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59212.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="GO:0051090"
FT                   /db_xref="HOGENOM:HBG182997"
FT                   /db_xref="HOGENOM:HBG320214"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI00003B6410"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU06"
FT                   /transl_table=1
FT                   /translation="MTIAQKTGELDQNEDASALQQSFTIWSPQDTVRDVAESLGLENVN
FT                   EEVLKALAMDVEYRILEIIEQAVKFKRHSKRDTLTTDDVAKALRVLNVEPLYGYHDGSH
FT                   SNRELSFAKVNTAGGQSVYYLDEGEVDFDKLINEPLPQVPRVPTFTTHWLAVEGVQPAI
FT                   VQNPNLNDIRQSQPPIVRGAIVTALNESSSQLGGSSGSNNGTGKGSVGGESVGGSGSNL
FT                   ASVVQPGQNVDVKPLVKHVLSKELQIYFNQIISTLTKHVESGDEEGQHMKGAALMSLKT
FT                   DTGLHQLVPYFIQFIAEQITHNLSDLELLGTILEMMYSLLSNTSIFLDPYIHSLMPSVL
FT                   TLLLTKRLGGTPEKDDEASAVEFLEKTNAVRDFAASLLDHILRKFPQVYKSLKPRVTRT
FT                   LLKTFLDTNRSFGTYYGCLRGVSVLEPESIRFFLGNLHNWARLVFEEQGVMVGDAGEHT
FT                   PSRFSKQEVGQLVDAIVSALIVLKKDLPEVYEGKGEAVSEGDKERLVAKCGVTVAHSIL
FT                   EREDAQEITCAIFFGEG"
FT   CDS_pept        721308..722618
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113855" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196604"
FT                   /gene_name="NSA1"
FT                   /locus_tag="CAGL0F07403g"
FT                   /product="Ribosome biogenesis protein NSA1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG59213.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG059331"
FT                   /db_xref="HOGENOM:HBG204287"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6411"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU05"
FT                   /transl_table=1
FT                   /translation="MRVLASCVDNGSLKEAVFGFGTDTSVQTAPQPQLIETHLCEGLDA
FT                   HVEQIHKIDDGKWLLARHNGTVQYVESELVDHSEIEGMKVSHFDVVGSITGLLDVSRLD
FT                   HLNAQSKRRTKLKDGFVSLAPVSKKDCYLACTKSGLVHILALNFKDKLLTKLQTFEVKA
FT                   PLEFAQVYDVEKTKKTVFACGGEENLVKLFELSESCDKISMIWESKNVKNDRLDMRVPV
FT                   WPVALKFLQPVPTSSAGYDKNKLNFQFLVVTGWSHFGIYNTQHGKRPMKYLDLLPEREP
FT                   LRQLELLDPSHNTKAITQLGNLKCKETESLEFITTDKKTQVLKYNGQGQLIGKYGKGDI
FT                   TGLATYIGIHDQKYLLEGGLDRYLRVFDIESRAQKAKIYLGTNINRILVLDEELEALQE
FT                   IEMAKNNKRKQTASDEEDDAEELWSKLETKKEKKRKL"
FT   CDS_pept        complement(722699..724543)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248413" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441110"
FT                   /locus_tag="CAGL0F07425g"
FT                   /product="Similar to uniprot|P53137 Saccharomyces
FT                   cerevisiae YGL110c"
FT                   /protein_id="CAG59214.1"
FT                   /db_xref="HOGENOM:HBG059330"
FT                   /db_xref="HOGENOM:HBG396371"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI00003B6412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU04"
FT                   /transl_table=1
FT                   /translation="MAVQKILEITGERPKLELPIVNFPPFKLRAWLIEKDPVVWAHLLE
FT                   TYVQYFKFLNHGNNIEDLNESTHDHLCIFLRTYLKEMAEEEGKLLSLGANSDVTKQLQL
FT                   LRTWVFELIKKCGLMHFQLHGETIWNLVKYYANRNPNSVRALLDGSLKPQINTTRTQLN
FT                   WAKQIQTHLKMLLETGKFDRIDLKCFESLLGEGDHTKSNFNSSFLTTNWVETLEQLWNK
FT                   GQGRSSEIVRQLMLICLITSPDKVISKLLKDLEISNIENLVMYPLLGSIILNKSYEKYN
FT                   KSLKKDFPFLNVNMSVPTSQYEDIEENYQIDQNNIDSIKEIFPDLTDYQVELLLVKFEN
FT                   NVETLTDALFEDPTIVESIPKEKPKSINTIKKPLSGPRYRRERRKSHEESEIISDRHVP
FT                   DELRNKTLTRALELLYEKDEDEHDDTYDESEVNHANLAEKISLEDEVDKTKSTNETNTN
FT                   KIQSQFEANEKYLWELLKKDKEIFSRSRRGTKERKNIKKETNWSDEQIEGWARMLERSP
FT                   QRARILEEKYMFRGNVKRGKTSYVKNRDENSDNEAHTRPPKSNNNRDRKNPQSTKEDNQ
FT                   QTQQKSKKQFARNEKNKASRANHNRKAGNMKKQAKAGL"
FT   CDS_pept        complement(724949..725320)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501944"
FT                   /locus_tag="CAGL0F07447g"
FT                   /product="Similar to uniprot|P53139 Saccharomyces
FT                   cerevisiae YGL108c"
FT                   /protein_id="CAG59215.1"
FT                   /db_xref="HOGENOM:HBG253395"
FT                   /db_xref="UniParc:UPI00003B6413"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU03"
FT                   /transl_table=1
FT                   /translation="MGLCASKESPSQPTSSSSDARPVQRTGHQKKSDTAAKVSGTTQRN
FT                   KSKKKLGGDEVLGEETQKISAKEAARLAAEKRYQDAHQKNTKGELGKKLEQERAKSHKS
FT                   KMMEEAEMRQAERERLEWD"
FT   CDS_pept        complement(725722..727572)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000732" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441111"
FT                   /gene_name="RMD9"
FT                   /locus_tag="CAGL0F07469g"
FT                   /product="Protein RMD9, mitochondrial "
FT                   /biological_process="sporulation resulting in formation of
FT                   a cellular spore"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG59216.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0030435"
FT                   /db_xref="HOGENOM:HBG059325"
FT                   /db_xref="HOGENOM:HBG204289"
FT                   /db_xref="UniParc:UPI00003B6414"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU02"
FT                   /transl_table=1
FT                   /translation="MFRYLSRTSTIYKGVIATSKTASTANVVAAQESRRNYANKRNNNR
FT                   NGPADALDEKLNSILSGKTSSKRKPYGGRKSPVDETSPWYAQLCALDDCLTTTLKQSAT
FT                   PMRKLLSDRVNHPDMRSNPTFWHSVSRAMTLYNELKQCPEMTDQRVTSLVHLLHNGLRT
FT                   DRQLVSSLNKKPDYDSQSFHKEMVNFIYTSLNEISDDILNNNVPINANGLMHLFTSYQE
FT                   MGFTDLVVQIWKKIETIAEQNPQSNIGKISKHPNVVGIVLPILYEKEIVNFSEAEKLFK
FT                   ECEQYHNRMFPNLYVGMILTSLKANENMKALELFETLCTNSKGVHYGYISETHIAFISQ
FT                   CKDISVAESFLDKAVNNEMPYRVEIQVSAVNSLMYNIWSENQDFNKIKEIWQKMVTFYG
FT                   ENNLRLAIFSSLNNEFFSYFFEKYKENKTEGLEQLQKLITQYNNLKGIDEPFLNIILAK
FT                   CTVWKEPEVIKYIEKNFELFNVPKSLITSRILLKSLGSIDNITKEQIVERWQEIVLKAD
FT                   SLGSKYIANADWAALRDATVKWAQENKDNQESLDRIEWYLQIVNVYQKYCRDGSQRYRI
FT                   LKGCSKSFPILAENLQRLDLVDTSSIPVCEVKSLKEALQN"
FT   mat_peptide     complement(725725..727461)
FT                   /gene_name="RMD9"
FT                   /locus_tag="CAGL0F07469g"
FT                   /product="Protein RMD9, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU02 "
FT   transit_peptide complement(727462..727572)
FT                   /gene_name="RMD9"
FT                   /locus_tag="CAGL0F07469g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FU02 "
FT   CDS_pept        728029..728454
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441112"
FT                   /locus_tag="CAGL0F07491g"
FT                   /product="Similar to uniprot|P53141 Saccharomyces
FT                   cerevisiae YGL106w MLC1 MYO2P light chain "
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG59217.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B6415"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU01"
FT                   /transl_table=1
FT                   /translation="MSQNKDIFTLFDKKGQGSIPKDVVGDYLRAIGYNPTNKQVTEILS
FT                   GSGEALTLPEVEELVKKNEAMLDATTKGKLEDFVKAFQVFDKDNTGKVSVGDLRYMLTG
FT                   LGEKLTDEEVDELLKGIEVDSEGQIDYKKFIEDVLRQ"
FT   CDS_pept        complement(729306..730505)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349771"
FT                   /locus_tag="CAGL0F07513g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59218.1"
FT                   /db_xref="HOGENOM:HBG124616"
FT                   /db_xref="UniParc:UPI00003B6416"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FU00"
FT                   /transl_table=1
FT                   /translation="MDELVLPLGRSASVLDVFERAVQDPCSLDIDEQDETDMLDRDYQG
FT                   YDAYTGAPEPAADNSALVKDNSFVASICPSTGLDPLQEEEDALCEKECAQECAQECASD
FT                   EQGKRKLARRASAASSTSCSYVSDTSSCQSVNDRVNVLNLDEPNKVKEQEYEFRNPFKE
FT                   KNERQSAEGQDCTARPPMTPSARASVEEFKLRRTQTEPEFPIRPSVLSRRNTCNMLHQI
FT                   NTRSQSIQVGRSRAPSLRRISTNGNSITYGRSGVSIPMRSNSTIPARSNSTTFMSNNII
FT                   RERSNSATPVGDSPSRTYSRGSFGIPTHLYSLEKYVSSQLDALATKEYDSEAAKQVENQ
FT                   RELRNKRSNTVSYIGSSPFNRTRSNTESSFGANQNPPIRCGNARKKSFIELSLENSFAS
FT                   "
FT   CDS_pept        complement(731456..732397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247969" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349772"
FT                   /locus_tag="CAGL0F07535g"
FT                   /product="Similar to uniprot|P28321 Saccharomyces
FT                   cerevisiae YKL094w YJU3"
FT                   /protein_id="CAG59219.1"
FT                   /db_xref="HOGENOM:HBG124617"
FT                   /db_xref="HOGENOM:HBG395713"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B6417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ9"
FT                   /transl_table=1
FT                   /translation="MAEYPYKLRTKEPELKYEEFNGAKFAYVLWPSEGAPKARVLLVHG
FT                   FGEYTKINHRLMDHLALAGYESFTFDQRGAGLTSPGKQKGITNEYHTFNDLDHFVAKNL
FT                   LECKEKDIPLFLWGHSMGGGIILNYASKGKHRDQVSGYIASGPLIILHPHSSPNKITQW
FT                   LSPVLAKCLTKTRIDTGLDLEGITSDPRYRKFLENDKPMSVPLYGSFGQIYDFLERGKR
FT                   LYNDQDGFVSRKYPRDKPLFIQHGKDDTINDPQGSQKYYDMCPAQDKTLRIYDHARHSI
FT                   LSLEKDELFAPIFNDLQAWLDEHSQARIKSKL"
FT   CDS_pept        complement(733271..734158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441113"
FT                   /locus_tag="CAGL0F07557g"
FT                   /product="Similar to uniprot|P28320 Saccharomyces
FT                   cerevisiae YKL095w YJU2"
FT                   /protein_id="CAG59220.1"
FT                   /db_xref="HOGENOM:HBG202313"
FT                   /db_xref="HOGENOM:HBG516146"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniParc:UPI00003B6418"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ8"
FT                   /transl_table=1
FT                   /translation="MSERKAINKYYPPDYDPVEAERIARSMSKKLKNANKSESTIRLMT
FT                   PFSMRCTKCDEYISKSRKFNGKKKTLDEKYLDSIKIYRFTIRCPQCANPISFRTDPKSA
FT                   DYVMESGGVRNYVKRQEEEKKAQDETLEETLKRLAKEKEEEEELKQNKGKSEDKSKDKM
FT                   ALLEEKLAKLQQQQKDVKDLEQMIQNNKAKYETSNMLGKISKPKNNAKLEQQNLDAIAE
FT                   SAFAKFRSHNSISTNDDKSETTAVQNTDTFSQLQSRSNLPELKNTSMEAKQKPTKIKLK
FT                   VKRNTLGIVKRQRK"
FT   CDS_pept        complement(734937..735575)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045374"
FT                   /locus_tag="CAGL0F07579g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59221.1"
FT                   /db_xref="HOGENOM:HBG058172"
FT                   /db_xref="HOGENOM:HBG202312"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI00003B6419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ7"
FT                   /transl_table=1
FT                   /translation="MQFTTAFSVALIAMAKLALADSQAFGLLAIHSGSPVQNTPVNSEN
FT                   GALVLKSGGSFAGTVTDAGKLKFSDNTYAVVNSDGSIKTGSESEGTSGFALSGSHLTYK
FT                   GNSGFFAIPSGSEYKFSTAQGTGAIDIVISPRSTKDGSVVADFTPAGSASSAASSAKPS
FT                   SAAASSAAPTKAAISQINDGQIQAQTTNGAAKAAAGMGAGAIAAIAMLL"
FT   CDS_pept        complement(738412..739068)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441114"
FT                   /locus_tag="CAGL0F07601g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59222.1"
FT                   /db_xref="HOGENOM:HBG058172"
FT                   /db_xref="HOGENOM:HBG202312"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI00003B641A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ6"
FT                   /transl_table=1
FT                   /translation="MQFTTAFSVALIAMAKLALADSQAFGLLAIHSGSPVQNTPVDSQN
FT                   GALVLKTGGSFAGTVTDAGKLKFSDNTYAVVNSDGSIKTGSESEGTSGFALSGSHLTYK
FT                   GNSGFFAIPSGSEYKFSTAQGTGAIDIVISPRSTKDGSVVADFTPAGSASSAASSAKPS
FT                   SAAASSAAPTKAAISQIGDGQIQATSTIHQQTTNGAAKAAAGMGAGAIAAIAMLL"
FT   CDS_pept        complement(741200..742456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196605"
FT                   /locus_tag="CAGL0F07623g"
FT                   /product="Similar to uniprot|P34246 Saccharomyces
FT                   cerevisiae YKL098w"
FT                   /protein_id="CAG59223.1"
FT                   /db_xref="HOGENOM:HBG124619"
FT                   /db_xref="UniParc:UPI00003B641B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ5"
FT                   /transl_table=1
FT                   /translation="MTEMDFDLEQIQKYELPDFETALLFSIVAKKNFLVLFDAEQRKLN
FT                   DEISNEELIQKSVGDVMQKRTDFKINFKYQCINHVTDEMISEIQKCELDDYKNLETMEH
FT                   VDEKGDRSANIAGVDQNVTIEFYLVEDIDRQSLADYYQLGRLMREGYIFNVQHNGIANN
FT                   KKYWKLFIGTVAWKRDEYIIPDDILQLGAADKKYSHKHGQSFKLKSFSTGFEDWIRHKF
FT                   WLVTTLAMPNIKPTIEVQAADDTASFSSVVITKDEAKEEEAITGSSDGAEKIISGDYKN
FT                   YDNIHIQASLRRYILDIMVHIRTHRLTFNARGGGIHKNCYSNMITLSKIICIKDHKSFV
FT                   VPQHVRLAAMWFLPLQLSVIDDSLKDNSILYGSKPELVRELMKRVVYVRNKQIIDMDNP
FT                   LFMEALIVKSALKKIVPPV"
FT   CDS_pept        742923..743678
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441115"
FT                   /locus_tag="CAGL0F07645g"
FT                   /product="Similar to uniprot|P34247 Saccharomyces
FT                   cerevisiae YKL099c"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAG59224.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG051096"
FT                   /db_xref="HOGENOM:HBG447430"
FT                   /db_xref="InterPro:IPR007144"
FT                   /db_xref="UniParc:UPI00003B641C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ4"
FT                   /transl_table=1
FT                   /translation="MAKLVHDIQKKQHRERSQLTGRARLGMLEKHKDYVKRAQDYHKKQ
FT                   NTLKALREKAKERNPDEYYHAMNTRKVDDKGLLIKSRYEDGEDPSLDMDQVKLLKTQDS
FT                   NYIRTLRQVELKKLQRDKQLIGYKSQSKHTVFVDDQDSMRDFKAENYFKTTKEFLDRPE
FT                   NRLTVDQLTSQNLNVGDSESLLMPKESLDKKRLKKIKQVKLHMEREKQLNQIQQRMDSQ
FT                   RERMKKGSKKKIISDTGNVTFKWKKQRKR"
FT   CDS_pept        complement(744275..746653)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441116"
FT                   /gene_name="MSS11"
FT                   /locus_tag="CAGL0F07667g"
FT                   /product="Transcription activator MSS11 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59225.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124620"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="UniParc:UPI00003B641D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTZ3"
FT                   /transl_table=1
FT                   /translation="MSSSSIHTTEGSTPNTAGGMGKEPYSNVSGSQRSSDTLKQQKFIV
FT                   SDAMAKNSRQLLFAHIYNYLVHNKFYSTASQFLKEVEVPLTTIENIGKIKENTVRDDSS
FT                   QMRYDDIPENLLRPDMLLNASDTFLVEWWEIFRTLFDHVDGIPNESLDSNGNQEVFKQR
FT                   IMAILPHNNPTVPPPFINGAENLVDPERHMNIARGSSVSQPSGVLRSPTQNELLNNSQD
FT                   QRPPQFRSKSMMNGMPPGLSSMSTPNGVEGMQGNFERPTFQQSKSAALPTQRKSSIEEQ
FT                   ANRNSSNFSGFGSQSPKNVNEDNEIDSKSAKGKLRSKSSKRGKVGKAAGTPKYNEVDEK
FT                   HSTMQGSPFSPELLGSNNPVLQNQSKPSAQSQMNGSQWDPNFLMQQQRNPQQWQKLNGN
FT                   NMQQDIPNSSHPSIGSNNPSNTSHRFNSRRKEQYDSKPEAIGNGSHRSSTSPSAGSVGN
FT                   MSADYGDQNEYGSNKSSNFSGAFTNNNAMFQEMAKTMNLMMNQKSEEMNQWNKSNPYNM
FT                   RPDNMPMSTMNWNNFPMPKGTSNSFNKDMLQAMQNKMMQSQSSSGMDPNLQQQYLMMMN
FT                   MLMNFQSGNGFQSNPTNVYKSRGNDLDFAQPFSSENNLANDQSNIRSSYEAYQEDSKTP
FT                   STENGGRKMNMTPSLQSTNMISNGQMKHSTSRFSPTHGAPNQSELNKMESTQRGNDISH
FT                   NYNPPNNRFVGNNLKSQNFSLASQDESVIAAAKKGRRKLTKLNKRNLATPESTSNTNYP
FT                   ESNKNGISTPNGSVGNKGKQTDINGHSNYPDNPFELFNI"
FT   CDS_pept        complement(748281..750740)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196606"
FT                   /locus_tag="CAGL0F07689g"
FT                   /product="Similar to uniprot|P32567 Saccharomyces
FT                   cerevisiae YMR165c SMP2"
FT                   /protein_id="CAG59226.1"
FT                   /db_xref="HOGENOM:HBG051099"
FT                   /db_xref="HOGENOM:HBG396084"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B641E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ2"
FT                   /transl_table=1
FT                   /translation="MQYVGRAFGSVSKTWSSINPATLSGAIDVIVVEHPDGTLACSPFH
FT                   VRFGKFQILKPSQKKVEVLVNGKSTNVPMKLGESGEAYFVFETSANADDIPKELLDSPV
FT                   ISASSSPNQSPVSTSLDLNNGMEDDATQRIDSHKSTFLDSGSPVIDKLEEPDFLDINES
FT                   TENFDKEDRTLNKKKTKTFQENLNRKLTEIHIPSKLENDGSLLLDIEGYKPNKEKVHDT
FT                   DEQLKSILKEELGSEADISNFIQEDGKGNIKIVNPFENNKSPLMSPPQSPTMSGNTSEL
FT                   VMSPPSPASADSTFHASSDELDSSSQISQDDEEKNRRFIKTIRLSSDQLKCLNLVYGEN
FT                   DLAFSIDHGRSVITSKLFVWKWDVPIVISDIDGTITKSDALGHVLAMIGKDWTHQGVAK
FT                   LFSEIARNGYNIMYLTARSAGQADSTRNYLRSIIQSGHRLPAGPVILSPDRTMAALRRE
FT                   VILKKPEIFKIACLNDIRSLYFDNIDFHTARESQKLEDAGGTNEKISDAIDKGHTLTFS
FT                   ATNTDDEKPTPFFAGFGNRITDALSYRTVGIPSSRIFTINTEGEVHMELLELAGYKSSY
FT                   IHINELVDHFFPPVLLNADDDMRSISSFTPGSPVSGTVDGKMGNISFQSNGPDDASKPY
FT                   FRSTQEEKFTDVNYWRDTLLSTDDLPDLSSDDNLDDVNDTKAATTSTENETPNKGKKNN
FT                   ADQKLMSQQGDKIATTTNGTNISKKGPVDTEKSGHSNKTHVSPESKEIGKRIYLHLGSP
FT                   LTSPVKTYPGESILEEMSALTKRASSPSSSVTKLNVLDDAHDEYNHDSELSDDNNEEDE
FT                   FDEDDFE"
FT   CDS_pept        complement(751794..752900)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441117"
FT                   /locus_tag="CAGL0F07711g"
FT                   /product="Similar to uniprot|Q03829 Saccharomyces
FT                   cerevisiae YMR166c"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG59227.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325384"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B641F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ1"
FT                   /transl_table=1
FT                   /translation="MWSFTSSIPVFGTVHDTDGHGHDIPTTSGGSGPSSSRSGDDQNLF
FT                   DDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEE
FT                   GFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSS
FT                   FVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLAR
FT                   DLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVK
FT                   TRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFFSGVGPRFVWT
FT                   SVQSSIMLLLYQMALRVLSNRESEKLDL"
FT   CDS_pept        753761..755932
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441118"
FT                   /locus_tag="CAGL0F07733g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59228.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG014498"
FT                   /db_xref="HOGENOM:HBG631009"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTZ0"
FT                   /transl_table=1
FT                   /translation="MGKIRALDPSVVNKIAAGEIIISPVNALKEILENSIDAGATMLEI
FT                   LVRDGGIKLLQVSDNGCGIQLDDLPLLCERFATSKLTNFQDLENIATYGFRGEALASIS
FT                   HIARLSVTTKTNDEQCAYKVSYNEGKMVDKPKPVAGKNGTSIHVEDLFYNIPSRLRALK
FT                   TPNEEFTRILDVVGRYGIHSKGIGFSCKKFGDSSYSITLKPDFTTIDRIRSIYGNNVAT
FT                   SIIGFEMDSNENLGLTKVSGYISTSNLNNKKSVQPIFFINDRLVTCDPLRRAIYNTYTN
FT                   YLPKGTRPFIYLSINISPPSVDVNVHPTKREVRFLHQDEIIDEITTSINDQLSKLDTTR
FT                   TFNRGVMMSKPLTDNSSTKYSQAATPTTTHPMNSSQTSQRRYENKLVRVDSSQAKITSF
FT                   LKSSQYNSAEYISASQHIGKQSNTASDNNKDKATPIDLNDDVNITRAQSLQDESQSNTY
FT                   SMLSKERVTVNLTSIESLRNQVDMSAHKELTEIFAGSNYIGIVDYYKRLLTIQFDLKLF
FT                   LVDYGAICNELFYQIGLTDFANFGTIQLQTQDTEQLSIRNILKTLNLAETKIDEISSQL
FT                   VEMKEMLWEYFSIEIIENESHVAFLKTIPLLLKGYTPSLSKLPLFIYRLGTIVNWNSEQ
FT                   ECLDGILKQIALFYIPEIIMEVSSSSESPKGEKHSNTENAHKKEELSEKIEHVIYPCLK
FT                   RRFLAPSSIVDDVIEIANLPGLYKVFERC"
FT   CDS_pept        complement(755947..757782)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441119"
FT                   /locus_tag="CAGL0F07755g"
FT                   /product="Inner kinetochore protein/centromere binding
FT                   factor Cbf3b"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59229.1"
FT                   /db_xref="EMBL:AAP69663.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059404"
FT                   /db_xref="HOGENOM:HBG203461"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B6421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY9"
FT                   /transl_table=1
FT                   /translation="MFQRPLPTKSNRPCSVCSKRKVKCDRLVPCGHCRKRGTESECVQS
FT                   AISANKGNHESEKGYLSGLLRFWQSYEYWIPNIGLFKSQKLKYENNEVLDYLNVEAQFW
FT                   ESSITETGSYKLLNYTIENLGTLYFGCIGDVTELYKILEQYWDIKEDQSSKLPFSDSDK
FT                   CYSRALLWSIFTMGVYYCPKELLDGIISIDKVRDFTKKQTLTEEQIRCKIYEGFITTTI
FT                   DSLYRCNFMAQPDIRFIQTYIILSTTLYSFQFPIQANMILTNAMYVTKLLSATVISASN
FT                   SEDIIGSIANESLNRLWYRICACDYIQEGPNKSIDFNRELGSLLKHAAYLEDLPSTDVY
FT                   KEEDNYEILFWKLLSLDRDIDQYLNNGLKPPPKTLDAVQREVDIYTQKVSNLEEDQKSI
FT                   NSKFEKFLGHFILYTVSWKIQKLQIIFYDNKVSLNKLIRITKNIIKLLVKNFEHGHDTF
FT                   NKHPLVIYYLSRVATFTNFYHIFENSVEIHEIVLDINELIVNLPPIFGNHLENLKYIIF
FT                   RFTLLRKEFGKTDVVDTGGEFQHPVFKVLQNDVATISKSNNKLNYLLKGLGSLIPGKSI
FT                   GEGIYEEDEDSMLDPTILEIVSEFEEKYPIDRVID"
FT   CDS_pept        complement(758205..759719)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349773"
FT                   /locus_tag="CAGL0F07777g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59230.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B6422"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY8"
FT                   /transl_table=1
FT                   /translation="MPEVFEEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPAT
FT                   EEVITSFYAATEDDVDKAVKSARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLAAL
FT                   ETLDAGKPYHTNAMDDIDQIIHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCG
FT                   MIIPWNYPLAMASWKMQGCLAAGNTLVIKPAENTSLSLLYLAQLFKKAGFPKGVVNVVP
FT                   GKGSVVGNSLGLHMDVDKISFTGSTKVGSSILELAGKSNMKDVTLECGGKSPAVVFQDA
FT                   DIDNAIEYIANGIFYNSGQNCTANSRVYVQEDIYDDFIKRFTEHTKENWKFGSKCDPFD
FT                   KDCTVGPVVSEKQFETVNDYIRHGKEEENLQIHQTVEKCDCKGYFISPTIFTDVPQGSK
FT                   LMKEEIFGPVVVVAKFKDYKEAIKLANDTNYGLASMVFTKNISVANWFARDIKSGTVWI
FT                   NSSNEEDPTVPFGGFKQSGIGRELGETGVESYMQIKTVHLNMSEKI"
FT   CDS_pept        complement(760681..762423)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196607"
FT                   /locus_tag="CAGL0F07799g"
FT                   /product="Similar to uniprot|Q03212 Saccharomyces
FT                   cerevisiae YMR171c"
FT                   /protein_id="CAG59231.1"
FT                   /db_xref="HOGENOM:HBG058545"
FT                   /db_xref="HOGENOM:HBG397085"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR018355"
FT                   /db_xref="UniParc:UPI00003B6423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY7"
FT                   /transl_table=1
FT                   /translation="MLLFLGLLAQASGFVIPDAYRDAQSTGLKRRDDVPTPPEVLPYPG
FT                   PAEDVPYPGTPDGYTNQDDQLDINVMFIYFGSMLVMYLCICIIYFTTKIVVTRLLTRHA
FT                   RISLLNEEGMATGLSARSRRLAESAESRWPSALDDENEVKSKLQKLSPEEQFYYKQGEE
FT                   YIKQNPPLIISTGSRSGDQNTVNDPIINDQTRQFIEEEGALAWEFQPNPNLPNDTIIVE
FT                   NKTEISFLNYNYDASVTTNLPIPCINRVYYCEFKIFELSITDDQTTLKDNEIISFGLST
FT                   SPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGT
FT                   VFFTRNGKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGSYGFVFIEANVKKWG
FT                   YAKPNGIKLPPPSYDDYVQDTLLESGYEDNDNSDNDSDDESDTDNRRQHRSIKNTIIDI
FT                   DGNLLPPPPGFEFSTSPHSHGTNEEINLDSLPMNPPSYSDEESKNQVKSKITPRDSVGR
FT                   SDGLTQDEQGSREGKSMMLNDLENDGLDDDEDDYMESDDGYEHDIDELQAMIEMEDDDR
FT                   NDSS"
FT   CDS_pept        complement(762977..765742)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196608"
FT                   /locus_tag="CAGL0F07821g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59232.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG124622"
FT                   /db_xref="HOGENOM:HBG204273"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI00003B6424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY6"
FT                   /transl_table=1
FT                   /translation="MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEA
FT                   SAAYIQRQIRKFLSCKKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFL
FT                   TQFGTALGNWKLLNIYSDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGT
FT                   SGLHIDVIAPVLSAWKVQFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELN
FT                   GSSVLLENMSYLYSKLKHANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYSY
FT                   LDSINIHTNFSSDLLNFIENAPSEAERDSVYVSLLSRENFVENLLNIFSRFQDPEQTYW
FT                   DDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKP
FT                   TNDSFLYTNEALPLLKIIYLRDSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYED
FT                   YYRSYKDNYDDLYDSDDEDNNDKEINDIMNLKANYLVNMEVKPNNIKQFRKLKILLEAP
FT                   FYVPFEQRVEMFYTLIELDKRRLNLDDDSSLMMDVLNALGPSLSRRQAVNISRDNVLED
FT                   AYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTN
FT                   QNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYF
FT                   DDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKN
FT                   NVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINL
FT                   EDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKF
FT                   GIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQKLLYAINAGAGFDLS"
FT   CDS_pept        766285..768123
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441120"
FT                   /gene_name="GPI10"
FT                   /locus_tag="CAGL0F07843g"
FT                   /product="GPI mannosyltransferase 3 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAG59233.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG027263"
FT                   /db_xref="HOGENOM:HBG397465"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI00003B6425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTY5"
FT                   /transl_table=1
FT                   /translation="MVTNKKDTDENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYFQ
FT                   ADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALSII
FT                   CSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETVEYYGVIYAPKLFMALLAATGEYF
FT                   TIKLIQKVYLKTVSKNDDQLPKLSNITKIALLLTLTNFFNCFFITRTFINSFEMILTSI
FT                   ALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSNAIIWIVLGFFLTINLLLRRDYTLI
FT                   GRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLL
FT                   QSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFI
FT                   YPLQPLFCLLSALGALKLAGKVQNYRYLKEYVWIIPLMSMIVSIFITTFQESGVIQVMK
FT                   DLHNEKDIDSVGFVMPCHSTPWQSYLHRNDIRQLWAISCEPPLHLLGKNNASIELQTYM
FT                   DESDYLYENISGFIKKNFPKFTNSMDMENVNNNASMPQFPHEWPQFLIIFEQLDNEFMS
FT                   RYLLDSGYVKYNKIFNSYSHWDSRRNGDLIIYYKNN"
FT   CDS_pept        complement(768270..770804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441121"
FT                   /locus_tag="CAGL0F07865g"
FT                   /product="Similar to uniprot|Q12151 Saccharomyces
FT                   cerevisiae YDR213w UPC2"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59234.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG192605"
FT                   /db_xref="HOGENOM:HBG203209"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B6426"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY4"
FT                   /transl_table=1
FT                   /translation="MTTLAVQNAVTNDVSKPQSRKREKIIELVDIGGKKVSTTSTGKRK
FT                   FHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLECVYTPVQPPKRRTRTRVKYITRDA
FT                   NGEIIETEKPQVEGKDVNGDLPPKAVSEIPGRKFMLSDPKDSGLPASISNLLSKGTSLD
FT                   PKTTNEGNAQDYHNASNRNQPNDISLKSLAGIEKSLLSHMSGNNLLNNTSNILGIPNQS
FT                   LLSGNQIQQHLQLLQQMNDSKPDGKTSSSFADTSLPHLNMKENEEKSNISQHKVLVQLQ
FT                   QQLQLERHQKQQLAQYQKLQMEQQQEFIKRSQEHENSSSSKSSLAAESVSSYDEQKGKI
FT                   DNNNNSATAVQADTLAQLSKLGISMKGLSSLLTAGFGGVQYDFQALLGLKNLGQSKQDK
FT                   ANYAHDALTSMQEDHEYARDEKIKMETTANNDINRMLGSSNNVSTPKLADTPGTTSILN
FT                   MTPLIREALVGSMSSPSMFDRSRENNILNVPTPTMSQNMVPADNLLGNNVKNLEQLSKS
FT                   SNLNLLDLKTFHHYCTNVWQTIVAANISDPQVWKNEIPAMAFEYPFLMHCILSFSATHL
FT                   SRTEAGLEDYITNHRLEALSLLRSAVLNITEENTDALVASALLLLMDSLANAWNNHDPH
FT                   MQLPKDTSNATDILKKNGMLLNAMSPSAWIFHVKGAATILTAVWPLSPKSIFFNIISVD
FT                   LSEFANSINHENNTITELICFDESISDLYPVEIDSPYLITLAYLHKLQGERKKKDFLLK
FT                   IFAFPALLDKTFLSLLMTGDIGAMRIMRSYYKILMNFTNDVKDSVWFLEGLSQVLPQEV
FT                   DDYSGGGGMHMMLDFLGGGLPSLVAANINEYL"
FT   CDS_pept        complement(773115..774794)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441122"
FT                   /locus_tag="CAGL0F07887g"
FT                   /product="Similar to uniprot|P12612 Saccharomyces
FT                   cerevisiae YDR212w CCT1"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59235.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI00003B6427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY3"
FT                   /transl_table=1
FT                   /translation="MAQLFNNSRSDTLFLGGEKVSGDDIRNQNVLAALAVANVVKSSLG
FT                   PVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVII
FT                   ASELLKKAYELVKNKIHPTTIITGYRLALKEAIRFINEVLSMSVDSLGKETLINIAKTS
FT                   MSSKIIGADSEFFSNMVVDALLAVKTQNPKGETKYPVKAVNILKAHGKSSTESVLVNGY
FT                   ALNCTVASQAMPKQIGGGNVKIACLDLNLQKARMAMGVQINIEDPEQLEEIRKREAGIV
FT                   LERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLISS
FT                   MSNLEGDETFESSYLGTCQEVVQTRYSDDECILIKGTSKHSSSSIIVRGPSDYSLDEIE
FT                   RSLHDSLSVVKRTLESGHVVPGGGCVETALNIYLDNFATTVGSREQLAIAGFASALLVI
FT                   PKTLAVNAAKDSSELITKLRSYHAASQLAQPDDQKKRNYRNYGLDLVRGKIVNEVTAGV
FT                   LEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHAH"
FT   CDS_pept        776659..779808
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441123"
FT                   /locus_tag="CAGL0F07909g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59236.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124623"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B6428"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY2"
FT                   /transl_table=1
FT                   /translation="MSTETPSRENSQLPGTTPMIDYGMAMELLQQHYKRRSTKACDHCR
FT                   KRKIRCDEVNPVTNKCSNCVKFKVECTFKFHEELQTKKKRMYELKAIEKANKKAKKRPY
FT                   RKRNRDAKQDSNTTDEASQTSANTKTVSPIYSDAQQHTEITNHFLAEENGKPVITNDEQ
FT                   HFIHQYNYQQPTAFHNYSHSMPSFQNMSPQHNQYNAKNDFNMHQPAVSYANGEHQLPNL
FT                   ENNNIPNAIHNPSLVVDEDTLAAVNDQITKIDRKLKGIVNANVYIQKCMDSLQSEDNSK
FT                   ERANDQPTMPVTKQYTTLLFTTQNMLYIKKKFFGQSNPSSNFDIDGNFLTKDELNQYSN
FT                   DTSESGNNGNYSNILAEKDFMPALKDIFAVYLKYYVVQMTKVMEFSSMPTLKPGNKLCN
FT                   IISREQASALISSFQTLLISSSIFPTDGKECSNLVDRYFRNNGNGLTKPEYLLVNICIC
FT                   LGAQKMRSQILRGKKEARQLEKDLLLKVKNLTLLNSVYFFHKMTISNICITSLQGLLLL
FT                   CHYIQIYINTETAAGVLVEAVNMAISLELHLHKSYEGLSPLELIKRRVLWSYCFSVDKY
FT                   YSLILSRPPLVRNENTDVLSPEVFFETVTVNILPTITYNPDLLKNDTPENRTEALNILL
FT                   SHYEFMPAVLAYFKVKLVKVELSLYETCFSVRSTLDNTFDQIIDKVLKIKAELDSWRES
FT                   LPSMLKLESYIQYISLLHSQIPEDNTLPNPVNMQCSVLNLHFRYYYLITNLSLFIDTFL
FT                   SDNKNLWNGSKHNISQVSQIFHNKAKDKSIKVLTLFLSLDYEPDLYSELSYYFLTCLFV
FT                   VLLYVIKNLNKTSNNCEMVYLINLLNDCHKFIIGNVENLLVSEDMKWNMSIFFFTYLMH
FT                   AITKNFKNDETSKQNFQLDFVFLGPLLARLVRTKTTIKQDILKQLESFVNIMGLYKEDG
FT                   NDIFGTQNFGESSATVLPNGNYLEELDIFSKFNSEALKILRTPIFGTGNVINCHGNELS
FT                   VRDEELTKERDIEGRSILPLDLDESESFGTSPYDSIDEFQDFLLQGVFFYDRDMLFSNH
FT                   G"
FT   CDS_pept        complement(780118..780825)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196609"
FT                   /locus_tag="CAGL0F07931g"
FT                   /product="Similar to uniprot|P50087 Saccharomyces
FT                   cerevisiae YGR235c"
FT                   /protein_id="CAG59237.1"
FT                   /db_xref="HOGENOM:HBG058615"
FT                   /db_xref="HOGENOM:HBG204434"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="UniParc:UPI00003B6429"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY1"
FT                   /transl_table=1
FT                   /translation="MAVDYYREVDLVQERVVPPEGVVVPSSGAKEAVYTPEKSNKDVIA
FT                   KASSKFVKLIGNNELVDGISVRYPPYMVDFFRRRRTNLAERLDRTSEKLEKASNRYYRS
FT                   ERKITSTIAGLKAERKEEFIPGLTYTAVSFMTGSVLTRNRNFVYRFFTPIILGTTCLAF
FT                   VLPGTFNNVKSLCYDIEKHNFPSFVENQDKIVFKINVGIGKTISVLEHTFSTIGKGVSR
FT                   TQAALQEWTGLNV"
FT   CDS_pept        complement(781219..781509)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441124"
FT                   /locus_tag="CAGL0F07953g"
FT                   /product="Similar to uniprot|P50088 Saccharomyces
FT                   cerevisiae YGR236c SPG1"
FT                   /protein_id="CAG59238.1"
FT                   /db_xref="HOGENOM:HBG124624"
FT                   /db_xref="HOGENOM:HBG204435"
FT                   /db_xref="UniParc:UPI00003B642A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTY0"
FT                   /transl_table=1
FT                   /translation="MQINPRIYSEAQKVAKQPQFKYLVAAMLCAAMVPTAYRRGVTLPH
FT                   YSQSVLEEVNENIAHKPIEKEKNPSMWGMLKDANKYDLNEEYTYELFSSIM"
FT   CDS_pept        complement(782229..784541)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441125"
FT                   /locus_tag="CAGL0F07975g"
FT                   /product="Similar to uniprot|P50089 Saccharomyces
FT                   cerevisiae YGR237c"
FT                   /protein_id="CAG59239.1"
FT                   /db_xref="HOGENOM:HBG124625"
FT                   /db_xref="HOGENOM:HBG204436"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B642B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX9"
FT                   /transl_table=1
FT                   /translation="MSTSTSYARHISFDDLAPSLIDDQAKIIRETSQHIGFYNHFIKVP
FT                   PQYNPAYRNAVGSGDASPLRQQNHELDSRKLTSKLDGMHLAPRGRSALGTSNRSRSVSP
FT                   FIHSPKVTNAPRLPPPPEQKILKMKEIKVDEPVEIEDIDISDVDPNLEKHIKKVTESNT
FT                   QTNSGSNHGYTQNAFSNLNELEDRIDVKNNKTSQPPVGEEKKRSKSFAGMTDAELAQLE
FT                   DFYTSQARSTSVSNQMNNFDFGKQIPVFFDDSKKNNNVNANLALESLAAIYPTRPTITY
FT                   KSMSLNSQHPEYTAFMKKMRKHVPCREKEHTIDYRTIMCYISGRRYTWSSVDWYIENVA
FT                   ADGDHLVIVSRVPEFEKELETLCNQEKRKSKLQQRNSDRSDRISVYSESHTLSSTPSSD
FT                   PDAVTPSTIGFRAEAIRDRAREVCRELLDYYAYRLKDKITKITVEIVKSDSTKDAITGA
FT                   AGVYAPNFQIISTVSTNTQIKFRNGNVKLPFFVLKHYPMPTFLIPFEFIDPSLLDKDYL
FT                   SPESHGSVKVSYVDDYERVDLDSRLTWLDQVIKKTTKNPYAQNSDKPIDPICDSDSEAE
FT                   SVASFTGDLPIQDKKRYEEFEHLGYVMPAPMRQLLAKRSKLVYDIDGKRLAPDNTSRGS
FT                   GRSSRLYLNDGGMYRVKSMVDSVQTSETDGENDRSKMNQNTLNNTGIRKVKSSGGPIFL
FT                   TPPMPGSTNRPPKGRKHSDTSLKKAKSHDPTSKSSTPLSLPRASSNGKSKKTDSSKNSS
FT                   SSSSKKSIGSMFKKVFW"
FT   CDS_pept        complement(785803..788613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441126"
FT                   /locus_tag="CAGL0F07997g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59240.1"
FT                   /db_xref="HOGENOM:HBG124626"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI00003B642C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX8"
FT                   /transl_table=1
FT                   /translation="MTSFLFRRLTRRKKNKDPKEKNKEKSNRGNLRISKVPPPAEKYPT
FT                   PPRAKNQYVIPTITDDPAVLNSPSTSVRIPRAPMFADIDYDNITERKAKRLSRTDRSVR
FT                   YSHRHSSRRISMLISKLEEDKKKTVSLDSSDINVRYSFRDSALSRLQEVLDEANESPWG
FT                   RTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGELVYGDTWMLTANSDSTNFTTQVID
FT                   LTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTIPTPIGT
FT                   RPLGRYGHQVSVIATTPKKAKLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKA
FT                   FTPPPLTNHTMVAYDYKLWVFGGSSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEH
FT                   SATIYKNLMCVFGGKNKDDEYQNTMYFLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQN
FT                   DKILIMGGDKNDYCVNGANLNDIDEYDRGYGVASYTLDLKNLNDYCPGVFSIERPANLT
FT                   HVAKNPEARYSMASPGPNILTPYLQQVRQLNRLLSTASMSPKTPSPMISKALPESSEKE
FT                   DISKDQAENTSGSTQSPPAGLLGTSEAPQSGRSENESVFEDAFPASHLSESSSPQQSEI
FT                   SIVENKKQNNPFITNPLGTINSSIIELNKANTSQLPIEGTRSVILSQDTVEQLQQDLEE
FT                   LRIMEESNETVSDNKLKQLKMEIDNLRNKDVVEDTTKSTLDDLNEKFKRLEQGKDALRS
FT                   KMSKLDSMFENNEHHKATEHTGYALLNLNSKASRNKDTDLDDSNQHLVSIDAEKVADEL
FT                   LLIGDKREDSSASDKSESFTLTESNQPETSNGDFIYNDANKNGKTSLERKTVPRKMPVD
FT                   KKRVKRRTILFHSQKHKEMMEELTKQLDMLTYDSQEMASSEIDSNSSYKLENQMPVMPG
FT                   NFPQTM"
FT   CDS_pept        complement(790810..791508)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441127"
FT                   /gene_name="PEX21"
FT                   /locus_tag="CAGL0F08019g"
FT                   /product="Peroxisomal membrane protein PEX21 "
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG59241.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="HOGENOM:HBG124627"
FT                   /db_xref="UniParc:UPI00003B642D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTX7"
FT                   /transl_table=1
FT                   /translation="MSQYCAADPIQRMVSRKGPYLDTQQQRVYKHRSGTGHGTNIRQPT
FT                   TGIVEATFLQNNSGMNAVHPTTLNVQTHNAHATGRTIAKSVDTNSWVNDFSSMKVQDPL
FT                   EFADSYKNLYKQYEQKQFHNTVPAQCPRNLYIPTVTRPQTTLNIVDHHEDKSSAVDQLI
FT                   DDEFEKIEEEVKDQNQKLEFQESAQSFIEICERSQMKEKLQRSKFFQVMQKVSDGEATI
FT                   RQDGENYVIR"
FT   CDS_pept        complement(792575..795550)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441128"
FT                   /locus_tag="CAGL0F08041g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="6-phosphofructokinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="6-phosphofructokinase complex "
FT                   /protein_id="CAG59242.1"
FT                   /db_xref="GO:0003872"
FT                   /db_xref="GO:0005945"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG027559"
FT                   /db_xref="HOGENOM:HBG324640"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniParc:UPI00003B642E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX6"
FT                   /transl_table=1
FT                   /translation="MLHQDNCYGVAFRAIATADEELFKQTVRFYHSLGFSTIKDFNKFK
FT                   HGENVVLASGTSDDSLREVWLESFKLSETDSLGFRVPQQEASNKAQSQGAFVKVRLVMH
FT                   EPLKDVYSTAQTSHITYFSADLPAIAKEFGDKVTKVSDSVLQMNDPMGNQLSFTSFASP
FT                   LDEKPTNMDAFLKPLEKEDDITASQSTDAVNQLKESLQSGSNLQKKKKIAVMTSGGDSP
FT                   GMNAAVRAVVRTGIHYGCDVFAVYEGYEGLLRGGKYLKKMHWEDVRGWLSEGGTLIGTA
FT                   RSMEFKKREGRKRAAGNLISQGIDALVVCGGDGSLTGADLFRSEWPSLVEELVKDGTFT
FT                   SEQVAPYRNLTIVGLVGSIDNDMAGTDSTIGAFSALERICEMVDYIDATAKSHSRAFVV
FT                   EVMGRHCGWLALMAGIATGADYIFIPERAVPHGQWQDELKEVCQRHRNKGRRNNTIIVA
FT                   EGALDDQLNPVTAEDVKDVLVDLGLDTKVTILGHVQRGGTAVAHDRWLATLQGVDAVKA
FT                   VLEMTPETPSPLIGILENKIIRMPLVESVKLTKSVATAIENKDFDKAISMRDTEFIELY
FT                   ENFLSTTVKDDGSEMLPVTERLNIGIVHVGAPSAALNAATRAATLYCLSHGHKPYAIMN
FT                   GFSGLIQTGEVQELSWIDVENWHNMGGSEIGTNRSVAAEDMGTIAYYFQKNKLDGLIIL
FT                   GGFEGFKSLKQLRDSREQYPIFNIPMVLLPCTISNNVPGTEYSLGVDTCLNALVNYTDD
FT                   IKQSASATRRRVFVVEVQGGHSGYIASFTGLVTGAVSVYTPEDPISLKSIREDLSLLKE
FT                   NFRHDKGENRNGKLLVRNEQASSIYSTELIADIISESSKGRFGVRTAMPGHAQQGGAPS
FT                   SKDRVIASRYAVKCIKFIEQWNKKNKATALDKDAKVLRFKFDKHGAKIPTVEHEDDSAA
FT                   IICVNGSHISFKPIASLWENETNIELRKGHEVHWTEFNEISNILSGRLRLRAEVEASNN
FT                   RV"
FT   CDS_pept        complement(796793..798397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441129"
FT                   /locus_tag="CAGL0F08063g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="1-phosphatidylinositol binding"
FT                   /function="clathrin binding"
FT                   /biological_process="clathrin coat assembly"
FT                   /cellular_component="clathrin coat"
FT                   /protein_id="CAG59243.1"
FT                   /db_xref="GO:0005545"
FT                   /db_xref="GO:0030118"
FT                   /db_xref="GO:0030276"
FT                   /db_xref="GO:0048268"
FT                   /db_xref="HOGENOM:HBG204440"
FT                   /db_xref="HOGENOM:HBG252389"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniParc:UPI00003B642F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX5"
FT                   /transl_table=1
FT                   /translation="MALNKLVKGATKIKMAPPKDKYVGPILQDTSTSRHSMQEAVQLLG
FT                   QRIAGSNEWTIVFKSLIMLHLMIQYSEQSEARGFDDDDDYYGGNRRKGDGSPILDYMSR
FT                   NLDFFNSTRKILSSSKWSRDDIKVIERYNQYLKIRCKEYDLCNGTDYVKVGFNIAMKYR
FT                   RERSQQNLGNKNISISTELDHVESLENTITALIKNRFSQIDLQNDLILYTFKMLVTDLL
FT                   PLYNSLNGGVIALLESFFELDRAEAKRTLELYKSFVDLTDHVVNYLKIGKSVGLKIPVI
FT                   KHITTKLISSLEDHIRNEERGGAKLNSQRKVSSNTTAYGDESNRNANQPGTLQRSETTS
FT                   SMAQQKLEQIREQKKILEQQLQNQQVLITPTVPQEPYVNNPFTPSAADTFSFEPTGSNP
FT                   FAPQMTSPQMMMQQQQPQAQPQQPMQTSPMPMVQQGTSMYVGNQMSGFTGGNVNGIQQQ
FT                   SPQQPLAQQPLRTGSNNPFALENMAQYETVENPFGTAHMPTIQEVDMQQMQMQQPVTYA
FT                   MIPVQITNPFQQQQQQM"
FT   CDS_pept        799495..799902
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188910" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196610"
FT                   /locus_tag="CAGL0F08085g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59244.1"
FT                   /db_xref="HOGENOM:HBG335382"
FT                   /db_xref="HOGENOM:HBG627499"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI00003B6430"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX4"
FT                   /transl_table=1
FT                   /translation="MSTIGFAFKRFWQSETGPRTVHFWAPTLKWGLVFAGLSDLNRPVD
FT                   KLSGTQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGVQIGRLMNYRLTNGDT
FT                   MSQAIGYLFHGKPANTIASSGNGKKPEQLIA"
FT   CDS_pept        complement(800627..801886)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501945"
FT                   /locus_tag="CAGL0F08107g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG59245.1"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG130207"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI00003B6431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX3"
FT                   /transl_table=1
FT                   /translation="MFRGTVLNKNLAQLARVQGKRHLSIHEYRSAELLRKYGVGTPRGL
FT                   PAMTPEEAAKAAEQLGTDKLVIKAQALTGGRGKGHFDTGFKSGVHMISSPQEASKLAKE
FT                   MLQHKLITKQTGEKGKLVSAVYIAERVETKHEAYLSILMDRATGKPMIICSSEGGMNIE
FT                   EVAEKNPDAIKKFSITVSEGLKPETAREIAESLGFSADAIDDAQDAVSKLYKIFSETDA
FT                   TQVEINPLSEIANNKDHKVMCTDAKFGFDDNAFFKQEEIFSWRDLTQEDPDEVSAKKYE
FT                   LNFVKLFGNIGCLVNGAGLAMATMDVIKLNGGEPANFLDCGGGATPETIKEGFRLIMSN
FT                   DKVDAIFVNIFGGIVRCDFVALGLVEAAKELGLRIPIVARLQGTNLDEGRQIIKDSGLK
FT                   IYSFDELDPAAKKVVELAHH"
FT   CDS_pept        complement(803610..805847)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196611"
FT                   /locus_tag="CAGL0F08129g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG59246.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG347669"
FT                   /db_xref="HOGENOM:HBG561315"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6432"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX2"
FT                   /transl_table=1
FT                   /translation="MVKRSRAAILPTNIILLQNLVKRDPESYYEEFLQQYAHYESLRDI
FT                   FMLGNMAGEGDATTSGVESTTGSSEGNTSTSQLIELIGFVSQVCSCFPKETQNFPDELR
FT                   ELLLEHHKSLPFELKEKILTSLTMLRNKGVITAEQLVQTFFPLLVAYSSQGNTLGINSH
FT                   AKELRTLVYKNLISLLKSCNTGSKNQKLNKSTQAICFNLLDQPDSQGIWAAKLTRELWR
FT                   RGIWDDSRAVEIMTQAALHNDAKIAISGVMFFLDADREREETFEEKSDDEDAIDINALK
FT                   HKMQVNKKTGRRGKKLENAVKTIKKKNKNGTNQAFLNFSAIHLLRDPQGFAEKLFKEHL
FT                   SGKNSNKFSLEQKISLMQLLSRMIGTHKLIVLGIYTFFLKYLTPKTRDVTKIMAASAQA
FT                   CHDLVPPETLNVLVRKITDEFVSDGVASEVAAAGLNTIREICTRAPLAIEETLLQDLVE
FT                   YKGSKAKGVSMAAKGLVSLYREVAPEMLKRKDRGKVASMELQEAKRSGTERDNRKLQFG
FT                   VENTVQGIQGIELLAKWKKEQEANGEAVDDDDDKNWEVEDMEEEDDVDGEWVTMDSDKE
FT                   YDVDMEDSDDEKKSEEKSEENPEEKPEDKIDPESAFREIASSRILTPADFAKLQELRTE
FT                   EGVAKLMGMRNEKNEEVVDAGLLTGPVKYKQTREERLQKIMEGREGREKFGSRRGKRDN
FT                   ARSTTNREKERRKNFVMSIHKRSVRGKQKMSLRDKQKVLRAHITKQKKKGH"
FT   CDS_pept        complement(806209..808005)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441130"
FT                   /locus_tag="CAGL0F08151g"
FT                   /product="Similar to uniprot|P29056 Saccharomyces
FT                   cerevisiae YGR246c BRF1 TFIIIB"
FT                   /function="transcription activator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59247.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG489279"
FT                   /db_xref="HOGENOM:HBG713726"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI00003B6433"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTX1"
FT                   /transl_table=1
FT                   /translation="MVLRCKNCGNTELVVDSSTPNNDLVCVACGVVSEENPIVSEVTFA
FT                   ETSSGAATVTGSFLSAGQSHTSGGLGSNAMESREATLNNAKKKLRAVGHALNIPDYIVE
FT                   ASHQWYKLALAYNFVQGRRSQNVIAACLYIACRKEMTHHMLIDFSSRLQVSVYSIGATF
FT                   LKMVKRLQITKLPLADPSLFIQHFAEKLELGEKKIKVVRDAVKLAQRMSNDWMFEGRRP
FT                   AGIAGACILLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKGTKAASLSVKEFRNDD
FT                   PKKEDSGAAPPSFTKNRKQEVALKKKLEKKELYETSEEALARNPILTQVLGEQELSSKE
FT                   VLYYLKEFTQKREKVIQRLKTTHGIDDSDVLQSQGTDEEEVVTNGGETNETNEHNNKKR
FT                   VREDSQEVEESVASDAKSLNVTLSSGRKINDLIDGYSLEKDPYRPRNLNKLPTTESLLS
FT                   KVPDDPENLDDVDDEDLDALILDEEASKLKERIWIGINSEYLLEQESKRLKQEADIAAG
FT                   NTSGKKKRQKKRKNKNDGEVVSAVNTMADLKDKSGFIAALRHAEEIGDTTAAESVKKML
FT                   QKSTFSKKINYDAVEGLFNHAA"
FT   CDS_pept        808506..809087
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111920" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349774"
FT                   /gene_name="CPD1"
FT                   /locus_tag="CAGL0F08173g"
FT                   /product="2',3'-cyclic-nucleotide 3'-phosphodiesterase "
FT                   /EC_number="3.1.4.37"
FT                   /function="2',3'-cyclic-nucleotide 3'-phosphodiesterase
FT                   activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="Golgi apparatus"
FT                   /protein_id="CAG59248.1"
FT                   /db_xref="GO:0004113"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG058935"
FT                   /db_xref="HOGENOM:HBG398102"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniParc:UPI00003B6434"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTX0"
FT                   /transl_table=1
FT                   /translation="MSIALWYCPAPGTLDYEVLKTLINSLQLLVPGSPSFEPHLTVVTH
FT                   LQVQNRGDVSKVLQSCSSCLKTIPKGHSLIKYSNWSINKQYFKKIVLECEKDKYLLSLA
FT                   QLMRELYVEIEDQKRRAEHWVIEEFQPHVSLMYNDSQITKATEMVVRQRIHDAMQLFSN
FT                   NPSSKSWRTFKVVSCEGPVEEWQVLGSVTL"
FT   CDS_pept        813050..814027
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441131"
FT                   /locus_tag="CAGL0F08195g"
FT                   /product="Similarities with uniprot|P53050 Saccharomyces
FT                   cerevisiae YGR249w MGA1"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59249.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124628"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B6435"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW9"
FT                   /transl_table=1
FT                   /translation="MQHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCD
FT                   NVLKRYFKHGNVSSFVRQLHMYGFHKVGNNSVNSHINNIEGNKIVSKKEPHFIIWKFSH
FT                   PSGNFHRESSYETLCKITRKPTGFGKDGKRKNILSPIAISYLNPGIKTELSYLPFSRAA
FT                   TGIDNFDLQKENMSYIESATDEALTTSTDTLIDNSLFSGITSANSINTIKTSGTGSNGI
FT                   TTGSSNIQTLINNNIALLKKTTLLIIEILDKFNNPELSQKSEEMFSNLQKLQELKNQLV
FT                   SKQCELVNMVQPELNSGKSNQVIQSNQYPTPSQFPNFQNYFPSM"
FT   CDS_pept        complement(814508..816544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196612"
FT                   /locus_tag="CAGL0F08217g"
FT                   /product="Similar to uniprot|P53316 Saccharomyces
FT                   cerevisiae YGR250c"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG59250.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG124630"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6436"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW8"
FT                   /transl_table=1
FT                   /translation="MAGNPHIENIANTNQLTIRLKPTNEELNAALNNCATDHKGLIVPQ
FT                   ERIEPYESLNETKRAEYLSLKNINNEQNKLVASGNADTEEIESYERVIQFQFKHMPNLK
FT                   NCLKKVKAILKEEFEKGALAYWSISLNTHALTHPGNLFIGGIPKNMSLNTLMETFDKFG
FT                   TISSLKILFDNKNVGIGFLSFMLGSEAAECIRCMNGTKIRSDNGDEGTLFINYHIERKE
FT                   RERLFLSHESSDSSASSLSVRNMRVNTHHRGKHNSPELNSWSTNNSSDDLTINNCVFIG
FT                   NLPTDIQNEGEFIDDLTEAFPSVTVISYYFPYDHSLNQYKGYGFIKLQNNDQARRIIHE
FT                   ISTDCFEFCGNHIIANKASNKDNKTTSHFTLYTKTTETNPKTRNNYLEQTSPYAGGINT
FT                   FPPSMNNYTFGYDLYPPIKRGSHNLPYIYGLPVPLEGQQESNIYVKHVPLDWSDKDLFN
FT                   FYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYGFVYFANPLDAAYAILST
FT                   DGYYLEGAIQKLSVSYAQKKKKDGQSLLDESLSNESSDQIDNSEKTNEKEKRNHSSAKF
FT                   GQQQYNKKFMNALMSNFYHRNYVGKPSYNLVPSQAMGSPGMSSGMISSSRGNMGLMTPQ
FT                   LIPAAPIDMYSTNSQPRILPNANWFAYPIYPQCPVPLPMDNLV"
FT   CDS_pept        821107..822540
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501946"
FT                   /locus_tag="CAGL0F08239g"
FT                   /product="Similar to uniprot|P53318 Saccharomyces
FT                   cerevisiae YGR255c COQ6 monooxygenase "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, NADH or NADPH as one donor, and incorporation of
FT                   one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAG59251.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016709"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG399370"
FT                   /db_xref="HOGENOM:HBG464401"
FT                   /db_xref="InterPro:IPR000689"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="UniParc:UPI00003B6437"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW7"
FT                   /transl_table=1
FT                   /translation="MLKMQLSSVRYLATIAKNSTPKLTDVLIVGGGPAGLTLAAAIKNS
FT                   PTLAGLSTTLVDAGDLKKVGEFHDQPPEHFTNRVVSITPKSLHFIAERAGAGDFLLRDR
FT                   IQPYDGLYVTDGVTKSLLDLEKPSMLEMIEILNIQSSLLKKLSQYDEVLDGFKLVEKSK
FT                   VTKIENTDPKDPTSWPLVTLDNGDVYKTRLLVGADGFQSPVRKFANIETRGWFYGTFGV
FT                   VATMKLQYDTYKLRGWQRFLPDGPIAHLPLPGENATLVWTTTERISKLLLTLDPKAFAS
FT                   LVNAAFVLDNTDLQYYFDELEAGKISTNELIEDVKFRMDQEFSKLSDETMIDELYPPQV
FT                   IDIKGDTRARFPLKMTHADNYCSHRVALVGDAAHTTHPLAGQGLNMGQGDVEALVDALE
FT                   KATQRGQDIGALLSLEPFWAERYATNHVLLNMADKLYKLYHTDSAPVVALRSLGLDLTN
FT                   NFPPVKNWIVKTLTADTEF"
FT   CDS_pept        complement(823014..824330)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441132"
FT                   /gene_name="ENO1"
FT                   /locus_tag="CAGL0F08261g"
FT                   /product="Enolase 1"
FT                   /EC_number="4.2.1.11"
FT                   /function="magnesium ion binding"
FT                   /function="phosphopyruvate hydratase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="phosphopyruvate hydratase complex "
FT                   /protein_id="CAG59252.1"
FT                   /db_xref="GO:0000015"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004634"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG410079"
FT                   /db_xref="HOGENOM:HBG726599"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniParc:UPI00003B6438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTW6"
FT                   /transl_table=1
FT                   /translation="MSVTKVHARTVYDSRGNPTVEVEVYTKDGMFRAIVPSGASTGSHE
FT                   ALELRDGDKSKWEGKGVTKAVSNVNDIIGPKLIESKLDVKDQKAIDEFMIKLDGTKNKS
FT                   KLGANAILGVSLAVARAGAAAKGVPLYQHIAELADMKKEPYVIPCPFFNVLNGGVHAGG
FT                   NLALQEFLIAPVGAESFHEALRLGSEVYHKLKALAKKRIGSSAGNVGDEGGIAPSLSTP
FT                   FEALDLIYDAIKEAGHEGKVKIAMDPASSEFFQGDKYDLDFKNPHPDAKNKLSGAQLGD
FT                   YYKTILEKYPIVSLEDPFAEDDWEAWTNFFPKAGVQIIADDLTVTNPERIQTAIDKKTA
FT                   DCLLLKVNQIGSLTESINSAKLAYGAGWGVQVSHRSGETEDTFIADLVVGLRTGQIKSG
FT                   SLARSERLAKWNQILRIEEELGASNTIFAGAKFHKGQLL"
FT   CDS_pept        825860..827500
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501947"
FT                   /gene_name="GCN5"
FT                   /locus_tag="CAGL0F08283g"
FT                   /product="Histone acetyltransferase GCN5 "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59253.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG211743"
FT                   /db_xref="HOGENOM:HBG749648"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00003B6439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTW5"
FT                   /transl_table=1
FT                   /translation="MVTRRRLHHPEVEQVSKRQKVDKAESKNKKHADVAAERGEQSTED
FT                   HEDESQDKKDKKVVGDNRDEDEEVSPNGQEAAEDNDDRKDKDAKEKDTETNDEGTEKSH
FT                   TDVNDDDDDVDESKEEDAAAAVDITKEKKDEQESDNKTEEKKVQENEEEEEEDENKNDE
FT                   DVEELGSTEPVDDEKKGLVKFEFDGVEYKFKERASVIEENEGKIEFRVVSNDNTRENMM
FT                   VLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYKPFNKRQFAEI
FT                   VFCAISSTEQVRGYGAHLMNHLKDYVRNTSDIRYFLTYADNYAIGYFKKQGFTKDITLD
FT                   KKVWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAALRRKIRTISKSHVVHPGLE
FT                   CFNDIENIKPIDPMSIPGLKEAGWTPEMDELAQRPKRGPHYAAIQNILVELQNHAAAWP
FT                   FLRPVNKEEVPDYYEFIKEPMDLSTMELKLENNKYEKMEEFIYDARLVCNNCRLYNGEN
FT                   TSYYKYANRLEKFFNNKVKEIPEYSHLID"
FT   CDS_pept        complement(827705..828829)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501948"
FT                   /locus_tag="CAGL0F08305g"
FT                   /product="Similar to uniprot|P53320 Saccharomyces
FT                   cerevisiae YGR257c"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59254.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG382079"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B643A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW4"
FT                   /transl_table=1
FT                   /translation="MTDRPPATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQQQQML
FT                   ADCGCADISELDDSKVRKRISEGGVRRNTLEQLRQSKVVNRIDTVPKIFWESTCFQNLN
FT                   CRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGL
FT                   YPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIA
FT                   MRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSF
FT                   LGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEG
FT                   IGALYTGLAPRVAKIAPSCAIMISSYELTKRLFM"
FT   CDS_pept        complement(829426..832404)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045375"
FT                   /locus_tag="CAGL0F08327g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="endonuclease activity"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59255.1"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG059409"
FT                   /db_xref="HOGENOM:HBG397052"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI00003B643B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW3"
FT                   /transl_table=1
FT                   /translation="MGVHSFWDIVGPTAKPVRLESLHDRRMAVDASIWIYQFLKAVRDK
FT                   EGNAIKSAHITGFFRRVCKLLYFGIKPVFVFDGGVPVLKRKTIQKRKERREGKRDNATN
FT                   TAKKILAKQLQTLKDNGAANEQLQSNASNGTANGNTSKVFTPFDEWDLPDIPGFRYSRS
FT                   DERVNAADDFEKLINSIDTDVIDDIDLDSINPASKEFEELPKTTQFMILSTLRLRSRLR
FT                   MGYSKEQLENIFPNSMDFSKFQIDMLKRRNFFTQKLINVTGMNDGGASKLEDEDSNGGS
FT                   RLSSTKDKEYKLVKTENGWSLGFGDVDGSEANKAILLDDPEHSVAIKMEKDMGNNLGSS
FT                   FGAEDEDGEEEFDWEDVDLKPAPQRKVEDYSLKAARKLTTGAGSEIKRAAVQSFLDTRP
FT                   SDISPRKRKAQEQIMKPIHIEEDTTPDLQNENVAEVLSTDDSEGEYEQQMKEIELMENF
FT                   KKKRNLKEQLNDSATNESIMRVDNNYKVNEQPIIRGDRTNQPVLTESEQNLRFIVNKIP
FT                   TLDGGGSLLFGPNVEKPVIDDIDGVQKVLPAEEGEKRDREVPEIPSWFTNDSFIEKSNP
FT                   YTANQFVNDIDLKPNADEISKSPRKEEYQLLSGLAATDAINELSSTRAPNDVVEVGAFQ
FT                   SFKTPSQKAETAQKSSSDEEDYDDEQVRKPEVFDYNFSEEEEEELAENLRREEEDFREF
FT                   RVTALNNKDVSQNAFIEDEIYAQQVKDKRDADEVTMDMIKDVQELLARFGIPYITAPME
FT                   AEAQCAELVNLKLVDGIITDDSDVFLFGGKKVYKNMFQEKNYVEYYDSEDIYQGLGLTR
FT                   ETMIELAQLLGSDYTTGIKGMGPVSSMEILAEFGDLKNFKRWYNEGQFDKKKQEGEDKF
FT                   RRDLRKKLVKNDIILDDDFPSVFVADSYLNPEVDHDKTPFTWANPDLDMLRQFLYSYLG
FT                   WPQEKSDEVLIPLIRDINARKKAPKQSTLTDFFPREYLDHKKLNLGKRITTATGKLKQR
FT                   RLK"
FT   tRNA            complement(832602..832674)
FT                   /gene_name="tRNA Val (CAC)"
FT   CDS_pept        835733..837322
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501949"
FT                   /locus_tag="CAGL0F08371g"
FT                   /product="Similar to uniprot|P53322 Saccharomyces
FT                   cerevisiae YGR260w TNA1"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG59256.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B643C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW2"
FT                   /transl_table=1
FT                   /translation="MTLRMRGHDNIEEEVSSGHDFDDGRKVVKVESPLRETDESESDEK
FT                   KVLESANEREVLGTTTDDDGYMLPSLDHPMEKKILKKMDLFIIPLLGLMYFLSNLDKSN
FT                   IGNAEVAGLSKSIGLKGKEYNIAVTVFFGTYIVFDPVGANLLKIMGPNRMMSSCLLCFG
FT                   AISLATAFIKNYGQLLAVRLLLGMFEGMIYPAINMYLSVCYRREQYAVRFAFVFTAAAL
FT                   SSAFGGLIAYGCSKIHGSLEAWQYIYIVEGAISIGFVPVYIWGLGRKLEDSWFFTEEER
FT                   EYVIERYNTMNTFNPDEKFEWFQVWLAVKDIKTWVSAIALFGIDLTTFGLTVFLPIIVT
FT                   SLGFSHVRAQLMTVPVYFLTAVVFFVCAIWSDKLKLRSPFIIGACLTTSIGLAIVLGST
FT                   VHGVRYFGVFILCMGIYVNAACNCLWLSGNNGNYFKRATALGINLFIGSGSGLVSGQIF
FT                   LAKDKPRYIMGLSLCLGFQVLSIVMTALQFYLYYRSNQQKQKIIDHCHEIGEPIPYDER
FT                   LSDLNPEFKYMY"
FT   CDS_pept        complement(837596..840016)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441133"
FT                   /locus_tag="CAGL0F08393g"
FT                   /product="Similar to uniprot|P46682 Saccharomyces
FT                   cerevisiae YGR261c YKS5"
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAG59257.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG397051"
FT                   /db_xref="HOGENOM:HBG434009"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B643D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTW1"
FT                   /transl_table=1
FT                   /translation="MSQFASALESARTLTLEAAAVASSKLGESSYKQYSKTISPRQLKT
FT                   LLNSRNTREVKDGLKCLISAMALGDNTIDAKSYLPDVVKTVHTDDMRIRRLVALYLVRY
FT                   AEIDQDVALLVVNSLQKLVNDTLSETRAFSIKSLVDMRLKSLEPIIIHGMRKSVSDPSA
FT                   IVRSEVAYTIAKIYTSAYEDFQDELEITLKELLADSDPTVISSVIVVFYRHFLDHLDWL
FT                   HGHFRRYCNILHELDSNAQIYMITSLTLYSKRYIPKPLLRNSENEKESMPLPDDIQEII
FT                   YTAFTIENDPDLDLLLSGIRKLIYSDNFAVLLTCCQAILQLSTPGSLRRTKFPEVIANL
FT                   INNSRTNGSIKSLILQNILLMSTVDPQIFTPYFRQFFLYPTDNIVTAEFKLKVLSSLVT
FT                   EETIDSVATEIRRYVYDDLAQNIKKEAMIALGICGQLSELWESKILKWLLRFLTYQKLD
FT                   KNLMDTAVDVIRVLLHSNPRSHIKTVLELSTLLESQDTLHDKARSGIIWLFGEIARVEF
FT                   SVCPDVLRKLTLNFAQEGRYSRHQILLLAAKLLSYDISANTTGDGAYDYSKSRLYQIFN
FT                   TLIYLAKYDDDFDIRDRARMLGSLFHEDKLQIGTLLLQGTKPEPQLFPSNYRNRDGSED
FT                   QNVKSLISYGVSSSLINAYLFRKWEYSPDPVSENQDIREPTPTKDYRKYYTSISSDSFK
FT                   GRDTISNNAFSSSIDRNKDFEAKPSKDSTYVSKRGQKYKLQSLEEFFSDIPEQPNKKSL
FT                   NQSIDNSTGDKKPHISSEEEDTEEESDEGSNSESETGEDDLDSSEEYTDDSSD"
FT   CDS_pept        complement(840334..841134)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441134"
FT                   /gene_name="BUD32"
FT                   /locus_tag="CAGL0F08415g"
FT                   /product="Serine/threonine-protein kinase BUD32 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59258.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG174503"
FT                   /db_xref="HOGENOM:HBG574115"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniParc:UPI00003B643E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTW0"
FT                   /transl_table=1
FT                   /translation="MSQEIVDRVRNYLSPNIPVTPISQGAEAVVFTTSVHPYLPENCNS
FT                   NEKYIIKYRSPKRYRHPVIDKSLTKHRTLGEARLLSKLYTIEGLHVPKLIACDAYNGYL
FT                   WLEFLGEDLPENFGYSNLKNFLWMYDAKNDPYCEVVKRALIEVGEQIGKLHWNDYCHGD
FT                   LTSSNIVMVHSDTDSHHWVPHLIDFGLGSTTTMVEDKGVDIYVLERAILSTHSQHAEQY
FT                   IEWMLDGFKSVYEKNGKLGKKKLDELLKRFAEVRLRGRKRSMIG"
FT   CDS_pept        complement(841456..842718)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196613"
FT                   /locus_tag="CAGL0F08437g"
FT                   /product="Similar to uniprot|P53324 Saccharomyces
FT                   cerevisiae YGR263c"
FT                   /protein_id="CAG59259.1"
FT                   /db_xref="HOGENOM:HBG124631"
FT                   /db_xref="HOGENOM:HBG204444"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI00003B643F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV9"
FT                   /transl_table=1
FT                   /translation="MDTKSNVSVNTTEIPTNITVTTDLSTLRNEEDSITMSIWHTLRFL
FT                   SKFIGILPFKMTYYLIKVVMESERGVNIDIVSRIFMRESTKLIDENICQYVLNPIFEFI
FT                   YKFEGNGISLINYSVPNDDLEQISGGIFDKPFVKSTRTQSKFFWKRQINPHTFNPEIDP
FT                   ILIYYHGGGYALQLTPTTLSFLTNTGKYFPDMPILISDYATTASKLDSNKYPRQLLDIL
FT                   AVYDYVTQSLGCKNVIVMGDSAGGNAVLVLLLYLHKHNRPLLPRKAIPISPWLNTTYIG
FT                   EQERTYMKQSEKWDGICTKGSEMFGDLYIPKILRESGYNPDNDEYINIEHNFDAETWNL
FT                   ITEKCDLLVTYGDDEILSYQIKLFVDKLIECNPKRYNNVENVLAHFQGCHTGPILAWDG
FT                   NVESWSKQTMIKPILDFIDKA"
FT   CDS_pept        complement(843128..845380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441135"
FT                   /locus_tag="CAGL0F08459g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59260.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="HOGENOM:HBG266382"
FT                   /db_xref="HOGENOM:HBG721667"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="UniParc:UPI00003B6440"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV8"
FT                   /transl_table=1
FT                   /translation="MASQVSFDKVKGRDAKVVLANNLKIALAIELAKGLKLSINEDRSE
FT                   PLLTAGELVLRDANAILRYALDDFEGIHSEQYHYALSSVEAYLYHQQSSEEHATELVNK
FT                   MIDNYLKLDKDSKLDAVTLISFANAYALRPTQINDAFKDDLPEALKKAIQTATKYTPRS
FT                   SSEFKNTGEKHIAEGYLVSKQGSEILPKEGERNILITSALPYVNNVPHLGNIVGSVLSA
FT                   DIFARYCKSRNYNTLFICGTDEYGTATETKAIEEGVSPRELCDKYHKIHSDVYKWFQIG
FT                   FDYFGRTTTEQQTEIAQDIFLKLDKNGYLGEESMKQLYCPVHNSFLADRYVEGECPKCH
FT                   YEDARGDQCDKCGGLLDPFELINPRCKLDNAIPEPKTSDHIFLALDKLEPEIKKWVEKA
FT                   STEGEWSKNSKTITNSWLKDGLKPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYVS
FT                   ITANYTKNWEQWWKKPEDVKLYQFMGKDNVPFHTVVFPGSQLGTNDEWTMLHHLNTTEY
FT                   LQYEGGKFSKSRGVGVFGNNAQDSGISPSVWRYYLASVRPESSDSHFSWDDFVARNNSE
FT                   LLANLGNFVNRIIKFVNAKYNGVIPKFDTKNLPNYDSLVSDINEILRNYVKEMETAHER
FT                   RGLEIAMSLSARGNQFLQENKLDNSLFSQHPEKSDAVVGVGLNIVYAVASLIYPFMPET
FT                   AETINRMLNAPALKIDEEFHIALLGGHNINKAEYLFQRIDEKKIDEWRAKYGGQDK"
FT   CDS_pept        846289..848394
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045376"
FT                   /locus_tag="CAGL0F08481g"
FT                   /product="Similar to uniprot|P53326 Saccharomyces
FT                   cerevisiae YGR266w"
FT                   /protein_id="CAG59261.1"
FT                   /db_xref="HOGENOM:HBG124633"
FT                   /db_xref="HOGENOM:HBG397456"
FT                   /db_xref="UniParc:UPI00003B6441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV7"
FT                   /transl_table=1
FT                   /translation="MTSEDGVSGDWDATQYHKLVEGVDSCSDTSPIKQDGVVCGPTLRL
FT                   KSIDYERDVWLGSMLIVVRDAFDPSSPRAPKVTYELGGGSHSGEFQGKLFHTDYFGDDN
FT                   SNKSVFQFYRYDIELPLADNEAECKYTVADKAEEHYRFFIPGRNQNCNSISYSCNGFSL
FT                   SVDTTKFKGSLWYDILQKHANVHYHVMLGGGDQIYSDSVKIYSERVKKWLETHDPVKKY
FT                   TMKADEFFVKEVANFYLKEYLEWYGYGHWKGATEKSKTTQRCFPIATATIPSVNMWDDH
FT                   DIIDGFGSYPDRFMSTNVFSSLGNIAYKYYMLFQHHVSIEEKQAYLEDKHWVLSKGKGA
FT                   FIQQQSHSVFTRLGPSIGLLGLDCRTERKLKAILPKSTYDIAFERITKELQAKRFDHLY
FT                   LMLGVPIAYPRLVLLEYIFSSKLLAPIKYLSKKGIFAKGLVNEFNGDVELLDDLNDHWC
FT                   AHYHKKERNNFIAALQDWGAKYGVRITILSGDVHLAAVGRFRSKLHRHHLITSEETKKE
FT                   NEEILDSAQEDNRLMFNVISSAVVNTPPPDGMAKLLQTKNRIHKFDYETDEDSVPLFKM
FT                   NPDQKSKRDEDCFLNGRNWSDLIPVENLMKNKYLANTFKVENGDKVLPGMVKEGLGFEV
FT                   KNKKPKSDENPLYPVTPNGIMVTIHVEKDRKSNASESTMYSFPIPELTVKGEKLSHKGA
FT                   KHLVGFH"
FT   CDS_pept        complement(848954..849691)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349775"
FT                   /locus_tag="CAGL0F08503g"
FT                   /product="Similar to uniprot|P51601 Saccharomyces
FT                   cerevisiae YGR267c FOL2 GTP cyclohydrolase I "
FT                   /function="GTP cyclohydrolase I activity"
FT                   /biological_process="one-carbon metabolic process "
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59262.1"
FT                   /db_xref="GO:0003934"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="HOGENOM:HBG219138"
FT                   /db_xref="HOGENOM:HBG370191"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniParc:UPI00003B6442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV6"
FT                   /transl_table=1
FT                   /translation="MQQALNHRLSSMERTGTPLNTRPASPYTSIPTVASDGLSWPSKGA
FT                   RTRAHETEEEEKQRTGRIADAVKVILEELGEDVTREGLLDTPQRYAKAMLFFTKGYQTN
FT                   IMDDVINNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLAR
FT                   LAEMYARRLQVQERLTKQIAMALSEILKPLGVAVVIEASHMCMVSRGVQKTGSSTMTSC
FT                   MMGCFRSHKTREEFLTLLGRRSI"
FT   CDS_pept        complement(850744..851325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000240418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441136"
FT                   /locus_tag="CAGL0F08525g"
FT                   /product="Similar to uniprot|P53200 Saccharomyces
FT                   cerevisiae YGR001c"
FT                   /protein_id="CAG59263.1"
FT                   /db_xref="HOGENOM:HBG138683"
FT                   /db_xref="HOGENOM:HBG381854"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="UniParc:UPI00003B6443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV5"
FT                   /transl_table=1
FT                   /translation="MNLFKEDWQLSQFWYSDSTADKLADALLEGADATTVIAIVSAPSV
FT                   YAAIQKRDDSEIPTKHIYLFEYDTRFELLAGKDHFFFYDYNKPLDFDDKLKGKVDRLLI
FT                   DPPFLNEDCQSKSAQTAKSLLAPKDGSKTSDGLLKHRLISCTGERMAQVIKKAYPDTEI
FT                   TDFYPEHGNGLSNEFRCYANFEWSGWKFSK"
FT   CDS_pept        join(complement(853127..853206),complement(852168..852711))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207273" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196614"
FT                   /locus_tag="CAGL0F08547g"
FT                   /product="Similar to uniprot|P32471 Saccharomyces
FT                   cerevisiae YAL003w EFB1"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="CAG59264.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG020880"
FT                   /db_xref="HOGENOM:HBG714747"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="UniParc:UPI00003B6444"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV4"
FT                   /transl_table=1
FT                   /translation="MAFTDFSKIDTVKELNTVLGEKSYVEGTSATQADVEAYKAFRTAY
FT                   PNFSRWFNHIAAKADEFDSFPAASGASAAAEEEDDDDVDLFGSDDEVDEEAEKLKAQRL
FT                   EEYNKRKAAKGPKPAAKSIVTLDVKPWDDETDLEEMLANTKAVQMDGLNWGAHQFIPIG
FT                   FGIKKLQINCVVEDAKVSLDDLQQAIEDDEDHVQSTDIAAMQKL"
FT   ncRNA           complement(852967..853041)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="SNORD18"
FT                   /db_xref="Rfam:RF00093"
FT   CDS_pept        853613..854824
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000074513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441137"
FT                   /gene_name="SFH1"
FT                   /locus_tag="CAGL0F08569g"
FT                   /product="Chromatin structure-remodeling complex subunit
FT                   SFH1"
FT                   /biological_process="cell cycle"
FT                   /biological_process="chromatin remodeling"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="CAG59265.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059342"
FT                   /db_xref="HOGENOM:HBG202542"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="UniParc:UPI00003B6445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTV3"
FT                   /transl_table=1
FT                   /translation="MSNRAVPQGYLANLQFRIRSDNLPLLSTVQPSRGHKRGGRAVNYA
FT                   EFDNELLEDFSNFPTFDIDSDSNDEEQSSASAGNDDPQANANGGEAAGVNGQGSGDGGS
FT                   ANTGAGRHGKSQLTAEMEKNYKTGVPDLNEQKDSLNVLRYQKIRESFQHGKIAVPYRLY
FT                   VPPELSTGQQEAILIPITLNVEHGNNTISDAFVWNVNDTSISVEDFVTTYCNDLGLYGN
FT                   VSLHSQIVSSINEQIQELENVASLVIPDLEVVVNLTCTIQGKFFEDYFQWNLSDKSLSP
FT                   EKFALIIVADLGLAREFAPGIAHSLHEYLLHVKKEWAEGSLHQDTVPNEAAFGYLAGVR
FT                   LNIDDLGAKWAPKVEYLTQEEIQKREIEKERNMRRLKRESDRMGGGARRGRRRLDDLEL
FT                   TMKM"
FT   CDS_pept        855132..855620
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349776"
FT                   /locus_tag="CAGL0F08591g"
FT                   /product="Similar to uniprot|Q06162 Saccharomyces
FT                   cerevisiae YLR315w"
FT                   /protein_id="CAG59266.1"
FT                   /db_xref="HOGENOM:HBG124634"
FT                   /db_xref="UniParc:UPI00003B6446"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV2"
FT                   /transl_table=1
FT                   /translation="MSSTDLIIAHFNELRFSDVLSIEDFKEIIIQSKTVEVHDEDVNKW
FT                   YQSYLRAEQKKLKLFRERLRIFLASIRQRELQKLEKEQLSESYNLEEIISSLYKLNEVF
FT                   EGIVMNQNDELRQKQAELANFKDHLAASLDSSDRSILDSINSSIEAIEKYRKALDEGS"
FT   CDS_pept        complement(855805..857403)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045377"
FT                   /gene_name="SWC4"
FT                   /locus_tag="CAGL0F08613g"
FT                   /product="SWR1-complex protein 4 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59267.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG176908"
FT                   /db_xref="HOGENOM:HBG676997"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00003B6447"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTV1"
FT                   /transl_table=1
FT                   /translation="MSSSDIFDVLNIKQKSSSPNAASPSVPASGKSSKPQLTGMQRELY
FT                   NLLGENEAPVVVQSMNRFKEKLASNAKPTPWSLANFKANEYLTLQHWVKGSRELIGEEP
FT                   QESEFKKYDVHLTIPEFTEDEYNSFIPTSNAEENEKQNIGEKVEANGDSTDVNMTEEDT
FT                   NDKVKESVPQDENKSTSDNKKNNEKWEYNEVKYLFDLCKKYDLRWFVIQDRYDYENSNR
FT                   TLEDLKSKFYEVSKCYFKAKKPDDPMLQSLNYSKDKETQRKKYLERLLARSAAEIAEEE
FT                   ALIIESRKFEMAAKKTLAERETLLRLLDSPQSDISVAQYLTSNGMSQLYNSLLADKSRK
FT                   RKIDSAVPENPWMKQQHQFAQQRQQMQQLQQKKLEKHDASATPGPATTVTATETSTNVT
FT                   SAGSIPSGLQSPKKTKRQKLELQTALKRKSESEYAEQLLKIFNMDERKSLGVIAHGEKL
FT                   SPGVFLRSAKITTFKPAIQNKIISTAQELGIPARPVMPTFEVVTEYEALLKKIATLLDI
FT                   KKQIDKIEAGKQITK"
FT   CDS_pept        857724..859997
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501950"
FT                   /locus_tag="CAGL0F08635g"
FT                   /product="Similar to uniprot|P53202 Saccharomyces
FT                   cerevisiae YGR003w"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAG59268.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG204332"
FT                   /db_xref="HOGENOM:HBG472518"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniParc:UPI00003B6448"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTV0"
FT                   /transl_table=1
FT                   /translation="MINRRVGIRIPTKLSIPKQDFSQSWEILESALNHIYAEDTEKLSF
FT                   GDLYRTIYTQVLNRNGEKLYSAFEAYMAKKLDEIRELTFTEHVLSDNDSFLLEMGELWK
FT                   KQSDILKTISDLTIYMDKVYSKPNRVPEIHELGLQIFKKHILMKIKDQLLNSILADINS
FT                   VRDCQELDLQKAHLWKLLVSMMETITDTKDTFYLNYFEPKFLNDTGLYYKKSFTPTDKS
FT                   ATECLEKIRVLQSFEIEMCEDYLNKDTILKLNHVLEEVLYNQKLNIHVPELIKISFEQD
FT                   NYELLDQIYTVSLSDDYRLQIVNAIKSYMLKHCNNSEPKEIPKKRYLYAIQWTARVLAT
FT                   YKKCHEFLSNVNFGSVVVRKSEADNETETKAYNSAVISNEVFSEYLNQDGKRSSEFVTI
FT                   YLDSCLKLSIEKQKYKQVKQDLDAAVKLFKLLQEKDIFSQYYQQQLSKRLLQQKSSLDL
FT                   ERWLITQIKSEMGSLFTSKLEGMLRDVNSSIELYKTFQNTTKEAVAGFMFKPQILTPTS
FT                   WPFQAPDRVDPNFKLPETLQGIQDSFETFYTNKYNQRILKWSHHLSSIEVGYQFAKTYH
FT                   EIHLPIYAASIFFLFENHDSLTKDEIQDMTGLPDVELDKLLLSMTTAPRSKILVKSPPS
FT                   KIINSTDTFAINEDFTAPTTKVKLQMIIGVVQPNNGTGEPNKASIMDNVERERQEVTNA
FT                   AIVRLMKSERHLQFSELQEKTAVQLAQRFTLSLATFKACIETLIEKEYIQRDVDDHEFL
FT                   HYIT"
FT   CDS_pept        860500..862011
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196615"
FT                   /locus_tag="CAGL0F08657g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59269.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG192550"
FT                   /db_xref="HOGENOM:HBG396085"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI00003B6449"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU9"
FT                   /transl_table=1
FT                   /translation="MDQPSTKSKVLSEEEKERIKTNKVIKSVLKKRGKWKSNAYSNNEV
FT                   EEDYNIVSSPLLNSTPPTVSKALVKLYPYLIVTDKFLSIVTWTNDNLWLNFLSVLSYFV
FT                   FVLYFQFLVKYFGHLLIIGIIWCYSLVDSAVEDTMMSCPSLDDIVHIMVRVSTKADIVL
FT                   SPLTILNSQDIQRLLFTSAFLSPIYILVTKLIFYPRTLVLFAGVYVLTYHSSWSKAFRR
FT                   SLWNFRLIRLLMFYITGLDMGGINKHYTIFTSVNDQIKKLTGPKKADGSSNEPIRFTYV
FT                   LYENQRRWIGIGWTSSMLSYERSAWTDEFLNAAPPITEFTLPEGDSGLEWKWIDKEWRL
FT                   DLTNDGSIQLPSSKMKTTANPSSDDGFIYSDNTWKNPSTEDSFSKYTRRRRWIRTAELI
FT                   GAKINSRSNSVTTVQEINSTTSTGIDNHDIQSPADDAESTTMKRKVSFSDVRKIRIIND
FT                   QNEEVKDVTEKENINIQLTSPTLEKKVSTDQDPREILIESNKKIE"
FT   CDS_pept        complement(862179..863366)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441138"
FT                   /locus_tag="CAGL0F08679g"
FT                   /product="Similar to uniprot|P41896 Saccharomyces
FT                   cerevisiae YGR005c TFG2"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIF complex "
FT                   /protein_id="CAG59270.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005674"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG059604"
FT                   /db_xref="HOGENOM:HBG396105"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B644A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU8"
FT                   /transl_table=1
FT                   /translation="MSQRATPAAGPTLATAASNNDSGDEYLSQEEEVFDGNDIENNETK
FT                   VYEESLDLDLSKSKRQVWLVRLPMFLAERWRDRNNLHGQQLGKIKINQDGSKIKLMLDE
FT                   NDNDAIPHEYDLELTKKIVENEYVFTEQNLKKYQQREKELAADPEKQRQAYLKKQEREE
FT                   ELKKKQQQQKRRNQRKRFNHRVMTDRDGRDRYIPYVKTIPKKTSIVGTVCHECQVMPSM
FT                   NDPNYHKIVEQRRNIVKNSNKEKIVTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKN
FT                   NIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYA
FT                   FKYTLRPEYKKLKEEERKATLGELADDDQPTEGKEGNSENENEMGEEEIEMEDIV"
FT   CDS_pept        863663..864220
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045378"
FT                   /locus_tag="CAGL0F08701g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /biological_process="RNA splicing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG59271.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG189693"
FT                   /db_xref="HOGENOM:HBG396091"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="UniParc:UPI00003B644B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU7"
FT                   /transl_table=1
FT                   /translation="MATEKPRDERIQAVIEEEQKVDTTIDPQEIGKPNGAQLLSLKCNL
FT                   YLHKLLDTWALEQEEGGNDILKDTKRGIYPLLVSLRKARLPSDQLVSLATVLYHLQQYE
FT                   STRDKVHMQRSLESYMKLSLGNVAWPIGVTQVGIHERKIQRQDARNNTATAGIVANVMT
FT                   DEQTRLWITNVKRLLTHMEQRK"
FT   CDS_pept        864757..865707
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441139"
FT                   /locus_tag="CAGL0F08723g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAG59272.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG154920"
FT                   /db_xref="HOGENOM:HBG378440"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B644C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU6"
FT                   /transl_table=1
FT                   /translation="MTVHLWEEKVWIDGCFDFTHHGHAGVFLQARQTIDPEVSGGNDAL
FT                   ICGIHSDEDIRVNKGCLPVMQERERYEHARANRWCDQVIEGAPYVTHPDVMNKYGCMYV
FT                   VHGDDITLDKDGNDCYQEMKDCGRYKCVKRTAGVSTSDIIQRILTGSRDHHSRPDEVVT
FT                   LEELTKYSYDRDGYGPGCTVYRETLDNIVVRGKTVPERLVIVEGNFDLFHIGHISKFKK
FT                   IRADHPDRHVIVSVRTNEDDIMTLKEKALSILSCKYIDGVVLDLDMGTLATDIVTIQID
FT                   DIDGGEFDYLTKETIVNRIISQRDEYVSRNKRKGF"
FT   CDS_pept        complement(866073..866333)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441140"
FT                   /locus_tag="CAGL0F08745g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59273.1"
FT                   /db_xref="HOGENOM:HBG059605"
FT                   /db_xref="HOGENOM:HBG396127"
FT                   /db_xref="InterPro:IPR006861"
FT                   /db_xref="UniParc:UPI00003B644D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU5"
FT                   /transl_table=1
FT                   /translation="MTRTNKWTVHEAKANARYFTRNGNFGESPNSVKREGSGKGNWGKP
FT                   GDEINDLIDAGEIPPIFNKQRRGSNNQQNEHKLGKVQNREL"
FT   CDS_pept        867394..867789
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349777"
FT                   /locus_tag="CAGL0F08767g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59274.1"
FT                   /db_xref="HOGENOM:HBG124635"
FT                   /db_xref="UniParc:UPI00003B644E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU4"
FT                   /transl_table=1
FT                   /translation="MNQDDVEFPVNSRGDGDHLVLPSSQGGNDVEENSIPPIPQSADNQ
FT                   SRNLNGGGGLTMLDENNRIFVFFQNQNRENSLRQVSFETTISYTLDSYRRGIVTCVEIG
FT                   GGRSVVWFHETRVSRIDKSAIIRNHVS"
FT   CDS_pept        868002..869171
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196616"
FT                   /locus_tag="CAGL0F08789g"
FT                   /product="Similar to uniprot|P53206 Saccharomyces
FT                   cerevisiae YGR012w"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="CAG59275.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI00003B644F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU3"
FT                   /transl_table=1
FT                   /translation="MDSKWGRVIGGVVLSCGALYTAYTVIQRRYETEAKVYDGMQELIG
FT                   NTPMVKLKSLCDTDRNINVYAKLEMNNPGGSAKDRIALNIIQVAEAEGRLVRGEPGMVF
FT                   EGTSGSTGISLAMICNALGYKAHISLPDDTSLEKLNLLKSLGAIINPVKPASIVDPDQY
FT                   VNAAKKACDDYLESGKTKYAIFSDQFENEHNWEIHYRTTGPEIYKQLKGKVNCFISGCG
FT                   TGGTISGVSKYLKERIRPYVVLADPQGSGFYNRINYGVMYDSVEKEGTRRRHQVDTIVE
FT                   GIGLNRLTFNFLKGEKYIDESIRVTDPQAIKMAKFLSINEGLFIGSSTAINAVAALELI
FT                   RRNDQAILPNDSNIVIIACDSGSRHLSKFWKEALQVPDTVTLNEILASK"
FT   CDS_pept        869467..871308
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441141"
FT                   /gene_name="SNU71"
FT                   /locus_tag="CAGL0F08811g"
FT                   /product="U1 small nuclear ribonucleoprotein component
FT                   SNU71"
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG59276.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG124636"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="UniParc:UPI00003B6450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTU2"
FT                   /transl_table=1
FT                   /translation="MLEDALVPDDKLIYVSPENLYYCYANDTIDQDDKWTSIQPQQGYI
FT                   PILSANLRAYKIELLKKLRFSGQNNVSPSIKKEKKNLEPNKKITTKPTESTGSKKYLIP
FT                   EQFIPDSLEKQLRTLTVILKDALYLGKNNRFIKENEVVSDDTRLLILDEFLKLIIPNYI
FT                   DSLANWTLVDLNKGTDDESLLYLRFNESGTQSMISFYKKHSKMAKYMEIHYDTNTEKYI
FT                   NDNFKDDGDEDNVEAEQSHSVGEILKSMETAFEKARSQVGTFKGDINDDQDDKINYKID
FT                   YNTLLDIPSDSLEQLTKEILNFRTKVIDIEKQKQLRQQYEDNERRQKHMTQLFEKLRKG
FT                   TKSNDSNRNMDIESTDTINDSDSEEDDDEEDEDDLAIEKRKEEKRKEEEARKYRALLKD
FT                   YETTIEPHLHLLSQQYKQNLEYEKELAANREANVKDLLRQANDIYYDKDRSFKDREEQE
FT                   DKLDREKYGDIIIEDIVIDDDRKGQKKLLEKDKKVKKAGEPAIKINLAFKKAMDNSIQD
FT                   KRDKAEDIEPVSQPIEARSTNRYAALKEKRVVDELVKELLGVYEDDVVAYVFEILEKPE
FT                   MSDEKKQSELVTEMEDLFDKEGAVQFAEQVFKALDEA"
FT   CDS_pept        873849..876659
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045379"
FT                   /locus_tag="CAGL0F08833g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /protein_id="CAG59277.1"
FT                   /db_xref="HOGENOM:HBG124637"
FT                   /db_xref="UniParc:UPI00003B6451"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU1"
FT                   /transl_table=1
FT                   /translation="MKTAVLLSLLSAALAAPVANRFDDAINNYQNNADLGLASNSTNSD
FT                   NANANANANANSGNIDVDANKVSSYLNSIASKAFVTTKSSKSNDYDDTYNSKFSTIDLS
FT                   SSKSSDKNDFDWLSSSVVQSTPSISSIYSSNAYDTQIPSQVVSSNDFQLNSEIVSSVPS
FT                   AEQISSDTISSVPSAEQISSDTISSVPSAEQIPSNVISVPSSIDSSFSVTPLSSSSSSS
FT                   EEPTQYPISSSISSQIEQSSVIPSPVESVSSQIESDSSSSISDYLSSSTPTPIPSPPAE
FT                   STERSELESSISISIPPIVPPTTSSEIVSSLEPSSVPFQSSSEDNTSTYISSQAQVVPS
FT                   SVESIEPSSVPSEVPISTTTTSSPSQISSEYLSPTPSIFESPISQESTISSGSSFVESV
FT                   ISSELPKPPQPIISSDTSTESSILPQPSPSSVESNTISFPSSAVVTTTPQPPPVVESSE
FT                   SPLASSSSSSQIIVSSVDVPPSASVPVASSIPSVSVSSDPVAPSSVIPVDIPSSSSSSP
FT                   PYVTPSPSTIISVPSPLPIDSSDTITSSQIIPSPEVPSPSSAIPSSSVSQPPIEIPSSS
FT                   SESSSSSTSSNSNAWIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVP
FT                   EGYSVITIGFKKPLNYPFVVSESKSSAQIMYYLPKLLNANFESIFSDIKTVQLMPLEIQ
FT                   DSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLSALIDPRIPVTGLTD
FT                   TKTNNAGSSSSSSSNSNGRSSNSNQDTEHSSSFGNINSGSLDYIPSSKSASSDGTQSKT
FT                   KKRIIPIIVGTIAGGMAVIIMLFLFFRYHAMKRREQLNQERLARLNFERASSCSDDSIE
FT                   RYNNEKQQYSDDVSSLSPSMKINKWMNDNHNVEHSTTTTDVNGSKKIIKISMPIATQNS
FT                   LGWNDI"
FT   CDS_pept        complement(876783..877760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442171"
FT                   /locus_tag="CAGL0F08855g"
FT                   /product="Similar to uniprot|P53208 Saccharomyces
FT                   cerevisiae YGR015c"
FT                   /protein_id="CAG59278.1"
FT                   /db_xref="HOGENOM:HBG124638"
FT                   /db_xref="HOGENOM:HBG204336"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B6452"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTU0"
FT                   /transl_table=1
FT                   /translation="MHKSLHKKGLELRDVVPLAFHHTKPRIRRATPAPWKEKPAIINLH
FT                   GLFGSHIMFHSLNRPLMKTFETDIYNVDLRNHGNSPRAQPYDYLTLSKDIIQMIRDNIY
FT                   REQPGRPIYLIGFSLGGKVALLSSLSRQINVKKCISIDLPPYELDKVDDMFMQNFELLE
FT                   KIVKREIKVRRSCPSWKTDILTMFRELPVNKCNPNGNNVALYFANGFLTYKPNNESSSG
FT                   LENDYLQYAVPLEYMPDIIAEIKKWPSATSLNPMMYHTKSQLPTLFMKGLHSSFIKNDY
FT                   SLLKTQYPQSSVLEFDCGHTILMDYPKESTEAIIKFLSNNKRVQ"
FT   CDS_pept        878120..878704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442172"
FT                   /locus_tag="CAGL0F08877g"
FT                   /product="Similar to uniprot|P53209 Saccharomyces
FT                   cerevisiae YGR016w"
FT                   /protein_id="CAG59279.1"
FT                   /db_xref="HOGENOM:HBG059884"
FT                   /db_xref="HOGENOM:HBG204337"
FT                   /db_xref="InterPro:IPR016564"
FT                   /db_xref="UniParc:UPI00003B6453"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT9"
FT                   /transl_table=1
FT                   /translation="MSRIRRFNRKVLGYETDLMTEFDSLGGSDGIIIPEGPIDIIEQEE
FT                   LIEKFEVNLLVKNRWYINAVSLAYIICAGVYLMLLTKRTKMSSIPLILGFNSIILSFLA
FT                   LRYHLVNDYVLLRSLKLKLTNRTIDILNITQLIMIEWIVIDDYRSDTLILVFLHLPVLL
FT                   FLVQALIKLLLSEIDSDLSQLRDLKYNYKNA"
FT   tRNA            join(complement(878990..879028),complement(878909..878953))
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        879436..880137
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094410" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350064"
FT                   /gene_name="RRF1"
FT                   /locus_tag="CAGL0F08943g"
FT                   /product="Ribosome-recycling factor, mitochondrial "
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG59280.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG203857"
FT                   /db_xref="HOGENOM:HBG531104"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR015999"
FT                   /db_xref="UniParc:UPI00003B6454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTT8"
FT                   /transl_table=1
FT                   /translation="MLALRTSVGLTKNLFTRRLHISPVLLKKKPSHKGKGGPVEDEEID
FT                   IVNPSIYVDELVSKFDKSLELYSKELTDKRKGSVNANIFDNLSLKNGALFKEMASTTLK
FT                   GKGSLLVTVFDPNEVKNIVSAILASGQNLNPERVPTNNQQLKIPLPPPTAESRQNLCKE
FT                   LKTVFEKYKQSPSKNSLGHIRNEVMKKLKSLQKKDESVKKIIQNVEKVHKDYVTKLSEQ
FT                   LKQAEKSVMGQ"
FT   CDS_pept        complement(880296..882215)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502220"
FT                   /locus_tag="CAGL0F08965g"
FT                   /product="Similar to uniprot|P38694 Saccharomyces
FT                   cerevisiae YHR039c"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59281.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B6455"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT7"
FT                   /transl_table=1
FT                   /translation="MQDNIYLNSDMVQKLNHTIQEYVRDILRNQSIINEDVVADPRIVM
FT                   GTSMVATIFTLYVGYKLLLCSSGYKYKARKFNVSTPEEVQPNWKGKRLNPPKLVDDSKP
FT                   RHIQSYCPATGQYLGEFKSMTADEIDELVGNANAAQMKWAESSIAKRLEVLATLQKFIL
FT                   ENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWILKHGPSTLEPSRRPGPTNFFMKF
FT                   YKGAEVRYEPLGVISSIVSWNYPFHNLMGPIIASIFTGNAIIVKCSEQVVWSSEFFIEM
FT                   VRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPGIKHITFIGSQSVASHILNCAS
FT                   KSLTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQSSGQNCIGIERVIVSEKNYDQ
FT                   LVNILEKRMKETPLRQGSDIDHLEVVDMGAMISDNRFKTLEALIQDAVSKGARLLYGGS
FT                   QYNHPKYPQGHYFQPTLLVDVTPDMDIAQNEVFGPVLVMMKAKDTSNCIELANAAPFGL
FT                   GGSVFGSDYSECNFVANKLKTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLGL
FT                   CNAKSVCFDTLPFISTQIPKPLDYPIQSNDKAWRFVKSFITGSYAMTTWQRIKALVSLA
FT                   KNAN"
FT   CDS_pept        join(complement(883594..883596),complement(882851..883192))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186416" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196856"
FT                   /locus_tag="CAGL0F08987g"
FT                   /product="Similar to uniprot|P48836 Saccharomyces
FT                   cerevisiae YHR039ca VMA10"
FT                   /function="hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances "
FT                   /biological_process="proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase complex"
FT                   /protein_id="CAG59282.1"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016471"
FT                   /db_xref="GO:0016820"
FT                   /db_xref="HOGENOM:HBG351334"
FT                   /db_xref="HOGENOM:HBG621942"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="UniParc:UPI00003B6456"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT6"
FT                   /transl_table=1
FT                   /translation="MSQKNGIATLLKAEKEAHEIVTEARKYRQEKIKQAKLDASKEIEN
FT                   YKAKKEQELKDFESNNAGGVQELEKKADAEVQSELDEIKKTVESKKKQVVDLLLEAVTK
FT                   PTTEVHINAN"
FT   CDS_pept        883964..885076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045650"
FT                   /locus_tag="CAGL0F09009g"
FT                   /product="Similar to uniprot|P38772 Saccharomyces
FT                   cerevisiae YHR040w"
FT                   /protein_id="CAG59283.1"
FT                   /db_xref="HOGENOM:HBG057937"
FT                   /db_xref="HOGENOM:HBG203858"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI00003B6457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT5"
FT                   /transl_table=1
FT                   /translation="MGLCEVCNVEEFKYKCPRCFKKTCSLACSKQHKADESCSGKSHDP
FT                   TAYIPRTDIKEADDENHESNILVQRDYNYLINMRREVEVQIDDSKRKNKRILREIYDPY
FT                   MANKRQRGNSDNSSRLIRRGVSCLMLPKGMQRSLQNKSKWDNSLNQFTWTIEWVLCGDG
FT                   DTVTHLTHRAKENESVVEGISKIVFNKIQTFYKIENGDGDETQAVLSREDRIALIKDYN
FT                   LEFYIKWFPYNSTEMSDSRNLIRIDAVNSTLGDVFKNRTVIEFPTIYITKSAQELPKGF
FT                   KVMIEEKGSAPGAEENSRVNVAGSGSSSDTETDDSDAEPEEESSKQDNTQNKNVVVENV
FT                   SEATATVDKDTSDEEDDDYNPGVSLDFLMS"
FT   CDS_pept        join(complement(886842..886855),complement(885518..886289))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196857"
FT                   /locus_tag="CAGL0F09031g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59284.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG007973"
FT                   /db_xref="HOGENOM:HBG392118"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="UniParc:UPI00003B6458"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT4"
FT                   /transl_table=1
FT                   /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLI
FT                   VFLRNRLKYALNGREVKAIMMQRHVKVDGKVRTDATYPAGFMDVITLEATNENFRLVYD
FT                   VKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTDDGRTIRYPDPNIKVNDTVKVD
FT                   LASGKITDYIKFDIGKLVYITGGRNLGRIGTIVHKERHDGGFDLVHVKDSLDNTFVTRL
FT                   NNVFVIGEQGKPYISLPKGKGIKLTIAEERDRRRAQQGL"
FT   CDS_pept        888804..891233
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502221"
FT                   /locus_tag="CAGL0F09053g"
FT                   /product="Similar to uniprot|P38888 Saccharomyces
FT                   cerevisiae YHR204w HTM1"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59285.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058539"
FT                   /db_xref="HOGENOM:HBG396216"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI00003B6459"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT3"
FT                   /transl_table=1
FT                   /translation="MLITVLWLCTLCVVLARPELNYKERTFTKWELDEYKAEVKELIYF
FT                   GLDEYLGKGFPYDEIRPISCKPKTRNFKDLYDTGTNDVLGNFTTTLIDSLTTVAVLGDR
FT                   DRFKSLVDLVDSTYPNGFDMDSTVQVFETTIRIIGGLLSSHLYATDPSKKVYLGKKDYN
FT                   GCLLKLAKDMGDRLLPSYLTKTGLPVPRINLKYKFHGITPDLVNENNAAALSCPMFEFT
FT                   LLSYLTHDAKYEEITKYAFKKTWDLRSEIGLVPMSFNPQYSYSFGGVTGIGASIDSFYE
FT                   YALKGSILFDDNYLLDVWHSSYDAIRTHAKEDWYFNTIGTRDGHKATNWVDSLSAFFPG
FT                   LQVLAGNIEDSVYQHMLFLKLWDTFGGIPERWMMDGIYSFRPLELPWYPLRPEFVESTY
FT                   FLYRATKDPFYLNVGYRILQDFKFRFKKECGFGGMQDLISGEPQDRMETFVLSETLKYL
FT                   YLLFDEENEIHADRGNIIFSTEAHPMWITYEMKRDYNEKKFFTDKTYLEHLEEVQLFDW
FT                   DKKLRDNNEKNKELLNKYADVLKRINKFRNKTKEELSGLMKEKKEELEENGIVESHNAE
FT                   IGHSQFKDVCKVSKYRQNDAGFSFSNIMSSFKRISEPERIFNTTLIKPNYLDDYAPFEF
FT                   DKQFYDRWCPRNASSSLAATTLPFDIVLELPGQYELYQYPNGTVNAMKLGNKRKLRLER
FT                   ITRGDIDVYGEFVSDADFSGVNWDLVRQGNAKYENGTALKNNKSLYRVVKIDGVVIPRK
FT                   QMLFVNSTLFKEVVSFEELYEDPEILHKRDILRAFGVNKDGYLIFNDTVVSNCKII"
FT   CDS_pept        894761..897001
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350065"
FT                   /locus_tag="CAGL0F09075g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59286.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG330930"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00003B645A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT2"
FT                   /transl_table=1
FT                   /translation="MNFFGSKSHHPSSQGSSNSNSSSNGNKHALGSAGNGFFPSFTSQT
FT                   ATPTTAVSSSSYAMGTTGVASEDVISRMKAMNEPAKTSTQGNNVNQKIVIGVNDKPAII
FT                   TTGPEEQSTRDEQKHGSEPQFRTDTHLTPSPVQLEQSSSSRTDSSSSGENDIPRGKLEV
FT                   TIIEARGLSTISENSLPYVVCTFESSEFISDGPESVENNGSYVNNHGGLSSIREQLRKR
FT                   PLYTHRSSSQLNKLTSRQNNFDSEVVSSGLNPIWHHKATFDVLGSHSELDISVYDSNHE
FT                   DMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQDF
FT                   EVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKA
FT                   SPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLH
FT                   DNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAPELLLDESGY
FT                   TKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLL
FT                   NRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQ
FT                   TSTSYMNKHHQMAATPLSPGMQAKFAGFTFVDESAIDERFNANNSNRRFLQSSSFMEPG
FT                   SFIPGNPNLPPDEDVIEDQDDDDFENVKNPRDLDFDGDQHMDDEFVSGRFEI"
FT   CDS_pept        898706..900598
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350066"
FT                   /locus_tag="CAGL0F09097g"
FT                   /product="Similar to uniprot|P38889 Saccharomyces
FT                   cerevisiae YHR206w SKN7 transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59287.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058548"
FT                   /db_xref="HOGENOM:HBG397302"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="UniParc:UPI00003B645B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTT1"
FT                   /transl_table=1
FT                   /translation="MDYEVNANQIPVLGIEQGLIPDNLDGSVKADTATSTAMNMNDKSE
FT                   ISNDGSHSIHTSNPNNNGENGKNGGKPASNDFVRKLFNILESNQYSNIVRWSNTGDSFV
FT                   VLDTGKFTTQILPNHFKHSNFASFVRQLNKYDFHKIKRTNEERQKSIYGEQSWEFENPN
FT                   FKINDEKSLDLIKRKTPAQRKVMLEDASAPSQKTPELLSVQSENKLKSALLSNTVKKDI
FT                   FNNLRKRVDKMQKDMDTVMMDNYNLKSDYQKLATKYNTLLDSLITFRTVNENLINNFNA
FT                   LCNVLSSKGVELPSSVYENMNINIPVPSGQSPVNISPSPSLGIPIKNSTMSPSLPSMKS
FT                   LQNTPSLTGKLSTNQRLDLPPNSQGILSDTNVGQTESPEIQMPISSNSSSTTKEVDQNI
FT                   VLRKGFHVLLVEDDSVSIQLCSKFLRKYGCTVQVVTDGLSAISNLEKFRYDLVLMDIVM
FT                   PNLDGATATSIVRSFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSILI
FT                   RHLKDRIPLCDQNRGSGITSESPNLPPTQHIISSQQNNEQNSSLPQSLPPIHPPNHQSP
FT                   LFNNRASNITPLAPLNSAMSPQSPSHLERPLTNRSPLGMTPLNDGQPAFKKQHT"
FT   CDS_pept        complement(900830..902377)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000074714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442173"
FT                   /gene_name="SET5"
FT                   /locus_tag="CAGL0F09119g"
FT                   /product="Potential protein lysine methyltransferase SET5 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59288.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058551"
FT                   /db_xref="HOGENOM:HBG397508"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI00003B645C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FTT0"
FT                   /transl_table=1
FT                   /translation="MSVSQLKIQTLTLNDSEPSLPGKPITPSKEQIRDDVVLLWKEEPA
FT                   AEDLDLPHLYDKMKIRNTDWQFDINTLEDVLVSNNLYSVDDSQMDSYNDKIEFPDISEV
FT                   MHLVNDKLPSKVEIRECEELRKGRGLYATRDIQQGELLFHEKVPIAMVPPMDKLKLIRS
FT                   GKSCSMCGVSLSNSSHFTMLHGLDCNGCNSIWCSTNCKQKDITHPYLKHFGSKNKNIRP
FT                   MDWNMFERHCQENIFVAAYSIGVIHAASLIDKAQSDEINQQFEALAKISQRVRYESSDS
FT                   NNIGGTFDAEIGSLKEENPEPLWKKAFDLFIRTFPDTAEMGYEVFLEYLGRFHINQLSG
FT                   QLYFLYSFLNHNCEPNVRYDINNKLELKVYARKFIKKDEELVTTYVNPLHGVSLRRREL
FT                   RVNWGFICNCDRCAKEIELRKKNAVSIRETVLNSNSSSEVSLRSGLNVTSPIALQRSNG
FT                   GSSSDLRRKSSIRNRKPDLKEMLKNSKEFELEAPAALGRNRSTSVRFDDIVSMAVEE"
FT   CDS_pept        complement(904239..904448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442174"
FT                   /locus_tag="CAGL0F09141g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59289.1"
FT                   /db_xref="HOGENOM:HBG124640"
FT                   /db_xref="UniParc:UPI00003B645D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTS9"
FT                   /transl_table=1
FT                   /translation="MKNADCRLFTFYCLNPTPFLTHYFRYQFKNSPNSRTLLLTQECLG
FT                   TLFKDSPKNLLSHVTLVKGSNTKS"
FT   CDS_pept        904652..905410
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442175"
FT                   /locus_tag="CAGL0F09163g"
FT                   /product="Similar to uniprot|P40098 Saccharomyces
FT                   cerevisiae YER182w"
FT                   /protein_id="CAG59290.1"
FT                   /db_xref="HOGENOM:HBG058556"
FT                   /db_xref="HOGENOM:HBG203717"
FT                   /db_xref="UniParc:UPI00003B645E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTS8"
FT                   /transl_table=1
FT                   /translation="MILSSIRATGRALPRNLSIKHITRGRLSSSMPEFTINKTRKSPKW
FT                   VPITIFGATFGMGWFFTQHMTFTDLMAYWRYDSLPEDAQEVKDYKLQLYNKCEKLPVVK
FT                   QLGKAGYVEIFPPRRKEDLLIDRALSTPGGIAIPPRFFFNPTTKETVGIYHLGMKLTGY
FT                   PFIVHGGILATIMEDLMRESVKLITQKTDEKINDLSISYKFPTLANQFVIVRTTQHETF
FT                   GKNIKLTAEVMDQTGNRTLIKGRGSFSASK"
FT   CDS_pept        complement(905569..906258)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442176"
FT                   /locus_tag="CAGL0F09185g"
FT                   /product="Similar to uniprot|P40099 Saccharomyces
FT                   cerevisiae YER183c FAU1"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAG59291.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="HOGENOM:HBG325345"
FT                   /db_xref="HOGENOM:HBG507167"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI00003B645F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTS7"
FT                   /transl_table=1
FT                   /translation="MNEMLAVKQQLRKHMGQTLGKISREEIISQSECIRDNLMPILEGK
FT                   QNVACYMSMDTGELDTGNIIESLFEAGKKVYLPRCTHTKLTGHVQLRNDSKNPGNMKDH
FT                   PHLTFHEMDSHDHVLSLSPKGKYNLKEPDIEDEKLSPLPPMLDAILVPGVAFTSGCSRL
FT                   GHGAGYYDDFFSRYKLQHSNQLPLLIGIALKQQIVEDIPMDAHDYFLDCILVGDGSIHW
FT                   RNKPITM"
FT   CDS_pept        906883..908070
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442177"
FT                   /locus_tag="CAGL0F09207g"
FT                   /product="Strain CBS138 chromosome F complete sequence "
FT                   /function="branched-chain-amino-acid transaminase activity "
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="CAG59292.1"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="HOGENOM:HBG424074"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI00003B6460"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTS6"
FT                   /transl_table=1
FT                   /translation="MMLNSRLAFASISRNFGLARRSIASLDASKLKVTKKTPPSQPRPN
FT                   DELVFGQTFTDHMLTIEWTKEKGWDIPEIKPYGNLTLDPSSCVFHYAFELFEGLKAYRT
FT                   PDNKITMFRPDMNMIRMNKSAARICLPTFDSEELIKLMGKLIEQDKHLVPTGTGYSLYI
FT                   RPTLIGTTNGLGVGTPDRALLFVITSPVGPYYKTGFKAVRLEATDYATRAWPGGVGDKK
FT                   LGANYAPCILPQLQAAERGYQQNLWLFGPEKHVTEVGTMNVFFAFKNSVTGKKELVTAP
FT                   LDGTILEGVTRDSILTLTRQNLDPNEWEINERYYSINEVAERAAKGELLEAFGAGTAAV
FT                   VSPIKAIGWQGKDIDVPLIPGEQSGPITKQVAQWIADIQYGRVKHGNWSRVVAQL"
FT   CDS_pept        complement(908186..910693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196858"
FT                   /locus_tag="CAGL0F09229g"
FT                   /product="Similar to uniprot|P39961 Saccharomyces
FT                   cerevisiae YER184c"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59293.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124641"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B6461"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FTS5"
FT                   /transl_table=1
FT                   /translation="MAPPLAKKAKLAGKDRVIRACDVCRKRKVKCDGDQPCSSCMTAST
FT                   VCIYNGVAFPHVKSFYHRDNDLYRELRLLYKSAKALSRNEKIKASGQLCKTLTEIENSI
FT                   SNLQSQVDLDINDETIADYDGEGSLERQFIETSTVRLNRFSNVDMTKNNVPNITPYFGI
FT                   YSTLAIFSKYGFSWMFKKLMSYSNNTSTRETMYIYMKFLDMAQLHYEEDINQKTTPIEW
FT                   CFDKYAVNCDCKTLDGLFAILNIQVNPTKNDDILTKDVYEELARRPIEFFSKLIEYAWE
FT                   TCYLYYTGVGQSFQMSSKIFELEDIMTCLALEFSSKILYADMHHEIIIPATLRWVRICH
FT                   WHEELYTVGKFLACAIRRALDLGLNSWEYYISLPEVAAEKNRLIWWECYWWDKWFSLSA
FT                   GKSPLIDDAKITCLLPRRLMESGLDESMTCLEMMERCNFRHMSESEIRIFGYIMLGKYI
FT                   EYINSEILFKKEYTDYRLFASVKKPIDVTINKFYDEYRSAIDLLNKMENFFVSLTGVDV
FT                   DTDELTEFMTYFIETKMKCLIAMGSLIYRLKGVEVSGSELLDKCLKISLTNIYQCSLTG
FT                   LRRVSNFNSFLIERYLLHINLMILNLMLSIIESPENEPVENILLMCNVVHLLGNANALK
FT                   NCSNSKNMPLSELICRQSLSLSYICCRVYVQLAVKRNSSISEEEILRVLQRSNPHFATI
FT                   YNQLNDISSDIFKSLLELNVAGSYQAHLIDHFREMMGDKILQKMKQLESEVQSSATPSS
FT                   IEATSTVSSTVHQDHIDTNYKMNGGPAQELQDVTFEALLNSDSFASVYTDFLESLDLRK
FT                   PSGNDTMPSLSLDHHADMNNPSL"
FT   CDS_pept        925942..926406
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /protein_id="CAG59295.1"
XX
SQ   Sequence 927101 BP; 285174 A; 176761 C; 176510 G; 288656 T; 0 other;
     tagcatttca gaacagagac atgctactgt gattccaccc tctcagacaa ggctgttttt        60
     gtaggagaaa atggtaaata aaagagacta gctgcatgta tgaggcacat attagataca       120
     tatttgatta atgttgcatt gtaaataaga ataaacaacc cttgttgttt atttattgta       180
     gatagtgtac atttctgtgt tcacttgtgt atattttttt atcatttaag aactgtaatc       240
     ttataatggc caacactata ttctttcagg tatttataac aaaatcttaa atcatttcag       300
     attaatttac gccactgctc caaatatgga ttcacaatac aagctattgc gcacataaga       360
     accaatatca tcagtaaaaa ctcaccaata agttttgact ggtaaaacca tgtactgtaa       420
     ctaatattta ctatttctat tctggcactc atatacgttt aaacaattga agaatcacaa       480
     aatttgaaat tcatgtttgg gtgctcaagt gcgtaattat gaaaactctt cctacacctc       540
     ccttcaacct aattgccaac cctgtgaaac cttccctaga tgttagtgaa aaagtaagta       600
     ctcgttcatc aatatatcca tggtcatctg aacatatatc gtatgatgtg ctgttgtgga       660
     aatgttggca gggtaacttc gattggtcac gatatttttc gtcaaataac taaaggaaat       720
     tgttgatcag ggtaacttaa tctgtcagat gactaccgtg cactatcaca tctcgcgttt       780
     ttcgcagcat ttgaagttca atctcagacc acaggttcaa atccatggtt agccaagata       840
     ttataagaaa catcaacaac aggaagacgc acacaataca ataataaaga cataaaacaa       900
     cataaaactt ttagaagaga aaagtaatta tagtgttaac taatagacaa tatatacaaa       960
     aactcttgag aataatactg ctcacattat taatatgaga tatagaaaac agtacgtgaa      1020
     acaaaaataa tagccccaaa ttacgaacaa taaatatata ttgggaagct tcagtttttt      1080
     ttttacttta gtgttttttc agtttttttt tgttttgttg gactagaatc aatccatttt      1140
     atcaatattt atatttgaaa gtaacagcct atctaaaaat catggctgga cgaacgtttg      1200
     taatattgta catgttgatc agtcacagaa ctagtacact ttagatcata ccaacaacta      1260
     ttactgcaat aatggagaat accataccaa ttgaagtgac tctaattgaa gcacccttac      1320
     cctgtaggac agatgctgtc tgtgtgctgc tgaatccact gccgaagttg tcaacagagg      1380
     aaccagatga taatagaaca gtcgtggctg cctgttgacg tgatgatggt gcttgtcctt      1440
     gtccttgtcc ttgtccttgt ccttgtcctt gttgttgagc ttgtgaaggc tgagactgtg      1500
     gtgtttggct accatgaata ccactgactg cagatgctgt attctttgca gtctgaacag      1560
     ataaagatcc agatggtaca ttattgcctg ccgattggtg cactgaccca gagccagaac      1620
     cagagccact accaccggct gtgccagcag cttgtgttgg tttttcgttg ccagaccctt      1680
     ggccagccac attttgtgac tgaggtttct gagagttgac aataccacct acacctgctg      1740
     ctccagatgg attagatcct gcaccggata ctgttgagac tggtgttgca cttgagacag      1800
     tgctgccatg actctggcca cccacggttt gcgttactgt agaaacaatt gtgtgaccgt      1860
     gctcatcagc acctgtgcta tgggatacaa cctcggtgaa cgtgtaaccg tccgaaacca      1920
     cagtggtggt gtaatcagtc cccacatttg ctttagaaat cgaaggtgca ggtgcattgg      1980
     tgatcgtggt ggttactgtt gtaggattac cattggagtc ggtagtggtg atatgcgaaa      2040
     tgacatcagt ttcggtactg ccattacccc tgtcgactgt tgtggtgtag tcagcttcac      2100
     ctccgacaga gacagtggag atagtagatg tgcctgtcct ggtgactcca tcgtcgccaa      2160
     tagatgggaa gtacgaaatt acaacaatct tgctactgcc gtcatcctcc gtcacagtgg      2220
     ttgtcacaac tggtggctgt gagtaaggtg gagcagacgt gtacacgccg tcgcctacct      2280
     gatcgaagga ggccatcgtg gtgatgatgt aatggtcttc ccatcagaga ctgtagtagt      2340
     gacataagat acaacctctg taatcgtgtg tccatctgaa atgatcgtcg tggtgtagtc      2400
     ggcctcgcta cttgggttgg tcaatgggac ggtggtcaat gggacggtgg tcacgatggt      2460
     ggtaggcttg ccgtcggagt ccgtggtggt gatgtgggag atgatgtcag tcatcgggag      2520
     ctgcctgtcg gagttggaga ccacggtggt gtagtcggcc tcgctacttg ggttggtcaa      2580
     tgggacggtg gtcaatggga cggtggtcac gactggtggt agggatagcc gttgggagtc      2640
     ggtggtggtg atgtgggaga cgatgtctat gagcacgctg ccgtcggagt tggagaccag      2700
     cgagtggtgt agttcggcct cgctacttgg gttggtcaat gggacggtgg tcaatgggac      2760
     ggtggtcacg atggtggtag tgcttgccgt tgtgagtcgg tggtggtgat gtgggagacg      2820
     tatgtctgtc acccacagct gccgtcgaga gttggagacc acggtggtgt agtcgacctc      2880
     gctacttggg ttggtcaatg ggaccggtgg tcaatgggac ggtggtcacg atgcgtggta      2940
     ggcttgccgt cggagtccgt ggtggtgatg tggagtcgaa tgtgtgtgag cgcgctcccg      3000
     tggacgttgg agaccacggt ggatgtagtc ggcctcgcta actttggttt gttcaattgg      3060
     gacggtggtt caatggggac ggtggtcacg atggtaggta ggcttgccag ttggagtcag      3120
     gtggtggtga tgtgggagac tgatgtctgt tgaccacgct gccgtcggag ttggtgacca      3180
     cggtggtgta gtcggcctcg ctacttgggt tggtcaatgg gacggtggtc aatgggacgg      3240
     tggtcacgat ggtggtaggc ttgccgtcgg gtgtccgtgg tggtgatgtg ggagatgatg      3300
     tcagtctgcg gagctgccgt cggagttggt gaccacggtg gttatatctg atgttacctt      3360
     gtctgtattt atttcagaac ttacagatgt actattgttc cattttgttg atgtattcga      3420
     ttctgatgta atccctgtgt tgttgttaga ctgaatggat gttatggtag ttttactgcc      3480
     gtcactattt gtgattgtaa tagtttctgt tataatggta ggttgggttt gcttttcggt      3540
     gatagtagta taaaatgtaa tcggagatcc atttacgtca aacccagtca ccctgctaat      3600
     tatatctgtt tcagttgttt tactgtttga tttggtgatg gtataaacaa ctgggggagt      3660
     gtatattgtt gaagtaccaa tctctggcaa atgatcacta ttatatgttg aataaaagga      3720
     aatagtctct gagaagccta aatcattagt ggtttcatat ggttcgggga ccttgaatgt      3780
     gtatagcgga atttcaacgc atggtctaca tattgatgga gctgaattag gtggactgcc      3840
     attatatcta aaaaagttgt ttttataatg ttttccctgg atgtaattgt cagcaacgat      3900
     ttcaaaaagg gtatcattat aacctttacc aaccagggat agtaaagctt agcaagccga      3960
     tgtaaccagt agtaaatgtt aaaataccag ttaagtaact gtattcaaac ttcttgattg      4020
     ggaaatcagg gaacaaaaag ccatttccat ttccaaatcc tgatacaggc atattttgac      4080
     cgttactcac cgccaaaaca gaggtcggat ctgataaata gatagattgc tgtgaaacgt      4140
     cgaggtcttt gatgttgaat acagaattct caccaacagt aacacatcca acgccctcaa      4200
     ttggattttt taagttaaat gtcgtattag ccaaacaaat tgtgcctgtg ttgtaccagt      4260
     tatcggcgtt attaccgatt ttcaaaattt gaggagtgtt tgcgtcagta cctttggagt      4320
     agatgaatcc ggtgtttgtc acagacttcg cagaaatgtc aaacttactt cctttgcttg      4380
     atgtgaacat aatatctccg gtatttgtaa aagctaccgt cattaatctt ccatacacca      4440
     acagaagtac tcttcctatc atcgacaaca attgtaccgt cattttcgaa aacaaaatca      4500
     acaaataaag cgtggctaga tgaaatttca atccctttca aattgttgtt aatatagtaa      4560
     agagcacccc ctttttggac tctaactttc tgatacatgg gtacagtatt catatcctga      4620
     aatgctaaat aggcacctcc taaaacgata taaccgtcat catacccagt agggttgtta      4680
     ccataaagta ttgtgttact ctggattaca gcctgagcag taacaacgct agtaaaataa      4740
     agcaaatgga gaagccaagc atatgatttc ataaatggtg gcttttttct catcataggt      4800
     cacgcagaat tggaaatttt ttttatgttt gagttatgat agcgattatg tatacaatta      4860
     aattattcgg ttttgcaatt caatatagat tgtcgcgttt atttatgttt aaatatgatc      4920
     ataaaaaaaa ttaaaatact agatgaataa aaaatatgat catgagttca aaaatttatt      4980
     tgatatttat acatttttga aaagttatgg aactgataac tcttattttg ggagttaaac      5040
     tactcagtac aatgtatata ataaaaacaa caatattctg ggaacattca gtggactaaa      5100
     aatatatctc gtggctgtat tatttattta ataaactacc tgtattttaa tataattatt      5160
     gtagtaaatg tcctcaatta ttacctttct tcaaagcaag acaatttatt aataataaag      5220
     agcactattt tctataatat atgctttact ttcttaatgt taacagctag tattgagggt      5280
     agtattaaat ctcacagtaa tttctattaa tttattgctg ttcagagtct aattagtacg      5340
     caatttaaaa gcaaaattac ttacttttaa tattacttta tttctattat taatttctac      5400
     cgtgaagtta ggccggtaat aattttacaa acaataaatt ttctaatgat tttacaaaac      5460
     aaatggtaaa ttggacttgt cgaaatactt ttgttgcact tttatttaag acaatgttta      5520
     ttattctaat attagaaacg catagtgatt ctaatctatt gacatctgta tttttttaaa      5580
     gaaattataa actatttgga ggtataatat ctagatggat atctatacgt aggagagcag      5640
     atatagttga gtttatgaat tagagaacaa aatatatctc ttgctgtttt catattgaat      5700
     ttagtagttc tgaggcccac tccaaattac atacatgttt tttttgagtt gaattttgta      5760
     tgaatttacg taactgtatc attttccggt ttctattcaa ccaatatata gatttatctt      5820
     gctttagcgt gtgcccctca attttgtgtt gaaactggtc taatgtcaag ggcaaagaca      5880
     aagacaaaac ttcaacaata attagaatag taaggcaccc aaaattcaaa aaagtaaaaa      5940
     tggggtgtca atatatttag atataaaagt atttgtgcat gatttaggta ataataaaac      6000
     ttcaattcgt aatgaatacc tgcctcttta acaaaagagt ttttaatata cctggatttc      6060
     cttttgataa tacaagaata tgtcatatta cagcttatgt attataaagt ataagatttt      6120
     tagccagtgt ctttgattac ttagtaactc ttgtagtacc ccaaaattat aacaaagtct      6180
     gtattacctc tcatatagta ttaatatact gagaatgggt cagattgtca ttttgacatt      6240
     ctatttccta agttaatgca tcgtaaaaat atagaggtat ctgtagtatt tgtccaattt      6300
     ccggtcataa tgctggacta gtaatcattt gtatcatatc aggatcatat caatataaaa      6360
     aattttaaat accgcataat atctgattta aactaagaat tctacttcca gaaatgtcaa      6420
     gttttacaac ctcgtagtta ccataaattg tgttacgtac cctttttttt tatgatccta      6480
     ataagaatca tttctaataa tagtaatgtg agcaaattaa actcaaaaaa tccagtttat      6540
     tttgagattc actgataaaa attggttcag aaattaaggt gcataataaa aaacttcaat      6600
     atcaatgtag atattgatga atttttaaaa taagtctaaa aaggctactt agtttacaca      6660
     gacgttgcca gtagagactc atactaaaat tacacacatt tgaagtatta aagatcttgg      6720
     cattttcaaa cagtattaac tgatgtaagg acaaaaggtg agaatgaatg tattttatgt      6780
     tacctaataa atgtccatga caagccaacg tagctgtgag atttatagtt tgctttctta      6840
     tgtcaatttc ttattactta tttagaagat taatatactg gtagtaacaa tataagctgc      6900
     ctaaatcaga agctctgagc aatatatttc ttaactgttc tctgcaatac aacatttgat      6960
     cattttttcc aaaaagaaaa gaggtcgaaa aggagtcaaa ttttttgtaa gcctttatta      7020
     aagatttcat gtgacttctt ttttgaatta cttcagaggc gtgtgctgga ctacatgttt      7080
     attaactact tgttcgtttt gttcatcaaa gctaatatac taactacatt gcaaatgtca      7140
     atgtcaatga tcatagtttt agggcaaaga tatcacttga tatgacttta ttagtaatag      7200
     aactgtttat cttgctcaat tcatttttgt tacggcaaaa aaaaattgat tatttctttt      7260
     tctaagttca ccgatagttg cgaaatattt ggaagattac aataacaaat ctactatttg      7320
     ggccaagtgg tttctttacc aatattaact cgtacaaaat ctataagatt tgtttttctg      7380
     agttgtatat tattcattcc ctcatcgaca atcagtgaca ctgacacttt tggtactgga      7440
     gttccacttg cggcagctaa acggtcttgc atcattcagt gtgctgcttg tattttgaac      7500
     ccatcattta taaattcttt atcatttatt aaaggacata tagtaattaa gttattttta      7560
     gaaacaattt tattttccaa gttattcacc atattgtgta aatttatatc gtcatagtga      7620
     atttttgata aattcttcct aaaacagtaa tttcttgaag taaaggttac atatagatct      7680
     tcaagtatgt acctgtgtca ttaacttact tgaagagtag tatttacttg gcgtcctaaa      7740
     tactgcttac taagaagcat ggcaatattg tcactctcat gagtgtggac gtatttttgc      7800
     tcatgtaaac tgtttttaaa tattaaccaa ggccagtaat ttgaaaaatg acgtcataag      7860
     gaattcagta gtacatgacc aaaaagaaat gaattgtaat attttcttgg cgaacataaa      7920
     aatatcgcac tatatggtag aaattctaaa atcaaatata ggaatggtaa aaaagcattt      7980
     caaaaaatat tgtgtacctt aaatttataa gtcaaatttg atagtatgtt atttttcagt      8040
     gctctttcct atctaagagc gtagacacaa atgttagttt atttttccaa tttgatggcg      8100
     agtactcgtt cttcatttat ccgaatatat tcattataac cgtaggaagg atttcattaa      8160
     aagtagtaga ttcgtataca gagaatagct cagtatttcc acagtaaacg ggagagattg      8220
     aactggtttt gtaaaaaaaa ttaagtaact ttcttttgct tgtgtggagt gagaaatata      8280
     cgtcaaatat gcttgataaa ataaggtgcg aaatattttg taagttagtc aaacacgagt      8340
     aacagagaca tttcctgctt gtctatgtta tttttagaac aacagcatac agtatggtct      8400
     ttcgtaaaaa aatcgggaaa tatcggatat gcttgtctct gccactcaat tcaaagtcaa      8460
     tcgccttttt acataaacag gcaaagaaga taattcaact atgagcaagt aaaacagttt      8520
     cttacgtgta ctttctttga gagtatttct tagttatcaa ttgacaccca atttagttga      8580
     atcgagtaca atgattattt attgcagata agtggcaacg caatatcaga atacttttct      8640
     gcaagtacat atcgtgttct agattacagc gtttacctat taactattgt tttactactg      8700
     tatgttcttt tttcttataa ttccacaata ataaaatatt ataacagagt tggttttctt      8760
     taacaaatta gacaaataat acgttttggt tataacctga ccttgctagt tattaactta      8820
     tttatttatt tagctctttc tgggttaaaa taaatccttg gtttggctgg aactcatacc      8880
     atcgaaatga aaccttttga actgcttgga aataattaga agtccaaaaa tagcacctct      8940
     ttggaatttc ttaccatttt ttatgtttgg atcagcatgt tatatttcaa aaataattca      9000
     tgtcttattg taagtacttt accaactaaa atcatattac ataccattat ctaaaacatc      9060
     aagcaaggcc taaaatctcc aactgtacct tcaaggataa tatgttcctc tccgtaaaag      9120
     tttcaataag tatccatatt gatacttact aattcatatc ggaaaacatt gtttttaata      9180
     tttattgtat tatgtatcga taaaggtaag tagctggagg taatttatcc attgaaaaat      9240
     acgtagctca tattataaaa gattgatgta tatgtttctc tttagcgcat tttttgcata      9300
     gttctatatg tttagattac atatatggtt acggtttagt cgtctctttg aattcaaaag      9360
     atattatata actctcgtaa atattgccat tgttttcttt tgaactattc caatatcgca      9420
     aaaaaacaaa taaataacac attataataa caggatgatt tataaattcc atgctatact      9480
     cgagatgttt atatttgttg ggtaagattt atgagttgtg gtatacttat tacccgctag      9540
     taaaatgaag cgttactgat ttattattaa cattgtcata tgttgttata cgttgcaaat      9600
     attggcgtat cttttttttt tgaatcacaa ttgcaaccac tattatagca gcataatatc      9660
     tgatatactg tgtttgattt ctatcctaat gataaattag tttttgggat tctaatttga      9720
     accaaaaata actagaaata ttcatattta taccttttct tgtattaaaa agcattctat      9780
     gtagattatg ttatttataa ttattgattt tcaagacttc ggagtctaga gatatcctat      9840
     gatattactg aaaatacaac acataataga tgatcaaata atttatatgt acagaaatca      9900
     gcaactattt attgattgtc ttctatttct aaactaatac attgtatatt tcgcaacttc      9960
     attgcatgat tagtcctgaa gacttatatg ctcttttttc gattgaatat actggaattt     10020
     gagctcacga tactgcgtac ctgttaaact caaactaatg gaataacaaa cggcacacaa     10080
     atttcattaa gaatttacat tattgtcata tattatacaa agtgcctgtt accgttttta     10140
     ttataaaaat aatacgccat tgggtgggaa agggatattc aatcaaagaa taataccttt     10200
     ggttttatca gagaaagaaa atttactata ataacagttt gatatcatct actgaaagtt     10260
     ataaatagca aatctgatga tattaactag tttgtgggaa ataggttgaa ctaaagcact     10320
     gagcaatgat attgtttatt actatcaaaa gccaaagcta aaccaatgtt atcacaaaca     10380
     ttgatatgaa tttttttata ttttccttag tatcttaaat gactgaacct attcatttat     10440
     gaaatcaata ttcaaacagt ttttgattgc taagtacatc tttcattgaa taaaatgatt     10500
     tcggagggca ttgtgagtga aatttccaaa ctatcagatg ggctccttat tatcggtttt     10560
     tgcccgtttg aatcaacaac tagtatcagt gatgcataaa ataaagtcac actaatagca     10620
     ttagtggata taagattcag gtttccgtaa tcgttcattt ctaaaactac tcccagtttg     10680
     attcattgtg ctaaggaata ttgggatatg tttctgattg ggtattgtga ctataattgg     10740
     cctccattgt tctgctatgt tacatttttg acattggcgt tatcgaaatt acagatttaa     10800
     tatcctaaca ccactaataa aatatattat ttatttgatt attaccttgg actttatatt     10860
     tacatgttag aagaacttta tagcagttaa gtgttttatg gcatctaata cctcatataa     10920
     ttgtagctgt attgcactat tcatcatcag aatggaattt cattatccag ataaagtagt     10980
     aagttcccaa gaaccgtata aatagcattt gaatattttc tactagtgtt ctttaaatgt     11040
     tgccgatata aaacatctgt ctctaactag ggaattaata gtttacataa ctatttttat     11100
     tatattgaaa aacgaaattt gtgcttggaa ttgagattac tgtctaatgg agatagcaaa     11160
     cgtctagaac gggagggata aggtttagga ggtttctgct atagaatatc ttaaatgcat     11220
     tagaattgtt ttttttgcac atgtaatatt tccgatttat cttttaatat ttgtatataa     11280
     aagagtttat cttgagctaa tgacacttac tcgacttcta tataatattt agcataaatg     11340
     acaaaatgga ggtaattagg ccatttgaat ccattcataa taaacttact acaatactac     11400
     tgacatatga tttgaaacac tttaaacttt catatatgat gagtaaaagt ataaacttta     11460
     aaatattctt ttgcaattct taatattatt ccctcagaac aaatactacc atgcagtact     11520
     ctccggcgaa agagttctgc tatctttaca tagtaaaatc tagatataat atacatcaat     11580
     ctatcaattt cagtaataga tttaatctgc ctgcaaaagt tgaatttcaa gaagtctttt     11640
     taatgaattt ctttatttaa aattttttca caacaattaa ttcaatcacg ttttagtgtt     11700
     tattgattta tcagttaaga agttaaatct gccaccaaaa tgttaactat gtaatgaaaa     11760
     atgtatacat tatggttcac catctccata agagccgggt aattgtagct tacgggatga     11820
     agaatgccaa aatctagatg taagaaagac aaacaaattt gtagaaataa aatatcttga     11880
     ttactatcat cggtgcctga gccacaatct aaaaaaaaac tggtatgaac caaaatagcg     11940
     taaatttgag caggactctg tttggcagat catcagatcc aacagcaaaa ttgatagaaa     12000
     ggaggttgaa ttttacatca tcaataccat tcaagaagca gtgctcgggg gagggggggc     12060
     tactggatta ataaaccatg tttaaatgtc cactattatg agattaacat tactcattcc     12120
     tgctatcaat ggcttataaa tgttgttttt ttctttccac cttacgacat aatagtgggc     12180
     acttgacatg gcaaccggaa atcgaatatg ctatagaaga gattggattg ctaagttaaa     12240
     ctctgttgct aaaagccttc gatgagtttc tgatcttctt ctaattcaca taggtttgac     12300
     aatatgggct tcataatgag gtcccagaaa gcctatattt atgggattca ccagtccaat     12360
     atagttgatt gttccaacgt cactgtaatt ttctgataga tcagttacca tgtttttgct     12420
     aaaatgccga taaagtgtgc cttctatctt tggaacaaat taagataaaa tatagagatc     12480
     actgaatgag ttgtcttacg agtatggatg tttgtgttct tcattttgct gaggttgtca     12540
     ttcatgttaa acttggaatc tataaataat gcaaccaatc caaaagtgtt acattcagtg     12600
     agtaaataaa actaagacct accaccgata gtaaagtcct gaaatcgggg acttgaacgc     12660
     gcacttagaa ctggaactgg ttttctattt tcctcaacga atcctgtgca gagtatttta     12720
     cttgacatgg gactactagt actcagaaaa ccataatgaa attgtacgat gttattggaa     12780
     tatcatccat ctgttgctga tataaaggaa taaatttaaa aacagatccg gagaagcgaa     12840
     tatagttcaa tattgcacat atattgacat gaagtgaatt ttgttcattg agatgaaagt     12900
     atgcacaaca tttctcggta gaaaatggaa tagttagcac taatgttttt aggtttatat     12960
     gtttctgtcg tatagccaga aagttatggt aagcacgaga attacatcct atgtaatgaa     13020
     acattaggaa tggctgaaat tttgaaatca aatattagca agctttcata ataatgtcgt     13080
     tttttcatgt tccagtgggt ctcatttaat ttaatgaatg aagttttccg ttacaattat     13140
     tttctataga gaaaccgatt gaacatagtg ggccctatgt gattattttg acttcatatt     13200
     ctattgaatt gctgttgcat tcaagaatca attttctata tgtgcttggt tgtgtatgtt     13260
     ttttgcgact tttgtgatat ttctttatat attgtctggt tgttaaaatt ccgacaataa     13320
     tgatcacttg taactctaaa ttaggaccgt caaaataccc actgaagcaa atacatttac     13380
     ctggttgggg tagttctttt caactctttg aataattgca attcacagaa aatacatagg     13440
     cacttacaag agccggctga atttacctta tctataaaat gtgatgaagc aaatcaatat     13500
     tgatggtata aatcatcatt taacctaaag tcagtataat agaatctgca atttttttct     13560
     aacttgcgct atatacacaa tgatattgat ggtataaatc atcatttaac ctaaagtcag     13620
     tataatagaa tctgccattt tgttctaact tgcgctataa acacaatgat attgaaggta     13680
     gtaacatata ttagagatta gtccaggtat actacaatcc ccaacattag ttgttctgca     13740
     actgagaata ggaattttta taaaattgat caaaataaca ttctctaccc atttcttgga     13800
     atattaaata gtttgacaca ggaagaatat ttcacagagt caatttcaat ttcaagtaat     13860
     agtttagata gttgttataa attattatat gaactaagtt atcgaaagtt agaatactta     13920
     tgtattgcta atatcgaacg tatcaatatt actcttgtat aagactttta aaacgttatt     13980
     tttattttgg gaaggatagg cagattaatt actctgatca aatttgtcgc aaaataatgt     14040
     cttatgtata tgcggagatg cagttacaaa taagctagtc gagataattt cttatgaatt     14100
     aatgctagct gtgaaggaat ttctaaaata cagtacaaaa gaaatatttg agataatatt     14160
     tgtgttaaag ttttctgaaa tatggctggt tagtagaaat tttaacaaaa gttctagctt     14220
     tttgtcactc acgcactaag agtttagatg gataacgtat tggtctttat tggatgacag     14280
     aaatgttatc tctgactgaa gtagtaagtt tgaagcacta tacaagttag ctatccggtg     14340
     cattttcaag gctaattgtg ttaaaacaat cttacttctt cttatataat ttcaattaaa     14400
     tgtattattt gcataatctt tatcagccat gatatagccg tttcgattga gacggggctt     14460
     gatgtgaaag taaatttaag tctttaactt aacagcaatt tagtattttt tgtttattga     14520
     atcactctac gaacatattt aataataata aacagattta tatctatcag gaacttatta     14580
     catactttag tattaagata gcaagatctc ttgaaatgct ttcaagtttc taataagcgt     14640
     ttatttgtgg aaatttgaga tatacctatt cttcttggga ctttgtaacg atacagtaaa     14700
     aagataacag cggtacagta tttactacca caaaattatt gtctttgaag tttttgccaa     14760
     attttgtgct attcctgaat acatagtgaa atattcaagt gtgtacttac aggaaagttt     14820
     gagaaaaatt tgtaaacaaa gattcagcct caaataattc agtagtatct gaaattacgt     14880
     tgagtaatag gcgcaaattg gcggcatgtg catttgacac taaacacaat ttcatgttgt     14940
     ttaagacaga atatttttta cctctacatg atcatttata cttattgcat tgaaagaaca     15000
     aaaattagaa atagctgcag gagcaaaaat aaaaagtgac tagtagcgat actattcgct     15060
     atgccaaaat aggttgcaat gattgtaaat gatatagatg actgttgtca taatgtagga     15120
     atgtgttctt gagtacatgt tattgatgtg agagtagtac agattaaaat taaaatattc     15180
     ctatttgttt ttattaaata tggcatcatt tttagtatag ttgtaatggt acggccaata     15240
     accataaagc aaaattaatt attgagacat ttgctaggca attgctaata tcaatccaat     15300
     ttccatatct atgttgtacc ttcaagaaac atctatattc aaccaccaac ttgaaatata     15360
     tgtccgatac ttatctgttt gtatgtgttc tcttctgtat actattttga ggtgcaatgg     15420
     tacattacaa aaatagaatc tactgcaaaa ttcaccttgg tgtgagaaat tggtaggagc     15480
     tcctaccgtt attttagtgg gtagtctaaa caagcaatag gtgagccgat aaataattat     15540
     aacccgacaa gtccttctta agcagatcta actgcctata actatacaac acaatagtag     15600
     aactttcaaa aaaaaaccca agaacaaaaa attgaggtgt gtgaatcgga acggatgaac     15660
     agaaggtcca tgtagtttac acgaataaac ctatctcttt atgcacatcc ttacctaagg     15720
     cagtacgcta gttctcctat tgaacacttt tgaatacttt tgaatatctt gttctgctat     15780
     cttttatttc cttggtctaa aactattgga aagtaagagg tatctcaatc cgcaaattga     15840
     gtatgtaatt tcaatcacaa gagttgtata tattgtcaag gcgatagtcc tttctgaaag     15900
     gtaccatata taaatatagc atgttatgta tatggaagtt tcggccattt ataatggcaa     15960
     ttgctatgag ccggcaatga gacacataat tcaattatgt tgttcaatga tacagataga     16020
     agaacactat aagaaaaggc agttaatgcg aaacactaac aaagagttat ctttccttgt     16080
     cgaaaggaag tttattagtt ttaccctcaa gaacagtcta acaatgtcaa atgcaggtta     16140
     atgaaataca tttacataca acagtggtaa ttaggaggat atgatatcag cgttatagat     16200
     agcagtgaga cacttatggt tcgatgtcca aaaacttagt ccctcgtact caggatactt     16260
     caaaatcaaa agaataaagt gcctttgaga gagctactat tttcaaactt tggtcttctg     16320
     aacctcttcc aagtacaaca gaaatcaaga gagcccacag taacgttttg ttcttgctga     16380
     cttactggag tgaatgaatg agttgagatg aaacaactcc catggccccc aaacataacc     16440
     aaaagaaaac agctttgttg aagttctcca gaagaagact acagaagtaa cactcgttaa     16500
     aactgctata aaacgtgtaa ctgttgtatg ggactgcaaa atggataaga cttggctttg     16560
     ccttttcagc acatttgctc ttcaaagaaa ttgaatatcc ttctatccaa tcagatcatg     16620
     aagactatgg ctttgagatg agaacggggg tgcaatttga gtggtgtgca gccaataaaa     16680
     cagtagatcc cgtatttcaa aaattgcacc cggttttctt ttctcgttcg tacagctctt     16740
     tctgaattgc accctttttt catatgaact gcagtgttac ctagatcaag tgggggggtg     16800
     gcaggtggct atttctgcct tctacagcgc ttttagtgaa cttttgcttt gttgtaattg     16860
     tagttgtatt tctgtgtgtt acgtgaaata ccgtgccttt gtctatcatt ctttcagtgg     16920
     ttttgctcgc agagatgggg cattttgatc cattgtgtgt taaagcacag tgggacccag     16980
     gaatagtaga gagaaggaaa gtgggggaag ggtagcagtg gggccggaag gagaacgttc     17040
     tattctacag catatcttgt tctgttctcc tgaatgatat attctctcct gccagtcttc     17100
     taacttcggt tccattgaac aataatgatg tcgttgcgag tggtgaaact ctgacatcgc     17160
     ccaatgaaaa tcaatgtttg tgatcaggcc tgaccttcct ctgcttgttc gtatttttgt     17220
     tttgttctaa atttctgttt ctacattggc ctgagtcact ggccgcagag gtaccgccgg     17280
     gaaaattggt ttccattagc actggcaagc ctttctattc atttctctgt caccaactcc     17340
     cacttgttcg ttgagatgaa acgaaccgag aaaggtggac acagaagaac agcgcatttt     17400
     gcagaagaag aaatttgcaa ttctgacttt atcacagaaa aactgtaact aaatgctgga     17460
     tattcgatag ataatatatg aacttcgata ttccattgtg tgagggtgag ttttagagaa     17520
     tactattgca gttaacaaaa ggtattggat tctaatagat acttagaact ttgctgcttt     17580
     ctttgtttga cattctacaa acagctcaat ttttgtttgt tagttgtact tgtagtttga     17640
     acacggtttt cttccatgac ggtctaacaa taccgtaggc gaacttacta ctaatattgt     17700
     tgtgtcatat ctagaagtaa agtgagaagc gaccggtggt tgttgtctat attcgttgtt     17760
     ggcttgctct tatcttctaa atatagcctg caaagatctg agaaatggat taattggtat     17820
     gtcgttcccg gtgaatgata actcctcatt cgtttttaac tgccgaggta gactataatt     17880
     gatgaacaac tacgatatcg atggtggttg tttttttaca aagatcattc agaatcggtt     17940
     acataacgac tcaaattgca atttgagtcg ttatagaagt agtgctggac ttatcactat     18000
     tattctttgt gtttcaagtt tagtaataga tgaactcttg aaaatatctc atgtaattaa     18060
     tttgacattc gagatgaaca agaacagata attacaacat ccctgttcta atttgtatca     18120
     gcgatggcat tacttcgctt tccaaatttt attcgggaga aaactagaaa acttgtcatc     18180
     cataatgcct gattacaaca tatccggtat gtaagcgcct aagttttggc ttttggacat     18240
     agcgaaatag tgttttagat acggatcgac aagagcctac agactttcga cttagcaatc     18300
     agtcaggcaa gtgtagcttt tgaaattaat acgtactcct actacggata tcgcgatctg     18360
     tgtatgttac cttgtagtgc aataacttat acgttactaa acaaatgcgc cagtgctgca     18420
     ttcaaggtca agcaaaatat gcagtaatat gacattagga tggaatagca aaataccgtg     18480
     tgttcgttgt tcattcaacg acataatgaa gtccaataac taggttgaag tgttggacag     18540
     agggcacacg attaaaacac ttgttaccgt gttctttgcc tttttttctt tttttattct     18600
     atttttctta gagaaatatc actttgcttg aatttttatt gcctcggcac tcaatctccg     18660
     tagggaaact tccgagaaaa tccaatgata aggaatgcta acagaaaaat ctgctatgtc     18720
     tattatgtgg gatgtaatta ctagtgttcg catcagcaat aacttctcct taggttcttt     18780
     tggaaaaaat tttggtcaac tgaatgcccg caacaaataa tatggaattc cgaattagtt     18840
     tagaatgcag tgtgaataat gggcgtaccg atttaaggca ggaacaaaat tactatccac     18900
     ttcttacccc tcaagggcat attgatgttg tctcatccca ttgttctcat gattctgttg     18960
     attattcatt tgtctgcagt cactgcctgc ccaaattatt tggccgacga ttgaacgaca     19020
     acggcaatga agtcttttcc ttcaaaactg gatgaaaatt acacatgaaa taattttggc     19080
     actcctgcag caattaacag atatacgcat aacagatttt caccagatga agtattttct     19140
     ttttttctta tagaaaagag aatcaatagt ctaatgagca ataatgcttt actatatggt     19200
     gagagtagct ataagtttga gcaataaata attatagggt gcaatacaat ttagagagcg     19260
     caattctaat tcatctactt ttgagtatta tattttatga aggaagttag tggcactcaa     19320
     taatcgaaaa tactatataa actgttcgaa attcaagttt agacagccac tttgaattaa     19380
     tagatactca tcctctatct ataaatactg tccaggtaat atatcaaata cctttacaca     19440
     catattagtc gagagaatca caaaagagta tcgattttga tttctacctt ttgagctagc     19500
     acttgacata ttgctctatt acttattgtt tggaattgag tattatttca catcgttaga     19560
     attaaactag gatgggtaag gttggtgagt tttttggaca ccctggtaga cgacctatgt     19620
     ttcgtcatag agcaaatatc ccagttatta agagcgattg tgagtacgaa gagtcatgca     19680
     atgaaaagaa tgacccaaaa aatgatgaga ccatctgcag agttgattcc tttaataatt     19740
     ctagctctga ctcctcatta aatgatgtcc acttgcaaga tgatggtaac attttaacta     19800
     cacataattt tactggtttg tcaacaagtc gtacagataa agttttggat tggatggtaa     19860
     tggttgctgg gtcacagttt atgttttttt taatttggat tattcttatt atctggatcg     19920
     tcactggtat tatatataat ggtcccttca attggcaagt tgtaatgcaa gatggtcaat     19980
     ccattcaatg ttacgtatgg gatactttat taatgagaca acaactaaat agtacacatg     20040
     aacaaatcct aataataagt gatattagat cccgtttagc ttcattttct ggtttttttg     20100
     aaaggttgag ttttgcttgt ataaaaggct cgaaagaatc agatgttgat acgaccgctc     20160
     aaggtgttga cgaaagctcc aacaaaagcg acattaattg tgactgcgaa gataaaaatg     20220
     agaccacaga gtttatcaaa actggtgaat taccagtgga gaattggtat gataatctgt     20280
     gtacaaaagc ttcatatatt attggaagta tacccatgat gatagcattt tggttgggtg     20340
     tcatggtttg gatagtttgt ggtattattc ccaaggatgc tggtaattct ccaccattca     20400
     ctggtgaaac aactggtagt aatccaaaat tgaaaaagtt tagtgataca tggcagatgt     20460
     atattaacac cgcagttgca gtatctcttc ttatctgttc gacatttctc caaaacatta     20520
     gagctcgtca cgataaattc attgctaaat ttttattaca aatatatgac ctagagcatg     20580
     aaattgatac aaaactgaga acagcgttga atgactatga cacgttacat ccaattattg     20640
     aggttgctcc agttaagcgc tctaaactgg aggttattat cgactggtat gctgacgtta     20700
     ttggtactgg tatcggtgtt gtggtagcta ttatcgtatt tggtgtatgg attggaattg     20760
     gtcagccttt gcattggaat gataactggt ggttaatcat tggtacttac accggtttag     20820
     tgggattttt agatggctat atcattagac aagtttattt caaaatcatt cagcatgaag     20880
     aaaacaactt tcaaatgctt gctgacgaag atatggcttt attccaaagg tataacatac     20940
     catgtgagga tgaatacttt ggaatcaagg gcccagtgaa aatgaattgg aatttgaaaa     21000
     tttctacgta tataaattat ctttgcgcaa gtcaatggag tgtagtttgt tcggtgctaa     21060
     ttattttggg tttgattgga gcagcatcag gcttaaaatg gagcaccaca ggtcaactga     21120
     tagctaatac acccaccatg attatagagg agttcttttt gattgtgttg atccaggcac     21180
     acaacgaagc tgatcttgaa agaagaaagg aggttacagc tttatatatg cgaagaaagt     21240
     tactactaaa ctatgttaaa aaagagttag gtatttccca ctaatctgcc ataatcgttg     21300
     gtagcttaca agtgtactga tgctggcaca gaatgagttc ttcttttatg ttatatatat     21360
     tccgttatta atagtttata gagttaaagg acagttttaa taaaagaaac acaggaaata     21420
     atacagtctg ttcaattctt taattacttc attgttaatt cacttatcgc tcagtctaac     21480
     aggtagatgt ttgtaattac aatggaaatt cagaaaggaa atccagtaaa agaggctgct     21540
     tattaagctt ctcacaaaga cgaattgcta tatacgataa gctcaataga ggcagacaca     21600
     catatagaca acaaattaat aactttaaaa ttgaaatgta gcttttcata agaaacaagg     21660
     aaatacatca aaacataaaa tagtagatat ttagaaataa actcattata acaggttaat     21720
     agcgatagcg tcatttatga tgtcaatact tgatacgaaa gtttattgac tcctaagagt     21780
     tccaaaactc cgtgaggcta aagaaagctg ataggggaat aatgcaatgg aaaggaaaag     21840
     tcaatggtgc acttattttc ctttttgatt acataatatt aatgagtatc catggtatca     21900
     gttttcaaat ataagtgctc tggattaaga tacactgact agcaatgaac gggtgatagg     21960
     tcagaaagca gaaatggaat attgatgata ccgagattaa caaaagtttg acaactgaat     22020
     aattgagatt tcaaacgtta aagagtatca cagcggtcaa cactatgaga taacaattaa     22080
     aaaccacagg ttgtgatctg tcttcaaatt aaacaggata ttggaaattt ttgacctttg     22140
     agccatcatt accgaactcc ttgaaccagt ccatggtgcc gtttttgatc tttctattta     22200
     agtgcaataa gtataacctc ataagaacag cacaacaaat tgaggcagcg ataaatccac     22260
     agttactgga gaacgcaata acataccttg gggcattaga tagtgggtac aggtatgcat     22320
     tccaaattga tgttgagtta catacacagt tcatgacgga caaagcgata gctctcttca     22380
     atgggggtct tgggaccgac gacgacatcc atgaaataat aattgtatag gaacagtaaa     22440
     gaccggttgg catcaaacac atagcaaaat atctggctcc agtatttagt gttgatacag     22500
     caataataaa tgcggccaga gcaataaaaa gtgggcaaac aatgtgccaa aatctttcac     22560
     cagtcctgtc cgagtgccat gaccatccaa atgtggtgat aatagcgatt agataaggtg     22620
     gtgcagtcaa acacaaagtt ttgattctgc cgtagttcaa agtcttcaca acagaaggga     22680
     agaaattggt aacaccagct gcagcaacca agaatgtcaa acagccagtt aatagccaaa     22740
     ccttcgtgtc tgtcaaagct aacttcaacg cataccagaa agaattgtgt ccggattcac     22800
     ccagcatttc cttatccgag tctgaatcac caacttccat tctcaacttc cacataacaa     22860
     gatcacgctc ggtttcagtc aagaacttgg agttgtccgg gttgtctggt aaaatgaaat     22920
     atgctaatgg gactgttcca actgtgatag caccctcaat aataaagcac catctccaag     22980
     ctcttaagcc acgagtaccg tccatatgtt caatgatacc agcagatatc aaccctgaga     23040
     aagcaccaga gattagcgag cctgagtata ggatggagtt tctaagacca agctcctttt     23100
     tggtgtacca acaagataaa taatacaaac tgcatccaaa gaaacctgat tcaacaaaac     23160
     ctaaaataac tcttatagct aagagaccac cataagattg gactgcacca gtacaagtag     23220
     aaactatacc ccacgcagtc ataatgacgg ataagaacac agaaggtctg cctaatctgt     23280
     ttaagataat gttacaaggt atttgcatcg taatgtaacc aacaaacaaa atagaaatag     23340
     cagtttgata ttgttgtgaa gataagtgca ggtcttcttc taaaccaccc aatcttgcgg     23400
     aagcaatgtt ggatctatcc aagtagttac aaatataaat ccaacataac ataataagga     23460
     ttcttagatc catttttctt ctagtttttt tgtcaaggat ttctaattct tcagtggtgt     23520
     aatcttttaa agattctggg atttcatcct ttgaaacaaa tagtgggatt gcttcttctt     23580
     caaaatctcc tttaatatca tccacatttt gtagggatga atcttcatcc ttagaggaca     23640
     aatgaacagt taaatcatac tttgaagagt cctcgacgtg actgatttca tttctctttt     23700
     tagaatcatc atcatcaaat gattcgatca ttgttattat cttaaatgga tttctttaat     23760
     ttattaaaag ctaaatggaa ttgatgtcgc tgagattatt cgagtttaaa tagaattgtt     23820
     acccaaatgt gtgaaagaaa ttgacgctca attatttatt gattattttt tctacttaac     23880
     agtaaactga aggtctggag atcaaactta tccatgaaaa aaatgtgacg cttttatatg     23940
     tttttcataa tcagaatcaa tctagcaaga aaatgtatgt tcagcctaga aaagagagta     24000
     ttggctgggt ttagattagc actatagacc ccacccccaa ctaaatttta ctctgccaaa     24060
     gatgcaaaca ctataatctc gagggtcata ggctgttatt tccgctagct ttgaaaaaat     24120
     tagatatgct accccacatt attttttaat aaattgttgg acattattag atttctgtcc     24180
     tgtttcgaga aatagtatta ccaatacgtt gcataattct agaaaatgaa cggtaattgt     24240
     gaaagaagat atgagattta gacagtcttc acattacttc agtcctgact tccacactct     24300
     ccaaagctaa agttaaagaa gaactacgaa agaatcttga tggatatttt gttattgaaa     24360
     acaccctggt attttcttgt gaatctatag taccgatcat agtttcccct gttggagtca     24420
     acgtgaagtc aaggtgtact tattttagaa agttgattga gcaaatctac cagacaagat     24480
     acgctcaaac aactggcgct caagcagtcg cgaatcattt agcagtgaga attctaaaac     24540
     aaatgctcgg aaaaactcct atccaacgct ggtcactgat gtcccaagaa aaatcgatct     24600
     tacttatgga gactgtcgcc gttcaatgac tattatgaac aatagtgtgt gtgatatcac     24660
     atacattatt gtccggaagg gctgtagcaa tgcatcactg tgaccatggg tagatatggt     24720
     tgcacataga tggtatccta caactaataa aatatcgata gtaagtcgat aattcgggtt     24780
     tgctggtggg gcaatacaga ctcacgatta catgttaaat tggtggggaa ctgaacctct     24840
     acgtttgtgt ggtttgtcct ttttagtagc acttcgcagt gatagtgaat gagatgtgag     24900
     agccccagta aaggttactg attcagatag acttttggta aatattaaca atcctgtctt     24960
     atgaatacat aaaaattgtt ttgtagggtc ctttttgttg ggtgtgatta tagcagaagt     25020
     ttaatctcca gtacaactaa actagtaaag aaatttgaac atcttggcca tacatagggg     25080
     gtagtacttt tgataacatg caatgttaag tgttgtcact tcgattctac caggctttct     25140
     acatatttaa gtttgactca atccataaat gcggggtatg gatatatcaa ttatgtaaac     25200
     tcatgttgta cagcggcgac acaatttggt gtagctaccg aggtggggcc gcatgaaata     25260
     gagatattga cttatgtgga aaaactcaag aataattttt aactggggaa aatagcgata     25320
     caaaggggta atattttttc cgatggattt aatattccgt agggcctatt ctgttgggtc     25380
     aagatattcc agatcagaat ctaggagatc actaccattt tttcacaaaa ttgtgccttt     25440
     tacaataccc ccaacatcat caatgagata aatgtgtgcc cagaggatcg cagtcttttg     25500
     ccaggttttt ccgagttctc ggaataatta taggcaaatg agccaaatga cgaaagaaat     25560
     cctaatccaa agcggatgat catgaaaata atgtggggaa atgatggatg tattgtctat     25620
     ttttcaaggg aggctgttta ttattgtttt tctgtgaata cacttttctg ctagttagca     25680
     atacagctct tgtgttctac actaaataaa acaaaaagta tacaacatgt aattgccaaa     25740
     gttagttcat acttagtgtt cgctatctta tgtagttggt attaggtaca tgaaataaac     25800
     atagtttggt ctaaatagaa ctagacccta gcatatccaa aattagagcg ttcgcaacta     25860
     tagtaagtag tatatccaat taaaacttca taatattctc ttagtatttt cacagtgggg     25920
     tctttctctc tgattaatct gaaattattt accccttgtt tttaaatctg tagaaccagt     25980
     atggtgttgg gacttattct agatattgtt gtagtaggaa tggtacctaa ttgcaagtat     26040
     cgatcaaaat ttgttgcaca gttaatgggc atcataataa atttgcacac cccctatggg     26100
     tactgctgta gccatattta gcgaaagcca atgaacattg aaggaacaac ctttaaagat     26160
     aatattttct cttgattgta gtagctgaac tttttggaca ttttagtcaa cgcgtaaaag     26220
     cagccatagt taatggaatt ccagctagcc cgatatgaat tggcaaacaa atgctcatga     26280
     tttcacattt agttaagcct gttatctata tggggtaaca ttcagagatc aaacgacagt     26340
     gagactacaa tatctatcct ataaagtcat agtgctattt ttctagtgta agaactgcta     26400
     catgtattct ctgatgaact tgtattttac aatttaaaga ctttcgttgt aacgtttgtc     26460
     tgataatacc aatgcaatta ttcaattgac ttttgctcag tgttgattat aactccatct     26520
     agacaagcta aattacgtga ttgttggaaa ataaaatgcg gggtatgact ccttttataa     26580
     ctgaactata tcgccgtgga ggatagaaaa gacttgttcg gaaaattaca caagtaatgg     26640
     ttgagagaga tgaatttctc cgaacaagac gttatttgtt cgtattgacc cttaacttgt     26700
     acagcattag gatactcaaa aaaaaatgac agaaataaat gtattgacac tatagttatt     26760
     tggtgtttca tacaaatatg acaacaactt acctacaact cgttatatcc aacgcgtcac     26820
     atgcactatt ttgtagactt ttgaagatgt aaatctatcg tgtgtgaatg cttgatgtgt     26880
     aaagattttc tcttgtcatt tctccacatt atcaatatat ttgtaatgtg ggaaaatata     26940
     tggccttttt acaatagcta aattttgtat atgtgtaaaa tccatgtgaa agtcaataag     27000
     ttccaaaagt ttggcaaaaa aagcatgccc ttttgaattt aaccatattt ggggtaacat     27060
     gaagatgctg ttcgaggatg tttgatagat gggctattat cgaatttgaa aaagattcgc     27120
     aaatattgta aatcaattac taggaagaaa tatctagaaa gcatgcgtgt ttcatatttt     27180
     ttataagaat atactaagtt agagcttcaa gagtgtggat gattcacaga ttcttattca     27240
     tctttccatg gtaggtgtgt atgaagtgta aatttacccc tcatatttct tggtgttaac     27300
     ttagctatag tgcctataat atttttttaa ctcgcttata ctcataaaaa ttaatcgttt     27360
     atttttgtca gtcaaaagca ttccaggcca aacgcctgtt tatagtaagt gccgccttcc     27420
     ttgaagtata taacacttct atttatttcg tgaccatatg gtgattagtt gcaagtacaa     27480
     tatttgtgat tcaattgaaa ttgttagggg tctaatctaa tatataacgt gagtgctctc     27540
     ttttaggtac tggtgccatc gatggagatc gtattccttt ttacattggt ttcaatttag     27600
     tattaaagta tctgttccaa tactgtaata tatgagtgta gcgttcgtca gagtatctta     27660
     atagagtatt tgctagttac tatcaagtga gttacgtaca ctggtccatt gtcgatggga     27720
     gtttatatag gcagagttat gcgagtcggc aggattttga tgtgatagct gatcttatgt     27780
     ctaatatgtt gaaatcgaag agtggtgtac ttgctaagtt agctttacag taaaggagaa     27840
     aatcgaaaac agcttatctc gacttattgg caagattttc atacagctaa tctcaatatt     27900
     atgaatgaga ctctatcagt ataatgcgac tgcgattatc tagcgtgcta atacaaataa     27960
     aagtctacta gagttattaa ttgattctag acattgtaaa caataagact ttttatttat     28020
     ttcttatttc tacagtctct gtcatatttg tctttttata ttcttatcag gttggagcta     28080
     ttgatactta actagattgt gttgtgttgc cgagaatact gttgtttcag ttcttgaaaa     28140
     tatatttttg aaattcaatt ttactagtgt tagagctgtt ccatcttttt taatgcgatc     28200
     tttaatgtaa attatcataa atttttagcc gatcaaaatt cagtactatg tgtgggaacg     28260
     tattatgttt atgcttcaaa gaaaaagtat ataaagctta gaaaaacagt gaaactttac     28320
     aaactttact gaaatttagt tagagcatca ttccattgta ggaagcaaat tacttgggag     28380
     atttaatcca tttcttagac gtacttcaat atttggagca ctctcaggca agaatagttc     28440
     aacttcccaa agacgcaatc cttattggtc cgtcctcatc ggaccagttt tgtaaaatgc     28500
     gaaaaatccg gactcatttc tgaacagaag ttcacggggg aaggaaagga gatgtagttt     28560
     ggataatctg aaggaatact caaagttaga agctacatta cattacactc tttcatccgt     28620
     tagatctttg caaggaagac cacttgcttc ggtccacaag ttttattagc aaaccagcca     28680
     ataggtagat tatgctttag taggaaaaga aaaacctaag cattttgcgg gaaaatcaga     28740
     agtcaatagt gctcagtttt gtatttagtg cttttttctt tcccccgtca ttcttccatt     28800
     tcaccatttt gattgcaaaa acacgtaatt ctggtggctc cttgtttaga taccagtacg     28860
     cacttccttt ttcttatcct tttttcctct cttaggagat tagctacagc aaagtataga     28920
     gcttgtgaag aaaaacaaga aagttttcta ggttgaaatg gatattgacc aatctatgac     28980
     gagtaatcta agtgagcaaa acgtactgcg aggaagttct cctgtgcttt tgttttcaaa     29040
     tcttgccaaa atgccttgaa aatgcctcga actttcatag gaagatcgta ttagcactag     29100
     tggcacactt tgcaaaggcc caatatgcta cttttccccc ctacacgttt aatgatgatc     29160
     ccgaagacag gatgaggact attattgcga atatatatat tacttaaata agagatggta     29220
     gatgctcttg agaaatcaca cttttttgca ttttctattg ttttcttttc tttatacttt     29280
     ccttcactct tgcacttgga tacttaattt ttttatcgtt ttcttattgg acatccctct     29340
     aaactgcatt taaaaaatta gtgtgttttt gttcacttgt ctatagagta accagtgttg     29400
     ttttatttct gttctttttt ataaagaagt tgttattttt attattcgag gttctaaaaa     29460
     agaataataa tacttttgag ttctacactt tagataccaa aaaaaaagaa taaagagaag     29520
     cttttcaata aacggttttt actatttccc ctttcaaatt taagaacaag cgttagtttc     29580
     catcttctat ttgactacac cgaaatactt caaactcata ttgttacagt tagctataat     29640
     tatttgctaa cttgttcata cctgttttac tgtgcctatt tttgatacta taacataaga     29700
     aaaaatgtct aaccaattac ctcaatacag ctattctgat tatgccaagt ttgctttggc     29760
     cggtgccatc ggttgtggtt ctacacactc gagtatggtg cctattgatg ttgtcaagac     29820
     tagaattcaa cttgaaccaa ctgtctataa caaaggtatg gttggttcct tccgtaagat     29880
     cattgctgaa gaaggtgctg gtgctctatt gaccggtttt ggccctactt tgttaggcta     29940
     ctccatccaa ggtgccttta aatttggtgg ttatgaagtt ttcaaaaaat tcttcattga     30000
     cactttggga tacgacaccg ctgctagata caaaaactct gtctacattg gttcagctgc     30060
     tgctgctgaa ttcttggctg atattgcttt atgtccattg gaagccacta gaatcagatt     30120
     ggtatctcaa ccaaccttcg ctaacggtct tgttggtggt ttctctagaa ttttgaaaga     30180
     ggaaggtgtt ggctcattct acagtggttt cacgccaatt cttttcaaac agattcctta     30240
     caatatcgct aagttcttgg tctttgaacg tgcctctgaa ttatacttct ccttggctcc     30300
     accaaaagac actctatctc agacatctct aactgccatt aacttgcttt ctggtttgac     30360
     tgctggtttg gcagcagcaa ttgtttccca acctgctgat actctattgt ccaaggttaa     30420
     caagaccagt aaggctccag gtcaaagcac tgtcggtcta ttgttccaat tagccaagca     30480
     gttgggtttc gtcggctcat tcgctggtct accaactcgt ttggttatgg ttggtacttt     30540
     gacttctcta caattcggta tctacggtca attaaagaaa tccttgggat gtgctccaac     30600
     cattgaaatt gctggtggtg gtcactaagt agcagaataa ggatcaaagt atttaagaaa     30660
     atccagaaac tcttgaagag atgttttttc aactcttaat gtgttttatg gagactcaac     30720
     attccacaga aaactagttt atattcgttg aacacaaaac cctaatacct tttattgcaa     30780
     tattcccgta aacatatttt aagcaagcta tgatgatgtg atggataatt ggtggttttg     30840
     ttattaatca ctagatatct tgaatagttt tcatattcaa ggaacatttt tgaaaaaagg     30900
     tgtagtgcat tgatcacata tcattttatt atcatttaga gtgcatacat ctccttaatc     30960
     ttgtatttaa agcctaaata aatttggaat agttagttta aaatattatt ctactcattt     31020
     ttttttgttc tataaaaaaa ttataataat agatagtgaa agaacatagt gtctagaagt     31080
     gctcaataga actcgtaaat tactgaaaca gtctcattgg caaagagctt tgatgaatga     31140
     ttctggttca gaagttctca tcaacgcttc gcccaccaag aatccacgaa cgccttcctc     31200
     cttatactta tcagcatcag aaggactggt gataccagac aacgcaatta gcattgtttc     31260
     agcgggtaca ctattaatca gtgagcttgt ggtatttaaa tcgacattaa aagagtgtaa     31320
     gtctctattg tttacaccaa taacttttgc atccaagctc aatgcttttt ctaattcctt     31380
     ctcgcaatta acttccacta acggttccat acccaatgtt tttgagtaat tgtatagtct     31440
     tttcaattct tcctcaccta gcattttcac gattaaaaga acagtatcgg cgccggctaa     31500
     tctagcctct agtatttggt actctgaaaa tatgaactct tttctcagta ggcatggtct     31560
     gtcttcaggg tgggttttaa attcaatgtc aagagctcta cgaatgttaa ttagatcttg     31620
     tagagagcct ttaaaccagt gtggttctgt aaggactgag atcgcagaag cacctgctct     31680
     agcgtatctt aatccttgtt cagttgcaag ggcatctatg catatatcac cctttgaagg     31740
     agatgcacgc tttatttcgg atagcaccac agctctttgt ttagcggact ttatcttgga     31800
     ataaaaatca atttggcttg gtgctagacc caatttgtag ttgaactcca tgtctctcat     31860
     agtgaaccct ggaactttgc tttgagaagc tatgtcagat ttacgtttgg catatatctt     31920
     atccaagata ctctcttggt tattgccagt tgaggtgttt ttttcgttgg cttcgtattc     31980
     atcccaagta ccacctgtaa cttttagaat attttgaatc atcaaatgac cttcttcggt     32040
     taggatagac tctggatgga actgtacacc ttctatagta tacttcttat gtcttacacc     32100
     catgataata ccctgttcag ttcttgctgt gacttctaag acatctggca acgattcagg     32160
     agtaccagcc aatgaatggt atctggttac tgccacacct tgaggaacat ttttgaagaa     32220
     gcctttatta tcgtggaata ttggggatgt cttaccatgg acaatttcac cagcataggc     32280
     gacctcaccg ccaaaaactt caaacataca ttgctggccc atacagacac caaagatagg     32340
     tagtttacca gcaaattgtc taatagcatc tcgagagata ccagaatcag tagatggatg     32400
     accgggtcca ggagaaataa ctagaacatc tggttttaac gccacaacct catcgacagt     32460
     aactttatca ttacggaaaa cttggacatc tgcaccttcc tggcacagat actcgtagat     32520
     attccaagtg aaggagtcat aattatcgat caatacaact cttttcatct ctaggtaatt     32580
     ttttaaacgt atagtttttt ttttggtttt gccgtcaatc acccaatgtt tgctgtatta     32640
     cggctaatat aacaattaac ttaaaagaga ctgactactc ctgaaatgct atacttactt     32700
     gaaatctggt agtttcaata tttgattgcc acagatcaag ccattatata atacttaaaa     32760
     aaaaataggc tggccctatt gattgactca cacagttgat gaccaaactg aaatttttca     32820
     ggtgaaaact tggatagctt ctatgaaaca gtcgcacaaa tcccatctca tacatgttga     32880
     aaaaaaatat tcagaaaatc tgttcatcaa gctcatcgca ttgaactgaa gctcacaaat     32940
     ttgatagtac ctaatatgac cttattattg tcactaattc taaggtacac tgtagatgtt     33000
     acattttgcg catctggcgt tctgtaaact gcttaccggt atcgagaacc ttggtcaatt     33060
     tcacttgtgc gagaaaatac atttttgtaa ctttgttgtt catataggtt tgtctgcatg     33120
     tataaaatgc attcattttt ttactcatca tattgagctt aagagtcgaa ataatttaga     33180
     acaagggtta tgtaaatttt gccctccttg atatattgta aaatcgaata tagcagctag     33240
     aattttgttt acttattctg ggatttaatt acaaattaaa gaatgcagaa gcaacgctta     33300
     gcaataatac gattttataa atttttagca agcaggttag gttttagaag tagggaagct     33360
     agagtattac gcttataata aggtggaata catctatcta tgtattaaaa tagcacaatg     33420
     attatccaac ttaatatgga aattttataa atagagatta tggcttatac acaaatattg     33480
     tcgtacaatc tgattccctc gtcccaaaga ttttgttgct gatctgttcg atattttgtg     33540
     aagaccaaaa gcctaggcta gtggactatc agttaggcaa gcaagagtag caaacatagt     33600
     taagtctcac agagggcaga caaattacaa accgtgagct ctaactagtt ggtacttcac     33660
     atatatacat atctttctcg ctgattgtta ggctttctga tccttcatca atattgcgaa     33720
     cgcaaagaaa aaggacgtgt tgttttttgt aagatcaatt tacaaatcag ctcttctata     33780
     ataggttaat tgaggagaag tggtataacc aacatcataa ggtaagaata tgtctggtat     33840
     tattgatgct tcatctaccc ttaggaagcg taagcattta aaaagaggta ttagcttcac     33900
     gttgatgata gtaggccaat caggatgtgg tagatcaact tttatcaaca cattgtgtgg     33960
     tcaacaagtc gttgacgttt caacaacagt tatgttgcca actgatactt ctacagaaat     34020
     tgaactgcaa ttaagagagg agactgtaga actagaagat gatgaaggtg tgaaaattca     34080
     gcttaatatc gttgatacac ccggttttgg tgattcctta gacaatagga agtcatttga     34140
     tattatttct gattatattc gtcaccaata cgatgaaata ttgttggaag agagtagagt     34200
     tcgtagaaat ccgagattca aagatggtag agcacattgt tgtctgtata tgattgtgcc     34260
     tactggccat ggtttaaaag agatggatat tgagtttatg agacaattag gtacattggt     34320
     taatattatc cctgtgatta gtaaagccga ttctttgacc caagaagagc taaaattgaa     34380
     taaaaaatta ataatggagg atattgatcg tcataatcta ccaatttata acttcccatt     34440
     tgatgaggaa gatataagcg aggaagatta tgaaacaaac acgtatctgc gctcgttact     34500
     tcctttctct gttatcggtt ctaatgaggt tttcgatgtc ggtaactcta caatgattag     34560
     aggtagaaaa tatccatggg gtatgctaga cgtggaagac accagcattt ctgactttgt     34620
     tgtactaaga aatgctttgt taatctcaca tttacatgac ttaaaggact atacacatga     34680
     agtgttatac gaaagataca gaacagaagc actatcaggg gaaactagtt tcaattttag     34740
     aaatgatatt ccaccgcaat cacttccaag aggtgatgta tcacatttac ctcatggatc     34800
     gcaatcgcct atgccacctt cttcgcaaag tatcactgga caagatgcat cctccagcga     34860
     cacatacact gcacgtgaag aacaaatacg actagaggaa gaaagactaa aggcatttga     34920
     agaaagagtt caacaagaac taatattaaa gagaaaggaa ttgcttcaaa gagagcaaga     34980
     acttagagaa attgaggagc gtctagaaag ggaagcaaaa caaaagcaag aacaggcata     35040
     ctaaataggt gtaaatttat tcagaactcc ttgatgcttt tcaatggagt attattacta     35100
     ttataaatta taattacttg aataaatata agtgatgttt acttgttgag ataggatttg     35160
     actatttcat tattattttt aaatttgtgt tattttattt attttcctaa ccatatgaaa     35220
     ccaaaacata aaattgaatg tcaagtaata aaccacacaa agacaatata aaaaagacca     35280
     aaataattat gtaaacttca aggataatca gtgaaatatt aacgctattt acctatatag     35340
     tgtaatttat gatgctactt ttggtgctgc tttccagaac ttttctcctt tgtgagagat     35400
     aaaaaattga gctcttagag ggtcttcttt gtcaaagttt tccggaacat tgaatgaaaa     35460
     ctcaggaaaa actaaaatat cactaaccaa tttaggacta gtaatcttcg taaagtccct     35520
     ccaagtgact ttcctatcta aaccactctt aatgaaatca tttaaatatg tcattattgc     35580
     atcggtaaac agagcagaac cggtgaattt cattacactc aaatcatttc tgacattaac     35640
     tgtgcttaaa tcatctttgt tgtttaaaac atgctccact atttgtgcga caacctctct     35700
     cagtactggg tgaccaggtt tagcttgtat aacccatgta ccgaattgta atctcctcac     35760
     ataatgactt ctccaatcga ctgcttgcgc atcatgttca attccgacag ttaaaccaat     35820
     atcacttggt tcaacagttt ccggaatcca gtttggaatc ggctgtaatg ggctagtatc     35880
     aatatcagca taagtacctc ctcttgctaa caaaaccaga tacttgaaga aatcgattct     35940
     taagatatta tcaggcaata gtttatatgc ttcgactacc tccggcacaa ttgaataata     36000
     gtgatgaacc agagcattca tcatttctgg ggttaaaatt tcgtggacaa atccaggatt     36060
     tttttcttgc caagtagctt tgacgtgcag gacttcttca ggtgtttgtg atccagacca     36120
     ggtttgccag aggaacgccg gaaatctgct cttaccatcg tattcaaaat tatatgccaa     36180
     tttctcacgc aatgttgcat cggtcgaaat ttgtttcatg tttctcaatt ttctctcaag     36240
     gactttcctt tgtctctcaa actgtttgct ttgttcttct tgttttagtt ttatatcctc     36300
     tgctagtttt gcaaacttag ccattacatc agcatcggcc ttctgattag agtttgcaac     36360
     atttatactt tgagttatct cttttggtaa gttttgcaat atcttttgaa tatcagatgc     36420
     tctcgcattg gatgatagtt ttaaaagcaa tgcaataccg gctaaaccag ctatgagaaa     36480
     gaagaaaatt ctcaaaatct taaaattaga cctcttacgt gccattgtca tatatctgca     36540
     atgagcaaca attctatgtg cttcaaatgc aggaattaac ctattcgaaa tatgaactta     36600
     aattgaaagt caagtttaga atatgatccc tataaccgat gtagatgtct agcacagtgt     36660
     caaaaagatc acatcactga gctaatatta gaattatact ttgttattgt tctcaaagta     36720
     gagtgtatac aaatttttga tcaagttgtt ttatcactat acactaatgg ccctatatat     36780
     aactattgat tgcgatgagt agaaatattc atatatcgta ttaataagag aaacaaacgg     36840
     tgactatcat caaaacatac agtattgatt cgtgcaaata caaggattat tgactattca     36900
     ttttagttaa atccatgaat caggcgaaca atgacttgtc taaaactttg aattccttta     36960
     caatattctt taggacatcg taacttgctg taagtctctt gacctcttcg gttttgctta     37020
     agagctctac ctcttcagct tttaaaggta catttattga tattaacgca tctgtttcaa     37080
     catccttcat tcgttttaat gcaagacaga ttgccaacgt ttctctcata tcctgtttac     37140
     cccatttgtg cacagattca gttaatatgc aagtaatggt accatctggc tgagtttctt     37200
     tctttacagt atcccaggca tctccaccat tcaatgatgt cacatcttca atatgcacat     37260
     tcaaggcttc atcatcagaa ggagcctcca ccatttgtaa taagtcaata attatacttt     37320
     cgttttctgc taggccatcc tctgcatgag cacattcctg tggagtgcga ctattaacaa     37380
     atacctcctg agtatccggc acttccctta gcattgatac atccatgaac cctaaaggca     37440
     aaacggtagt aattgcacca ccataaagtt gggttgtaca ggtagacatt tctgtaattt     37500
     tgctttagaa ttataagtga aatctataat cgatgcctta ttggttagtt tctgcctatt     37560
     gtaaatcaac aattggagtt tcttctatga caggccaagt aactcatcgc tcttcattat     37620
     gtaaattcgg cgataccact ctgatcacac accacgcgat ttcattggga aaatgatgcg     37680
     agcgcgatga ggatggcatc tcaatatata gtacacacac gtaattctta taaatattgg     37740
     ccatacacta gttgaaactt attcttatat acttggaaaa gtacaataga aaaatagaac     37800
     tgtagtttat ttagaaatga gctctgttta cttggttcca gccaagattg aacttgtggg     37860
     aaacgctggt gttccggaag agatcaaatt tgaagaagtg gctcaacttc gaggtaagga     37920
     gctgcatggt gaggacttaa ttcaacatct agatggctat catggccaat tagtcaaaga     37980
     tggtaaaatc gaagaattat ctagtgtagt tgattttgaa agggaagaag agatattcaa     38040
     gcaggaactt aacgcgttta aagaaacagc agacatactt agtgcactac acaactaaag     38100
     caaaaaactg actacaatgt tacaagtaga taccatagaa aacaaacaat gtttaactgc     38160
     aaaaaagagt gtaaggtcta agcctaaatc atatggtcaa ggttgcacaa tgactaaaaa     38220
     tctcactgcg atcaccaaat tcacatgcat acaggtttgt ttgaatccac ctagtatatc     38280
     taacatctct gaattctaga tgaagtataa tgaattctga aagatatccc aattgatgtc     38340
     aactacaaca gactatcaca gtttgctggt ttcacgaagc attgaacctg cacacggctc     38400
     tgcgggttgc cgtgtggcat gtgaaatatt tcaatgccaa aggggacttg gttgactcgg     38460
     gaataagtaa tctaaagtat atataagtga agcaccaacc tatttactaa attgtggtat     38520
     atgtcaaaac ggcctaccat taatattact gactcaattg atagtgattt aatactaggc     38580
     aaggtaagat gtttggtgct gactttgtag aggataaagt tatccagttt gagaatttcg     38640
     ttgaagggct aatgtactct gtggattacg atgctccata cttctactct gcgttacttt     38700
     tcattatatt taacccattg ttttggaata tagtggcaag gctggaatac cacacacatt     38760
     tcctaaccaa gattgctggt tcgccaaaga gaggctgtta tttccttgca gccaccatat     38820
     tttctctagg tattgctaga gatttgacat ttgaaaaggc attgagacat caagaagtct     38880
     ccccattgtt agacacccca aaaatcacaa atatcgggta cgcgttttta attgtgggcc     38940
     aaatactagt gatttcctca atgtaccagt tgggtatcac gggtacttac ttgggtgact     39000
     atttcggtat tttaatgaat gacagagtaa cagcttttcc atttaatgtt tccaataacc     39060
     caatgtacca aggttctaca ttttctttca tcggtacttc gctaattgct ggtaaaccag     39120
     caggattgat tttggcattc tttgtacatg ccatgtacta catggctcta aagtttgagg     39180
     aaccatttac agctgaaatc tatgcaaagc gtgatgagga gaaaaagtct aagaaacaat     39240
     aattagtttg acctgtatag ctatctaact actattccat atacatcatt tcccaatcca     39300
     taccagaaaa ctttttagac actgttggta gtcggttcat cactaacaat aacttttgta     39360
     ttataatgtt tatgtattaa tgttggtaac cataaaattg aacatgagct attggattaa     39420
     aaaaaatgtt agcatcttca ggactgaaga gtgcccacaa ttggataaac agaatgcctc     39480
     ctgtgggaat tgaacccacg atccccgcat tacgagtgcg atgccttacc acttggccaa     39540
     agaggcaatt atgattagtt acttactacg tgaaataaca cctgctttgt acaatgcaag     39600
     aaaaatagtg acatacaact acacgatgaa atcacatgct cgatgcctac cctcttccca     39660
     gaatcacatt gttctaaatc tcctcaatta tagctgtaaa tgcgatgaag ataggcaaaa     39720
     gagttcattc gatcgaccaa ttgacttagt caaacgagat agcatagcag gttttaccaa     39780
     tagcagtaaa atacataatg aagtggcatt ttaccgacta tctaaaaagt cctgcaaata     39840
     ggttatgcat aagccaatat ttcacagcac aactgcatag caccatttag tgaaatcaag     39900
     caaaatatga ccaaaaccaa taaaaagagt actaactcaa cttattataa tgtagtgaat     39960
     aaggtcagaa acaaatgttc cagttttcaa ccataaactt tcccaagaaa atttttttat     40020
     ttattcctca aaccttttat atttctgcaa aactaaaatt cttgatctga ctacgtaatg     40080
     ccttcatgag aaaaaagaaa gaaggtcatt gcgtccaaac agaagagttc ctttgacgga     40140
     aaaattagag ctatcagcca ttcgatgaga tggccatatc accctatagg acagagagag     40200
     gtcagagtaa tgagacggtt cgaaaaaatc gttttaccat gaaaaaaaac caggagccat     40260
     gcgtagatta tcgtacaata ttaatctgac attgtagcaa tgagaaaagt ggctaaataa     40320
     cagtaatatt cagtagcaca gctcatcact tttcaatata cttagctggg aggctatgtc     40380
     atcttaaaaa actacgctga aaaaccttta gtactttcta tacttctcta caggtaaaaa     40440
     aaaactggaa ttggaacaca acccattgaa aaatgaaagt gagcatccac cattcctgga     40500
     attgtacacc aaaataggaa aattttgtta caacaagtac actgatctcc aaccactaca     40560
     gcatcgtata acgaatttac ttacgcaatt aattatttac caccccccac tccatacaat     40620
     agcaataacc tgcgattact tggcgtacaa aacttaacaa ttctgtagca tgtttacttt     40680
     ataactatgt taaaatatga ctaggaagag aacaatggga acgtctattt caggatcata     40740
     tggttcgaag tacttatacg atcgcttctg ctctagatta gtagtgccca ttctccgcat     40800
     aaaaaatcat tcattgtact ctataaactt catgtagcgt tgtattagtc cgcttcaact     40860
     cgtaccttag ttcttcctga tctagtaagt gagggtccaa aaaaatattc ctacccgctt     40920
     tcgcattgtt tgacagtata tatacgcata tttctaaaaa gaaagaagct atacagattt     40980
     gtaattatgc tctgttattt attcacagct gtgttatagt attgctatgc ttaccaagtg     41040
     cacatttgct ctgtggagtt catttttata ttattcctcc cacccccaag aactgcaaag     41100
     tatagtactg attagcaagc catctatgaa aaactagtac ccatgaaata tcatttaatg     41160
     tgttcgtttg tatcctgctc tatagtctaa attcgctata ttatcttttt caactttctc     41220
     tctcaaaaaa aagcaacgaa agtagttttt atgcctccca atgcggcact ttctgtggag     41280
     atgggcacag tcctgatgaa gaaatttgaa attctagctc atcgcaaaat ttttttttca     41340
     ttgtataata cacatggata gtggtgacat ggcaagtagt ccagttagtt gtgatatata     41400
     atctctatct atttcaccat tgatgacctg cctaactgtt tgtagtttat tgatttgaag     41460
     ttatcattag cattttttta ataattctga attctttctg tatagaaaag agcataattt     41520
     atataaccat aacgagaaat gtctaccaat tttgaaaagc actttgaaga aaacgtcgat     41580
     gactgtaact tggagcaact aagagacatc ttggttaaca aggaaggtaa gagtgctctt     41640
     gccaacagat ttagagctct gttcaacttg aagactgctg cttccgaatt tgaagccaac     41700
     ccatctgatg ctgaaaaggc agtgcaatac atgggtgaga ctttcggtga caacagtgaa     41760
     ttgttgaagc atgaagttgc ttacgtcttg ggtcaaacca agaacctaaa ggctgctcca     41820
     ctacttagaa agactatgtt ggatctagct caacaaccaa tggtcagaca tgaagcagct     41880
     gaagctttgg gtgccctagg tgacaaagat tctttagaag accttgaaaa atgtctgaag     41940
     aacgatcctc atgttgctgt tagagaaact tgtgagttgg ctattgctag aatcaactgg     42000
     caacacagtg atgctccaac caaggaaagc ctacaacagt ctctatattc cagtattgac     42060
     ccagctcctc ctctagctct agagaaggag tacgacttgg aagaactaaa gaagctcctg     42120
     aacgaccaag aaaaacctct attcttgaga tacagagcta tgttcagatt gagagatatc     42180
     ggcactgacg aggccgttct agcgttggcc agtggtttca atgacccatc tgctctattc     42240
     aagcacgaaa ttgcttacgt ttttggccaa atgggttcta ccgccgccgt cccatctttg     42300
     actgaagttt tgggccgtaa agaagaggcc ccaatggtta gacacgaagc cgctgaagct     42360
     ttgggtgcca ttgcttctga agacgctctt cctatcttaa agcaatattt gaatgatgaa     42420
     gtcgatgttg tcagagagtc tgctattgtt gctttggata tgtgggaata cgaaaacagc     42480
     aacgagttgg aatatgctcc agcctaattc aacactccct cacactttta atgcttcccc     42540
     tttcattttc ttaaacaaag acgtttctat tgaatggttt aattaatacc attccaaata     42600
     ctcaatttaa ttttcaaatg ctggttcacc tatttctgaa tcaattattt atttcatttc     42660
     atacttgtat gttttcttat gtatagcttt tgatagaata atcatgaaaa cagatagccg     42720
     ttgttaatat actaagcact ttcattggtc attagggaga tatctcttta tcttcgtgct     42780
     tgaatattat aaggattaag tctggtcatt ctaatcttta agcttgcatc agctataacc     42840
     tgataatgca gtcatataca gttattaacc tatcagtcac gtgatgcttt tttttattat     42900
     ctaaaaatga aaaatttgaa acaatttgcg atgatccgcc catcacatat gcaaaactca     42960
     gagctgcttt tatttatttc aatcgcttac cagacactat tattagtcaa tagaatttag     43020
     ataggatttc acaaacaaac tcaaaaaaca ttcaaagcag agaaaatggc gccaactgaa     43080
     atcacttttg tcactggcaa tgccaacaaa ttgaaagagg tacagatgct gctagcagct     43140
     gaagacaaaa aaggctccat caccttaaag aatgagccac ttgatttgga tgaactgcaa     43200
     gatgttgact taaaggcaat tgcactaaca aaatgtaaac aagctgtcaa agaactaggt     43260
     gtcggtaccc cagtatttgt ggaagacact gcactcactt ttgatgagtt caatggccta     43320
     cctggtgcct acatcaaatg gtttttgaag agcatgtcgc ttgagaaaat agtaaagtta     43380
     ctagaaccat attccaacaa aggtgcagag gcaatcacaa ccattgccta ctgtgacgaa     43440
     aatggtgaat atcatatttt ccagggaatc accaaaggta agatcgtcga cagccgtggc     43500
     ccaacgaatt ttggctggga ttccatattt gaacctctag aaggtaaggg tatgacatac     43560
     gctgaaatgg agaaagattt caagaacaca ttgtctcaca gaggcaaggc ctttgtcgag     43620
     tttaagaagt tcttatatgc ttaataattc gaactgattc ataactcgaa aatcattcat     43680
     tatataccat gcatttatag gatacacaag tcaaatatga tttatatgtt ttgcaggaca     43740
     atttgtaggt catacctgag atatttttat cagcatattc aggagttgga tgtgctcatt     43800
     tgtaccattt gttaacttgg agtcagtatc gaataagata atcgatactt tatttttgaa     43860
     ggcggtatca tattcagagc ttttgatata ataatcatgt agttgtgata cgactgatgc     43920
     tgctgaccac ccattcctcg taaattcttg tatatattca ctgatcttat tgaaatccct     43980
     tgtagcaacc aactctacaa tctgttttat tgaggattcc ggtacaaccg ctgcgagttc     44040
     ttcgacaagt tctttggata cttcatcttc tccagaataa ccaatatttt tggaagctga     44100
     ttgtaagagt gttatcgctc tacgtaaatc acctgctgat atatccagaa tggtctcgag     44160
     ggaacctgct ttaaccttta caccttcttc ttctgcaaca tatttcaatc tctgcaatgc     44220
     atttgaagaa tctaaagatt tgaatctgaa tttggaacat cttgaagcta gaggatcaat     44280
     aattctggtg acataattac agatcaaaca gaatcttgtg actgtggagt aagtttccat     44340
     ggttctacgc aaagcactct gtgcgtctgc tgtcattgaa tcagcttcat caagaataat     44400
     aatcttatat ggtggacaaa gatagttttc taggtcatgt ttcgatggtt tagagactgt     44460
     cagacgcgca aagtttttca ctttttctct aacaatcgat atacctcttt catcagaggc     44520
     atttagttct agcacccttg ttttcatgag ttccggccca aataattctt tggttagagc     44580
     caaaatagtt gatgtcttac cagtaccagg tggtccatag aataacatat gtggtaaatt     44640
     agctgagctt aacgttttct tcaacacatt aacaacatga tcctgagcgg caacatcatc     44700
     caatttcttt ggtctatact tctcaaccca tggcttatta tgctcagctt cagcagcaga     44760
     ctcagtattg atcttccttc tcttattttg tccaaatcct tcaaacattt ttgaattgct     44820
     tttgagtaac aaaaactatt tgccaatttc tttttatcta agtattatgt tcgagaacaa     44880
     tcaattgttt tggattgagt aaaaaaaaac caaagtgaat tctttattat tcctgggtct     44940
     ggtttcctat ttgttgccta gcactatata gttactattt tggtgttgtc gagaagttag     45000
     ttcaccgcag tgattgaaat tatgaaaaat tccatttttc ataatttcaa gtgacgtaga     45060
     gctcatcgca aaaatgcata taaaagcatt aacccaagta agcaatgttt gatgacaaat     45120
     acatgatacg ctaagccgat tattaagtaa gtggagcaag ttgatcttag gaacttttta     45180
     ttgattgagt gactgtttta gagatggctg atttattgga tgatgtatgg ggatccggtg     45240
     atgatctaga tgagtctacg agagaactga gtcccgattt actgaaactt aaagataacc     45300
     atagcaaacg ggggtatctg gatggcattg ttagcgcaaa ggaggaaaat ttacaagatg     45360
     gtttcgacat gtctttccct ttgggtgccg aattaggttt gcgtgtcgga aaaataatag     45420
     ggcgattgca aggtttagaa tacagatatg gcaaagatga tgaagagcta aagaaagatt     45480
     tcaataatgc aaagcaagaa ctgcaaataa aaaatattct tactaagcgc atttttacgg     45540
     aggattataa tttggaagac agcaaacatc cagtcgtctc taaatgggaa gaaatcgtca     45600
     ctaaatattg tgaaaagtac aatgttaaga cggaatagat ctcgatgaat aaagacctgc     45660
     tataatttca ctacctaaag caatatgcta taatgaacgt gagctataag tttgaagact     45720
     gtataattaa agctaaaata tgaagaaaaa gttatcaaat atctttgaaa ctctacggta     45780
     tatgaaatga tacttcatat tgtgattacc aaaatggaca ccaaccgata taatgttgac     45840
     ataaattttc cacagaagta gcttgctgga ttaacttatc aacttgttca ttaattccga     45900
     ggtccttaca ccttttaaaa tcgttaccag ttaacttgtt gatgattctc cgaagaacca     45960
     acaatgctct agcattcttg atctccgctt gctgctcttt ttccatttta ttagcttgct     46020
     ctaaagtaat tgctcctcta cgtagcaatt cgttggtgtt acttaattgc aactgaatgc     46080
     cagtcatttc tgttattttc tgcggtggta aatcaaagcc ccaatggatt aatggatcaa     46140
     atgcaaatgc ttctaacatg gccattaaag attctttgtt tgccctcaaa actctcatta     46200
     cgtgctcaca agttattctg aagcttcctt ctatgccgct aacctccatt gcgaatgtaa     46260
     gcattctagt caatctgaat ggtactttct ctgggaattt ctccctaagt atagcagctt     46320
     caaaacaatc accgaagtcg atatgaatta ccttacctgt tgttctgtct aacattaaat     46380
     tacttgggtg acgatcacct agaccaagaa tataaccaac catagacata acagctagtg     46440
     atcttgtgta tgttgttctt ctatccagcc atgcctctga tgatctactt ttcagccaca     46500
     aaattttata caggtcttga ccttttgtac tatctaaagc ataagtaaat acttcaatct     46560
     tttgaagcag agtaagattg tcaaagtctg gtgccatctg caacataacc caatgctcaa     46620
     tgttgagagg aattttcttt gcatcacggt gttcgctaat aagtacatga aaagtgtcac     46680
     tgttaggaac ccagcccaat aaaccagatt taggagataa tggaatagct ggatattgct     46740
     gtatgtccaa atgtctttgg aaacattcag aatcatttct taggagggta tttaccaatc     46800
     caaataactg cattactaag ttgtcttgtc gaatatcctc gtgacctttt aagacatact     46860
     ggtattcaac accgtcacta ccatgaatcc atatctttct aggtctctgt tttgacgata     46920
     tgactgttaa tgtcggttca aaataagata tcttgatcac attcttagtg gctgagtatg     46980
     ttccagggac agctaattcc aaatcatgtg ctgctaatag ttttggagaa acgtattgaa     47040
     gttccaatga ttgcaattgt ggcaattgcc tgctaatcct tctaaagacg ttataatata     47100
     tatcccaagc ttgatttaag ttgcttacat cttttgtgcg cttgtagttg agaacccact     47160
     cataagcatc atttagatct ctgccgaagg atttcttaaa tgtggcctct cgtaaagtct     47220
     cgggttcgca gttcagtaac tcatgaagag gttctaacgt tgcaaacatt ttttcggtat     47280
     tatgctctcc gaaaaattgt ctacttgcat cctccagtcc ttcataccat aattcgtgcc     47340
     atagaacagc caacctgatc agttcatgac ttactaactc cgcttggtca actaagatag     47400
     gactatgtat cctcatcttc tcaattatgg acaaagcagc tttctgcctc gaaacagact     47460
     cggatttaat tgcaacagtt aaaggataaa ttagtgcttg tggatgcgct ttccccaaat     47520
     cagaaagaag tgaaagcaac gctttactca caacaggatt aggttgatgt attctagata     47580
     tcaattgtgg taggacttct aaccaattgt caattttaat cataccaaat ccatcatgca     47640
     tcgctttatt agcttcttct actccaccga aggtgaacca taatgtcaga agacgtaaat     47700
     tatcttgaag tgaacttgcc ttaaggaggg atattgaatg aaagaaacct ttgatagcag     47760
     gaacaacgtg acgctgtata atttcagggg agaacttact ttcatcgtta ctaaaataat     47820
     ctgttcccat tatactattt tcgatcctcc aatccccatt aacttgagcg ccgttcgtgt     47880
     cctcattttt attttttgac gttagcatac taataacctc aaaattggct aaagcccagt     47940
     tgtgccatgc cttataccaa ttcttatcaa agtgtgttgc taataagtaa gaacccaaaa     48000
     tcgcatcagg attttgcact ctccaattgg gttgtattgc aactctccat tctccctgtt     48060
     tcaaaaagca ccttgctagc aattttgtgt atgtctcaat gtgctgcgga gcaaccgtcg     48120
     cattttgcgg tacgctctgc gctatcatat tactagggtc caaacccaaa tcatgagcca     48180
     ttcttgaagt gaatccgatt aaatgatgca agacctcttc atgggaagat gtcgcccaca     48240
     gatattttaa ttgagcgtaa actactggtg gtggtgcctt cgcagtattt ggttgatttg     48300
     gatcactacc atcctctagt aatgagtaaa gagctttttg agccaaactc attctgccag     48360
     acttacgaca taaattagca aactttatcc aaatatgcat atcctgtttt ggcttaacga     48420
     ccaaagagcg cactcgtaga attctttgcc aaatgtcaac atttttctga caacccagta     48480
     gacgttgatc ccataaattg cggtaatgtg ttctttttgc cgagttatga gatgccttct     48540
     tatagtcaat tatttcttcg agttcagcta tgatttgcgt acgaacaaca acaccataag     48600
     ctctagtata actttcatta attagtgctg atatttctgt aaccaataag tcgcgagcag     48660
     caaatatatg tttctcagcc tcatcaaatc tgtttctgtg taaacacaga actgcatcaa     48720
     agaattcctt atcaggcgaa ttttctttca ttacgctaat atacttttca atctcatccc     48780
     attcacctaa accccaagcc gccccagcag ctagaggtgc aattttcttt cgtacttgca     48840
     aattagatgt cttccatttg ttttctgcca gttgagacaa ggtttcatat tcacccaaag     48900
     catgtaatga cctcattcta cctacagtaa cttcaattga gttatctcct gcttccgccc     48960
     ttttggtata agagtctagt gcatcatccc atctttggag cttttcatac catgtttcct     49020
     tcaactgata agaatgatgt tgctgtgcat gttttagaat acctatagct gcatcagttt     49080
     gatgtaattg attgttaata ctaatcaagg actcaatcgt agagcttacc ggctccttta     49140
     taaattttac ttctttataa tgtagtgctt tagcatacgc gtgacatctt tcagcatatt     49200
     gtcctaaagt gtttattggg attggcaacg gtttatcatc atgttccatg aattctatta     49260
     agttcaataa aacttgatgt atttctgggg ggttttgtgg tgatgataat gcactacata     49320
     gagatccgat caaactttct tggtattgag tgtataattc agaccaaagg ctggagaaag     49380
     aggcattgaa tagttccctt gctagagggt gataaatgct tgccaaatta gcacatgtgc     49440
     gtagcgctgg agatggtgac tcctttaaga actggataga taaacgcctt atccaatctt     49500
     gccagtcttc tttggttcta agctgagaac agtcccaaac agatttcaaa ccattttggt     49560
     ttatcggaag ttttttatca gtagtttcag ctatattaga caaggataat tgtttctgct     49620
     cagtatcatc ttccaatatg atagtattcg gaagagcctc tccattaagt aattttgtaa     49680
     ccaaatcatc atatatggcg tgctttatag agcaatcaac taaaattcta ttgactactg     49740
     ggacaaatat gatatagttt cttttcaaac gtagtaacaa caaagatagt gtattcagag     49800
     tcacttccct aagttcgtca tcattaacat acaataccct tgccaatgag tgaactattc     49860
     gtgacgccat ctctgataaa ttaatacatt ttgaaagttt accaaccgtt atgatggcag     49920
     cctttctaag atggccggta gaaaattcag taagttttaa tattgatggt aatatagtat     49980
     gagcatacaa ctctagattt gtgtcaaata tcacaaaaga ctgaagaact ctaattgagt     50040
     tttctcttcc agctgaacga tctttttcta gaactcctaa caataaattt aaagttaaag     50100
     ggataaatct tttaaactca ccttttagtg cataacatag agaatttata acagataata     50160
     ttgtgacctg taagttctca aatcgaaaaa actcaataat tgcatcatat atttcgtcaa     50220
     cataaggccg tatatgttgt ttcattataa ctgtcaattg acatagctgt tggaaataaa     50280
     aatccaaaag attactggga cacatatgca tgactgaaat tatcccaggt ataatcttgt     50340
     caaggaatga aatacatttc aatcccataa tttggaatat ctgcattatg gcctgcactg     50400
     cagatgtatg ataggatgat aatgacggat ccttcagaat tttcatgagg gaaacaatca     50460
     cgactgtggg ataatagtca tcattagatg gagaattacc ttgcattaat aatgccacat     50520
     caattggagg ttgattctgt tctactgcaa gctttgtttt taggttaact tcaacatctc     50580
     tttgtttgtg tgggtcaagc gcacctaaaa taccgattaa tctaacagtt tcccttctaa     50640
     tattttgtgc actttctgcc cttaagatac caattaacac acttaacaga tcaggatagt     50700
     ctaaaaatgg acgtataaca tatcctgaag aggctgccaa ttgtcccaat gatttcaatg     50760
     ctgcatctct tttgaaggag tttgattgat cctggagtgt ttttatcatc aacggaaata     50820
     gtgtcgagtt attctgcttc atatcttcac ccccaaccac cgctagtgca ccaattgctt     50880
     taagtgcaat ggatgctacg gttgaggagt tgtcatctaa ctttggtaat aaaacgttta     50940
     aaatgggctc aatataaggt ttcgtaacat ttttgcttga ttggattaaa gtacatagca     51000
     atgtggctgc ctcatctttt ctagttgaaa aatttggata cttcaattca gtaataagag     51060
     acaataagta gtttcttaag gaaggaataa catatgcagg attaaccgtg actagtctac     51120
     caattatttt catagcctca atttggatag caatcagttc gtcatttaga gctgtgaaca     51180
     gcagctgaag attctctggt tttgccaaat gtgagtcaaa tggggatgag agatgtttta     51240
     atatttctag tctaatttca ggattcaagt cagtcaccgc aactgttaac aatttctcta     51300
     gtacttcaga tacagtattc aaagaattga gagaagtttc tttacatatg ctatcattaa     51360
     taaaaatttc acaacttgtt aaagcagcta gttttcgcac aagttggttt tcatgttcga     51420
     tatagtatat tatcacattc ttaacaaact cagttaatac taccttaaat ttagtttcgc     51480
     ggaatatctt caaagtctgt atcagaattt gagcgtcatt taggtcatca tttgctattc     51540
     cgatttgatg ataaacgttt tgatttctcc atactcttgc cgcatttggt gaaaacggtt     51600
     taccttttat gggcgtgcca ggttctataa aatgatcacc agaaagatgg atacataaca     51660
     gatctagcaa ttccttatca atatgctttg catagtcagg tgtgttagca ctcaaaatag     51720
     aaagtgtttt ttgcatatga tctgataaag gacattctag aattaatttt aatagaccgc     51780
     cctccaaata tttttgtaga tcttctctga tagcagaaga tagttttcca atacaataga     51840
     atacaccctc ctcgtaatct tttcttgtcc tgtaccttgt tctcaggctt tccttcaatg     51900
     taattaatgt aggttctaaa aattcaaaca tcatttcacc aacattatca gcaatatcac     51960
     caatagagat aaagatatgc gatctttctt tgttagaaat gttgtaagtt gtaatatttt     52020
     gaagtaaatc taggaaatgg ttcatgacct tgtccaaata aagattagaa aacattaccg     52080
     gattaagtga tgccaacagt gatacaatac tacatatttc ttcccgaatt aatggtgacc     52140
     tatgatcctt aaatgacata gtaacgtagt agatatcatc aaaaaagtca tttaagcatt     52200
     cgctatccag ttcgagaagc tcatgataaa ccaacaaagt tgcatgaata gcatctgttg     52260
     tttttaaagt cagtccaaac gcacaacctt gcataaggtg tattatccat tccttacatg     52320
     cactttcatc tctcttcgaa atgattctca aacaacagcc aactacttta gcggcatcaa     52380
     aacgcatcaa attatctgga tctcgtagtg ctcgccatat attgtcaaga atagaattga     52440
     tgtatgggta taacacagta ggagagtttt tactcaatac agtaattatt tgtaatgacg     52500
     cgtgcttcct tagttcttgg gtttgggttg agaatttgct ttcaggtgat gttgttagcc     52560
     actctataca gtttttaacc tcgtgctgta aaaattcaga agttattgag ctcgttggaa     52620
     tagctaactt gcctagtatc tcaattgctt gcttcattaa atccaagttt ttggaaggta     52680
     taagtacctt taaatatcca gcaagtttag tagtataatt tggaagttct tcggtttgtg     52740
     aataatacca tattaaacag tcaacggata gcacacctgc aatttgactt ctcacatcct     52800
     tactgtgaac catctggtaa atcttattgt ccaacttatg attgaagctc tgaaactgct     52860
     ctattgatat ctcatgagcc aatgatatta agacggtctt tagcttattt gtagccgata     52920
     gtcttagtct aacgttcgga cttttcaata attctaaaat gtagtccatg agcatgggca     52980
     atgattccaa atcgggaagc acatcacttt ccaacatagt tgattccccc tttgtaaaat     53040
     tactagcaga accagagtca tagtcgagta taggaaccgg tgacatgctc tgctcattcg     53100
     gggtaccaat tacagcagat cggagtaacg cggcactttc actgctatcc ctatcttcta     53160
     gtttcaaact tgacattcca ttggtgagtg catgtgctgt cccatctccg tcatgtaata     53220
     aacccaccgt tttcattatt gctgttacag atcaattatt tgctcttcaa tatgaatgaa     53280
     aataatgcaa aatggaatat actatgagac ttcaccacac aataaaaaga acgtggtact     53340
     ttgaatgatt gaaatggata taataatgaa ggtaaggcca agtttttgat caatagctta     53400
     ttattcgttt acgtttcaaa gttgtatttc accagattct gaaacgataa tctgttctgt     53460
     tttccttttg gcctgcaaaa taaaaagact gatagaaagc acaccctcca ataagacaaa     53520
     attttaatct attcactgca ggtccagaga ataacagcca gtcaattgca aaaggagcac     53580
     tacaacatta taattcttaa atatggaata tgatggccct ctaagtgagc agaattcaga     53640
     agtcattttt ggcaaggcca gtgacccttt aactatgtcg tttaacatta ctaatcaaat     53700
     ttatggacca taccgcccaa attggccgtt aagggtcttc aaaactggtc aattgtgctt     53760
     atcccaatac atttacattg tgtatagtta ggaataagag gtattgtatg ttggtattat     53820
     agatagattt gctttttgct ctgctcaagt ttctgcacag cgagcagtcg ctattccatc     53880
     atatatccag ttgaggaagt ggcattgatg aaatagttga agccaacaat agaatggttt     53940
     tgttctagtt cgattaaggt agtaactttt gtggtgaaat actaagagtt gtactaagtg     54000
     tggatcaatt aatagtgcta ccctagacag tgtcaactgt atttcataag caatttcaaa     54060
     aagaacaggg ctatgtactg tagtaatgat tgtttgacag ttcaaatgct ggagcgttta     54120
     ctacactctg gcgcaacttg aaccgaagat tatgactcga atagaccgaa tgtatatgta     54180
     atatactata gacgacatgt gattgttcat ggtcaacggt gacgtctgct atgatttctt     54240
     gggggttcac acttcctttg accaacattt cgctttgaag ggaaacttaa acttgctaaa     54300
     cctcttctcc taaaataggg acctcttgaa atagtgcctt cttctgatta agagatctgt     54360
     ttcgcatatt accaaatata ggtgttgcta tattgattag tgttcaatta aatagaatta     54420
     gaataaagca aggctttgat attccttatt gtataagatt ggccaattgg atcaccgaat     54480
     tgtaactaac tcaaaaatat aagaaaagcg ttgatacagc atacttgtta gtatcaataa     54540
     taatcaattt agacaaataa tctgtgtttt tgattgaaaa ctgttgaaac aaataaacag     54600
     attacatttg aagcattata aaaacatcta ttgcggttgt aaggagcaat attccaataa     54660
     cgaaactttg gcaatacttt aaaacagttc atttttactc aattgtttta gaaggcagta     54720
     aacgcactag aaactataaa aaatgtccta cttaaacaat cctgctgtcg ttatggacaa     54780
     tggtaccggt ttaaccaaac ttggttttgc cggtaatgac tctccatcgt gggtttttcc     54840
     aacagcaatt gctactgcac aagcatccaa caccaagaaa tctactgttg taaataagag     54900
     tagtgccggt ggtgctgatt cttcaggtag tgggtatttt ggaaattcta cctctgctac     54960
     ttcgttcaac agcggcgata tgtcatcatt gctgttgtcc aacaacctgg ctggtaagag     55020
     aggcactgaa gatttggact tctacatagg taatgaagct ttagcagcag cacaaggtca     55080
     gtcatactct ttgagttatc caattaggca tggtcaagtt gaaaattggg atcatatgga     55140
     aagattttgg gaaaattcca tcttcaaata tttgagaact gaaccagaag atcatttctt     55200
     cttattgaca gaaccacctc taaatccacc tgaaaataga gagcaagttg ctgaaatttt     55260
     cttcgaatct tttaattgtg ctggtttata tattgctgtt caagcagttt tggctctggc     55320
     agcctcatgg acctccccaa aagtcactga ccgttctttg accggtacag ttattgactc     55380
     tggtgatggt gtaacgcacg ttattcctgt tgccgagggt tatgttattg gatctgctat     55440
     taagaatatc ccaatcgctg gtagagatat tactctattc attcaacaac tattaagaga     55500
     gcgtggtgaa caagatacat cactaaaaac cgcagaacgt atcaaacagg aatactgtta     55560
     tgtttgtcca gacatagtaa aggagttcaa caaatttgat agagatgctt ctaagtttgc     55620
     ccaatttgtg gtggagagcc aagagaaaac taggaagaag attgttgatg ttggttacga     55680
     aagatttttg gctccagaaa tatttttcaa ccctgaaatt gcttcttctg atttcctcac     55740
     cccattacca actgttgttg atgagactat tcaagcttgt ccaatagatg tccgtaaagg     55800
     tttatataat aacattgttc tttcgggtgg ttctactatg ttcaaagatt ttggacgtcg     55860
     tctacaaagg gatatgaaat caattgtgaa taatagaata gcgcaaagcg aagctctaag     55920
     tggcactaaa tctacaggtg tggatgttca agttatttca catagaaagc agagaaatgc     55980
     tgtgtggttt ggtggttccc ttttggctca aacagcagaa ttcaagagtt attgccacac     56040
     gaagaaggac tatgatgaat atggacctga aattgttaga aactttagtt tgttcaacat     56100
     ggtatgattt tgccaaccaa ataacaagaa agaacgtaaa caatataaat aaatacatgt     56160
     aaactatagt atacaatagt aagagaacta tttgaatttc aagaggtgta tatataaagt     56220
     atcagtttta ttaaacagca gaaattttca tattagatgc aatgcggtag taaataggtt     56280
     tataggttct atttaatatt catctttgcc actgatgatg acattatcaa tcttcaaaat     56340
     cattctacat aactgagtgg ctagcattat ctgttgtttc ttactgatga aaggatcgac     56400
     gacaaataat tccttcatgt cattactacc tttgcctaga cagtcaacac cgaaaactgg     56460
     tatgttttcc ttcaattgct tgctcttcag cgtagatagc gtttcgattg gatctaaacc     56520
     agagttctct gccaatgtca ttgggacggt atctagggca ttagcaaagg ccttgaaagc     56580
     gtattgatga ataccacgtt gtttatctgc ctcttcagat acagccaaag acattgttac     56640
     ttctgcagca ccaccaccat acacaatacg agagtccttt attagattac gaacaacaca     56700
     tagagaatca tgcaaggcac gttgagcctc atcaattatc attttatttg aacccctgat     56760
     aaagcaagtt actgttttag attcttctgg ttgttcaata accagcatac gatccttagt     56820
     tgtaccaaat tctaattcgt agatgctaga acattcacct agtttatctg gagacaaatc     56880
     ttggaatctg ggcacaattc taccgttagt cgaaatcgca atatgctcta gctcttgtcc     56940
     gccaacccat cttacggctg gaagttcatt ttgtaatagt aaatgattgg cttcatcatc     57000
     aaaaccccat tgacatatca caacgtcagc accagaatct ttaacatatt gtatcatttc     57060
     cttgaatttg tcttgttcgt atgtttgtaa ttttttgtat tcttcgacac tggagatatc     57120
     tagcttatgc tttgtctttg gctttggtgg ttcaaacgga caggttagga tagccaattt     57180
     tacagacttt tggccttctc taggcaagac cttactaggc atctgtgggt gtgagaattc     57240
     tttgtctaaa agaacaccct taattaaaga tgaatcttct agagaaccac caacacgagt     57300
     ctgtagtttg atcaagtcga agtcaacatc ttttctttct ttatccatta cacttaaaat     57360
     agaatcaacg gccatttgag caaacttatc atgaaccttt gagacaatct tagagcccaa     57420
     agatgtctta gccgctttga acaggtagtc gttcaataat ttcgaatcct tttcgaactc     57480
     aattgctgtg atatcctcag tgactgattc aagatgggaa acagccagtt tagcagcctc     57540
     gtcaaaaccg ttagcgattt taattgggtg aataccttta tctatcaatt ccaaggcctg     57600
     atctaatagt gcacttgcta tgacgacaac accagttgta ccatcaccaa tttcatcatc     57660
     ttgagacttt gacaattgaa ctaaaagttt agcaatttgg ttatctagct ccatttggga     57720
     taaaattgtg gcaccatcat ttgtaattgt aatttcacca tctggggata ttaggatttt     57780
     atctagacca cggggaccta aagaagtctt aataattgag gcaacagatc tagctgccaa     57840
     gatgtgagat ttcttagctt ctaacccatg ctgtctcttc ttattagatt gatccttgac     57900
     aataataaat ggtctgccca tttcatcctg tgcaacaatt gcattggaga ggtctggcat     57960
     ctccatcatt tgctgttgtg gttgagccat tctttacttt attctggttt tggggctttg     58020
     ttggcttttg gtctgaagct tccaattgca agaatattga caaactgctt ttaaaattct     58080
     aattgttaga atagaaacac cgtgagatta tgttacatcc attcattgcc accagtaacg     58140
     ctattagagc aacttggcac caaaaactca tcgaagcaat tttttggttc ttcagtgcga     58200
     aagtgaaaaa aattgcttat gtatgtcgtt tttaatgata tatataagct atgttatatg     58260
     cttttataga atacttcata gagtttcaag tatttcctga ggccgttatc ctttatgtct     58320
     attaaatata tggattatat catatttaga tatgcccctt atggatatgt tcattctaaa     58380
     cgtgacaatt ctagtataca gattttagtt tgggagggat ttgaattgaa tccaaaaaat     58440
     attgcttctc agaaatggat caagcaatcc atgcaatgct cgtattgtta cttggagttt     58500
     tttctagttg ttcatttttg tcggtaaatg gttactctgt cataataggg cataaaaaag     58560
     tgaatgtggt agtaccacac agaatcagtt attggttctg tacttgtagt tacatttgat     58620
     acaggtgtag aaaactgtag caccttcatc tgccgaacgt aactgcaacg tttggtaacg     58680
     catctcatcg tggccacact ttggacattt ttctttgata gtagcaccat cgtcttttag     58740
     ttcatctctc ttcaaatgcg tcttcactac cgatcttttc agtctcaatg atgatgggaa     58800
     tgcatcctca cttgtggatg tgacaacttt caagttggta aactgggact ttgcgtactc     58860
     tgcttgacac tgtgagcatt cgataacatt gctgttgtta atcttatcct ctgggttatc     58920
     tagaagatta ccacaatcat cacagaatat aagggaaccg acagcagaca tattatattc     58980
     gtattcttta agtcaaaaat tgatttccaa ttcaatccaa atgtttcaca ccaatatatt     59040
     tttattttta gctttcttat caaacctgat attagagaaa atggtggcta aaggttatta     59100
     ccttaaatta taaacctatc agatagatgc cgactattgt agatttatta tatggtttag     59160
     tatgtgagct catcgaaaaa tttttagttt tttttttttc aaaatttcaa tttttttttt     59220
     ttcagttttc ccactcttaa cagtgatgat tccatcggac aaatgttaaa acatatggat     59280
     attgctacta cacacactct ctcactctct ttactcatgt aatcgataaa ccaaggggct     59340
     gtatgtacaa gttgctatgt actaaaaata ctccttaaaa tattactgct aatttgaatt     59400
     tatctattaa aagatgtatt ataattgaac aaagatcagt ctgtgtacac tactattctt     59460
     ctgtgtgaac atctacatgc aatcatataa atattatcat caaccttccc gtcaactcta     59520
     ttgagtttct tcagtgtttt tacttggtgg tgggggtata cttgcatctt tgtcgccagt     59580
     agagggtttg ggcgttggag attgatcttt accttcgctg aagtagtcac ccatggtgga     59640
     tatattaact gcatgttttt tggatgattt gcttgttggt gggggtttcg caatgcctgg     59700
     aacaaaagtt tccgaggaca ttggctggtc aaatgtaggt actggaatag cagcagtagg     59760
     agcattggtg atacctttgt tgctatgcat gctagtgttt ccatcttctt gttttctaac     59820
     agtagggata cggtgcagga aaccatatcc cacaccacaa ccgagtcttc catctggtcc     59880
     aatgttcaca gtcacaggtc tcacacaatc cacgactttg ttatacacgt aaaggatcaa     59940
     gtcatgatta gctcggcttc ttatcaagtc ttgaagcagt gtttctccac cagttgctag     60000
     caaaccatct tgagaaccga taatataatc ttcatcggga attaagccag ctgcgtgtgc     60060
     tgggccacct tcgatgttca actgtagaac atgataagta tatgtagcgg ctatcagtgg     60120
     ggtccattgg actttaaaac ctaaaggact aaatatttta gaagacaatt gatgatgagg     60180
     tgtatcgtta ctcaaattta tatcctccat ctggttttca tcgcttggaa tagctgacaa     60240
     tgacatatat tcatctctaa aagtgccacc tttagctgac cacacattca gtttcactgg     60300
     agaggcttgt tcagcgtgta tattgagtaa acggataatt tcgttataat cagggtacaa     60360
     atagccgtgt tggttgttca tcaatggaag tgggtcgtcg tcaataccaa caataaaatc     60420
     aaaatatgat tccaactgaa gttgtagctc atccacgtaa acaacacgta atccacttaa     60480
     cacgtctgaa agagtagaca tatctgtgtt ggaatgtatc tgtgattcca gcaaatttgg     60540
     tggaattgac tggaaaaacc catctagtct gtcctgatcg gatagagata aagtttgttc     60600
     gaacgtcttc acaaggtttt tcgctatctt aaacatcctg aagtacttgt ggttaatctc     60660
     actataagat cttggcaatt gatgtgtaga gataagtttg gacttacaat agtgctggta     60720
     aatttgatac tactcttaac tgctctgctt aggtgtatca tcgtgcgatt gttggtgctc     60780
     cctccggata tttattggat aactatgtac gataactggt cacgtgcgta aacaagcata     60840
     caaacgcagt ctgtactaag taatttgtat tataattact attgctatgt atgatataca     60900
     ttcggggggc tgtttcattg ccaaaaccca catatgagac tacaatcgag caaatgaatt     60960
     ggttggttta tttgttgctt tacgtctgtg aaatgttgta ccatgagtgt tagtagcatc     61020
     ccagtaaaca gttgtgatct tcttgaggca cattatcaca attgtaaaat tgcttcttca     61080
     gtttcgtcct aacaagtgtt ttcttcaact tgtactaaag tacaacgttt gaggaagata     61140
     cctgaacagg tgatagtcct gtatacatca aatagcatcc ctctgctacc tggtattccc     61200
     atttcctgca aatatgcgcc tcatcttcaa gcattaagtg tcaaaagatt gcggggtgga     61260
     ttcgatcaag tctcgctgtt ttgcactact tttccctcac tccctcccac ttcaccgatg     61320
     ggttttggtg aagcgggtaa aatttgcgta cgtagatttc aagaaatatt gcgggggtgg     61380
     ggcaggatta gttttcccga tgcagaggat ctaggtaagt ggggcattgt tccacaagat     61440
     actttaaaaa gcaaaaactt gaaaattagt ggatcccgcc caaactgtaa atacgtttct     61500
     gcgtttaatt cacagtgttg atattttctc tccccttgcc ccgcccccac cttttatttt     61560
     tctatcaaaa atctgatgcg cgaaagtttt tccttgttgc atgaaaactt gaattttccg     61620
     gttctgcata gtgtttagtg gacatacaca cacacacaag agattgagat cttccgtgtt     61680
     gaatgtacgc agaaagctac tatgagataa tattcaaggg taggggggag ggggatccaa     61740
     gggatggcaa cccaatctaa atttagggta gccttctttt gttgcccatg ctcaggcgtg     61800
     agaagatggg aagggtgtat ctataggtca tatggtggtg aggcaaacat acaaccacta     61860
     tcaattgaca atacggtatt gtagacacca agagccacga gggggggggg gaaggacggt     61920
     atcgaggtga ggggtatacc ttagtaattg atcaacattt cttcattacc gcaaattaaa     61980
     tcttctattc tgaaagaatt gcctcaccaa atcgtcctta tggcgaatac tctgtaaaag     62040
     agtacagaca ccagcaaact ggtaagacga aaataaaaaa tacctagctg gggccagtgg     62100
     aaagtgtttc tcgtacaagt agtgacggac gtactttcca ccaaacagga atacaatact     62160
     tgaaaaaaag aaatgagaga aagtcccatt atagtgtaaa tggcaagttt gctgccattt     62220
     cattgagtac agaaagaaga cacataaaaa taggttgttc tcaattgcta tatcctgctc     62280
     ttgattgttg aaccaaggga agggattctg gataccgtca atttgctgag agcgtactac     62340
     actcgccctg gtcccagttt gggattcttc tctgtagtgt catgcaagaa ctattatctg     62400
     aacgtgtgtc tcttggaatg tatgttcctc ttcttcattt gagtaaaata tagctacgca     62460
     atattctgta cacttgttaa ttaagatcac ttttcttttc tgttagtcct tttcattgga     62520
     cgtagtgctt agttgtttat ttaaatgtgg ggtaggagca ttctttagag gggaggtttg     62580
     tctaaggggc gggccatgga tagcagttgg aattgttggc ttttttccac ccacaagtcc     62640
     ctcatccagt agttttaccc agtagtttaa cattgcttta tccattacct cttgctaaat     62700
     ggatacctgt gcaacgtctc tgatgaacag gagccctgta aattaacgaa tgtttatctt     62760
     cttccaccat tgtgatcgta gtacagagaa atagggagac caagggggga ggggggggtt     62820
     gaagttggat gccagggtgc tgtaaacaat aacaactttt ctaagcaatt accgtggcca     62880
     atttctgcct cctacttttg gaaactagac gtaggataac atatgtcgta acaacgaggg     62940
     gttaagaaga gcatgtaaag acccaggaac catgtacttt caagggttcg taatagtgaa     63000
     aaaatggcat tttgagtaat ctttttagca tgcttttaaa atatagttac ttggaaaaaa     63060
     ttgatatata aaggtggtga aaatagtgaa aataggtacc gattctcttg cttcattgac     63120
     cctttaactt ctttatttct tattgctatt tgtatttaaa cattccctac taatactaca     63180
     tcaaagtatc aattttgcaa ttctttagga aaaggataat aagcactacg gaaatctaac     63240
     gtatctgtag ttttgctata aaaaagaata ttattgtttc cttttaaatt caagatactg     63300
     aagttacaat ttataatatc atacaaaacc aattaagaga aaaaccatca aaaatgtctt     63360
     tcgagaactt ccacaaagct accagcgagc aattgactaa agccgttgat gaactatgta     63420
     aagagttcga agtcactcca aagatgttgg atgaattaac tgcttacttc attgaatcca     63480
     tggaaaaagg tttggctgct gaggctgact ctgagaacaa gggtttgcca atgatcccat     63540
     cttttgttac tggtatgcca aatggtaccg aaaatggtgt tttgttggct gctgacttag     63600
     gtggtactaa cttccgtgtc tgttccgtta ctttgaatgg tgataacact ttcaagatgg     63660
     aacaaatgaa gtctaagatt ccagatgaat tgttagacga cgaaggtgtt acttctgagc     63720
     aattgttcgg ctatctaggt cgtagaactg ttgcatttgt aaagaagtac catcctgaat     63780
     tcttgaacaa gggtgatgat atcccaccaa ttcgtttggg tttcaccttt tcttacccag     63840
     tcgatcagac ttccttgaac agtggtactt tgatcagatg gaccaagggt ttcaagattg     63900
     aggatactgt cggtaaggat gttgttcaat tataccaaca acaattggat gctcaaggtt     63960
     tggggatgat taagattgtc gctatgacta acgacacagt cggtacattc ttatctcatt     64020
     gctatgcttc tggttcccat tcatcatctg gtggtgaaat ttctgaacct gttatcggct     64080
     gtatttttgg tactggtacc aatggttgtt acatggaaga aattgagaac ataaagaaac     64140
     ttccagaaga tatgagacac caattggcca atgaaggtaa gacccatatg tgtgttaaca     64200
     ctgaatgggg ttcttttgat aatgaatgca gatatctgcc aactaccaag tacgacgtcg     64260
     acatcgacca aaagtactcc gctaaccctg gtttccactt gtttgaaaag agagtttctg     64320
     gtatgtactt gggtgaagtc ttgagaaatg ttttggtgga cttacacagc cgtggtttaa     64380
     tgctaactca ataccgcgac tacgaccaat tacctcatcg tttaaagact ccatttgagc     64440
     tatctagtga agtcctatcc cgtattgaaa ttgatgactc cactggtttg cgtgaaactg     64500
     aattgtcttt cttgcaatca ttgagacttc caacgacgcc atctgaacgt gaagctattc     64560
     aaaagttggt tcgtgccatt tctcgtagat ccgcttattt ggcctctgtt ccaattgctg     64620
     ctatcctaat caagactaac gctttgaaca agagatacca tggtgaagtt gaagttggtt     64680
     gtgatggttc tgttatcgaa tattacccag gtttcagatc aatgttgaga catgccctat     64740
     ccttgtctcc aatcggagct gatggtgagc gtaagatcca cattagaatt gccaaggatg     64800
     gttctggtgt cggtgcagca ttgtgtgcat tggttgccta aacgttttga tgtactaatt     64860
     atgatacagt gaaaagactg ttttaagagg ctatatattt ttgccgtatt tttgtcactt     64920
     ttagagtaat tatacaactg ataaacgggt tagttggctt ctaatgttca ctgaaatcaa     64980
     ttaacttatt atgtgttcac gaattttttt atacaattgg gatattgtac ataatcctct     65040
     atgtatcttt tatgtgattt taattattat tcttttctcc aaatagttct ggatatttga     65100
     agtttgtgta aaattatttt tttatgttta taatgtattt cacagaacaa aaaaatttca     65160
     aaaccaaggt caacttacgt tttttttaag ctttagaaca taaacattaa tatttacaaa     65220
     ttctccatat tgtaggataa tatgttcgtg aattttttaa aaatatacaa taatgctata     65280
     aatataaata tcttttatgc atgatacctc ttgacatcaa tttacaacgt tgaatatcag     65340
     gtttacttta caattagaaa tcaaggtcaa gcattttaca agcttatcaa ttcttaagtt     65400
     taagataaaa gaaatataag acgatattag cgtgatgtag ttattcgctt gacacttgat     65460
     cagaacatat cgtaaaattt aaaaaaaaaa aaaatcataa aaagtcttaa atattttatt     65520
     gctcatcatt ttcagatttt tcggcagact tagtgtcaac tggagtacta ttatcattta     65580
     caggatcatc attttcttcg tttgcaccat caccaacctg acttctatga ttatcagggg     65640
     agctgtttga gttatatctt tgctttccgc cacggctgta agattgaccc ctcttgtaac     65700
     catttggtct gtagctacga ccatacatat aaggttgtgc tggaagaaga ctggaattta     65760
     ttgtgaattg atccaaatca gtaccagcca atgtcttttc aatggccact gcaaagctat     65820
     cctggttagt ttcattcaac catttttccc agtttttagc acgcacaaaa taattgttta     65880
     tattatattc aggaccgtaa aagttatctt gaccctttgc ttcgtgttct tcagcatttg     65940
     attttcctct aacaacttca acaacggaat cttcgttcgc agcaatttct cttagtgcag     66000
     ccaaaatgat ggttggatcc ccaccaaaag acatatttac aactctaaag aacttggcga     66060
     taagatcaat tggcacaaaa ccagcatctg agaatttaga ttttaaaaag gaatccctgg     66120
     ataaattttc ctcactgaag tagtattcaa tctgtttgga tacattttga acagccgtta     66180
     ttagggcatg cattgtatta taatactgag cattatatga attctgcaca tatggaacat     66240
     aatgcatatt gttgttgaag ttgcggttgt gtggaacgta cggtttctga ttttgtcttg     66300
     gatagtaacc attacgctga gtcttgtcat ggaagttggt gttgctggta ttgtatgaat     66360
     agttggtgct gtgatggttg ttaaattgtc taccagtatg cccgtaactt cctccttgct     66420
     gatggtgata agaatgtctt ctcacatgct tgcttgaggg ttcacccaca ttttgttcat     66480
     tagtattttc agtgctataa ttttctttct gcccagatcc tgaggaagct ctttgcccag     66540
     taggagtctt tgattcagtt tcttgtactg aagcggtttc tttttcttca ttaatatctt     66600
     tagtgttgac atccttctgc ttattttgct catgtttatg accatgatga tgctgatggt     66660
     tatgttggct gtgactatgg ttatgattat gattattacc atggtgatgg tgatgagcat     66720
     gcgaacttcc accgttcaca gtttcagaag aggattttac atcagatttt gtcttcactt     66780
     cagagctttt ggtattatcc ttatcggtgt cagtgcttga cgtgttattc tcatcatctt     66840
     tctttttatt gttattctta acattattac ttttagcctg ttttgtattt ttcttcttgc     66900
     tctgagagct ggaagatgta gcattagttc cttgagagtc acttgtggaa ttactgttac     66960
     ctgttttctt agtgtctttt cctttgttac ctgaccttct tccagatctc tttgatccgc     67020
     cgtttccgga agagacagta attgatgcct tcatcggaac ccatttaaca tttgacccgg     67080
     taggcttcat tgtgttagca gaacccccat ttttcctctc tttctgtttc ctagtgttct     67140
     caatctcttc ttccaatgaa acttcacttg cattaacaga ttctccagtt tgggagaccg     67200
     ccttccatgg tgagctcgtt ggaattggtg cgggcacaag tttactggca tccacacctg     67260
     gttccttagc gtcggccttt ttactcttct tgatatcaac atcggtagtg ctttctggag     67320
     cagcttgaga agcagaatca gcttttccag tgacagtcac tggtacggtc tcaacgttct     67380
     cctcttgtga catggctaaa gaatatacta tcgcttgcag gtgggttggt gtatgtcaag     67440
     tattttactc ttctgtttaa aatattacca agctacaagt atatgtgcat ccacaaactt     67500
     atagtaacga tgtggtacta tacctggaag attatcgagc tgtgtgcgca agagagtgat     67560
     aagaagtgtg aagcaaaagc acacacaaaa tttttttttc cagtaagctt tccaaagaaa     67620
     gcttcccaac cagtccacca gtaatacaca gactctacag tagtgggcac aagacttctg     67680
     aaactttttt tccacttttt agtgtctagt cctcgaagca tctagttgag ccaatacaaa     67740
     tcgatgaaaa attgctcgtc gaaacaaata attttttttt tcagtttttt gattcacgac     67800
     tgcagtggga atgtgagacc atggacgggc acgtatcgat ggaggtttgt gccacctgtc     67860
     tttgtgtttc accagctgtg agctgatctg tgacttcgaa cagtacacta tagcccaggg     67920
     tttttttact taccctaagt atgttgccta cgtctgtacc gatgaggaag agtgtgccca     67980
     atggagattg cattgcatca gtaggtaagg tgctaggttt gggtcaacta tcagataata     68040
     cgagtatttc atgtgacact gggccctttg gtactgttaa ctgattagta acagcctgtg     68100
     catttgcagt gctagtattc caagtactcg tactctgtat gtggctcatt ttttttgtaa     68160
     atagcggcat ccgtacttat ctgcagtaat atgttaaata tacaacttgc ttcatctgtg     68220
     tcgaggagta tcacacaatc tgttgctaaa aatagtttct tgcaagttat agattgatat     68280
     acatcgcaac tctaatagag cttgtcttgc agtgttgtga tgctatctat atgtaagact     68340
     aaggcactga aaacacgcca tccgtccaat taattgcttg gtcctgcaag ttttttggac     68400
     atgactcaat taccaataca cacgtggtgg agattatacc atcacttgct tcgccttaca     68460
     taaaaacact atatgcaccc atggcacaat ttataagatg tcttgcatgt cataccagga     68520
     actactttca cctcggttgc cgaggtgaaa agaaaaagat ataccatgct gtgtggcaat     68580
     aacatgcaca catagtgagt atggagttat cgcttgtaga catgtgccat atggacattg     68640
     ccctatagcc atctcttttt acataaacaa atactacgat gcaacctcat gacatttcaa     68700
     agacataacg ccgatgggca tcgcctcctt atgcaaaaga aaagtattgg caaggagcac     68760
     tctgcatacg gcgaggatgc aagtgacttc ccaagttgta gcaatgctcg cagcaaacgg     68820
     caataatcac tgtctcgctt gccatcttgg tactcccacg ctgacagagt gggatatgtg     68880
     acttccacgg aacgttgttt gtcatatagt gtgatgcaag ggagggtatg gtgatgcggg     68940
     ctgggacttc tgagagaatg ggatagagca atagacagcc aggtgtaact agtgtccagt     69000
     aacagtcact gcagtaggtg ggagaagggg agggggtcac aaatctagca tagcataact     69060
     gggtatgaga actttagata ctaaatgcgt ctcttgtgag ttctctaggc tatgggagga     69120
     cagggcgggg gttgacccct tcatagtaga actcggagat tgctcttatc ttccctccac     69180
     aatacgggtc acaaaacaag agtctcctta cggccccgtc ggaatgtgat tccagaagtc     69240
     gtataccagt aattaataca ttttttcata ttccagtact aattaagcaa ttaatttgta     69300
     tacgatacaa agctaattaa tttcaatgac acatgtattt cgtatcccct accatttaag     69360
     attaaatgtt tttaatttta aggccactaa tgtcctgtac gtctctgaca tcccttcaac     69420
     cgataccgag ttggagacaa ccggtacagg ccattatttt tgctgatagc gagaaatctc     69480
     ggaccaccgg tatatacatg cgtctctcaa ctgatcttgc attgcatgta cacatatttt     69540
     atcaacatag aaactacaaa agtacgcatt attggcattt ctacaataag gtactgataa     69600
     gaaatcccca ataataatgt atacacaacc tacactacca tcacaatacc gtttagctac     69660
     agaattaata aaattatacc ttgaatcctc gaagaaaaac aactatcaga aacatgagcg     69720
     ctaaatgtta ctgcactcgg agatgtactt accattccac agtatcacct gactggtagt     69780
     cgtattgtat taacgatgaa aagcaataat gaaaaagaag tgctcctacg ctgagttatg     69840
     tgccccacca actatgtgtc gtctcctcaa tgaatgatca ccagtaccca gatgaatgtg     69900
     cacaaaatcc ggaatagcta tttttggatc aaaaagggtc tctggcctct agatttggct     69960
     gtagacaaaa cattattaag gccttggaat aatgaaatag agttgaaaat accgtaaaag     70020
     agaaatcttg taaaccatac aattgagtgt atatcttcca agaggattgt gcgagtgtaa     70080
     tggaaaatca ccgtacgtta atgtcccccc cgcctgtgga cctccccata ttctatgtgc     70140
     atagactgtc ttgctacaat tactgcaata cacacaaatt tgcgttctaa cccaaaaaaa     70200
     aggtcttgca tcccactcag tctattactc ttcaaaagat aattggccaa caacgatcat     70260
     cgctacaaga gtgtccagag tattgtcatt tgcacgacca tctcatctac gttattgccc     70320
     tttgaggata ccctccgcat tagttagaat gacgacattt cttattccag ttattttttt     70380
     ctgttcctac ttaattttct ttgttacgac acattttctc tttgacagca ataatgctct     70440
     ctcctcccta tgcccccccc acctccctgc aactacattc cacttacttg catgcaaccc     70500
     tcactgagat tccatccagg atttggtaca gcgatccctg cgtctcttcc attttccgaa     70560
     atgggagata ctagtagtgt cctacagtcc tcgagggata cccgaagaaa gtacggtaga     70620
     gcttcatccc cctccaatgc attctaaacg ggaagaaaag ggcttgatct atctttcctt     70680
     ttcacccacc aagtaacgta ttagacttgc tggcatcgaa gcccgtattg ctctacgggt     70740
     gtttactgga tttttgggaa accctcactg ttggctaacc tgcccctcga aagggaaagc     70800
     ttcgattttt ctacgttttt cttcgattaa gtgtcttctc tacgacacac tcttagtggc     70860
     caagcacgtt tgagttgtcg agggcgggca gagatttgta cgcttcttcg cctgttgtac     70920
     atcacccttt tttcttctaa tgattactac gcatcactac accgactaac ctcttcatgc     70980
     tgagtttttc cgatccagtc cttcgagaac gttgaaaatg tctaccgggc actgcggcat     71040
     tgcagttacg gatccctagc ccttggaccc aacccaaaaa aaaagtgcca tatctggaac     71100
     aactagtagt catcgtattg ttcccaaaaa aaaaaaattt tttttgccca ttcggctaac     71160
     aaactaatgt acaaactcgg caatttatgg cttccttctc gaacgattat tctttaaatg     71220
     gggaattcaa agcaccgaag gaaccttcga tgctttcgaa atgctggagg aagtgggact     71280
     ttagacttcc gcttttccac aacgttttag tgggttaagc taccctcttt agtgtcgatc     71340
     cccacttaat ttttcttctt caatggcatc ctcaatggca aattaggaaa tctattttta     71400
     aattattgtt ggacatagaa aactgaatct tccctatgac ttctcatata ttttttttaa     71460
     attattattt ttcttttaga ctttgtatga agttgacctt acttcttgat tatggtaata     71520
     catctaaacc aaccctcatc aaatgtactt atttttattg taagagatgg ttttcttatg     71580
     gatcgactga gtgtcttctc cacatcacat tacgtagctt tcctatactc atcgcatttt     71640
     ttaacataat tacaatcatc ataaggaaat ggaaagcata taaatatttc atgaagttga     71700
     gatatattct gacttaacgt tttactccat attcattttt ttagcatgca tcccaacttg     71760
     taacttatat aattccttct ccataattct taacttgaac aataaaccca tacttattaa     71820
     acgctactaa ggatattata aaaaaaaata acctgaaaga ctgcaaagaa cccaaagcta     71880
     cacaacaatc tacaatacac gctattaaca actaacaaag atttctcaat tttaatcttc     71940
     tgaacaaaag aaaaatctta atgtcgctat actcatataa ctcgatgtcg tcatcatcat     72000
     tcgggaatga taccgacgac ttgtcattta acaacccgct atactccgac caaacaacca     72060
     tattcaggga tggagacttg ttcaaggaac aacttgatct ccgcagccct cacttcggaa     72120
     acgaaatcca gttcgaagaa caagaggact tgaacaacta caggataatc agcaaaatag     72180
     gtgaaggcgc cttctccaga gtcttcaagg ccgtcccatt gcataacaac ttagcgcttc     72240
     cgaagtttgt cgctattaaa gtggtgccaa aggaagactt ccacgaccac aacttgaaga     72300
     aaaccagcaa attacaaacc ttgaatgaat tgaacatcca tttgaaatta acaaaggcta     72360
     atgtgcccaa tgtagtcaag ttattggagt tccaggtgtc aaagaagtac tactacttca     72420
     ttcaagagta catagaaggc ggtgaaatct tcaaccaaat tgtcaaatat acgtacttta     72480
     gtgaagacct aacgagacat gtcatcagac aagttgccac agcggttaaa ggtctacacg     72540
     aaaacaacat tattcatagg gatatcaaac cagagaactt gatcttcgaa ccaataataa     72600
     aagaacaaac catccacaga taccaaaaac taagaaaatc tgacgaccca aagacaaaat     72660
     tggatgaagg taaattcata ccaggaattg gtggtggtgg aattggtaaa gtcaggttag     72720
     ttgattttgg actatcaaga ttaatggatc ctgccgaaag tggggcaagg acaccatgcg     72780
     gaacatttgg atatctggcc ccagaagtac taaaccaata taaggttgat ccacgtacat     72840
     caaatactag ttattcttac aaggttgaca tatgggcaat tggttgcatt ttatacacaa     72900
     tgctttgtgg attcccccca ttttacgagg atgaattcag taaagaatct ctaggtgaca     72960
     agatctcaag aggtaattac aaatttcttg ctccatggtg ggatgaaatt agtatcgaag     73020
     ctcaagattt gattagaaat ctgcttcaag tagaccctgc taaaagatat gacattgatc     73080
     aattgcttgc tcatccatgg ctaaatcatt acgactgtga aacttcgcgt ccagagtcat     73140
     tctatgaagc agagttactg gacaagactc acctaaacta tgtccttact tctcaagctg     73200
     acagaaagac aaatgcacac caagacaaag acatcctact gtttgatctc gatgatgtga     73260
     gcgactatag cacacaatca tccccattcg attcctctaa cggtttgaac ctacattcca     73320
     ctcaaaaaga acaaatacgg aactttttca atacagccac tggaatacag caggaaaact     73380
     ttaaggtaga aacagaaaag gctacatgta acaagtcaaa tttctttaaa aaccacttta     73440
     aactaaaatt aagctcagct acaattatca atagaagaaa gaagatgaag ctgcaaaccg     73500
     attaggcatt aactaaaaag catccgctta tactatagac tccatcatat taatgatatc     73560
     attgaatata ttgcaataat tatattgctc attaattttc agtattttgc atttctttta     73620
     ccactcaaca aaaagcaatt ataacgcatt gtacaaacac taatttaatc ataccgggtt     73680
     ataatcaaaa taaattaacc tataattctc aattatttgg catttcatac atatagacca     73740
     attagcatag taattatcat attaataaat ctttaataat acagtcatgc aaacactcct     73800
     gtgaatttta taggatttta ctaaacaaag tggataatac aagtttatat atatataatt     73860
     aggatcgtat ataattagga ttgggtactt aattactgtg actcttgaac actgacctgc     73920
     tgagcaacta gttcaacaat tcttttggtt gttggtaaaa ccaaccaagc cggaatatat     73980
     gcttcaactt gatcaaattt atgcgtctct atatcagcaa atggatcatt gaatggcccg     74040
     gtttcgggag taataaatat gtcattgctg tgagtaggag ctttagaact tgctgaaagt     74100
     gatgcttcag atttcacgat gtcagcaaca tatttcaaaa tctcttgagg gataggagat     74160
     tcgtagtcgg ccacttgata ctgggtaatc aacttttgca actgggctgg tgttaaggaa     74220
     gaacatatac cacgtagtat atcaatgtct tcaatgctgt atttccgaac ttgtaatagt     74280
     ttagatgttt ggatcaaatg ttgtaaacaa tcagttccgt ccggaacgcc atgtgtctta     74340
     caccattcct ccagccttgt tacattatag tttaactgca aacctctctt ccatgataag     74400
     aagtttctct tcatgatgag atcgttgaaa caaatagcat ctacgtagtt caataaggtg     74460
     gtaactactt tatggaatac ttcattttca atctggaatg acttcatgga ccaataaata     74520
     ctattaaaga atgttaaaat gtcatccata gtatattcct ccccagaact aaaaatttta     74580
     ttcaacaaac caccagattg tcctgcactg aaaccaggaa gagcttcaga caacacaaca     74640
     gcattaaccg ctttcttttg taactctctc tgaagtttct ttaaccaaat attgtagatg     74700
     ttgtaactca aggattcaaa atcttctttc aattctgtta ccaaagagac atattcctta     74760
     tattcgtcgt cagtcattcc actcttgaat gactcttctg ttaagataga atgctgtgca     74820
     aaaacaacaa aggagtacaa ttctctaaca tttgccaacc agaatgcacc agcaggaatt     74880
     agatcattac cttttaatgt tgtaacaact ttttgaatag tagttagaac ttgtgctagg     74940
     aatccttcac tctgtttggt taaaccaaat ctccacatct cacttaggat aataatcaga     75000
     attctagctg gatagacaac atctcttcta cttagttgca taccaacacc ggcagctggg     75060
     acttcgaagt cctttaataa accatctgtt atttcgttat tcagcacttc gatgtcttct     75120
     aacaacctga acaattcttc atttatttgt gtcaaagcat ttgaatcaga cgcatagcta     75180
     tccataccca tattagatac gcttccagca tccttactgt taacaggtct gacattcaat     75240
     tccgagccag gaccaatatc tgtaccgttg gtaacattgc gttgcatatg gatatctttt     75300
     gatggtgtct gtggcaacac atttgctgta actgtaccta aggatatttg tgtttgtaga     75360
     cgagatagtt cttccttcaa agagttcacc tcgttttgaa gatctgagtt aaaagtttga     75420
     acttcaatta attctgcttt ggtcttctct agttcttcca aatatgactt ggtagtggct     75480
     ttgtgctcct catattcttg agttaaatct agtaatttag atttgtattc ttcaacttgt     75540
     aaattagcgg catttagctc ttcttcaatt tgcttgcctt tttctgcaaa tacgtctttt     75600
     tgttctagta gttctgcatc gtgtttactc tttatctgtt ttaattcttc ctgcaatagc     75660
     gcgctttctt ccaaactagt ttgaagttca acaacacggg cacttaatga tttattctcc     75720
     ttcaccttag ctgcaagatt ttgagttaat tcaacaacct tgttttctag tttataactg     75780
     acttccttta ggtggttaac ggattttgca tccgccttta gttgttttaa ttttttctga     75840
     gcaaatcttc ttctaatcaa agattgaaca acaacagttt tgcgtctatc ctcaaggaag     75900
     gcctttctag gcttgaatga tctaactttg ctttgaatag caactgcagc atcagtctcg     75960
     tgctgaactt gagcgtgctt tcggttgagc tcctttctaa ccttcagctg tatacatctg     76020
     atactgctta ttattgatag aatttggctc cggcggcggt aacctcttag caatgactga     76080
     atttcagtag cagccttatt cttaaattct ctatcaataa tagacctcct gacttcacct     76140
     ttaacacgtt gttgaagact agtaattgca gacataatac gtaagaattc tcttctgtag     76200
     tatttagctc tgatattctt ttgtataaga acacttgaaa tatgcatttt gtcactcctc     76260
     aacttctcta ggaaagctaa cataccagct ttgaaaaata tcttagtatt acctatttga     76320
     tatttttcct tctctttaac tgtgacagca agaattttat tacatagacc aatgacatca     76380
     tcttcagtca tatccttctt ggtaaagatg aaagaccatt cggatgctgg tagaagaata     76440
     tagtatctca aaataaactc attaaaggtc catctcgaag ggaaaccagc acaagatata     76500
     cgaatagttt ccaggacacc acacgctctt aattgagata aaaccatcaa attatcaaac     76560
     ttccaggctt ctttgtcatt attaggctta atacatctaa tgtaatgcgc atttgtagat     76620
     ctgatagtag tcatcaattc tattagcgat tgtttaaaca tagaacctaa cgtgggttta     76680
     cgttgtactg ttctcattgg accaggcttt gctggtttgc tttcttgttc ggcctttttt     76740
     gcatcttcca atttattggc atttctttcc agagtgtcaa ggatattaat tagagtttca     76800
     ttcgtggatg cctttagaac ttccagatga ccatctgaaa ccgtatctct gttcttttcg     76860
     ataaaacctt caacatcata agcaacatca agagcataat gactaacaac gaacttagtc     76920
     tgaccaaatc ttggttttga aaaaacttta ttggttggag gtttgtcaag tgtctgatac     76980
     aatttctgcg tccatgattc atcagaacca gccggcagtc tactttcttc atctaaaaga     77040
     gacaagatac ctaatttgtt ttcaatcaaa tcaatgcatg gttgattatc attaaattca     77100
     ataaaagacc attcgatctg ttctttcaca tattcttcct gttctagttt gaatacatgt     77160
     tgattgaact cttgttgtag tttttcatta gcgtaattaa tacagaattg ttcgaaagag     77220
     tttttctcaa aatgttcgaa accgtaaata tctaggacac cgatgaaaga cgcaacttta     77280
     tcgacaacag cagggttaca taaaacagtg ttgatatttt cgactaacca gtcaaacaga     77340
     gccgagtaaa tgaattttgc tacagagtct ctggcaacca aagcttgaga gtaatttaaa     77400
     ttagagacaa tcttttcaga acgggtaata atttgtttct ttgtgatcca ttttgcaaag     77460
     ttgaaggagt caataccaag cagttcgcac gctattttca agttttcttc atcagaagat     77520
     aatgaggcat cgtttctagt tttcttgatt tcaatattac ctatgtgaag caaggccgcc     77580
     aggatcttaa atatatgctg ttgtgtttcg ttagaaatgc ccaccaaagt caatgcatca     77640
     accgtggtat tatattcctg tttgtcgtct acaccttcaa tcttgacgtc tccaccttgg     77700
     ttcatataat agtagtcttc tgctcccttc aaatgaagtt cagctttctc cttcggggac     77760
     aaaccggcca tcatctggta aaagatgtgg tagtttcttt ctgtttctgg ctgatatacc     77820
     agtctcgatc tctccaacag gtaagtcctt atttttgcac caatgatgga tgtgtcctta     77880
     tcgaacaaaa tttccaagta cttaccgaat ctggacgagt tgtcgtttct agtcgtcttg     77940
     gcgttaccga aggcttccat aatcgggttc gtggccagaa ttttctgttc agtctccgac     78000
     atctccacct ggtgctgtac agtcatggag ttttcttcct ctacggatgc gaagtaacgc     78060
     atgatatact tagcggagac ggtcttacca gcaccggatt caccactgac cacaattgtt     78120
     tggttctctt tgttgtcctt catgagccta taggcttctt ctgcaatggc aaacaagtgg     78180
     ggttccattt cacctctctg tttgcccgcg taggcctgga tcatgtcctg tgagtacagc     78240
     tggtcgacgc ggtcgaacgg gtttgtggcg atcagcacga taccggagta cgtgtagatg     78300
     ttcagttgcg agtaccgctg cttgatggcg tgcagcactg ctggctcgtt caagtacgac     78360
     agcgaggtca ggtcctcagt ggcctccagg ataggtggat tcctcaacaa gggcaagctc     78420
     tcgtcgctct catccgtgag gtccttggtc tcgatgttaa ccgatttacc gtcttccaag     78480
     gccaattcca tgtggtacgt gccgtctttc agatcattct tagtgacttc agcaccgatc     78540
     cacccaagct ctttgctggg ataccaacaa cgggtaccaa cttcaaagga catcttgtag     78600
     gaaagtgtca atgtgccgcc ttgaggttgg gataaggaat atggtataat gttacgcaca     78660
     tatataatat atacaagggc attgggcata gatcaaatca aaatacgtgt gctttctcga     78720
     aggatgagag aagaaagcct cagagaacaa gtgtttcgtg aacttcaaag tgcgaaatcg     78780
     atttattttg gtgtcacctg tcacatgata tgtagatcca tatcccgtag ctaattataa     78840
     gattgacatt tagggcttct tcagggcttc ttcagggctt cttcagggct tcattagggt     78900
     tttttacctt ctcaatccgg cgagagtctg ccattcagct gcaaaccata catgcctagg     78960
     tgctgcaagg caatacttgt atagctgaat agtatgtgtg tatgtgtatg tgtatgtgta     79020
     tgtgtgtgtg tggtgtgtgt ctatgtatgc atatatgtat gtgtatgtgt gtgtgccgtt     79080
     tcattgttac gtcgaggcag ttgcgggttg gaaggggggg tagcaatgac gcaatttgta     79140
     tatgaaggtg gggtgcgggg gtttctgaag ggaggtatct tgtaaatgac aaaaactgct     79200
     ctgggcaagt tgaaaaaaaa aagtatatag actcattgca taaaagacta gtatattgta     79260
     attgtaatgt aattcgacat tgattctcaa gcagtgtgta attgtagtaa taataaggta     79320
     agaatgtcgt ctgctgagaa gattgctaaa caggctcgtg tggctggtaa tgtgttgaag     79380
     actatctcgg atgagaacag gtcgaagata ttgtacagga tccgtgatgc gttggccaat     79440
     gcgaaggatg agatagagag cgcgaacaag gaggatttgg agcaggccag ggctggtggt     79500
     ttggctgact ctctagtgaa gaggctagac cttttcaaag gtgacaagtt cgatgtgatg     79560
     ttgcaaggga taagcgatgt cgctgactta gaggacccag tagggaaggt taagatggct     79620
     agagagatcg acaacggttt gatgctatac caagtgaccg caccagtggg tgtcatcctt     79680
     gtcatcttcg agtcccgtcc agaagttatc gccaacatca ccgcgttgtg tatcaagtcc     79740
     ggtaacgcgg gtatcttgaa aggtggcaaa gagtccgtca atacattcaa ggcaatggct     79800
     aaagttgtca accaaactat cgagcagtac aaggacgaaa ccggtgttcc agtgggcgct     79860
     gtccaactga tcgagaccag acaagacgtg tccgatttgc tgggccaaga cgagtacatc     79920
     gatctagttg tccctcgtgg atccaacagt ttggtcagac aaatcaaaga tagcacaaag     79980
     atccctgtct tgggccatgc tgatggtatc tgctccattt acgtggatag agacgctgat     80040
     ctggagaagg ctaaacgtat tgtactagat gcaaagacta attacccagc tggttgtaat     80100
     gctatggaag gtctactttt gaacccagac ttctcacaat gggatgatgt cctgcaccat     80160
     ttgataaccg aaggtggtgt cacaattcat gcaactactg atgtcaagga agcatttttg     80220
     aagaaactac aggattcagg taaactaaat gatgatatta aggctaaaat tgtagatgcc     80280
     aaggatggtg actttgacaa ggaatttttg tctctagact gcgctgttaa atttatccca     80340
     aacacagttg atgctataaa tcacatcaat gaacactctt caaaacatac agatgctatt     80400
     atcacagaaa gtaaggaaga tgcggaaaaa tttttgaaag gtattgactc atcaggtgta     80460
     tactggaacg cttctacaag atttgcagac ggtttcagat acggttttgg tacggaagtt     80520
     ggtatttcta cttcaaagat tcatgctcgt ggtcctgtgg gtcttgatgg attagtaact     80580
     taccaatacc aaattagagg tgacggtcaa gttgcttccg attatttggg tgctggtggt     80640
     aacaaggcct ttgttcataa agacattgat gtgaccaaca tcaaattatg attacgataa     80700
     aaaacatatc ctacaactat aggtgtaact aatatagctt ttaaaattct ataaagaaaa     80760
     atataacaaa agcaaatgtg cttattgatt atttgaagat attgaacaag gtgtctgtgg     80820
     cacagcatat ggatagacgc cttggaatat atatattttg agattagttg gagacagttg     80880
     attgctgttg ttcattctca ttttcgaatt caagctcaac ttcaatactt ttctttttga     80940
     tatccttcaa tttcctttgg tagctctcat catcatctcc ttcatcgtca gttgacgaga     81000
     aatctgagtc atcttcgtct ttgtctgagt gatcggattt gtcttccaac catttttcta     81060
     agttatccaa atcaacttct tcctcttctt cagtatcttc aatgtattcg atctctcttt     81120
     caacatcact ttcttcctct tcttcatctg cagagacgcc ttccatgtct tcctccccaa     81180
     gtttacccat gatcttattc catatatttt catcaacatt aagaggtgtc agagttttat     81240
     cagcattaga ataagcgcca ctttttaaac ggttcaaaag ctctttagag atactttcct     81300
     caatcttagc tgccactaat gcctttcttt ccctattcat ctcacgtctt ttgacctttg     81360
     gcgcaatgcc aactagtctc ttctgttctc cattcatctg taacttcaac tgtcttctct     81420
     ctaccagttt aatttgagat aatttcacat atctctgttt acaacgatgt aagaagaact     81480
     tattccaata cattaaatgc tcatcgatct gtttaagggc ttttgagtag ttgttggaga     81540
     gacgtattct ttgccacatt ttagccgggg tatgtgccct ttccggagtt tttatgcata     81600
     ggtataacct acctttatcg ccatattccc ttacagtggc atacttggag ttggccaacg     81660
     ggcatgattg cctagtaaat agcccagtaa cattataggg atccctgtca aacgtttgtc     81720
     ccactttagt cttaatctta gtagcacaaa agccatgatt aataatatcc caaattaaat     81780
     catcggaaac attcatcttc tcaaatccaa tatttacaat gaagaaaaca cagccaattt     81840
     ctattttcac acagctaaat aactttcaat tcaatgcctg gagttgaaag agcttatttt     81900
     acaaatataa taaattaggc tagtattttt ctacttttac gctggcgttt tacaaaagat     81960
     atgatacata ttccgcaagt tattcgggtt cactgatctt caactatccg tatatatacc     82020
     atgtaagttg tataacacat taatctatgg cccagctatc tgtttgcctt ttctaatgca     82080
     cccattatca gtgagctcat cgcaactttc atttcttttc agcattttgc caaaattttc     82140
     agaatttttc aatatttttt cactttgtta tcgggactcc tacggcttgc tctaagatat     82200
     tctttttttc acaatcaagg caccctattt caaataatgg cctttgcgat gagtttgaat     82260
     gctgtatgtc ctgtacaagt ttattataag tttgggggtg tctgatcaga gtttacttca     82320
     ctgcctcctg ctccaaagat agcgcatatc aaacttacaa taatcaggca gtttctagtt     82380
     ctttccacta gttgatcatc ctcattagta gcagatttct ctattcagtt ccctcgctat     82440
     tcatcatctt acaagtagct tggtctgact cctgttaagt aacaacccac tacccacttg     82500
     gttactgtga tggagaatta gatttgacaa gatcatctgt agtatgtgag atcactacgt     82560
     atcgactgat ttttctcttg aaatttcttc tgacttagac atgttgtgaa ttctgatcat     82620
     agtgatcaca tttaatatgt gggtcaaatg ccagcttgaa aatgcattaa tatagtgttg     82680
     cataaaataa gcatatatta agatactata taagaaaaag aacagcagtg gtgctaggtt     82740
     ttgaaaacag tgaaagctat acgcccccac cgatgctaaa ttttcagagg ctaggacgaa     82800
     tccagtctaa tgacaatagc aacagcacgg cacaatcaca atcgaagttt gggtctcctg     82860
     tgaagctgag gcgaggatct gaagttcaca cacctggtaa accagaggat gtgagcggaa     82920
     gacctccttg taaactaccc attgatctgg agttgaacct cgagtcccct ccatgtgttc     82980
     tttatggttc tgctacagac tcagctgggg ctgtgctttg cggtcagttt gttctgagag     83040
     ttaaggatcc ccaaagtgag aatttcatat actctgttga taaccaagaa catggtggta     83100
     gaaacgcaac gcagcacgaa accggctata ataacatcac aataacctcc gttcacttaa     83160
     aatttgttca aaaagttact tataataagc ctttcattcc tgattcaagt atatccgcat     83220
     catccacagc attacaactt ccagcaaatg ctactggtaa catcataaac tgtaagaatt     83280
     gtaaagtcaa gtacacatct ttgaaatcgt ggaacataca atcaacaaag aaacttatca     83340
     caattggcaa gcatgcatac ccattttcgt atttagtacc gggatctgta ccttcaacat     83400
     cagctcttgg tttatcggcc aacacaaaga tacaatacga actcgttggt aatgtttcat     83460
     attatgatcc agtgcataag gacaaggaat atatgttgaa cattaaaatg cccataccag     83520
     taacaagaag catccatcgt ggtccagata agaactcgct gcgtgttttc ccacctacac     83580
     aattgactgc ggcggctgtc ttgccaaatg tcgtttatcc aaaatcaaca tttccattag     83640
     aaatgaaact caatggtata tcttcgcctt caaccgggaa aggctcagac aaaagatgga     83700
     ggatgagaaa attggcgtgg agagtagaag aaactacaag agtcaagacc aatgtttgta     83760
     cccagcataa acccgatttg aagaagttgg aggatcaggt gaaactgaaa gaagaagagc     83820
     gtagcaaaaa acctcctgtt cctataaaac gttatggtga tatcgggcct caaataagaa     83880
     tcgccctgag ttcaccttcc aatatgccgt tgtctggtgg aagatcagga ccacaaccga     83940
     ctttgacgtc tagtgaggaa gctccaaatt ctgccacttt gtcatctaga gaaggtgaag     84000
     ctggtaacat agatactgat gaaaatgaga ctactgatca atttgttcat ccaagcgatg     84060
     atgccatgag acaagaatta cttcagcaac aacaacggca acgtgaacag caattaaagc     84120
     aggaactaaa aaatagtagt gccttatttt cagaagaggt acgtataata tcgaaaggcg     84180
     agatgaaaag tggatggaag acagactttg atagtgataa cggaaaagtt gaacttgtaa     84240
     ccgatataga tttgcttcat tctaattctg gtgtttctaa tccaataatg catacatcaa     84300
     caacgcatcc atataagaag aaacctgatc taccacctgt taccattgct tgtgatattc     84360
     aggatcctaa tcttggtatt tatgtcaatc atacattggc catcgaaatt gttgtggccg     84420
     aagaagcatt gcaatatgct aatggtcagc caattcgaaa tggaggcagc agaagatcat     84480
     ctgtgattcc cgaaggttcg aaacctgagg gtactacgga aaatatgaat gatgatgatg     84540
     atgacagccg tgagatggat caaaggctat tggaactgtc acctatgttt gccaatagaa     84600
     acgctcaaag ggccaaaccg gttgaataca acgacctctc tcctgtgaat tctcgctcta     84660
     gtacgaggtc tggaaacaat actggaagga ttacaccaca tatgtcttct acgccaagga     84720
     tagtgagtgt tccaacaggc gcagctaggg ttcttagaat gcagttcaga attaatgtta     84780
     ctgagagatc tggacttggc atatcatggg atgaagaagt tccacccatg taccatgaaa     84840
     tccaaacaaa tgcgcctcct tcatatgagg cagcattgaa agattctggt ggtgtccaga     84900
     ttgttgataa ctccgaagac ctgggagagg aacctgaaca tcaaactcct attattgcat     84960
     ttccacctat ggcacaccac aataactcca atataagaaa caacttaacg acagtacaat     85020
     ctcctcaact tgaaaacata atcagtatac aaggtgctgt tccatatggt agagggtcgc     85080
     cattaacacc aaacaatacc attgaaatgg gtattagaaa tctttctgag gtccttgata     85140
     ctgaccgtat cacccaataa aacgagaaca tatatatttt gcattatttt tacataaaac     85200
     aaccgacact ggaccgttaa gatgctttaa atatgttaca cactgaagtt tcttttgcat     85260
     taaactttct taataaaaca attacgcata taataaatta tatgttatat agtataattc     85320
     aacagctata cagtcgttgt tcattacatt aacgtccaat tgcaacgtcg gtgattctaa     85380
     tattaaagca caataatgtt ttttcgtact atcgttaaga tctatttact gaattgaaca     85440
     catagttata attacacgac atcccagttc ttcatccagt tcaagtgctt atagttttca     85500
     agtttaccgg tcataccata agagaatgga gcaaatagta tgaagccacc aatgacaaca     85560
     gacatgtaac cggcataaat acagaattta atgatccttt gagtctttgt cttgttgtag     85620
     tatcttaatc cagcgtcgaa gatatatgcc aagacaaaga gtgcgaagta caaagcaggt     85680
     aagtaatggt gaacatactt aactctaccc ataatgacaa atgggaagaa atgcaaaaac     85740
     caaccaagca atggataaac accaccataa ataaatagtt cttcatcatg ttcattttgg     85800
     aagatttgca tttgtctatt ccatttcaaa actttgtaaa gtagtgcaaa taccaagaac     85860
     aatacagcaa ctgtagatgg ccaggtagaa gcaggagaac ctaataacaa atatctggtg     85920
     tcattctcat tccaggagtt aattcttaga gaacggtaca aagttggcca ttcccaggac     85980
     tcagatctta agtagtcatg tttatccttg gaaacagtta aggcgttgtt tgtagccatc     86040
     attctcttat tcaattcaaa gaaatcgctc cagaatgatc ttcttgggta aatgaagttt     86100
     tctggggcct ctaggttagg gtgagtgtga gtgtcaacga tccacatagt cttgatatca     86160
     ttcttctcag gttccctgat acatctgact tcagcttggc taaaacccca ttctggtaga     86220
     tgctcattac tttgagccaa gtaacagttc aagaccgcgt gtctgaaacg aacatgagta     86280
     gtgattggat ggatcaagtt tttgtcctcg ttaccgtcat ccttaatgat ttcaacgacc     86340
     cagtgatcct tcaagtcccc gatggtcaag ttaccgtaac ctgacacttc gtaatccagt     86400
     ttgttcaaag gtgcttccac ttggtgtgag tgcaagttag aaccagtacc tttgtgaacc     86460
     agacggattg tgtcaccgtt gcggatggct tcatgctctg tgtcgttgac gtgccagatt     86520
     ggctttccgt gtggtctata gacaatccag tcgttgtttc cgtcgacgta gttgtagcag     86580
     gtaacttgtc tctgtttgga gccctctggg taggtctggt ggtgggagtg caagtaggca     86640
     ccgcggggct tcatgttctg caaagtgata gtggagccga tggacacgtc acgagggccc     86700
     tgaccgatgt tagtgccgtt tagcgctgct tggaatcttg ggggcatttc atggtcgcct     86760
     gggcctgagc cccacagcaa agcaaagtgt attttgaagc acagggcgaa gatgaggaat     86820
     ggggtgacga tgaggcagat gatgcgagcg atccagtggt tagcgtagcg cttccaggtg     86880
     atgttcttgt cgccgaggag tgtccacagc tctacgatgg tgtggatgcc gactaaagtg     86940
     atcacgaaca ggcccaccat tttcacggaa atggcgcagc ccatggaagc accggttagg     87000
     aacagccaca agcaccactg gaatgagaat ggctttctgt ggtagctgtg gaatttctgg     87060
     aagcacatga aggtagcgac ggtgaagaac aacagcaagg agtccagcaa gatcagtttt     87120
     cctaaggttg tgtaggagtt ttcgcacaac accagtatgg tggtcagcca cactgttggc     87180
     aaggagaaac cgatggcctt ggctgcgaag tacgtcatag gcacacacag cgctgagacg     87240
     gcaccttgga agattctcat tttgacgaaa ggcacgtagt ctgggtaagg ctggccggag     87300
     gggaagtccc aggagccatt gtagccggcc aagtagccgg agaagcccac cagcatctta     87360
     cccaatggtg gatgcacgtc gtggtagaaa gtgtgacgca ggtagtaaga gccgaacttc     87420
     ccgaagtgcg cttcatccca ggtcactttc ttaaccacgt cgagcctgta cagtctcacc     87480
     agcagcgcca gcaaggtgaa cacaataggc atggctacgc gctcgagtct gagccagaat     87540
     tgcttgttcg acgccttctg ctctttgttg tcgttggcaa ggtcgtggcc gtggtcgtgc     87600
     tcgaccttga cctcggagac agaaggagcc tttctcgccc tcaattccga atccatgatt     87660
     gtctgttttg tcgtagttgt cggtgtttca ctctgctaga cacatattac aatttcaaga     87720
     ctgttttaca tatgctgcat atttttgcgt caattataag caagagctcg acctctcgga     87780
     tgccaatccc accgtgcacc gcatccatca cgttttcgtt gttgtgtatg tggataaaga     87840
     gcattaccca aacacaactt atacacttcc cacatcctca ccttcctcac tatccgcacc     87900
     atccgcacca tcatccaaac ttcccacaac cacttgctct gttccacact attaacttct     87960
     acagttacag ctccaactac tacaccatgc acaggcgggc catcgaacaa tggaagtgat     88020
     cggcggtgat ctgcgctttt caccgctccc cacacgcctc tctgagactt atctccccag     88080
     tgccacagaa ccccccgcag caagctaccg caaaaacccg catccctgtc aaaaagcaat     88140
     cgagcttccc acgaaaaccc ctcagaggac gcgcagcgtc ccatgtagga tcaaacaccc     88200
     gcaaaagcac agaagaacca gcaggccgcc ccccgattgt cctttgtgtg gcttacgtct     88260
     ttgcgaagtg cgggtgtgtc gcgccggacg catcgtggtg ggctacattg caaagtcacc     88320
     cacaacatcg caggtcgcaa ccgcaacggg cgcaacgggc gcactgatgg aagctccgtc     88380
     ctatataaga gcagtttggc gggcttctcg tagtgtgaac atggggggga tatagacgga     88440
     gccaagggta ataatgtcgt tggatgtgtc ggtgcgggag cgcacacgga acatgaacca     88500
     gcttatgcgg atactgatgg atatcaacca cttgaacggg ggtgattctg gtgtgctgga     88560
     gaagttgcgg ctgtcggcgc ggaacttcga gagtgccata tatgagaaga gctcgacgaa     88620
     gcaggagtac atggcgagca tgcgggagaa gatcgagggc atgcagcaga cgctgcagca     88680
     gaagaagcac acgcccgcta cgccatcaca acaagtacct ccgccacaac aacaacaaca     88740
     acaacaagga tcacagccga ggattacact gactccgcag caacagcagc tgctgctctc     88800
     gaagatgcag cttgcggtta tcccgcagca gttgctctct aagataccga acctgccggc     88860
     gggggtcagc acttggaagg acgtcactga actggcgtcg aaaaacatgc tcgaccaacg     88920
     taccatggag atagtcagag gtgtgtacaa agtgcaccag cagctgcttc tgaaagcgtc     88980
     gtttgagcag cagcggaaaa gacagccacc tcaacaacaa cagccacaac agccacaaca     89040
     gcagcaacag caacagcaac agcagcaaca gcaacagcag caacagcaac agcagcaaca     89100
     gtccccacag aatgtaacaa atggtaacct tttccacatc ttgctgcgct tatttcagga     89160
     cgagtttctg tcgtcaaagt accaagagca attaagtaag ctgttcaaga tggaggagat     89220
     aaaacatatt atacagcagg caatagaagt agggaagaag tatgcaacac agcggtacca     89280
     gttgggacac atgctgacca atgaggaaag agttgttttc tttaaaaagt ttctgaatca     89340
     cgttatcttg aagaagatgg aagagaccaa aggaagcaac aagaccgacg ctacaatgat     89400
     gaatctaacc gacaatcaca ctcagatggg aactgggcag gagtcgactg tacctcagca     89460
     gtttaacaca gatcaggtga tttcaaataa tcagatgcca gtgaataatt tcaacatgaa     89520
     catgaataat aatcaaatgc ctcaacaacc gttccagcag cagatgcctc aactaactct     89580
     acagcaacag caaaacttgt tccagcagca gttacaacaa caacaacaac aacagcagca     89640
     gcagcagcaa cagcagcagc aagcacaaat tcaagctcaa cagcaacaac aacagcagca     89700
     gcaacagcaa cagcagcaac aacaacaaca acagcagcag cagcagttgc taatgcaaaa     89760
     tcttgctgca actaaattgg atatcgaaga gatacggaac atctcaatga aagcagctaa     89820
     attgcagtta caactgactg acttgaccaa cactttaact aacgaggaga aagatgccat     89880
     taggagcaga ttaaagacaa atcaaaagtt gtttgttcag gttagcaatt ttgcaccaca     89940
     ggtatacatg atgactaaat cgaagaactt tctaaaagaa gtctttcaac ttagaatatt     90000
     tgtaaaggaa atacttgaaa aatgtgctaa tggaatattt gtggtgaagc tggaaactgt     90060
     tgacaaactg ataatgaaat atcaaaggta ttgggatagt atgagagtgc aactactgcg     90120
     gagacaatct caaacaaaac aacaagaaat acagggtgct ctgcagcaaa tgcaaagagt     90180
     agaggcacaa aacaacaaca acaataacaa ttataataat aataataata ataatagcac     90240
     taacaacaat accaacaata acccacaaat gcccaacctc aataactcta acataattac     90300
     aaacttctca actcctttcc aggtacctat tgctacacca aataatatca ctaatgcagt     90360
     caaaaaggaa tcgaggaaac cgtcggtctc agcatccaat gcctccactc caggaacgac     90420
     ttctggtaaa gccaaaccaa aatccaggag taatagacaa aattcgaggt caaattcaat     90480
     aaatgaagtt tcatctgact caaccaaaca accccagaca actgaggctg tttcaaagga     90540
     ggaagcggct aagatacatg aagcaaatgt aagaaagagt gaaattttat ctcgctttaa     90600
     gcatagacaa aagctcttta ttacatctcc tgctgatctg tttttgtcaa ctcttggtga     90660
     ctgtctaggt ttgaaatgtg aagaaattga aacaagctac aaaattccaa aaaacatggc     90720
     agattttatt aacggtgtca agataagcaa gactgaacaa agaattcgaa cgcaagatac     90780
     cgttgtcaca tctgttgtgg ataataaact tctgatgcag agtaaaactg ggggtgacaa     90840
     aagaacgtat ggtatagatc cagccgctct ttcggctgta ttcaaggggg tacaaggtac     90900
     aactaatatg aatacactac aattattcag ttcttcttct ttatctcccg ttactgagga     90960
     aaatgcatga aataataatc agaaaaaaag gcggcttgat caatccgaaa taagcccggc     91020
     gaattctaat gtaactacaa gtactgattc cacaactatg ggtgagtcaa aaaaactccg     91080
     aattgagaca cctgaagaac ctcttatatc agctaatcat ggtaatatca atccaaaaca     91140
     gaaaattaat acagcaaatc caaatgataa caatgtatgg gactggaatt attgggaatc     91200
     tgccatgatg tagagacccc aaattattat ttcttaaatc aacaatattc aattagtacc     91260
     aaattttttt tttttattct tttgttttca taatcagcct attttcatct tattttcaac     91320
     ctatttacga ccacattcta taatttaatt tatcagtttc ttataatttt atacaaaatc     91380
     ggagaagtat gacttccacc tttaatacaa ggatgactag tatgatgctg tcttctaaac     91440
     ttcaatgttt tgtgctatgc aagaaaaata gactatttta attatttaaa attaatgtgt     91500
     tgtagttcat tataatgata tgatgatagt tatcattatg catgcttaat aatctttaat     91560
     gttacattcc agtagagtta tcaatgcatt agcattcgat cattaggtaa taatcgttgg     91620
     gtacgtgata atctgtgggc cacagttttc caatgccatc agataaatta gcaatattaa     91680
     tgccatgact tccgtctgaa cttgagctct atttctatta taagaatcac tttcttaagg     91740
     aattgagtat atcgttgctt gtctttaccg aagataccat cgtttactag ctttaaacta     91800
     gtacatttct atcgttggct tatttgacgc catgaccgaa ccaattgtac cacaggcatt     91860
     aacaaatgag gaattggaga aacaaatttt accagaaaca taccaatggg ctctgtcaaa     91920
     tggtttatta atgtacccac ctgattttca attgacccag gctcaaattg ctccattcac     91980
     cctttaccca acaccaattg ccagaaaaaa cttcgaagaa gccattgaag tccagcagag     92040
     ctttaatgaa ttatacgctg aaatttcaag agatcaggga gagcattggc tatctcaaga     92100
     aacagagaag ctagctcatt cggatgaggg ctttactggc aaattatggg atttgtataa     92160
     gtcagtgagg aatgaaggta ttgcacaaaa actcagatta ggaattttca gatcagatta     92220
     cctcattgac aaaaatattg atcaaatcaa gcaagttgaa tttaacacag tgtctgtatc     92280
     atttgttgga ttttccacta gagtaggaga agttcataaa tatctgaatg actcaggtgc     92340
     ttacggtaaa tcatcctatg ctgacaaaga tattccagtt ccaacctctg ttcaggaaat     92400
     gactaaatct tttgctgatg ctttccagaa gtacgatgca ttgaatgatg aaaagaagat     92460
     catactaatg gtggttcaaa gaggagaaag aaatgttttt gatcaaagaa taattgaata     92520
     ttcccttcaa aaggactatg gtatccgtgt cattagaatg acatttgatg atattatatc     92580
     tagattaacc tcagataatg ctgacaaaaa ccgactattt ttcaaagaga ctggtgatga     92640
     aattgctatt gtctactaca ggaccggcta cacaacaact gactatcaga atgagcaaga     92700
     ttgggaagca agaaaattct tagaaaaaag ctacgctatt aaagctccag atttactaac     92760
     tcaattatca ggtgctaaaa agatacaaca attattgacc gatgataata ttctatctca     92820
     atttgtgaag tctgaaaact ctagaagagc tctacaaaag actttcgtaa agatatatcc     92880
     cttagatgat tcagagttgg ggaatattgg taagaaacta gcttttgatg aacctcatcg     92940
     ttttgtgctg aaaccccaac gtgaaggtgg tggtaataac gtctacaagg aagacattcc     93000
     atcattcttg agtacaattg gtgaatctaa gtgggatgca tacatattga tggagattat     93060
     tgacccatta ccatatgaaa ataacgtcat tattcgagga aatgaaattt tcaaagaatc     93120
     aataattagt gagcttggta tatatggttc cattctcttc gatgatgaga aaatacactt     93180
     caacagaaac agcggatggc ttttgagatc caagttcact acttctaatg aaggtggggt     93240
     tgcagccggt tttggctgtt tagatagtgt cgtgatgtat taacctctga aactaattac     93300
     tattttttgg ataattggta tacctagata aacgataatg gtggctctta tattatgggc     93360
     ataacagtat actatttttg taacacagca tacatatttt ctagcacaat tttctttttc     93420
     aattcatgat agatatggat acatatatta aactatagaa ctttctgttc ttttttaacc     93480
     agatccgcag accaaatcgc tgctccgact gtgttactca taattgttac catagaggcc     93540
     aaaggaatta attcaaatag gcccgcagat acaccaaagc aagctaactg acccagattt     93600
     ttgtatttga actttttgat gtctgggctt gtatattgct tcaagaatag ataacgactt     93660
     agatagctta gtgccctatc cggtgctgtt atttggttaa ctatcaaagg gcctaatact     93720
     ggaatgaggg atactaatga caaaacgata gattgtccca agctagtaac ttttgccgaa     93780
     aggaatgaat atattattgt gtgtgcagac caaatagatc tccgtgactt agtagtcttt     93840
     ctgctgagat attttgcatc agagactaac ttttgttggc cgttcttggc caaagtaagg     93900
     tcgaagacct cagtgttcag tttttcgagc atcaagttcc tacatatata agcagcgata     93960
     gaattagact gaactagcca ttgtatgtga gctagaacga gaccaatagg acccatagtt     94020
     aacaaggcac ctcccagaat aaagggcata attgtgacat aatatgcacc tgctaccaca     94080
     gcaaatatta ctagatatga tccggcaaat atacctagcg gtttccaata gtaaggcctt     94140
     gtgataacat taaatagacc ctagaatgag taaaagatgc catctcatcc agcgaactct     94200
     cagagatgat tgagaatttg atagataaaa caagcaaatc tgaatgttag taaagttgtt     94260
     ttgtgttttt aggttgttgc tcactttaac taaaacatac ctttagtggg tacttgtatg     94320
     tactcgatag gaacaaatct ttgttgaacc cttgttttat caaatccatc ttgaatagat     94380
     acctcttttg tctcaatttt gcgtgatcta atactggagt gaagagatac tgttgtaaat     94440
     agccagcaat acccatttta aatatgaatt aatttataag aataatatta atagaaaata     94500
     gatgaatcga tataattttt gcaaatgagg gggtggggtt gtattgcgtt aacaagtaaa     94560
     aatgctaatt atcgaaaatt tggtcaaaca atgctagagg actaaaagta aatgaacccc     94620
     ccgatgtatt acagctaata ttattgccat atgcccaagg ggacccttga tgatcaaagg     94680
     ccatcgcaaa ttgatgataa ttaaattagt tttttaaatc tgtaaaaagt agtcacacgc     94740
     agaaattgcc gtagtcaaga cacatctcct catacataag actaaaaggg catagaaagg     94800
     gtacttgact agatagagct ctcggagttt agaacatcca ctagcgggta tttgcaatgt     94860
     agcatttgtt gatctgtttt aaggttatgg tataggaaat acattaacga atctttagct     94920
     atctatgtaa aggtttcaag ttttaggtgc tatgtagact cctgtggttg tatagggccg     94980
     aatttctttg tccttaattt tacttcttct tttaactctc ttgcgctcca aagcgatgcg     95040
     cccacaaaca agcttggttg gaggtatcct gagagaaatg gaagggactc tatgactgcg     95100
     caagctactc catatagata ccatttacta tagttctggt agtatacttt tcttagttct     95160
     ttctcatcca tctttcgtag ttctttgaaa taaggctgga aatatgcgaa cccattttgt     95220
     cctgcaaaga ttaattgaac tattgtgatt ccaaaaaatg gtataaagaa gcatgcaact     95280
     ataaatatat agtccagaat ttcaattgat ctatctatca agaaattggg aagtgtatct     95340
     acaaggaact ctgcgcttgt aattcttctc cacagtctga tattggtgtc gccttggaaa     95400
     atgtttatgg tctgtgtgaa aacaacaaat tgatttaagt ttaaagtggt gaaaacattt     95460
     cccaaaacta gggcacctaa tttatcagtg tctcttctgg tgtccataag ggccaagtaa     95520
     ttgcttacaa gaataacttg tacaatcact agcgcaattg caatgggacc caaaaacaaa     95580
     gaataaacca tagtcattgc aggcccaaat actaaagcaa aagtagagcc atctgcaacc     95640
     atgcacatta aatattttaa cgtcatcgta gatggaccgt tctcagaagt accgttttta     95700
     tagtcaaatg ttatgccctt aaaaggataa aagaaaattt cctttttggt ttgaaagtct     95760
     tctgttatac ttttcttcaa gagtgtcatg tttccctggt actcgtcaaa tctatcttta     95820
     taggcattga attttctctg gaatatattc atctctttgt tggattgttt cttttgccat     95880
     agttctcgaa ccttgagctt attcttttcc ctctcgatca catcatctcc aggtagtggc     95940
     tgtagcttca gccctttcat aggttttgga ttcacatatt cggggttatt cagatgagta     96000
     tattctgggc catgtatttc acaaggctca gtgataaaat caaacttata gggcggatcg     96060
     acatttaaat tcatggtttc ttaatatttc taaatcgctt ggtagattga atcagtactt     96120
     tggaaaccct gttaggatag aatatttatg attatgctaa gtactgctac attataatat     96180
     aagaatagtt ggttttagtt gtcatccgca gtaattcttc ttaatgtatt atgtcgagtg     96240
     acacaaaata ttaaaactac tacccgtaac ccaaaaaaac aatgagcggt tcagctctct     96300
     acttgaagtc caaaacagaa gaaaactcgt ttttgctctg gccaaaatct acgttatatt     96360
     tataaaatta ttaagtaatt aatcaatcac taaagctaac agttattttc ttatccatga     96420
     gcacgctctc cgatgtcacc taacatgggt aacgatgctt atccgtagtc catggttact     96480
     taatgcatgc tctaagagta aatgacaggg atgtatatgc acctgcaacg tttgtaacca     96540
     agtgcacttg cactattgct aactccagtt tttgtacttc aagagcacca ttgtttccat     96600
     tgtgtaaaag aaatgttgct gctgaaaaaa tgctgaaaaa aaaaagaaag agctgaaaac     96660
     gtggaaatat cgagatgagc taaccagaaa tgacaatttc ttccgatgaa taagctctct     96720
     tagaagtctt ccacatatta tgaggtttaa tagctgatat atatagttat aaattctctt     96780
     ttgtacagca aataatcacg gatatttttt caaatacaac aggacttgag cacgaggcat     96840
     atagtactag agagggttat atcttttttg tgaaatactt gatagaagat aagaacttga     96900
     cttaccatct gataaagaaa tatattacta gactttgatt gttattttta ttgacacacc     96960
     cttttgagaa agtttcttgc gttatattta ttttacagaa aggcgctgag atattattag     97020
     ctatgccata cgcagggact tcagactcgt ctagagctgc tttcaaggcg tttcaagaga     97080
     agcatatcac caaggatacc atatttaata agaagtttga tcttgcgtcg ataccgtcat     97140
     ctgcatctgc gtccgataca tctttgagtt tcaagaatat aagccgaggt aactcctatg     97200
     tggatcttca aaggcctagt cctttttata ggcatgagaa tggatcttcg gaatcagtta     97260
     aaagtagctc agaaaaattt gactacaaag agcttatatc acttcctaat gagtctacac     97320
     atgcatactc atgtaatcct ttgtctccga tttcgctgta cgttagacta tctatcctaa     97380
     agagagcttt agatatcatg gctaatgacc ccgatatgct agaagagagt aaagcggtag     97440
     agcctttaaa gagaatgaag gcatctaata cagcagatgt tacccatgta gcacacttgc     97500
     aggaaatgat taatgagaaa aataatgaag aggacatggt aactttgcca aagagaggga     97560
     gtgttaccaa atggaactct catgcagcta ctttagaggc atttgtatcg aatagcatgg     97620
     ataaaagtgc tcaacctaat agcaaatatg gggatctcac aaatgaagat tcacaaatcc     97680
     cagaaaggcc agtgcaaatg caaagagcgg tatcattggc agttttaccg cagagtatat     97740
     ctaatcatag caataattca ccgttcaaaa aggattttaa ttttcgtggg acccaatctg     97800
     gcactaaatt cagacataat aaagacatat tggaaggttt acgaaaactt ttggatgata     97860
     cattagaaaa aaaatcaatg agcaacgcat caaagttgca taaattatca ctcttaaata     97920
     ttgacaagtt ggacctgact tcggtaccaa cagatggcaa tgatgataca atcaatgatg     97980
     tggaagaaaa agggaacaag ttaaaacggg ctttactaga cagtttagcc gaacccttca     98040
     ttgaatttgg tcgtgaaaac gataatatgc aggacgatca atataaaaaa ttaaatgaac     98100
     aagatctgaa tatcaacatg tctgaagtgg tacggcaata tcgctataat aaagtgttgc     98160
     atccttttac ttcaggaaag aactctgcac cacaagcaat ttttacctgt tctgatcaac     98220
     atccctggaa ctttaaagct gcaaacgatt tggcgtgttt gacttttggt attaacaaaa     98280
     atgtcctgaa agctttaact ctccttgatc ttattcacac agattgtaga aattttgctc     98340
     tgaataaact cattagtatt caagatgatc aagatattgt ttttagtggg gaaattatag     98400
     ccatagtaca acctaattca gaaaataagg ctggattgat atgggcaacc atttgggcaa     98460
     gaagaataaa aggttccttg gtttgtgttt ttgagaagat tccatgtgat tacgcagata     98520
     ttatgttaaa tttagatgac ttttccgttg aaaacattaa cgattctacc ggtttgcttt     98580
     ccaaccttga ccaaaataca gaaaatgata ttacagtaac cgaaagtgat gaattagaaa     98640
     aaaagaagac tgtgaaattt gcaaacgaag tacatgatat caaaaaagtg agtaagtcct     98700
     tatcgaaact aattaaagac gtatgtacag gaaattatga tatggatgag gatgataagt     98760
     tagtaccact gtcaattcgg gtatcgaatg agattaatag aagaagatac tttacattaa     98820
     atcattcaaa ttataacata tcatgtgctg tatcctcgtc tgtgttggaa aatgagctaa     98880
     aactgaagat tcatagtgcc gcttatcaag ttggtttgtt cattattgaa agagaaactt     98940
     tgaagcttgt ttcttgtaac aaatcaatct gcaagaatat gtttggttat catacttctg     99000
     aaattatcaa ctctgatatt actaccttga ttcctgatct cgccaaaatt cttgccttta     99060
     ttcaatatca gtatccgatt ttagacttca gtgctgaaga gaacagagga ttggttctta     99120
     ctgagcattt tttcagaaag attgtttctg aaatgcattc tgatcctgga agcttttact     99180
     cttctgttgg gttggatggg cttcataaag acggaaataa cattaaggtt gattttcaaa     99240
     ttagagtatt ggatgaaaat atctttctat tatggatttc tcaaacaaga gacctgttat     99300
     ttgaaaatta tgattcgaat ccttctcagc taagcatgtt gaaagagagt gaactttcac     99360
     tagttagcag tagaagtagt tcgtcgtcct caaagaggcc aactgaatgt ttagcgttat     99420
     ctgcgctaaa gagaattgat agcttggcta ttgctgatca aggtatagaa gatgaaactt     99480
     gtgagcataa tgaaaacaga tgtaattcta tcgaaaaaca gtccgtggct atttctaata     99540
     gtaataaaga agcacatcca ccaaaaaata gtgaactaaa aaatactgtc gatattattg     99600
     ataatgatct gatttctgat cctacaatca gagcaaatat cgaattggct agaagatata     99660
     caaataacaa atcagatttt gtcaaggaag ataattttaa acttgatgaa gaaatgataa     99720
     agaaaattgt aaacacggag attccagagg tggctaatgc tgactctaac ttagcgccgg     99780
     aagaactctt gaaggtgttg aacataaaag aaccaattgt gattggggcc caaaaaagga     99840
     agaaaaagta ctccgatttt gttgtcctac aaaagatggg agaaggggca tatggaaaag     99900
     ttaacttatg tattcacaaa gaaaagaaat atattgttgt gattaagatg attttcaagg     99960
     aaagaatttt ggtggacacc tgggttagag atagaaaact aggtaccatt ccatcagaaa    100020
     ttcaaatatt agcgacaatt aataagagac ctcacgagaa cattcttggt ttgttggact    100080
     tctttgaaga tgacgattac tactacttag aaactcctcc tcacggtcaa actggtagtg    100140
     tagatttatt tgacatcatt gagttcaagt caaacatgac tgaatttgaa gcaaaattga    100200
     tctttaagca aattgttagc ggtatcaagc atttgcacga ccaagggatt gttcatagag    100260
     atataaagga tgaaaatgtt attgttgact ccaagggttt tgtaaagttg attgattttg    100320
     gttctgctgc ctacgtgaaa agtggtccct tcgatgtttt cgttggtact attgactatg    100380
     ctgctccgga ggttcttggt ggtaatccat atgagggcaa atcgcaagac atatgggcca    100440
     tcggtatctt attgtatact ttgatctaca aggaaaatcc attttacaat atagatgaga    100500
     tattagaagg agaacttaga ttcaatgata gcgcggatgt tagtcaggaa tgtaaagcat    100560
     tgattacaaa gatattaaat cgctgtgttc gtaaaaggcc aacaattgac gagatttgcc    100620
     aagatgtatg gcttcaaatt taaaaaaaaa atgtctggta cattattctg tgtgctgttg    100680
     aatttgtaac tacgttcctt agtagtggtg gagcaatgtg tttgtatcaa ggatagaaaa    100740
     cagatactct acattgggtt ataaattttt ttgatttcat tttcgaggtt tggatatatt    100800
     taattgaagt tttcattcaa tttttttttt ttttgctgta ttgaccttgt ttaacaactt    100860
     taaatttgca tttagttgaa ttgcttttgt tattgaattt tagttttttt attcacataa    100920
     ttttttacat aataccgttt atattgcatg attttaatac taatgactaa ctaatttgtt    100980
     atgagaagta acgcaacaac agttgttacc acaaatacta atttgaagta gtagcatatc    101040
     ctcgaggttt tttatcaggt tcttccttac caactgctcg tcggtttaaa gttgggtttt    101100
     ccgaacatcg gggttactgg cctttaaaaa ataaggttaa atacagcttt aaatgtcata    101160
     caatgtgtat atgcaatgac tcaatttgat atcggtaagg atataatcag ttagttacca    101220
     gaattacaga tgcagttaaa ggaagatacg gtgaacatgt ctaacgtttt gccagaatct    101280
     accatgacca cagttcagaa tctgctggat gatgatgatt ttagtgatga gcctgctatg    101340
     agtccctatc aaaatgatga taataccagc gatgagtact acaattgttt agatttattt    101400
     atcaagggag agcctaagca gtgtttggaa gctatgctga gctgtggctt gctaaatgaa    101460
     tcccagattt ttcagaacat ggacagcgtg gagttattca ttaatgcatg ctctagggta    101520
     tcagacttgg caactctagg tatatctttg caaaacaaga tcatacagct gtttatttat    101580
     agtgagattc tagaatttgt acgacgcaat tccccagctg catctgcctt ggcgttaatt    101640
     acaaaactcc atggtaatat aattagagct atcgggctaa tgagaggaag tagagatgaa    101700
     cgttatcaaa taatagctga tgagaaagat gcattgatcc atgatattgg atttcatgtc    101760
     aagaaacgga caaacgagag taggaggcaa tataatgtgg aaatgttgat gcttgcagaa    101820
     ttatatctat ttgatgtcca gatacagcta gagggcaaga aaaaatcacc aaaattatat    101880
     gaggatcttt gtgacaaagt attgcaatta aagagtgtct ttgatgagac agtgcttgac    101940
     gaaaagccac ttagtcagat tatattggct aagttggaac aaaagaagga ttcggtagag    102000
     aaaaagaagt catcttctcg aaagagtctt agagagagta caaaagtgtt acaagcaata    102060
     cccacgccgt ctgacgaggt tcgagatcaa ataaagatgg ataacttggc attatctaag    102120
     ggagcattca gctctattac gagtcacatt ccccaaaaat ggttaaaagc tttaaccacc    102180
     caaaaatgga tttataaaaa catgaaacag ctctcattgg tgctagttgt agcggttatc    102240
     ttactggtta aaaggtatag aatgattaca aaatggtttg gagagatccc ttcaacatta    102300
     tctcaattaa aacctgccat agttgaaatc ctacgcttgc tatccagcct atagatcgac    102360
     tataataacc atgtcacagt accctttatt agcttcaaat aaaaatatta atcactgtaa    102420
     ttacctttga caatggattg gcaaatatat tggatggtta aatgcaactc catgtacatg    102480
     actctacaga agtaggtaaa ctttatattc tacatcatat atatcatata taacgaagta    102540
     tattttgctt gttatttttc tcaagaagtt ttgttagttg tgaaatccgc aaaggcacct    102600
     tttgccaggt ttcagttcga acaccagttc tctaatctcg aacaaacaat tgaaccacat    102660
     ctacataaac tgaggatgtt tcttgcattg ttggatttaa tagggacagg gtcaagtact    102720
     gaaagtaata aaaggtgaca ttttctgtat ataccacgcg tgaaggaagt caagtagaca    102780
     catacccgaa agaaagcgtg acgtttgtaa ccctattcga caggtgtgct ggaagacttt    102840
     gatttgctat agacctctta tttggtacaa gaaagagata agctgacagg attcagttgc    102900
     ttagaggaaa ttataccaac tgttagttag gaaactgcat ttttgatcag aaaggatggc    102960
     cgataatcag aacggaaatg aaggggatct gcacccacta gccttgttga tggatgagtt    103020
     gaagcacgat gatattgcta atagggttga ggccatgaaa aagttggata ccatagccat    103080
     tgctctaggt ccagaaagaa ctagggagga attgattcct tttcttactg aagtggccca    103140
     agatgacgag gatgaggtct tcgccgtctt ggctgaggaa ttagggaaat tcgttccttt    103200
     agtaggcggt agtcaatata ttaatgtctt atttcctaca ttggaaatac ttgcagctac    103260
     agaggagaca ttggtaagag aaaaagccct agcatctttg aataaagttg tcaaagacat    103320
     gacaattgag caattactac atgactatgt tcctttactg gacaggttgg ccaacgctga    103380
     ctggttctca tcaaaagttt ctgcatgtgg tcttttcaaa gttgtgataa gtagggtcaa    103440
     ggatgataca ttgagaaaaa atttactggc tttatactca caattgatac aagatgacac    103500
     acctatggtc aggagagctg cagcaagaaa cttaccatcc attattgacc aactacgaga    103560
     aaatcccggt ctttcatgtg aagacgattg ggaatacgta tccgagatgt tcaagaaagt    103620
     tattactgat aatcaagact cagttaagtt tcttgctgtc gaatcattaa ttgccattct    103680
     taaatttttc aacgcaaaag gggactctag tcatactgag gcgttgttgg catatgcctt    103740
     gaagcttgca aaggatgagg catggagagt aagatacatg gtagctgaga aattcgagga    103800
     tttggcagat gagatttctc aactagacaa agttgttgat catcttcttg aacctttcct    103860
     aagtttgtgc gaggacaatg aaggtgatgt taggaaagct attgctggcc atgttagtgg    103920
     attttccaag cacattaaag atgcctcaat aattgaagca aaaattattc cagctatata    103980
     cactctgagt atcgatgaaa atgagactgt gagagcttcc ttggcgcaaa gtataactgg    104040
     tatgtcctca ttacttccaa aggagagtgt tactgaaaac ttgcttccaa ttgttctcaa    104100
     catgttaaaa gatgagttcc ctgacgtaag gttgaatata attgctagtt tgaaaaatat    104160
     aaataaggtt gtggatacta aaatactttc tgaatcactg atacctgcaa taaatgagct    104220
     agccaaagat atcaattgga gagtaagaat ggctataatt gactacttac cagtaattgg    104280
     tgaacaactt ggcaaatctt tctttgatga gcagttaata gacctgtgca tgactttgtt    104340
     atgggatcct gtttatgcca tcagaaacgc cactgttaaa attttaacta aattaactga    104400
     gtttttcgga tccgactggt gcagagatga aattctaact aagttgttaa cagttgacgc    104460
     agagacatta gaaaatttta tttacaggtt tactgtttta tcggcgttga gggagctaac    104520
     ttcagctgta agtagtgata ttaccttgga gcatattctt ccatatattg ttaagctttc    104580
     tgatgataag gtgcctaata taagattcaa tgtggctaaa gcctacacgg ttatctgtga    104640
     aaatttgaaa aataataaaa caaagaattt gaaagaaatt ttcgaagaaa aaatgttacc    104700
     ttctttcaag aaattacaag gcgatagcga tgtagatgta aaatactttg ccaatgaaaa    104760
     tttggaaaag tgtcagttgc tgatcaatta ggcactcaga acatcggagt ttcaaattaa    104820
     catgatagat cgtattcatg gaaatataac tttggggctc taacagagct tcgtacatat    104880
     taatgaacgg tatttaatta atttatatcg aaaagaggat atatttaaat attaatggat    104940
     ttaatttcta ttgcaccttg agctactcca tatgctacta aaggtcagtg tgcaagagca    105000
     ccagttgcgt atgctgaaca agatagaagg gagtggttac ttacatgttt atgtattcat    105060
     agttcaagga ccttcggctt tgatggggta cttgtcgctt ttgagtttct ttttcaagta    105120
     cagaatatat tcatcaaaat tccctcttgt ggttttgctt agtttccaaa aagcttcgtc    105180
     tatatcctct tcaaattgaa gtttcgagag aagctttcta tctctagcat tacaaatatc    105240
     attggctaaa caaatatcac atcttttgcc gcgagccatg catattactt gaccgaaacc    105300
     aactagcaca gtattaattt cgtaccataa acatttaggg agccatgttt gcaatgcctt    105360
     tctggtatgg tcaggtgtct tgcatttttt tgcatccacc catctccaca tcttgcaaag    105420
     tctatcaaca tgtacatcta cacaaatccc atccatctta ccccaagctc gctgtaaggc    105480
     aaggtatgtc atcttaggcc cgacaccagg cagacttagc atatcattga catttgtcgg    105540
     tacatcagaa tcaaaattat cgcgcagcat gcgaacactt ttatatatat aagttgcctt    105600
     ccttctatga aaaccaacag attttatttt ctcatcaatt attgattcat ccatcattaa    105660
     gacagattcc aacgtcatcc cattgggatc atggagctca ttgaggcagt atctcatgat    105720
     attaagcatg gcttctgccg tgatctcatc cttggtctgt gatgataaca tcactgcgat    105780
     tagcagttga aatctatagt ttttcggaag tatttgttct ttatgcagcc cacagttctc    105840
     cgcaatgaat ataggcatta atgcacaacc aactttatca actggtgtct tcagctgtgc    105900
     cctcattagt ctaacgcgat tataaattgg aataaaactc ttgggtagct tagctatttc    105960
     cagaggtttt agcccaagag aatcttcatc aaggggtttt aaccatcgtt gtggatcctc    106020
     acttgttcga tcatcaatat aatcaaaaaa cgcctgcgta tccaagctct tgatccattc    106080
     aatatccact tcatcaacaa agtctttgta gtcacttaca ggctcatgct tgactgtaac    106140
     agtttcttcc tttttgaaat actttgattg gacaacacct tctgctggat ttccttccac    106200
     atctacttcc aagtaccttc tagtacgctt tcttggtacc atgacagcct tcaatgagta    106260
     ttcgaatgct ttttataatc tgctgaagct aaggaaccgt taagattcat ggtattcact    106320
     gttatgattc atcttgacta ttagctcatc gcattttaaa tcagcatcat ccgatgccca    106380
     gacagactca cagataacgg tatgccaaaa aatttcagat tgatttacgg ttctaccata    106440
     ataacaaaag agtactctcg atccaactat ttgcggtttt aattgcgttg atcgacaacg    106500
     tatttatcag ctgctcaccc tgagaaatag cttaactgtt ttaacgctca tacgttgagt    106560
     aacactacct agtctatttg accggagggt ttttccaaga acgttggtag aagtcccagc    106620
     acctagggat ttgatatcgc ttgctatacc acaaatactg ctagctgaag catatcttcc    106680
     tggtagaggt attagaaaaa gatcatattc acagtggaat acagctgtag aggaagcact    106740
     gtgtgataaa cgcttaaaat aagcgataga agagaggtct aattaaagct tcgacatgct    106800
     cgcaagacaa tttataccaa ttggtgcaaa cgttttaaag aacagtgcaa aaccattgtt    106860
     tacgttacta agttacaacc ttttgtcacc ctcatacatg tggcctcagg tgtatacgta    106920
     tgtgcctgag aaatataagg attggaacta tagacataaa ctcctcgaac aggagttgct    106980
     agataagtat agagctgaca ttatgtgtct ccaggagctt acatcagaag attatagtaa    107040
     cttttggaag aaagctcttc aaactaacat gaactacggg tcaaactata ttgccaaaac    107100
     cccgccgcaa tattggaaga gaccagttga gcaaatggac ggtgttggca tattttacaa    107160
     tctggacaaa tttgagttca tttccaggtc tggaatatat cttaatcaat tacttggtgt    107220
     tttcagtaat aatgaattag agtatctcga aaaaaagcca gttacattga ctgatggggc    107280
     cggtaatcaa gtcggtgagc aaagtttgct ccaaatccta aaatcaaaaa atcaagtggc    107340
     tttattcgta tcattaaaac ataaagaaac cggtaatgtt tttgtcgtta taaatacaca    107400
     tctgtattgg aaatacgatg atgtgaagtt aactcaatgt atgatcatta tgagagaact    107460
     ggctagaata attgaaaaac atttagtcgg tttagagaat gtaactgatg acaagattaa    107520
     aattttattc actggagatt taaactcaac atcagactca ttagttataa atttcttaaa    107580
     gggtcaaatt gttagtcatg ataatctgaa tgttataaat cctatgaagc cttatttaga    107640
     acattgtgtc tatgatgatg taccagaaga gttatttact cacacatgtt attcaggaaa    107700
     actgaagggt atttttgatt acatatggta ccacgacaca gacttcaaat tgagacgtat    107760
     actatctggt agagaagtat ctcatgagct tgcagctttg aatcaatttg gtctaccaaa    107820
     cgagaatcac ccaagtgatc atattccttt gtttacagaa tttgagattc tgtgatactg    107880
     gttggttatt agtaatctgt taatccacct tagttgctag tattattttg ttatgcatat    107940
     tcctttaaaa aagctatatt atcatgaact tttattatgt gaattaatta aagtaaacag    108000
     tatttttatg ctctgaaaat gccttacgat tttattttat aatttacaat tagagaatac    108060
     taaaattcta ttatagatca ttttaaagaa cttagttatg agcgtatttg cctgaaatga    108120
     aatccataat cccgttttgt tatatcgaac agtattattt tttttgttgt gacttcttaa    108180
     atgcctgtga tctcttagta actctgccag tttttgatct ttccttctta cctttcttca    108240
     aaactggttt gctatcatct tttgtggctc tgataccttc aacggtaagt tccttcaata    108300
     gttttgatct ttcggctttg ttcaatatct tctttgctct acctaattta gtcttttggc    108360
     catcagtcat gtatttacca gatttcaatg ttggttctac cttcctaata ttcttacacc    108420
     tcgttacacg tagctttctc ttctttaaat gctcgttttg agaaatcatc ggcttctcat    108480
     ttagaagtag tgctttacta acactttgta actcattgaa ctgcacataa gcaaaacctt    108540
     tacccatgtt cgtctttggg tctctaacaa ttctaacata ctctatagag ccacaagcac    108600
     caaaatgttt ccacagactc tcctcatctt cttcaaagtc aaggttacca acaaagacag    108660
     atctttgctt gtcatgtggt gctgggtgtg taattgaatc cactcttaag tgacgattac    108720
     taaaaacctg accgtttagc cttttaatca acttattcaa tagcggtgat tgttctttat    108780
     agacgatgta agcattcaca gatgctcttg atttgtgcaa tttttgttga acaaaggcaa    108840
     cctttctagg taaagcgtct tcaaaagaga cagatctgaa tcttatactt tgaattggta    108900
     gtttcttgtt ttcgtcatca tcatctatat tgttaaatag tttttggaac aacttgtagg    108960
     tgctctttga aataataact tcgttggaca agttaccgac aaagatagtt ctagaggcct    109020
     tctcgatctc atcttccttt gtagatttct ttgattcttt gccttcttca acaagttttt    109080
     ctggctcttc aggtacttgt tcaggagtct ttgtttcttt gttcttcttg gctaacttct    109140
     tcttagatgg tttcttaact ttcgcatcat cacttgcggc atcctccatc ttttcgtcgc    109200
     catcagcgtc tttgtcagtc ttcttgatga cttcaatctt ttgaactttg atcaagggag    109260
     tggccttctt atctagcgca ttcgaagtct tgaacaactg actgactttg tcgtcagtag    109320
     ccactgtttc tgggaataag ttcatattgt ttgtactggt tccaaatatg tattaaggct    109380
     ggctgcttgc tctttgtaac gtccagtata aacttacgat cagatagaat acaatctgaa    109440
     atttatgagg ttaagcaatt ataataatag ccagaaatga tatagcattt gtacaggagg    109500
     atcagtgctc tgtagctatt gtgaagcttt tggattttgc gatgagcatc gcggttttcc    109560
     aaaaaatttt cagatttttg caaaatatgg gcatacagaa gatgatgctc tacgacaatt    109620
     tctgtgagcg ggtggtataa gacaaatcta aaggatataa tcatccgggc tacatgtgca    109680
     ggtgtaactg ttagctgtgc tgcacaatat tgcgcgagtg atcttaatga ttagaacttc    109740
     ttaatattat aatatcgata taatatgtga gtatatatat ctaatatatg ggggttgtaa    109800
     aagataatgt aaggactatt tttattgtat tgatgtattt tggtttttgt aaatgttaag    109860
     agacatgaga tagaaaaaga ttttaaaaaa aaaataaacc agttgtagaa accttggcga    109920
     tggtacaaaa ttttgggaag taaattgggc tttttgaaat gtggagtaaa atgaaacata    109980
     gacacagaga cttcatagtc aagaacctcg aaagtggcca acgattaaga tacccagaga    110040
     taagggacgt aaaagaaata agaaaaaccc ctcccatttt catatgaatt ttctgagtgt    110100
     tctcaattgc gtaatatctc acaaatagtg aattctcata aaatatcata aaatagaagc    110160
     ggaaggatta gatgcttact ggttaaattt aagcgatgtc tttcttgaat aatttccgtc    110220
     tgtcgaatta ataccaattg ttttgaagga ttggtatttg cttaccctgt tcaatttcaa    110280
     ataaggaaaa aagattgatc aaaaccattg atattatagg gtcaaaaatc gaggtctcgc    110340
     aaatcggaaa ataggagatg ctctctatgc gtgaatattt caagttattc catttgctct    110400
     acagacaaag agctcaaaat acagatccca gtatgttttg caatatcata gaaaaaaggt    110460
     tcttcagttg gttatatttt aatgtagtat tagatttttt tgattaaaat caggtaactt    110520
     atctcaatgg gatgaaacgg gaggtggtgg caccagctct accgtgtcta actggagtgt    110580
     atgtgatgga gaattcaccc aagtagtggc ccaacatttc tggtctgatt tcaacttggt    110640
     tgaaaacctt accgttgtag ataccgacaa cagaaccgat catttctggg acgatgatca    110700
     tgtttctcaa gtgggtcttg acaacagctg gcttctcgtt ttctgggcag gccaacttgg    110760
     cggctctcaa cttcttcatg aaaccgtttg gcttaccgga gacaccacga gagaactttc    110820
     ttctaactct agctggggtc atcttgatga agtcctcagt ggacatctcc aacaacttct    110880
     ctaggtcaac acctctgtag gagtgggtct tgaaaactct cttggacttg gcaccagtgg    110940
     cttgagacat tgtgtgatag tagcgttagt ttctgttggt cttgtatcaa gaagtactac    111000
     aaaagaaaat ggtttatttc ttatatatca aatataacat aggaagccta ttattacacc    111060
     aataggaacg cccaggatag gtcataccag tgtgttccta tgcctggtca gtgtcttccc    111120
     agtgtatgtt gtgtgtctgt gtcctcaatc gatagcacaa cgaaagtgaa aaaaagtttt    111180
     ggaattttca gaaagaaaaa aaatttgaaa attttggaaa atttggaaaa agtttcaggc    111240
     cctttgcggt gagagaaagc aggaaagggc actgtttgtg cgggtacctc tgagtaggat    111300
     ggaagtttca gtccttcacc tgaggaccac acagagatgc acgtagcaag gtcttcgagt    111360
     tgcgagtcgc tcaggcagtt gcgtggatcg ctggccggaa gagtgctgta gtacggatta    111420
     cccggctagt gaggatgtgg tggtgggggg agaaggaggg gggggagata gaggcatctg    111480
     tccgctggcc cccgctggtc tcattttgct gagcctaagg actgggctgg tagtctaggc    111540
     agagctgggc tggtattctg ggctgagctg ggctggtagt ctaggctgag ctgggctggt    111600
     agtctgggct gagctaggtg gagggtggca gagtggtggt agtaccccca caaggagccc    111660
     cccctgctgg taattccact ccaacatcga tgtggtcttc cgcccacccc gacgtccgcc    111720
     gcgtccacca cgtccactac gttttccact ttgccaagaa tctgccacca cgtacctctg    111780
     taccgggtgg ccagggcgcg cggagtgcga agtgcgaagt gcgaagtgcg aagtgcgaag    111840
     tgcggcaaga accctttggc cgatcgcgtt catcttcacg caaggacagc aggtgtctgg    111900
     gtgttagagg ttgcactcac ttttgtgact gttgtattgt tgtacgtata cttcctctcc    111960
     cttgttcacg tgccttatct agtatatcgt gagatgtaaa gtggtccggg taaagttttg    112020
     cgacggcact tgtccagctg ctttactgaa aaagtgaaca tcgtgccttt ctacacgctc    112080
     tggtgtctct cgatgctttg agttgttccc ttactatgca ataataatac accgttgtgc    112140
     gagggatatt gagtacacaa ctttttattt tgcagcaata ttgttaagct gagcaagagt    112200
     tagaatagcc ggagcagata caggctaaag accttcacat acacacacac acacacacac    112260
     ctcattctat cagtatcaac agctaatggt ggcaaaggtt tggtcacgtg tgatacttat    112320
     atttattgct actgttatgg tttttgccag ttcacagcag ggagacgcca acaaggtgaa    112380
     cacagctagt ccgccgggag ctaacggtat agcgtacgct agcgtggttg ctggcgggag    112440
     taatcatgtg agtgcggctg gttccgtgac tggtgatggc gttcagctgc ccaatgcaga    112500
     agtcgatatt gactggctgg aagagcacct ggaggattcg catgactacg agaaagggta    112560
     cgaccttgtg gaacagcact tcaacaagtt gcttgtaggt aacaacgcag atgcgtcttt    112620
     caaagtacga gaactggcaa gcagacttat cttaggaacg ctaaggaata atcctcctgt    112680
     aaagcggttg atttgggatc agcacccact ttttgtctct caggtgtttg atttgtatat    112740
     aggaaacgca ttgaagcaag gctcgggtaa tcccctgaaa tatccgttat tgaagcgcta    112800
     tttgtcgata ttgctggagc tcataccgtt caaccgtgac ttccgctttg aagaagacta    112860
     taaagatatt cttgataagc tctatacaga gtctgatgtt ccttcggata taaagatcaa    112920
     ggttctggag cttataacac tggattattc caacataaag ggtgcgtccg gttggattga    112980
     cagaatcact aatgttctga cggattcaga gatgggactt gatgagctac acaagaggac    113040
     atttttcaat gcaatgcacg ccctgaagtc agaggatcca aagctaaaat tgcctactaa    113100
     ctttttgaac tggttagccc aggagactaa ggaaagagct cataatctca aattagctca    113160
     agcacaggca gacgataatg acctgaaagt aagagatctc gaacaagaag aatttgatca    113220
     gagattggta gatagcaggc actctgtgtt tggcaaccca atggcggccc gtatgaagga    113280
     tccatatatt gttgatgaac tgtagtcttt gcccaatgac agcaaactat ttaactgaga    113340
     atagcattac aataagttaa gaatatgtga tattatagta caatgctgtg tatttaatga    113400
     tatagttata gagaaattat tgtcatattt ttggcttgcc aaagtcctac tgttttctta    113460
     ttatgcatgc acaataataa acttgataat aaattctagc gcagtatagg aaaacgctga    113520
     ataaaaatca tgttgcagta acctcgtcca ggaacgaccc atcgttagct agcctattct    113580
     taaacttgtc ccaccagcca tcaaatcttt ttatggatac gtttccattg tcatctagaa    113640
     aaccggtcaa gtaattatag gcatgctgta caattttgcc tgccaattct tgagtaagta    113700
     aagggtacac ttttgccagt tggcctactg tatttatacc cagattgttg ttcccgcggg    113760
     ctagcactag agagttcgta ccggtactac tggccaactg ttgttgctgc ttccattcca    113820
     ttatcttcgt cattccttca tttctgttct ctatagatat acctatgatc aactgagata    113880
     tgttatgatt agttgtaggt ccgttagctg gcatgctgat gtcatcgtca tcccccatgt    113940
     cgatctcccc taggccatca ttgggagtgg gcgtagtttg gctctggggg agtttgacct    114000
     tgaagatagc actaggcttc tcggtgctca agtagccaaa cagtttgaaa tcctctgttg    114060
     gggtcaactt gaagtaaacg gttgctatgt actccgcagg gaaggtcaca ttgggtaata    114120
     taaacaatga tatgtgagag taattcttgg gttttgtaga gctcagtaca atagtatgtt    114180
     gcattccatt ggagtttgga acttcctcgc tcatctgcaa tgggttacca gaagcaattg    114240
     cagcaaacat cctttgtggt tatcttattg tattgttaca aatatctgcg gttcgaatat    114300
     ggttgcgcta ctgaagtagt tgtaattgac gctgcaagta cagcttgtga tgtgtatgta    114360
     caggattatt tgtattaaac ttttatacag tttcaacaat tgtgattagt gtgctattgg    114420
     cgatgacttt caaacaattg atgagttttg gctattatcc tcgagaaatt gctgttgtcc    114480
     cccatacgtc atttgcaatg gaaaaaaaag ggaagaatgg ggagactgag aaacacccgt    114540
     acgaattgcc cctccttact cccccaagct gatatcttgc aggttcgaga aatttctagt    114600
     tggaaacggt acaacgcctt ctgtgcagga aggggcaccc tgagagggca gggagtggga    114660
     ccttccatgc ttctcgaagt tcatataact cagacagttc cgtacgactt cagtttccaa    114720
     atctaccgaa tactttctga gaacggaaaa tcgaagttta gaacattcac gtgattagta    114780
     cagctaaccc catggaatag caatgcattc ccattaactt cactttacgt ggagtaagcg    114840
     ggaagctcac agggagctca cgaggaagct tacaacaatt tcatagacta ttgctctagt    114900
     atttggattg cattagcaat tctttcctga gcctcgctga cgcccaagac tt