(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_9

ID   CAGLA1_9; SV 1; linear; genomic DNA; GRV; FUN; 1050361 BP.
XX
AC   CR380954_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome H, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380954.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1050361
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome H"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        complement(2611..3711)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197938"
FT                   /locus_tag="CAGL0H00110g"
FT                   /product="Similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /protein_id="CAG59733.1"
FT                   /db_xref="HOGENOM:HBG124802"
FT                   /db_xref="UniParc:UPI00003B6613"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI8"
FT                   /transl_table=1
FT                   /translation="MVTRSQLLYLNVTTSNDIGQTVTNTVTVMSYDQVGDGVYTSAPGY
FT                   SQAPVTTTTVSADTATATVVISHFPSIGVDGVTRTGTTTLSTVSVGGETGYTTSVDRGN
FT                   GSIETDVISHITTTDSNGNPTTITTTITNAQSASNSKANVGSDYTTTVVSDGHTLTEIV
FT                   SHSTGTDEHGHTIVSTVTETLGVQSHGNTVSSTVPVSTVSGAGSNASGAAGVGGIVNSQ
FT                   KPQSQNVADQGSGNEKPTQASAQPVVVALALALALALGQFTNRQAVMYHLDPHLFRVQR
FT                   VLCLQSVVFIVAKHHTLYLPKPNNKDKDKHHHHVNSLPRLFYHLLVPLLTTSAVDSAAR
FT                   KQHLSYRVRVLRLELLLPVLYSPLLQ"
FT   CDS_pept        complement(13625..14851)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046821"
FT                   /locus_tag="CAGL0H00220g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59738.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG060667"
FT                   /db_xref="HOGENOM:HBG747640"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniParc:UPI00003B6614"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI7"
FT                   /transl_table=1
FT                   /translation="MTNQNVVVVICGALRLLISATFPSLRSQLDNTVEFSTPFTSFKSL
FT                   SEGVFLYDNGFPLYNGGVVHHSPLLIAFMSVIMKFRLDGLLYAVIDCIICWQLMEIVKS
FT                   NNATILQLLQKKDHILIGIIYALNPLLVLSNISGSTVIFTHFAISSALYFSSKGRYTTS
FT                   TFFMALASSLSIYSILLVIPFLALNVRSSEKAAGSKQFKMLLRDNLQSYLLFFSLLLLW
FT                   SYKVSYQSFDFLSACYFQYMTFAKSFPNIGLWWYFFIEMFSSFIPFFKGVFNLLLVCFI
FT                   LPFTIRFNRLPIVAFVLSLGWIVLINPYPTLGAYGFLISLVPLFDKIYGYMKYPVISFL
FT                   LLMHAVILSPLFYHLWIDLGSGNSNFFFALTFVYALGLSSILSDLIWGSLRLEYDGRKQ
FT                   DFNKRVTQI"
FT   CDS_pept        16529..18802
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446638"
FT                   /gene_name="SEC232"
FT                   /locus_tag="CAGL0H00242g"
FT                   /product="Protein transport protein SEC23-2 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG59739.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG021213"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="HSSP:1M2V"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI00003B6615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSI6"
FT                   /transl_table=1
FT                   /translation="MDFEANEDLNGVRFSWNVFPSSKTDANKNVVPVGCLYTPLKEIED
FT                   LQIASYNPVVCAGPQCKAILNPYCAIDPRSSSWTCPICNSRNHLPPQYANMTQENMPIE
FT                   LQQTTVEYITNKPVQIPPIFFFVVDITAEQENLDALKESIITSLSLLPPNALIGFMTYG
FT                   NVVQLYDLSCDIIERCSVFRGDREYQFDQLVEMLTGQKPSNTMAPLANGKITPLSLNRF
FT                   FLPLEQVEFKLNQLLESMSPDQWSVPAGHRPLRATGSALNIATLLLQGCYKNVASRIIL
FT                   FASGPGTVAPGLIVNTELKDPIRSHHDIDSDRAPHYKKACKFYNSIAERVAENGHTVDV
FT                   FAGCYDQVGMSEMKKMTDSTGGVLLLTDAFSTAIFKQSYLRLFSKDEEGYLTMVFNGNL
FT                   AVKTSKDLKLQGLIGHASAVKKTDATNVSDSEIGIGSTSVWKMSALSPHHTYGIFFEIA
FT                   NPNAVSPITTDRANLAYTQFITQYQHASGTNRVRVTTVANQMLPFGTPAIAASFDQEAA
FT                   AVLMARIAVFKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPASFRLAPNFSLYPQFT
FT                   YYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEEDPQPVLLDSI
FT                   SVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYADFKALLEEPKVEAAELLVDR
FT                   FPLPRFIDTEAGGSQARFLLSKLNPSDNYQDMARGGSTIVLTDDVSLQNFMAHLQQVTV
FT                   SGQP"
FT   CDS_pept        19281..20294
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446639"
FT                   /locus_tag="CAGL0H00264g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59740.1"
FT                   /db_xref="HOGENOM:HBG059262"
FT                   /db_xref="InterPro:IPR013743"
FT                   /db_xref="UniParc:UPI00003B6616"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI5"
FT                   /transl_table=1
FT                   /translation="MFETIKDLFAGVVTTSDRRKKEHGSLADIKRRSMNKRKRALGHNK
FT                   SITNTDQRNAEYLNKLKMRNSIRGKVGKPPLRGGYMNSVDIKPDTKESRARMVLNAVKS
FT                   IFSNEDQTLMNMASTDINKLLRNQGYDKNQENLKDSILRSNAFKKKVTELEYNKRMLRD
FT                   LRRSGVSGNYNIIRDDDLEEDRYLLLQKKYQKIKKRLYEVEQELKSVQDSLRYSQEMNA
FT                   LLQETLDKANIDDAYLKSRRQIKNLQKENVLPERELSPSPRRPIDPLFTSSPVRKSRNG
FT                   EENGSKPKTDYKHSPIKETSNFYDKYPKLPETEQLAQDKGNHSLSPIRIDYSRYSS"
FT   CDS_pept        complement(20670..21305)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248348" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046822"
FT                   /locus_tag="CAGL0H00286g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="FMN binding"
FT                   /protein_id="CAG59741.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG059263"
FT                   /db_xref="HOGENOM:HBG397311"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI00003B6617"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI4"
FT                   /transl_table=1
FT                   /translation="MSIISKKFPDDLIALIRSSKYVHVATCSKYCEPSVSLMNYVYLEK
FT                   PQLFSEFFCADLKGAYEDSDGIDNGYIIFATFDETEKIGNIRENPKVSLLFHDWISANN
FT                   LSLRKGNPLLNSSGSIEFSPQYSHGNRISNVLNNLEDNELNQMSATITGHARIVDCDSD
FT                   ESTYYMRLLLGANPDADIFILAENAVIVIVKMLDAKVSDNENNVGIYK"
FT   CDS_pept        complement(22157..23119)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142010" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197939"
FT                   /locus_tag="CAGL0H00308g"
FT                   /product="Similar to uniprot|Q06188 Saccharomyces
FT                   cerevisiae YLR455w"
FT                   /protein_id="CAG59742.1"
FT                   /db_xref="HOGENOM:HBG059264"
FT                   /db_xref="HOGENOM:HBG202602"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniParc:UPI00003B6618"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI3"
FT                   /transl_table=1
FT                   /translation="MTTSNNLKTGDLVLCKVGSFPPWPAVVFPQRLLRKDVIKKKRNNC
FT                   IAVCFLNDPTYYWEQPHKLKRLEKNIITEYLSKEHKSQSQADLVEAYSQADQFGDLRSF
FT                   VVERFSSEDRIEDLEKDEELYGKLKSGEDPHITDPDTNSRKRKSSSKDDGKVSSSKKIK
FT                   ASKDITSMAKSSDNQLIIDNSVDKEKKKSNKLDRSRREEISLLLRRRIQRNLIQRDTPP
FT                   TDVELQESHKLLSKIKENLDDQPPFFDLDTLRKSKLHKLLKVIVNNSDLKEFHDICKSI
FT                   LLHWSDIIATLKAEKLNHLKQAYQSETTDRDDPSLKEVQ"
FT   CDS_pept        complement(24048..31955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446640"
FT                   /locus_tag="CAGL0H00330g"
FT                   /product="Similar to uniprot|Q06179 Saccharomyces
FT                   cerevisiae YLR454w"
FT                   /protein_id="CAG59743.1"
FT                   /db_xref="HOGENOM:HBG058253"
FT                   /db_xref="HOGENOM:HBG202601"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019439"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniParc:UPI00003B6619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI2"
FT                   /transl_table=1
FT                   /translation="MSGRLWQQASDSVVDVLPILKWSMRELFYRSTWHILNAVVVFLVV
FT                   KFLLKVLIGLNIGFINPLRLRVCHLSYKDKIQISYIQFNPWQKRITVSGLKLKILKEKS
FT                   NKTEEVKTEKKENSNKKSLAKYAKYFPILRRILDGFEFHLEDLQLSDLGISIAGIGLII
FT                   STIPKTGQLDTQFYLRKVLWKDEIICNESIISFKADTVTDAAKLNESQFLENIYLDLKF
FT                   GGINIPMNYLAAFKKSKETVDVGHLLDYEESEQDILVRNKLEMEMEMERLRFTDEDIFE
FT                   AVNNIENILDTVREYSDILSDFTISIDKFGVKNMMVTSHPALLKMNDYMNYSFCCSNFT
FT                   FNASKYRNDMPGFKLLFKEEDSPFKISSAISRIDFNVNLNRVDNNTSEVLKLVSIPNIT
FT                   LFGETNILSQKFRTCNTTEAVSENSLFNIKSTISSPTIDVSLSDLSFLKSFKKNIKVFT
FT                   STCSGCMFKNEVRKENSHTKMKQILSTYFKTFLPLINLKFSLEDPKFIINHNNNLIMAQ
FT                   LSVLVFDYESMCDLVAINEKRKEIIYESWCNVELLDVNLIHINKHQKYEQSIFSSDSIA
FT                   INNKLKLLPDLIVSSEMIIDTLNVDLSELPTLKMLSDVVRKLDDEIYAVEQFYFNNLYE
FT                   EFSTVIRNAKKQCNVIGKNMVENEIPLKEMIYKSLPDFFDYFLLTVRNVSATLGIRSVF
FT                   MPKDKFTSLEPQSGKDFIDGKLRKYCNQINKLQVTFFGNKTQWHSNINGGHVGMTRSGD
FT                   ENKYKSYYASELDDISTSDATEVERPWNLSLLIDKITSTIIGECPQLSDKLTIKTVAKI
FT                   AIISIKVFPETEYYDTNENAKVIVQIENKSIKAIISLMNIFFILSGIHTLHHIFGNAVE
FT                   ENKGPSKAKKFFLAVSKVKKKSSIKKIRWTDIKQMLTVNIHSEQYEQIFVLPNELRTSL
FT                   DFSHMFLTIENLNNISFTGEYFRTCIESPTIKHYWVRLITIVRYKVNADIEKLKSQTQK
FT                   NNDSGGNSEPGVTLENESWHFSIPYDFEMFRIFDNFSTIAKTLKQLIYSFKSSKNDLVI
FT                   FAKPVSAAILPNIKLKSNRLLFTVDDDPFEAELNSIFQIGLQEQRSRLEKRKEFNEQAL
FT                   KSLHGRAGATSHTDISVEELIWKKRLKINKKNTPDQLIKQNMPLVNTPFNIDGKQNKNK
FT                   TADHLITAELETEYDKLQEQLSHSWIERIRSHKQKQHKKFLSDFTYVWGRVNYSKLPDD
FT                   INKRVLDFSTNPFLTTLIIEDIDVDIAKPHCGVEHIPDFIYEVGKGVPKDTKYSILVPM
FT                   HLDAKFSEIRWHLRDYPLPFVYMPKLLPSQSRESQSIRIHGDFMVTEDMIYSEQELRTV
FT                   FVPLVPSIIVENKDKLYSLLVPRTMTSIKLFTNLEFDLHSKDTLTVTWGGSYSPAIQQV
FT                   MQCLDNFSKPPLDPSPKVGFWDKVRYIFHGRININLKNNGKFEIALKGSKSPYKIGGQD
FT                   AGFVIGFEDDVKIICNPNDDPKDFLTCSADRVHFSIPNHFAKPLLVWSSPSKDAIFIPN
FT                   QSDTNLQESASFYYLLNLEDKVNQNSDIHSMKGAYIEKTGIKLTGGMKLKLGFVFERLI
FT                   RGTSDRTYDSRNHWDVRLCNPIYVSDLHDHDSFNDFRSDFIHLSLVLTSKSETSYNALQ
FT                   LSPKGLRTFFSWWKMFSGNFPVRRGPLFGLQSIAPKFGEHLETLTYYADVSPLYITHMY
FT                   HNLDADKIMKKSFLDTSEYAGIKAKAGRFLMDLHQRKEVFTEYQEELDRIKKVQKLKFL
FT                   DGLVATFDIDIRAVHGLFTKLEYTEQREDAKYDIHDNDMQWIDLTDFQEAFYVEIDNFL
FT                   PNIKILPMLSAHKFIYSKHASYGDKYQVDPKTYNPIKPFDNSISHDCAIRKPFTPNFEV
FT                   IRDRLERLKHVKATIESNHYGMDSESEQKAHEKYLVRSEASVRNVQSLLEDLEIMTGLK
FT                   EKIDSSKAYNYPAIQLIQDTNSESFDNKYYVYHMLLKWNEGVRDIAFKFLHFSNLTHQF
FT                   MELASHKTNRMFNDIINKRQQKDNVNEEEDISSKIQRVKSEVEFDNANDDEHVKAALLE
FT                   MFEEGLSQLGIDINHSISRNHFVNFICPQIQLISDDDPNICVLVSTPIILLKVLSFDEE
FT                   TPDNVYLENTFLKRYGLFLSNANAFIFHKERFDKYPELVFDASLYGQEKGSDWPPWLGA
FT                   EVAFHPTPLSKFAVIENFSAFTFLQKLLPFSSMYDMVKDVIENKISACLPRVIVSATSE
FT                   DYLAIYKIVTNLILYVEPDNKSLKKQIETASLAFDFDDIERITSLIGNLTNAEQVLERI
FT                   VKEFIFKRRLLKDVDLIDLSNIYNERMNHLLQLYVILRVFTESNRDESNCTVLWDFKIK
FT                   EVVLHMLHNSSTPFLDVIVNNVNYQRLQTDTGFTDNMVSVRNINIFNRDKDAIYPTLVK
FT                   PYSTRRLLDTQYDDQPVVAIRWGVDKPVGGIRIVKSVTTNITGLVVTLEEETINRIISW
FT                   LSLEHLKNLSPENEDSDNSSMGSESISDMSFSQDTRIHITGTKDIDEMFKRSTNFLTIE
FT                   NMLINSFKLMISYKGKGKMRLANVTNFLFTFPTLIFENQTMTLADLMIKIKKILIKVLI
FT                   KHTGKFLGTKLKNHPSDLSKEQPKGDDRKMIEYTKTVENGPTVDAIGSKDITE"
FT   CDS_pept        33180..34292
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446641"
FT                   /locus_tag="CAGL0H00352g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59744.1"
FT                   /db_xref="HOGENOM:HBG124810"
FT                   /db_xref="UniParc:UPI00003B661A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI1"
FT                   /transl_table=1
FT                   /translation="MDDEFGPIRKSLKKVSVGSITQSNYDTDDLCTTEIIPLQKRPRHA
FT                   PNVLDTPFAIVNYPCIVTDDNRKDTYATELFYEQVLFKTFRYKLLDNLLQNQLEFAPAL
FT                   NQIAKSLYKLVIKSFNKELTTVKNYRIVAPEVSSSRFTSNIIDNVVVFDTVASKHFNLI
FT                   NIRLESPEGLQAKDVSRIHRFLKKSYPIDEVPMQSEGLNGFKNIIDYFTKLNSTAIMRS
FT                   LKPLHFKIDIFQYNYDVEKITNIIPTKPNFKIIISTIGSSHSLDDNPITTIVNLSELSD
FT                   INLSRMCQQALHCKCDMGKHTGLKEYQDLWNHCVADITQNKLGSNNLFHLFLVSFTIGG
FT                   LGTNFFFYLEQTLNGVRSMDQLLRNFGINR"
FT   CDS_pept        34932..36884
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248349" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046823"
FT                   /locus_tag="CAGL0H00374g"
FT                   /product="Similar to uniprot|P11972 Saccharomyces
FT                   cerevisiae YLR452c SST2"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAG59745.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG124814"
FT                   /db_xref="HOGENOM:HBG397313"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00003B661B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSI0"
FT                   /transl_table=1
FT                   /translation="MASSSNVKLGNTEFRKTPAGNLFTSDIKTIFSILLIRLDLNAHLN
FT                   ERNKNPFILGSKQYEFSFSLQKAICLLRNLCLLPSENRACLKVCYTIEQPFSQFLMSVF
FT                   MTAKLLHTPADRTRKGPKDKVLLQPTPKGIAILQAFCRSIGLQRLPDVLFSSLNTMNLF
FT                   LFERSEFTDKLLMSRVLIYLLFIKLMGPFPNVWSPSKEHDYAYVALPQNISIEDIKFSL
FT                   DQNVMLSNFEPDNIAPPVDTLKGSNVYLNQSKILSPLAHKFFTNPDSDSHIQYYVSTVG
FT                   VRSKPDVEVNFKTTKNYVFTTKAIWQWLMDCCDIFYPRDAAHVTARFLFYGLLEEVPAS
FT                   PENYAGLISKNKYVKLTTLGENIVKWGKKDDTGKNPQVDSKCLSNLGQLTSISRSPSVF
FT                   PFLPRLSYPSSRQNLDKILKEPGLRHLFRHHLEKEHCSENLNAYLDVRRFLHMMGGLKN
FT                   KMKLDNYNDSLSPNSININYSLLSSTAKNNEDFLSLVGTCIETACNIYSIYIMKDSPME
FT                   INIDSNLKNKIEKIIIGYVQYDYEKTCSVNSIEATIGNTLDSASGHTYLLHKKNGILKD
FT                   TTMKEFSREAFMNKFGKLEINNLLFMISSLGHLYLLYEHVENATYHMMETDSLTKFLDS
FT                   AVIDKIGSAFSLISV"
FT   CDS_pept        complement(37005..39827)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503356"
FT                   /locus_tag="CAGL0H00396g"
FT                   /product="Similar to uniprot|P08638 Saccharomyces
FT                   cerevisiae YLR451w LEU3 transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59746.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058249"
FT                   /db_xref="HOGENOM:HBG397314"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B661C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH9"
FT                   /transl_table=1
FT                   /translation="MDSVSPGFGTPFSDIQSDINLTNRAPNSEEASVTPELPPQSSPTN
FT                   GSKKPKKKKRVACVECRQQKSKCDAHDKAPEPCTRCQKKGVPCVLKKDFRRTYKRARNE
FT                   AIEKRFKELTATLSNLSSEQILKRIEEEQQQLLDNSNFTKDKIKKMKDENMKKWQQENQ
FT                   ETSIINSINYQEENSPVAAHIDSNGNKTISEENYDKSANVVFHFSEMTEEQLKCSPKNL
FT                   GDVYVSSQQIAELFQEFATKYHIFLPVVNLEYGAEKIYNLSPCLFWVILLIGLRRKPQS
FT                   THLMKKLSGLVKSVLAEITISPIIRYTPSETDEPVLNVASVYSVQAFLLYTFWPPLTSS
FT                   LSADTSWNTIGTAMFQAIRVGLNCADFSKEYTTANFELINEQLRTWVCCNIVSQFIASS
FT                   FGFPSYTSFDNSILNSTSLLFNQMKGTNIPLPLKQLTQIARFENQVINTISNNGTNVVG
FT                   VADRETVHPLIQVLNQQLVHLDLSLRESNIDDIRKFSLLVAKTHLLTYYFNDPFLSEVG
FT                   SKDGNHNLMQLSNKTEALFETKKGLVKAYNAAIEFLSHAHSMWKSNPTIIKYLPGVFVL
FT                   NIWQSACIISKLANSSLAPMLDVAYGKKAYQNAVLLTFNASVLKHDMAYRSSGIMRSIW
FT                   SLYANMYESWKKEQRKKENSFVEEFTNFNLGITVRSRMAVSVFFDCLYILKEKSGMAKL
FT                   ERESKRSHISGENDEKNDEDDESDSGIEKGTSKDAKNNDIKLSHVKNPEMKARRIIETI
FT                   PLDPNPINVSTGSSNGSLTNTPNSSTYDNQSVHANTNNKMSPESYNRGNGTFNQYIRPN
FT                   SDVLRKKEISKSLIRPPETSMFDIVRNQKPKITSDYRNATSGEFSERQLQNGKSTAQSP
FT                   ILNDNLGIKSSNDLTNQQFIIPFSDDHINTTPTNDSPNSIMANWDNWESDVVWKDVDIL
FT                   MNEFAFNPTL"
FT   CDS_pept        complement(41327..42181)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446642"
FT                   /locus_tag="CAGL0H00418g"
FT                   /product="Similar to uniprot|P32643 Saccharomyces
FT                   cerevisiae YER175c"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAG59747.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG059945"
FT                   /db_xref="HOGENOM:HBG395694"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI00003B661D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH8"
FT                   /transl_table=1
FT                   /translation="MSSFSKSNFNSEGYKQSRPQYPLEFYKHLQQYHNGKCDLIVDVGC
FT                   GPGTATLQLSEVFNDTNEIIGTDYSERMIEAANNGNPAKNVNFHVAGGEDFTFLGERQN
FT                   KRQCDMVVSAEAIQYFNLDKFQDEVHKNLRADGTLAYWGYLEPVVLELPAVDDALYDFC
FT                   FGEEKLAPYWEKPAVDIIASYYRNIKLNDSLFKEVDLKVYNPREANYESAPFKMICEMT
FT                   VQNLREYLQTWGIYYKWKHDPKNANKKDIIDEVIDKILENNYDLDTKIHVSWKTFYTFA
FT                   RAI"
FT   CDS_pept        43439..44776
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446643"
FT                   /locus_tag="CAGL0H00440g"
FT                   /product="Similar to uniprot|P47159 Saccharomyces
FT                   cerevisiae YJR124c"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG59748.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG032383"
FT                   /db_xref="HOGENOM:HBG397407"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B661E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH7"
FT                   /transl_table=1
FT                   /translation="MRFRQNVVGAPRDVKLLWASVFLRLLSYGITNQVLTLLLSGIHMG
FT                   EDRIGLFMSLTLVGDVLCSYILTWYADSWGRRRVLIYGSIMMMLSGIVFSYSENFHVLL
FT                   IFAIFGVISPSSDEVGPFKSIEESMIAHLSSNDKRPDVYAMHSLVGTVGSALGAISCGV
FT                   FIKFIKSHGYATTDVESYKLVFRLYAFIAFMKVIIMFMLSEKTELDSHFHDHIEDNNLS
FT                   EAIVHDELTPLVETAAHKNEINKSRALSKETKATLTKLLVIFMVDSLGSGFMTSGWMVY
FT                   YYKNIFLLSPVALGTMFFVSQGVQALSTLPSSSITRRLGPVKTTLAVQIPSGIFSILIP
FT                   FAVNYLPLSIFLLNLHFATMAMDVTPRQIILTNLFKSSELTRVMGIVNIGKTFARCIGP
FT                   IFTGLLASKGLLWCCYIISGSLVITADAILAFWFLSIDHKIKAQCS"
FT   CDS_pept        complement(45146..45823)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446644"
FT                   /locus_tag="CAGL0H00462g"
FT                   /product="Similar to uniprot|P26783 Saccharomyces
FT                   cerevisiae YJR123w RPS5"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG59749.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG297325"
FT                   /db_xref="HOGENOM:HBG378671"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="UniParc:UPI00003B661F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH6"
FT                   /transl_table=1
FT                   /translation="MSDTEAPVEVQEEFEVVEEFTPVTLATPIPEEVQRGSTEIKLFNK
FT                   WSFEDVEVKDPSLVDYVQIRQPIFVAHTSGRYANKRFRKAQCPIIERLTNSMMMNGRNN
FT                   GKKLKAVRIIKHTLEIIHILTEQNPLQVVVDAITNTGPREDTTRVGGGGAARRQAVDVS
FT                   PLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELERVAK
FT                   SNR"
FT   CDS_pept        complement(47587..49080)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046824"
FT                   /gene_name="CAF17"
FT                   /locus_tag="CAGL0H00484g"
FT                   /product="Putative transferase CAF17, mitochondrial "
FT                   /EC_number="2.1.-.-"
FT                   /function="transferase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG59750.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG124827"
FT                   /db_xref="HOGENOM:HBG202265"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniParc:UPI00003B6620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSH5"
FT                   /transl_table=1
FT                   /translation="MMKTLTRSILDLTRSSKNAVSIQCGRRFISSIKATNLDNALLVYG
FT                   EIPNKSYLQVRGPDTIGFLNGLVTSKLLPTFVKKNLTTIEVSDEKNKKDTNNNESPEFN
FT                   EKKGNWGIYNAESHNGPYLSRFGIYSAFLNGKGKLVTDSIIYPSPGVVNDQTEAKIKLY
FT                   PEYLLEFDKDIIPRMLTSFESHKLHNKIKFEEVKNTKTWDFFISFPGLTQNDPNPWIDN
FT                   VYVPLTYLKNAEASNEFAESFITSLFPKISNKILGFYIERRTETLLNNDGTAPQFFRIV
FT                   TTEDVDNAFDAFNSEAFPFTFEKLEKDSSFFKQCKLQYGFLDGSDAIQPDSLMPLELNF
FT                   DYFPNTVSNNKGCYVGQELTARTYSTGILRKRLIPIEFENLSEQAVKLLNECDKYPDIE
FT                   VEVDPKNQEPEPLQSTAPSPFGNSPFGNASTKLRQRKKAAGTLISFDGKYGIALFRIEH
FT                   FKNIYDTPTPSKFFLTIGQEKIDVTPQRPIWYNEWKSSQ"
FT   mat_peptide     complement(47590..48972)
FT                   /gene_name="CAF17"
FT                   /locus_tag="CAGL0H00484g"
FT                   /product="Putative transferase CAF17, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSH5 "
FT   transit_peptide complement(48973..49080)
FT                   /gene_name="CAF17"
FT                   /locus_tag="CAGL0H00484g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSH5 "
FT   CDS_pept        complement(50095..51618)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046825"
FT                   /locus_tag="CAGL0H00506g"
FT                   /product="Similar to uniprot|P00830 Saccharomyces
FT                   cerevisiae YJR121w ATP2"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAG59751.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI00003B6621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH4"
FT                   /transl_table=1
FT                   /translation="MVLPRLYAAPSSRAALQAARMASKFNSPVRFASTAALASGKVSAV
FT                   IGAIVDVQFEESNLPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEK
FT                   VVDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKLRKPIHADPPSFAEQSTAAEVL
FT                   ETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTRE
FT                   GNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVL
FT                   LFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVY
FT                   VPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRLLDAAVVGEEHYNV
FT                   ATKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIEG
FT                   KLVRLKDTISSFKAVLEGKYDDLPENAFYMVGGIEDVVAKAEKLAAEAS"
FT   CDS_pept        52511..54733
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503357"
FT                   /locus_tag="CAGL0H00528g"
FT                   /product="Similar to uniprot|P47156 Saccharomyces
FT                   cerevisiae YJR119c"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59752.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058247"
FT                   /db_xref="HOGENOM:HBG202263"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00003B6622"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH3"
FT                   /transl_table=1
FT                   /translation="MYAMEVPVVYPTEEEFADPIDYLNQPALRRLGKVYGMVRIVPPAG
FT                   FNPPLALDKARFKFKVRWQNLNELQLLNRARLFFINNLNTFNRLKGHPAHLEHTYVRVA
FT                   TARLHLYDLYIHIMQRKGLLPTKSVLVDKPLWRSFLSRNKLSHTVSPEQLVQVFTSYLQ
FT                   DYYSYLYRMYRKTGSGSIYNAMLYKEAIPHSALQTNDLDSQDDQDHQDNQDNQDDRNEQ
FT                   GEETLRTQEPTPDEPVHHMARMSAAVGADDSELQDWCPICKHIPKDNELDDVSYCDSCS
FT                   QIFHNRCIKNNNYLNNASGEWICNNCIIGNGFYGFKYSTHYFTLKEFEQKYGTDESPDV
FT                   DKLEKEFWDLVGNQDVKTTVPYGADIHSEDPAELTGFPTNDKTYSTHPMNLLNLPQASS
FT                   SLLPFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVWYSIPDNSCD
FT                   NFHKLLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYNVKWYKAVQHPNEYIVTFPKC
FT                   YHAGFNTGYNINEAVNFTSESWLPYGLEAISDYQLTKKMPVFDMYELMVNILVMYYRDN
FT                   LPSPVSDAFLQHCHHELLSYINKETRNIFSVMPFIAQERLLHVSNQLHLDSEDTKEYIQ
FT                   EDDEDGFFCASCSTMCSFVFVLQCKLDRSRHAKRRKTTNNDNHLLKVREFKKHLEEDSD
FT                   SQVLCLTHFLECKDKSETINSLISLREFNELHHILKLSGNKMDGIK"
FT   CDS_pept        55179..55673
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197940"
FT                   /locus_tag="CAGL0H00550g"
FT                   /product="Similar to uniprot|P47155 Saccharomyces
FT                   cerevisiae YJR118c ILM1"
FT                   /protein_id="CAG59753.1"
FT                   /db_xref="HOGENOM:HBG058246"
FT                   /db_xref="HOGENOM:HBG396058"
FT                   /db_xref="InterPro:IPR018815"
FT                   /db_xref="UniParc:UPI00003B6623"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH2"
FT                   /transl_table=1
FT                   /translation="MGILSAQNLILLRSALLLTIAFFCIKNVNSILQNSFFLVLSQAME
FT                   LPALSMSQYSGQLGMFSMLFFFAALNDLVPLMEDNKTYFRSIVPVRLTVFFIIGAIAYL
FT                   WTENLYFHNNAVFIYCFIEIWINFLLLNAVREERNEEFKREHRFMNDDLIEEPAPFEKA
FT                   E"
FT   CDS_pept        complement(55888..56736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503358"
FT                   /locus_tag="CAGL0H00572g"
FT                   /product="Similar to uniprot|P47153 Saccharomyces
FT                   cerevisiae YJR116w"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59754.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG395368"
FT                   /db_xref="HOGENOM:HBG434259"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI00003B6624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH1"
FT                   /transl_table=1
FT                   /translation="MSSLNDTVAAGYYEPLFGLSWYPDRLDNLWLAHLHEIVYAFIFYQ
FT                   VCQYTIAPKINRYFFGKHYSDITDKKLKLDFDVHTVSMIQAVISIAILLPVLALPFDLN
FT                   IATYVNPWCSMVSALSCGYFVWDLALCLRHFSIYGFEFLFHAVGSLVVMLAILTPFCQP
FT                   WVGKYLLFEASTPFVNMNWYTIQLNHKHKSSSGPVIPNWLNMINGLLLLLTFFGVRIVW
FT                   GWSCNLLLLRQFWRARYELPYLAGAVVLSLNITMSLLNVLWFSKMLKIAKKMASPSKKQ
FT                   D"
FT   CDS_pept        57283..58644
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446645"
FT                   /locus_tag="CAGL0H00594g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59755.1"
FT                   /db_xref="HOGENOM:HBG124845"
FT                   /db_xref="UniParc:UPI00003B6625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSH0"
FT                   /transl_table=1
FT                   /translation="MVDTDDGASVGGLKGVYKWTVDALFGSGVSPSAKYRGLNHGSSRQ
FT                   RYSQDDTNYSRYKPLSSMRSRSRSNSWSVPVPQDPSFYKRYDLLPPISSDDEDYSEEDK
FT                   LQYGANSNRGSPMVKGLMNPAPVVPKQQNNGYGEFDRRSTNPLFTDPTDTFARRKTSSS
FT                   LMNNYRSSTEGIGDTAFIEETRNININGRDPLIAKLFGRITSPKKMANLPGKFPSPAKA
FT                   TLDSNRRRKNSVLHSIGSGRVRETSTSLDDKKILSEYMDIISDLDRNNENLSALSEQVE
FT                   DRNQRYEEIDTEYKKKYYDMRNELIKELKQSKKTHDNYYLLYNKYKELKEMASESNRLK
FT                   STIYNLESEILEQGVSKNREIQNLNEKILKLESRCQELEAEKLLERDKYELRIASLEAK
FT                   LREQNISNGKNYFSDYSYSHRSREFSPDNYRYLNNYFSEEMSDFDADIPYKNGR"
FT   CDS_pept        59437..60792
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111175" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197941"
FT                   /locus_tag="CAGL0H00616g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59756.1"
FT                   /db_xref="HOGENOM:HBG203952"
FT                   /db_xref="HOGENOM:HBG435435"
FT                   /db_xref="UniParc:UPI00003B6626"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG9"
FT                   /transl_table=1
FT                   /translation="MTAVQPQMRAMTPSFTGSGGTLTNGNSALFVKNAVGTPISMIDSN
FT                   QLNDIPSAGNYNSSNLTSNLKLKESLIEDQRVDISSMIEEITGILGRDQWTKYAQILSL
FT                   FILGKLSRKELVNELDILFSGSNNMKPKMMRLHNHLLLGILANSLRENPLTMIKNGSWG
FT                   FGNGTNANGKQSKKGNKHNSQIELYKKIVMSLPIEDRNRIKSITKDAGKRGFVFCSVLQ
FT                   SRLNNIPKIPIVTNADTLKRIKNDNMKTPLEWSQDIMNGFGAPLASESYSLPDTDSFYL
FT                   RIVGIAREHGIVGNIDAGCIDLISLALDVYLKNIIEMAIDTVRYRKKKYSDYYDLDDFG
FT                   TYQAVSSGTDTSKDAKDDIMEIERKRTISLTNEDIYTSLSLFPNMADASGAYYNAMNLG
FT                   LVNDDELVIKSSSIDDLPDFLEEKPFFTPVDEKNIGTPTELNWLIRDILTEN"
FT   CDS_pept        complement(61015..62769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446646"
FT                   /locus_tag="CAGL0H00638g"
FT                   /product="Similar to uniprot|Q12045 Saccharomyces
FT                   cerevisiae YPL253c VIK1"
FT                   /protein_id="CAG59757.1"
FT                   /db_xref="HOGENOM:HBG124850"
FT                   /db_xref="UniParc:UPI00003B6627"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG8"
FT                   /transl_table=1
FT                   /translation="MYRIKYRKLENITNKVSGNKEENTLERGLKRKQLNQLIRENEKFV
FT                   RTDKNLQIKIDKYQRKDIPNLKYEVQKRTGLLSQLEKTVNQINLNFEALEKEKTALSSK
FT                   NLAELTEIENKYKEVIEQKAAEFSQIFEKQQNAWREKIEELRNMPPEDELINQINNLKH
FT                   TLSSTEQNLEDKIAKNDNDLILYKQKLQVSFSEYKKKNSTSLEELQSQSKNLESTMAEL
FT                   QNIKTEKNSQLRTLAEEQSELERIVMDKQLQVDKLNAEIEPVENKIKEYQNSFVLLKND
FT                   IEGMKIKAIDNEQQYNEVYDTLGEELSRRRRLLNSITELKGCARLFANIIEDEISEKLI
FT                   VNYSDESIEDMKNHKTYKFTKLIQNFSHQNKDLFKEDLHVYIDFCLKRRENFNLFSVGS
FT                   SNIPNTFEKLLAFFKNNYFDKFVITLQYVMLSDNADSQDLLSNNKDGGKDVEIKLKIEE
FT                   STISLGSTLITLDEITDKLQIKKKYSQLNHQNGIGLSKFQFFCLQDIEPIPIDFYFIEI
FT                   YQPSIYPILKRSTGTESNLNSPLEIVLKKIFHDTKSAFVFQIDHSAEVYDILKLSSHLS
FT                   FIRNPKGK"
FT   CDS_pept        complement(63754..64257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446647"
FT                   /locus_tag="CAGL0H00660g"
FT                   /product="Similar to uniprot|Q12184 Saccharomyces
FT                   cerevisiae YPL252c YAH1"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /protein_id="CAG59758.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG267069"
FT                   /db_xref="HOGENOM:HBG524254"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="UniParc:UPI00003B6628"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG7"
FT                   /transl_table=1
FT                   /translation="MQHILRRSIVPISRNIGLSRRFADRPLWQSSARLFSTSMMLSHGH
FT                   IKKPNPGEELHVTYILKDGSQKTYEVADGDTLLDIAQANNLDMEGACGGSCACSTCHVI
FT                   VDPDYYDAIPEPEDDENDMLDLAYGLTETSRLGCQVKMSKDIDGIRVALPAMTRNVSNN
FT                   DFNQ"
FT   CDS_pept        complement(65095..68235)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000011547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446648"
FT                   /locus_tag="CAGL0H00682g"
FT                   /product="Similar to uniprot|Q04336 Saccharomyces
FT                   cerevisiae YMR196w"
FT                   /function="mannosyl-oligosaccharide glucosidase activity "
FT                   /biological_process="oligosaccharide metabolic process "
FT                   /protein_id="CAG59759.1"
FT                   /db_xref="GO:0004573"
FT                   /db_xref="GO:0009311"
FT                   /db_xref="HOGENOM:HBG157410"
FT                   /db_xref="HOGENOM:HBG330830"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI00003B6629"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG6"
FT                   /transl_table=1
FT                   /translation="MNQLREELVNTTVEEKRLEENSKHEKYWYRWGPYLSERAWATVRE
FT                   DYSQNGDAWSHFPFEHANARVFRWGEDGLFGVSDNKQLVCMNVALWNGKDERLKERLFG
FT                   LTGHQGNHGEDVKELYYYLDNTPTHSYMKALYKYPFKKAFPYKELVQKNAERGYQDREF
FT                   EVHEVDGLFHDKATGDTPYFDVYFEMAKSDSNPDDLNFRITVHNRSNQDSGELYVTPQI
FT                   FYRNTWAWDAESKKNMPRLEKDAHANNLVHLFHKKFGKQKIVFQPSPDIKEGEDVEPEL
FT                   LFTDNEPNLVKLFNDKKNPSPYSKDAFEEYLVHGNKKLCNPEHKGSKAGAVYHFKNIPA
FT                   GESVTVRYKFTNDFDNTIFPSKDLAVIDEDIFDTTFDNRKEEADNFYWRVNPSPIDKEL
FT                   RNVQRQAFAGLLWTKQFYNLTFDEWFKGDPNIKPRPPQNRANGRNSNWQHLYIEDVLSM
FT                   PDKWEYPFFASWDTAFHCIPLAMIDPDFAKKQLDLLTREWYMHPNGQIPAYEWNFNDVN
FT                   PPVHAWAVYRVFKIEKSLYNREDRHFLERVFQKLLLNFTWWVNRKDANGKNLFEGGFLG
FT                   LDNIGIFNRSEPLPTGGTLEQADSTGWMAFFSLQMLNIALELAKTNPAYEDIASKFFEH
FT                   FILISDSMSFEYQKDLDNGEIIKQNLWNENDKFYYDAISWGGDHREQLPIRSLVGLIPL
FT                   YASMTLEPSIILQFKGFKKRVDWFVKNKKEIFGRNVASMSEEGVGKRLLLSLVTKDRLE
FT                   AILKRMLDETEFLSDYGIRSLSKYHEKHPFEMNVHGVQYKVQYLPGESDSGMFGGNSNW
FT                   RGPIWFSTSFLIIESLQRFHLYYGSDFKVECPVGSGKFLNLSQVADELSSRMVKLFLPD
FT                   QKTGLRPVHGDIEADFLSKDPHFKDLIPFFEYFDGDTGRGLGASHQTGWTSLVAKWISE
FT                   VGIYCTKSLDKKNLKENVPKGGFADGTPKMKDERRRKSTKSLVNVESTKLELAEECDSK
FT                   DKFENAYTAYVGANAEHILETKLMERLREKMQNLSFGDDIVDDELATNANSDLACHF"
FT   CDS_pept        complement(69155..69547)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503359"
FT                   /locus_tag="CAGL0H00704g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59760.1"
FT                   /db_xref="HOGENOM:HBG124858"
FT                   /db_xref="UniParc:UPI00003B662A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG5"
FT                   /transl_table=1
FT                   /translation="MSDIIFPISINEEEAPVVYKPVIQDPLYEDVDLDLDQDDDDDSTS
FT                   DSDSVPSSYESVFTLGNNYTFTPLSYEDEMIPRSDAYADTDSHFYSKIQNRLYTTAPRT
FT                   TAEVPRQNYNFANVAQDNYKLWLSTV"
FT   CDS_pept        complement(70626..73754)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141899" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446649"
FT                   /locus_tag="CAGL0H00737g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59762.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG252912"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B662C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG3"
FT                   /transl_table=1
FT                   /translation="MATSTDLGNVETASDMAESTGVSSIDASPVKSKNSKKNKKKKEKA
FT                   KKKKQSQQALQNEAESIDDSAGNEKESTAEIQEPSNEELATSTQLEEPKLVVTTDHVNK
FT                   EHGESAEGQTDAKDEKDLNTIEKSQDNDLSKTGNSSDKTNDYMTEEDLNSSPLDHLPEG
FT                   ENEAQKLNETNVSTKLNSEKQTNISDTQIKEEVLENPTLEHNDMGKESKENFPIQTPKN
FT                   EDNGTNDEANDDMIDHGTTENEVLITEASKEIKNSLEKNLENDVKSDTLISTDPTEDNL
FT                   LPAPEMSTVDKTTNQQREESLIKVEENSGEKDLLPAQDQETTEKKDNSPENDHSDHDSL
FT                   LNAGKPIKHRFTSGDDYENSEQQGSNRNMHDFTYTDEDENHNGIQMSDHDDEQYNGHYS
FT                   GKPPALPTRHISQSPMSITTSDTDHRTPPALPSREMKTRVKNAVPPPLAEELKSDKFRE
FT                   EFEKGKIKAKHKRYPSSSSMRQSSSQLETAADVNLIANRYRKTSSHVLRETTSTQELLE
FT                   EGQTQLKTNYTSILENLKEENVTEAQLEADHEYSKDEKKELLRTDWTFWTEVVNDFPAV
FT                   ASQEPEKLEQQVIAGIPTQIRGIIWQLMTNSKSKEMEDIYNTLLPEPTPHDAAIRRDLK
FT                   RTNFIPQEKIEPLYNVIKVYTIFDPEVGYTQGMAFVIAPLLLNCETEADAFGLLVGLMK
FT                   NYGLRDFYLPEMPGLVLSLYQFDRIIEENSSQLSNHLNREGVRASMYATQWFLTMFAYK
FT                   FPLSFVLRILDVIFVEGLESILKFAVNLMLKNEAKILSLKFDQLLSFLKEELFEVYRVS
FT                   EDKLDGADASSVIVHDSQPAVDDVAETRYDVDQFVQDAIADVQITPLSLRRYSEEYKEI
FT                   QQLEHQRETQYESMRIKNHQLNKEYHKLQNDYKQLNHEHESIASELIEIRLKYQMLLDE
FT                   HNDLQGSIESVRAEIQQLKDHGVSEDQAHVATNDLEVDLQRATHRNTEVMRENMKLEDR
FT                   IEELKLLVKELKMANRMNREPTTLGTTLGTTLGTNLRSSAGASWSGFKKVFGK"
FT   CDS_pept        74843..76999
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503360"
FT                   /locus_tag="CAGL0H00759g"
FT                   /product="Similar to uniprot|P35187 Saccharomyces
FT                   cerevisiae YMR190c SGS1 DNA helicase "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent 3'-5' DNA helicase activity "
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAG59763.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0043140"
FT                   /db_xref="HOGENOM:HBG124864"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="UniParc:UPI00003B662D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG2"
FT                   /transl_table=1
FT                   /translation="MSQIAEYFMNHLDPTGYDTSDSYGSCIVSSSQSYKGQSALEQCLF
FT                   VPSSSSLPSSQLSGLVNAQQTQPDSKKENKSSLNTANPWDKQVQNILKCTFHMEQFRGS
FT                   QIDIINSTLQGKHVFVLMCTGGGKSLCYQLPSLVTLGYTKGTTIVISPLISLMHDQVEA
FT                   LISKRIKACMLSSTSSSKQKTMALQLLSEGKLNLFYISPEMVMGSSPCKGIIRRLYRQN
FT                   RLARLVIDEAHCISSWGHDFRPEYKKLGQLTKEFDGVPVMALTATANDNIQEDILKILN
FT                   LKNVVVFKDSLNRKNLYYEVVQKNSRTIEYMTYLLKTEFHGQSGIIYCNSKASCEKVSK
FT                   ELNQANISSEFYHAGKTANSRLNTQRKWQQGTIQVVCATIAFGMGIDKENVRFVFHYDI
FT                   PRSMEGYYQETGRAGRDGNPSKCILFFCLQDVNRLQILIQRENVSALQKEHNLKKLQDV
FT                   LVYCHNKVDCRRLQILEYFNEEFFPSNCMKTCDNCKNIGVSTIEQKDFTHYAKQILSLL
FT                   RKLGNERITTNQCQDIFRGSNNMKTRFSGYDNFEEHGSGKDLTKSETDRLFVHLLKTGY
FT                   VCEYFFTNSMGYSTKYLKLPDPIKEIKGKVMLNSLKKQYKAKKKQDIDVDNSQSRIDTF
FT                   SSSLSLFKCHQNSSFQSEDVSMQNLLSENSQSMLDDNSSLIFETINSCISTNLYCTEEK
FT                   ENHKHPKRKKRKSETLPFKKRKKS"
FT   CDS_pept        complement(77292..78833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000260968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446650"
FT                   /locus_tag="CAGL0H00781g"
FT                   /product="Similar to uniprot|Q12523 Saccharomyces
FT                   cerevisiae YPL247c"
FT                   /protein_id="CAG59764.1"
FT                   /db_xref="HOGENOM:HBG020934"
FT                   /db_xref="HOGENOM:HBG395799"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B662E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSG1"
FT                   /transl_table=1
FT                   /translation="MEYQPGKRASVSFGSPSHSVHQSYTTSPFSSGVNLATTAEGVPNN
FT                   TGGSGSGANGEDVFMTNRSPMYSPLDFLHPLYSPNYSQLHQIRAGLNNTLKNMNQGVVC
FT                   EYGAHFPLYGVDWSIEDYVCIGSYKEDSRNKLQVIHSPDLFKWDNVAECDVIYPVSNIQ
FT                   WMPSAFRSRKIATASDSLRIWSLNTEENKLEEQLNLSLCKFHKQHPNNKAFVGLSQIPT
FT                   KTSDVNPSVLGEFPPITSFHWNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLIAHDSE
FT                   VFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDE
FT                   NSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTK
FT                   KNTLISCSDDCQVLFWDISSYFDQGAVSHTTTPRPAASGASMEVDSEGDYSYDDSASKT
FT                   SSIKATKPLSKDLDVPTMCYSNKTHEINNIVWRPQRGDWFGCVSGKKFQNVRTPL"
FT   CDS_pept        complement(79284..80084)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446651"
FT                   /gene_name="RBD2"
FT                   /locus_tag="CAGL0H00803g"
FT                   /product="Rhomboid protein 2"
FT                   /EC_number="3.4.21.-"
FT                   /function="serine-type peptidase activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59765.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059640"
FT                   /db_xref="HOGENOM:HBG397694"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI00003B662F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSG0"
FT                   /transl_table=1
FT                   /translation="MIAPQRMLMPEGRPPAGLTTGLLIFLTFLFGISQLYEDFKNHFVL
FT                   TPNSLFDIDLGKLSLYPLMHLSYLHLVFNALAIVGPLNNFESSHGTIHTGVVLNLSAVI
FT                   AGIIYCVVSRLLSLETGVAGASGWVFTFITYLCVKESQLYPRLELSRFIPGVTQSIPTQ
FT                   FTPVVFLLFTAIVFFQSSFLGHTAGMIVGYIMGYGETWFNILIPPAWIIEKIEEKADPL
FT                   INLIPFGIKFYRSTEINTDDGYRSFFPGQEVLPTTTPGNVLGTA"
FT   CDS_pept        80996..82306
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000288797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446652"
FT                   /locus_tag="CAGL0H00825g"
FT                   /product="Similar to uniprot|Q12179 Saccharomyces
FT                   cerevisiae YPL245w"
FT                   /protein_id="CAG59766.1"
FT                   /db_xref="HOGENOM:HBG258216"
FT                   /db_xref="HOGENOM:HBG344808"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="UniParc:UPI00003B6630"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF9"
FT                   /transl_table=1
FT                   /translation="MTVSRASRFKRAKPANVVKSIAMDKLSNVKLSEEQQQLRGRILEF
FT                   IRQNLASYQKGGKPGMFVVQGDAGTGKSVILNSLFNDVQKLANNNPDTTDILKGTRNYL
FT                   IVNHPEMLKLYHRMSTNYTYINKASLERPTSLINNLQKRKEMADVVIIDEAHLLATSKD
FT                   AFKRFYGENHLKELLELAKVLVLVYDEKQALRMGCYWDENSENGANLQTFYDEIPESKR
FT                   GWYNLKQQFRVAAPPDVLDWINDISVEGKIPKYPKSAKGSLEPKFDFQIWDDCNEMYMK
FT                   LKEKNETFGQCRMLSTYDFPYRLDGKIYYVTCGDFKLRWDMYAPKALLPWSEREDTIDE
FT                   VGSVYTVQGFDLNYAGVILGRSVGYDKANDCIKLRPELYDDHAGFTKKKNISDADTVKQ
FT                   KIIMNSINVLLTRGTKGLYVYAWDPELRERLARSRTE"
FT   CDS_pept        complement(82430..83518)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446653"
FT                   /gene_name="HUT1"
FT                   /locus_tag="CAGL0H00847g"
FT                   /product="UDP-galactose transporter homolog 1 "
FT                   /biological_process="carbohydrate transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59767.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG203273"
FT                   /db_xref="HOGENOM:HBG382050"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI00003B6631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSF8"
FT                   /transl_table=1
FT                   /translation="MSKSNSIFPVLFCAAGIYASFLTWALVQEPLTTQVWENSHKRFQC
FT                   PNVIAVVQAVAAVCVGYFYMRAKGAQRNYGAIAMVRDYAKPLALISFTQSASSPLSQYA
FT                   LQYVDYLTYMLAKSCKMIPVLLVHLIIYRTTISRKKSVVAVLVSIGVTIFTIGGSKGKI
FT                   SGSISGSNDEHFFQKASGFLLLFLSLFMDGLTNATQDKMLKNNRVQMAIQNAETQDKKQ
FT                   QHKVFHTLTGAHMMFALNFFVAIWNIAYLLVIDRGQICNAHAMLKKDPIIVSYLLAYAL
FT                   CGSLGQCFIFYTLELYGSLVLIMITVTRKMMSMLLSIIVFGKTVNATQWLGIVIVFSGI
FT                   TWEALDKRREKKALEAKVQKSE"
FT   CDS_pept        83996..85786
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503361"
FT                   /locus_tag="CAGL0H00869g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59768.1"
FT                   /db_xref="HOGENOM:HBG059648"
FT                   /db_xref="HOGENOM:HBG203998"
FT                   /db_xref="UniParc:UPI00003B6632"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF7"
FT                   /transl_table=1
FT                   /translation="MPIFSPINATYGVRVEQILETDQDFVKYHDKLNRKLQKLRHRCQG
FT                   VTKDTKKYSEKEKFSKITSDNYDKQSKLYGVLYLLQVERDLSLVETLKLRGRQRGKLKR
FT                   PERKVIQTRLKKVAKLVEGLVALTQNEQNYVTRLQYLIYSKLAKAEFILNGKLTTKKKA
FT                   ESDVAGLLALAFAGLQYLAEHNYISEDISSFIQSKYEYSLMQYAGNLVSNVRLQNFIIE
FT                   SLKSIGDKDEIVKLLLNNGFKLDIKEVDDTTTNSLTNINWRSFQAKITDREVSHLIELA
FT                   ESVEISKLSDYSSKLLYWEDALSKQEAVIANYDENESTENADIDDPQENNQILLSYVKY
FT                   NKLMVNILRDNEICKELWQQWDKSCSTLSAKVVKYKELERITSNLSVFLHEVMELPGIY
FT                   SDDELMYQLELLDLHYKTLLSSKALAYLYQSKGKYREALALHVRSFQELNSKLEQDMLY
FT                   SNDEILPNSLFDKLDIEKNQSNIKAAWTGVIALAGYQKSLETTGKSKYKLSVIEKISNQ
FT                   KEIEASDVNISNLFPLTPHMQPVGAKPTLFDLAFNYIQYEKFEQRNITENKPAEKQSSE
FT                   PENHKEEQPKKRGFLGLFGR"
FT   CDS_pept        complement(85886..90313)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351130"
FT                   /locus_tag="CAGL0H00891g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="Ras GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59769.1"
FT                   /db_xref="GO:0005099"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059668"
FT                   /db_xref="HOGENOM:HBG204004"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B6633"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF6"
FT                   /transl_table=1
FT                   /translation="MTDSNSFLQRYVDLVNTNESPVSPLGLKSSSKTNLLSPSPVKSKL
FT                   SSPVSLSMADKENQGYKKSFDLPQTPTKSQSVSKAFTADELRYYEFLCRVHEVKVWIES
FT                   VISEELPSVTELATGDVMRDGVFLAKVTNKINPALAPSVFPAGDKLQFKHTQNINAFFS
FT                   LVEHVGVPDSFRFELQDLYNKKDLPHVFETLHIMISIINKKWPGTTPDIKNVSGTMVCT
FT                   KEDIQVCRRAWPRIKDFGSLANTSAVPSPKKVDIPKSEGLIQDFSSSITKDKKVNTMEQ
FT                   QPKTPIKPKAEGRPTYISSFKTPVSKVLDTSKTDEYMSLKDGPSAANIFAKTPSLSYSP
FT                   SKMTSFSYYSPSISKYLTFDTDFYMRRSQYRDSELSHYSTYKYSPSRYSPTRKTRMNEE
FT                   EFLDCVMKIQAMTKGVNIRYQIYLQNQLLSLFKEDVVGLQSLIRANSLRKMKGTKSHKW
FT                   RSIEKSVDFVSLTSLIRGNRIRDKLDKKRIAVNRKESSIILFQSICHGILARRNATVLS
FT                   SYVKNNTTIVTIMQGLLRGKLARNVVSHTSKDLHANIPCLTDIQATVRSILVRQCIDNR
FT                   RKAFFAPSISSSLEAFQTVGRSLLQRREIQRINIELSESHKLIALLKGHSVRRRIGRCQ
FT                   TDLSSELEPAIGFQALVRGILVRYTLDLVDDIVEYHQIEVLQSLIRGALQRGAIKENTH
FT                   HYRKNISHIIQIQSHIRMFQMKTAYQELMTYPNPSLWSVKKFVHLLNNRKSIESIQDEV
FT                   ETYQASLDSENMKKTKVLREIKHQLDLLDVLERQNLAKGINHGTFSKIKSKVPNSNYPG
FT                   FEGLFYLLQVDPSYWKLMAAKEKEFSMRNIYSTFTTTNKKMEERERRLFMKLVSELLQQ
FT                   DIQECTSVGEFMAFSSPSWKLLLDEFIEKEYSEAFELFVPVLSFLGNRETDFTSDPYVL
FT                   YEKFYSEAPSSQPIENQRVKNEFIKNLRNIWHAIEMIAEIFSRKTNEIPVELRYICTKT
FT                   LCYFADKNICEEEALKAISMVLIESFIEHFMVNFQKFGFDQYNDENINDKIKVVIESLR
FT                   IVFLQTSFDGYHKPLNQYSGEIRPHIKNLLYNLLVDLEYEQVGYAEIYNDMVSTSPVLE
FT                   LLSSKVIEVAQMFSDYSEDFTDLDPIQDVLKTMDFKLMSNNSGRVTLELDSSSYRFLTG
FT                   DDGIRKVYDQVKRAFVIMIQVEDVETNLYDLSVSSVLPQDEPVFQELLRNNIGLEKDSF
FT                   VSKLTPRTYFTLKNETLRNIQELTTAKVICMKDNKLQNFLNDIANTIKNPDYALHFVEK
FT                   EVEMTNRTLVEIQNVNHKLESELRNMRSFVSSTISDIQKTSDFTPHHKGALGNLKSAYK
FT                   KVQNKDSKLDGLKYKWNARQLYEKGILKRIQGENLGKHSVKVFGSSGPKFPDINFRIST
FT                   TNGSRFGIQMTDKRKGPEHKHMDITDFFEFRDLLEKQAKNPKGTITLLNRKVDLNVAEL
FT                   LKLVTTAFYYRQSI"
FT   CDS_pept        complement(90756..91592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046826"
FT                   /locus_tag="CAGL0H00913g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59770.1"
FT                   /db_xref="HOGENOM:HBG124883"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI00003B6634"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF5"
FT                   /transl_table=1
FT                   /translation="MDIAQQLRRLEDTAEEAQEQWLAELDCAYAQFNERIADLTKYDRE
FT                   KCKRRFDALFAWRNSGGGSGGGSGQGPHGQRLRFRFKHTPRLKTSTEAPAGDPAARSTP
FT                   PLQHVDAVLELSEMQMKRVFNLDRLDRCVVLYDGASNDAMSAFSMAHARNTVVSLNVPQ
FT                   MLGSIFVTDCEHTTLLIRLRFGEKVQIRLHNLVNCQIQVEPADNTASAQTVIIEDCDEV
FT                   TFHSTAQDLIAIRNFNVFKAHTDKPPYKWGPPLPDQDQDPIKLREAYIAAERGIVM"
FT   CDS_pept        91979..92560
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351131"
FT                   /locus_tag="CAGL0H00935g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59771.1"
FT                   /db_xref="HOGENOM:HBG037955"
FT                   /db_xref="HOGENOM:HBG397791"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B6635"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF4"
FT                   /transl_table=1
FT                   /translation="MSLHEKPLEQEDQDAVILDARAGDLESLQEIFTTLIHPKLLATCV
FT                   SSDNGSTALHMAAANGHLEVVKYIMEQVKQSADAGAVGRYVNLQNKTGNTALHWATLNG
FT                   KLDVVQYLCDECDADPFVKNEFGHDPIFEAENNGKEEVENYFLKKFDVEPESESESEDD
FT                   VKVSHGTEIEQVTKEATEVLAKQTESLQLE"
FT   CDS_pept        92911..93657
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446654"
FT                   /locus_tag="CAGL0H00957g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAG59772.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG374400"
FT                   /db_xref="HOGENOM:HBG738095"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI00003B6636"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF3"
FT                   /transl_table=1
FT                   /translation="MSDIEVKKVVDDPFAGLKKKKKKSKSVKEEEVGADEVTEALSELT
FT                   LKKKKKKSKEVTDEFEKELAKAGLTGESNSKESSVGQESSIQQNVGLPYPELLSRFFNI
FT                   LRENNPELAGDRSGPKFRIPPPVCLRDGKKTIFSNIEEISEKLQRSTEHLIQYLFAELG
FT                   TSGSVDGQKRLVIKGKFQSKQMENVLRRYILEYVTCKTCKSINTELKKEQSNRLFFMVC
FT                   KSCGSTRSVSSIKTGFQATVGKRRKM"
FT   CDS_pept        complement(94328..95527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157694" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446655"
FT                   /locus_tag="CAGL0H00979g"
FT                   /product="Similar to uniprot|Q12003 Saccharomyces
FT                   cerevisiae YPL236c"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59773.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF2"
FT                   /transl_table=1
FT                   /translation="MLWQWLSGPLSVLCCGFCPDFSNTFLLVNGRKYSIVRLLKEDDMS
FT                   FLYLVRLEDGMPLLSAAASGDDDDGYESVNTYTLKRIRCPIGNISNVSDAMREIDNYKR
FT                   FQSPYVVSSVDSQVIQELDGAKTIYIVFPHYPLGSLQDSIDDRILDGTFVSESECIRIM
FT                   CGIARGLLCLHDSSSAPRGVRTLTTGVDEGASDNVNTDFNLSDNLGDDRDKISASYTDE
FT                   AGLSMDEHLLELDSISTTSVVPVSYSHKMLSPSNIIFSSNGLPIISELGSCSKADVEIK
FT                   TAKQLNRLREWVDDNFNSYMAPEFLDLKTNSKLSTKVDVWSFGCICYALLFGMNPFERE
FT                   EQLYGASIKYAISTGKFSFPSQSRYSDSILDIIRSCLQVDPSERPSVSIVLNNLQQLQS
FT                   "
FT   CDS_pept        95818..97248
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351132"
FT                   /gene_name="RVB2"
FT                   /locus_tag="CAGL0H01001g"
FT                   /product="RuvB-like helicase 2 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59774.1"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG015017"
FT                   /db_xref="HOGENOM:HBG749829"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="UniParc:UPI00003B6638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSF1"
FT                   /transl_table=1
FT                   /translation="MSIQTSDPNDPNGSLKSLSLIAAHSHITGLGLDDNLQPRASSEGM
FT                   VGQLQARRAAGVILRMIQNGSIAGRAILVAGPPSTGKTALAMGLSQSLGKDVPFTAITG
FT                   SEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKT
FT                   TDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGYDTKF
FT                   VQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEW
FT                   KEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIIMMATNRGISKTRGTNYKS
FT                   PHGLPLDLLDRSIIITTSNYNEEEIKTILTIRAQEEEVELSPDALDLLTKTGGETSLRY
FT                   SSNLISVAQQIALKRKSNTVEVADVKKAYLLFLDSSRSVKFVQENQDQYIDDNGKVIIS
FT                   TSGEMTQPADGEAMDTTE"
FT   CDS_pept        97613..98647
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503362"
FT                   /locus_tag="CAGL0H01023g"
FT                   /product="Similar to uniprot|Q05635 Saccharomyces
FT                   cerevisiae YDR279w"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59775.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058085"
FT                   /db_xref="InterPro:IPR019024"
FT                   /db_xref="UniParc:UPI00003B6639"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSF0"
FT                   /transl_table=1
FT                   /translation="MTIEDEQKRVGIEGICLLPSEIKLLSEAYFFELPASSNNESSSTT
FT                   KLLKYGTEIYQVTDYCFGKGRKYEKVKDEINDRYHYDEEGKPLRSAIHVNSEDKTNYTV
FT                   LPNANIKYFSKYDLTYNLIGFKFKDCVTGKESEYFKPTHKETTKKDDDRYLTLRDHQDM
FT                   LIDNGHANWSQIPSPTLEHCLSNISDQIEEAGDKYYKITLDKILNYLKLKIVNIVENFP
FT                   NSISVPPSLDKNDLNAFKIFIASNILVSLVPKIIFVSLQDDDIPIEKYDISVKQAFHDI
FT                   EVFYKTSTDKDAEQKILLEAATNVGMPGDSGPRQMDKKPKKVVPKKPKVAVGRGAIDGF
FT                   FKKK"
FT   CDS_pept        complement(98818..99903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446656"
FT                   /locus_tag="CAGL0H01045g"
FT                   /product="Similar to uniprot|Q05648 Saccharomyces
FT                   cerevisiae YDR282c"
FT                   /protein_id="CAG59776.1"
FT                   /db_xref="HOGENOM:HBG396597"
FT                   /db_xref="HOGENOM:HBG431219"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniParc:UPI00003B663A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE9"
FT                   /transl_table=1
FT                   /translation="MTNIDSYGVKTTKFTKGIANPTRYLRRSFVPRSKKVNAVDTESED
FT                   DKFESSILKTLVIKPCTTVTTGERYDLGKCLEILNINGFQPSNLIPGEIVSFNYRTNGI
FT                   DGTIMILGQTGSVVCWGVDERTALIEIVPLISEAIVNKLEVEEYETEDMDYIEIESAED
FT                   LENLRSHSGIQSEPKINSRLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVLENAM
FT                   ERHISNTRIITEKISTGIKLKVKESDALKSIGRLFLIRGRLNLYSELIETPDLYWSEPE
FT                   LEIIFKDVSRYLDISPRINILNSKLDYSTDECRAILSLLNERNSSFLEWIIIYLITFEV
FT                   IFELFHFYKSNQESTKRVEVD"
FT   CDS_pept        complement(100610..101530)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446657"
FT                   /locus_tag="CAGL0H01067g"
FT                   /product="Similar to uniprot|Q05541 Saccharomyces
FT                   cerevisiae YDR288w"
FT                   /protein_id="CAG59777.1"
FT                   /db_xref="HOGENOM:HBG058086"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI00003B663B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE8"
FT                   /transl_table=1
FT                   /translation="MDEEYSSEQSPEINSKLDNVAYRLVGFILSSTEQGNSVLGRAKLQ
FT                   KAIKQYASNENVVRCPMSDVLLKVNQILDDTYGFELIGVSTNKTTSQADQSGRSTPIAI
FT                   ADSTKSIKSSDINYFVLRNKLKPITAVENFKIELAKEAYETFLSKELGENEDYNSDGEN
FT                   IIPQSQINATLSSDYEIKDNLVLKGILSVMLCIILFSKNNLLERDLYEELKKFGISENN
FT                   PIPLLDMSIDSVLRIFVNQQYIDKRDQNTETGNVITTYHIGRRTKYEFDFDSVVLLVKE
FT                   IMDIDVTKEERLKRDVKRALADSYS"
FT   CDS_pept        complement(102118..103005)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446658"
FT                   /locus_tag="CAGL0H01089g"
FT                   /product="Similar to uniprot|Q05533 Saccharomyces
FT                   cerevisiae YDR287w"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="CAG59778.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI00003B663C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE7"
FT                   /transl_table=1
FT                   /translation="MAKKLTGEELRKIEQHLIEFLKTDIGPILKNASGTKFDSYDEKVN
FT                   DVDLVTVVDKKVETLIRKFAEENYPEIKFIGEESLSKDERFDLEDPTFIVDPIDGTTNF
FT                   IHGFPFSCTSIGVAQGGKPVIGCVYNPHLNQLFHASLGNGAYLNDEPINIEKRTLSLKK
FT                   SIIGLEGGSEREDGKGTNFTKKFDTYRKLLSDRGAFIHGFRSLGSAAMNICYVSIGYMD
FT                   AYWEGGCWAWDVCAGWCILNEAGGKIVGGNPGQWNIPINNRSYLAVRGGLVDDDEQEKF
FT                   IQDFWGFVEGALKY"
FT   CDS_pept        103424..103768
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446659"
FT                   /locus_tag="CAGL0H01111g"
FT                   /product="Similar to uniprot|Q05530 Saccharomyces
FT                   cerevisiae YDR286c"
FT                   /protein_id="CAG59779.1"
FT                   /db_xref="HOGENOM:HBG050869"
FT                   /db_xref="HOGENOM:HBG203238"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B663D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE6"
FT                   /transl_table=1
FT                   /translation="MRSCLPRRLIQTATTGVSKGGVKLTLFSKPQCGLCEEAKEIIEDV
FT                   LESDAIPKHNISMNIVNINQLNNKKWWDLYCFDIPVLHIEKDNDKESLFKMMHRIDEDV
FT                   LVDKIQTYLK"
FT   CDS_pept        join(complement(105539..106608),complement(103968..105360))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197942"
FT                   /locus_tag="CAGL0H01144g"
FT                   /product="Similar to uniprot|P31111 Saccharomyces
FT                   cerevisiae YDR285w ZIP1"
FT                   /protein_id="CAR57985.1"
FT                   /db_xref="UniParc:UPI00017BD8BD"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN05"
FT                   /transl_table=1
FT                   /translation="MSFFRDNINLPFKNRSNIFQNKLRTVSDATDYNNENSKPEVAASE
FT                   DSSIVMDEYINKIIETEYSENTVVNDDVGNSFQKPNDELQITEIRIIDDKEQLAPVQDQ
FT                   SHNQTQQELRPNFTQVKESKNENIMQPLITENSNDVLLEAFTNTQKICSNLKSQLLKEQ
FT                   RENERLKKMLNDFEETNQKTGKKINEYKSLFESLNEKLSVLSHQKIQNEKSLKEFVTFQ
FT                   EEQKSKLDKSQIEIESLKSKLNEGKNILDVMKNDLMQKSSEIDFLKKELDECSGLLSEE
FT                   KIKSNKINQTIENKNNDLVHYLDKNITNQQNLMDELFKQVSTNNLKKLLQRLDIALTKM
FT                   QSFVESKSSDILVKIQESYRNNNALELSLENNITNIFNSLSSFIENNANQINDIISSNS
FT                   KNAIASIDNIDKRFNSFENSLKSENSQLLKLLEKHEQNFSSKLESIDSSLKEYCSEVDV
FT                   TKKLKDKILALEKYNIKLENDVENNQHSEKRLEQLLTSQRNEIESLKVELKSKNETLKN
FT                   STADVFKLKEELSVKVAEISRLNEINNLQKVNYESKLGSQSEILKVLIKEKDELKTKID
FT                   SIDDDRKRVEDELYKKVANFDKINKQLQSVNVEMVQLAANKLELEEETRNLRTVLKESE
FT                   KCTTSIERELKVLKQERIQLKAENQDLVSEKLEIEGKLKEMASKCMVNNKEKKKVASAD
FT                   KNPINGYRNDSNSNARNLEEVKKDDLLQKKHQRPSSIIKENTHKQDDEDILDDVFDLSY
FT                   SNSASDFESVSSIAFPKLAANSKVKVNSNLEKTIGDKQNGRNTSKKKFLIEDVNGDKNT
FT                   NFKRRKKT"
FT   CDS_pept        108423..109316
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351133"
FT                   /locus_tag="CAGL0H01177g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59782.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191419"
FT                   /db_xref="HOGENOM:HBG395619"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B663E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE5"
FT                   /transl_table=1
FT                   /translation="MNIDRLTFGLARGERESNSRLERLATTTSSKWRIQDVCLLLIIMV
FT                   VNYPVYYQEPFQRQFSLDDRTISHPYAEVERVNDVMLFIYSFIVPALSIFVVWLLFADP
FT                   RHRYYLIYVSMLGLIFAWFSCSLFTNFIKNWIGRLRPDFLARCQPRSDLPTDRYYTIDE
FT                   VCTTENYDVLLDGFRTTPSGHSSESFAGLGYLYYWLCGQLLTEKKYVGLWRKTLALVPL
FT                   LIASLIALSRTQDYRHHFIDVIIGSILGMVFAHFTYRRYFPSITDELPFKPLLDDSTVG
FT                   TDLYSSANEEVSLPTV"
FT   CDS_pept        110610..115556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446660"
FT                   /locus_tag="CAGL0H01199g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of translational initiation"
FT                   /protein_id="CAG59783.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006446"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG055343"
FT                   /db_xref="HOGENOM:HBG397659"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR016255"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B663F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE4"
FT                   /transl_table=1
FT                   /translation="MSRSYLSLDEYYEIQCNELEAIKSIYMDDFEDRTRKKSKWDKQPQ
FT                   IQFDISLRSMDKDPEELSLVVHFAMTPMYPHTAPEISFGERSNVTDTQIKVLENRLKEI
FT                   FKELKGQEMVFEITSYIQEKLDEFQNNVTTSSLEDERLQRIKEEEEKMIREEEERKRRI
FT                   EEKKINEQKRIDEIVQKELAKRQDDEDDEKIFQHKSQVNLMPPQDWISSGEAILFPKVM
FT                   KAKLPNNTQFKFCAVVAPKQIFLQNDILSFANQYLVKPYVPSDSPLADVLMSSEMMQNF
FT                   YFLLTEIHLKNPYFNTSNGKKEIANLEKELESLLKVQHDNVLRVFSFTVERMGKNHSSF
FT                   FWKIRILTEYSPAYSVGEIVQSVNFVNLATARVWIIRLLEGLESLHKAGIPHRCISLET
FT                   VLLLKDTDLGNTVPKLTHPSYAYIIINMLSRYPNKDDNNIELPEFAWPAPELSKNPSMK
FT                   PTRMTDIWQMGVIFLQMINGIESVVDFSTPSDFLEAYAMDESLHDVLSKMLNNDPKKRL
FT                   GTLELLPMKFFRTNIDSSANKLFIHTEKSFQNFQNMGSSYETKDRTLSSSSMRRRSFNV
FT                   GSRFSSVNPSTKSRYATDFEEIAVLGKGAFGQVVKARNALDSRYYAIKKIRHSEEKLSS
FT                   ILSEVMLLASLNHQYVVRYYAAWLEEDIVDNDVFESSDDESYSDESSEISKDDLLLSSG
FT                   FTSRLSTKDLDESNFDFISNSGYPDIVFENSGDDNSKNESDESNESDETDSDFSDAESA
FT                   SNGIEFVREDSMKKTKKRSTLFIQMEYCENRTLYDLIHNEGLNKERDEYWRLFRQILEA
FT                   LSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHKSLDALKLDSQMSTGSVDDL
FT                   TSAIGTALYVATEVLTGKGNYNEKIDMYSLGIIFFEMIYPFSTGMERVNILKDLRSSNV
FT                   KFPNDFDNNRMKTEKKIITLLVDHDPQKRPGAKTLLNSGWLPAKHADEVIKEALKSLSN
FT                   PSSPWQQQVRETLFDQPYSLTNDILYDNNKQVTTKFAQILRARMTEEVVKIFRKHGGVE
FT                   NNGPPRIFPKAPIYGTQNVYEVLDLGGTVLQLQYDLTYPMARYLSKTTSTINKQYRMQY
FT                   VYRPPENSKSSLEPRRFGEIDFDIISTSSSESSFYDAESIKIIDEILTVFPVYEKTNTL
FT                   FVVNHADILDNVFNFLNIDKAQRPVVSRLLSQIGFAKSFREIKAELKSQLNIASTALND
FT                   LEMFDFKLDFEGAKKRLQKLMIDSPYLRKIEESLNHISKVLNYLKPLEVTRNIVLSPLS
FT                   NYNSAFYKGGIMFQSIYDDGSSRNLIAAGGRYDNLISYFARPSGRKSSTAFRAVGFNLA
FT                   WETIFGIAQSYFKLASKNRTKKRKEFLKDVSIDWKPSRCDVLVSSFSNSIFDTIGVNIL
FT                   NQLWKNGIKADFLRNCYTVDDVVSGAQQDGVDWIVLIKQQSYTVNSQKRKYKPLKVKHL
FT                   GSDIDVDVTLEEFLVLYRQETTRKLGVENQLLASEKYEETKRWDDGSSAGSSQEDDNDE
FT                   PLNGNANRKITYVPNMATRSKKASKREKWVYEDGARHASQAIINDLSNAPIIAVDALRD
FT                   EAMDIIAITSLAQKDEWLRKVFGSGNNSTPRSFATSIYNNLSKEASKGHKWAILYCHKN
FT                   NKSCVVDLQR"
FT   CDS_pept        complement(115828..117006)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446661"
FT                   /locus_tag="CAGL0H01221g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59784.1"
FT                   /db_xref="HOGENOM:HBG057935"
FT                   /db_xref="HOGENOM:HBG203240"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR006903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI00003B6640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE3"
FT                   /transl_table=1
FT                   /translation="MSFSASQFIGKLGTLEDSQESINSASKWLLSQYREADNVANTWKD
FT                   YMLKDSVKARRKLLGIYLLNHVVQQAKSQKIDHFQKAFSNVVYEVIKNVYPQLHPEMQK
FT                   KAKRVVDIWYDRGIFPKDILQKLRNSILEINKTAKLDLESGKDKKTSSSRSGSIDKDRT
FT                   KLSLELPDTIEQYAMLHKELRKLQQNAVSLKTRFDNSASELDPSSHVYEDNYNTVSKIA
FT                   NLAVDAVQKSMDTRQKAIDIIQSVLNAEKKQYEASQTMLTEINFSLMSKNPAKIQQIPE
FT                   DNVLPTYTSGSNANDSSSDDDSDASDSSESSSDEKEEKQLSDLNDRKRSPDDNLNENDS
FT                   SKKMKAIENEENVGETEKNELDEAEKNSENNGEDTGGNITSNIQDLLSKLAN"
FT   CDS_pept        117461..120745
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446662"
FT                   /locus_tag="CAGL0H01243g"
FT                   /product="Similar to uniprot|Q05549 Saccharomyces
FT                   cerevisiae YDR291w"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG59785.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG053034"
FT                   /db_xref="HOGENOM:HBG330712"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniParc:UPI00003B6641"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE2"
FT                   /transl_table=1
FT                   /translation="MDEPVLKRPKVEEQREESAGQDDFQLRDFKKFFFKLNTLYTFLSC
FT                   RKHVVPSFETLSKPLNASMKREVNEMDFARVVALMPRGTVFKYIDENQIVTERKLFDFN
FT                   KGGYQQRDNDIFELEEIEKQFEESRSTQILIFEFVDGTMKRTWNRNGQDNPNKQVFLPT
FT                   YTPEEMKKMIKKREAFFNERLSLFIEEASNEGIPTMKKLDELALKHMPKPKDYEDPITS
FT                   MLKAKEEKEKQVVNEETGESRPLMTEMVSKLKKSEHYNGQIKTHMEIPQRHAEYGELNV
FT                   DIDSEILDAIGYSQFYSHQADAINAVHNGENVIITTSTSSGKSLIYQLSAFDLMFRNPE
FT                   STFMYIFPTKALAQDQKRAFQVILSKIPSLKNVVVDTYDGDTDPEKRSFIRNNARVIFT
FT                   NPDMIHASILPNHVNWRRFLFNLHLVVIDELHIYKGLFGSHVALVMRRLLRLCREHYDN
FT                   FFTRFISCSATLKNPVKHMMDIFGIDKVRLISNDGSPRGTKHLVVWNPPVLSQHDRKRE
FT                   NFISESAKILVDLILANVRTIAFCYVRRVCELLMKEVRSIFEEMGRQDLITDVMSYRGG
FT                   YSAADRRKIEREMFHGNLKAVISTNALELGIDIGGLDAVLMCGFPLSLANFHQQSGRAG
FT                   RRSKDSLTVVVASDSPVDQHYVAHPDLLMNSEDPDSFQDLVLDFTNMLIVEGHVQCASF
FT                   ELPVNIERDKKYFNDKLLRNICHERLQKDENGYHCNIRFLPWPSKHVNLRGAEEDQFAV
FT                   VDITNGRNKVIEEVEASRTSFTLYDGGIFIHQGYPYLVKEFNPEEKYATVQRVDVDWVT
FT                   NQRDFTDIDPQEIEYVRSMEGTDVPVYFGKIKVTIIVFGFFKLDKFKRIIDAVEVHNPP
FT                   VIINSKGLWIDIPSRALEILESKQLNAAGAIHAAQHAIMGLLPKFIVAGSNEIQTECKA
FT                   PEKEFAERQTKRKRPARLVFFDSHGGSYGSGLSSKAFEHIQEILNGTLQRITDCPCEDG
FT                   CPECVAASYCKENSLVLSKPGSLVILHCILGHEEDDYIDLIKDGPEPNMPEIKVETVIP
FT                   VKEHVNFAPDFEILDIKNIKKEEGYIINEDENNKLYIKKEEETINH"
FT   CDS_pept        complement(120894..122711)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446663"
FT                   /locus_tag="CAGL0H01265g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="CAG59786.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR015284"
FT                   /db_xref="UniParc:UPI00003B6642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE1"
FT                   /transl_table=1
FT                   /translation="MFEQLTIFTPQGEVLYYYNCYDRKFAEAQVNAVISHLLTSPISRD
FT                   HGSSKYKLLSIPSVSKNAKPFTVLSHVSKQPELYFIITYPEPSMELNNEAQEVLDVAIA
FT                   LWDSLPINDIIIKAAKGTGKKNAFNCIDISGEISEDIEKFDNYLRTKYNESIKVDQANT
FT                   NINSDEIRAESPGAKKKSKAKKPIKGGNNRKWGIDGALEETGNDSGTLDFSDPNAKPTG
FT                   EMSQNVDTNIDTSDFGSKSKSGDFLIKEIDDILSQQQQQKSSSGSDNTGYTKSAFGFLQ
FT                   KHLLGNKTITEKDIHEVLEKFKQKLITKNVSPEAADYLLKQVSRDLVGSRTDNWTSVEN
FT                   TVKQAVSKSLTEVLTPGVSVDLLHEIQKKTGNRSADGKKNPYVFSVVGVNGVGKSTNLS
FT                   KLAFWLLQNNFRILIVACDTFRSGAVEQLRVHVENLAQLMDEKHIRGSKNSRGKSGNDY
FT                   IELFEAGYGGSDLVTKIAKQAIKYAKEQDFDIVLMDTAGRRHNDPTLMSPLKNFAEQAN
FT                   PDKIIMVGEALVGTDSVQQARNFNNAFGKNRNLDFFIISKCDTVGEMLGTMVNMVYATG
FT                   IPILFVGVGQTYTDLRTLSVNWAVNTLMS"
FT   CDS_pept        complement(123328..127302)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446664"
FT                   /locus_tag="CAGL0H01287g"
FT                   /product="Similar to uniprot|P24276 Saccharomyces
FT                   cerevisiae YDR293c SSD1"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="CAG59787.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG057938"
FT                   /db_xref="HOGENOM:HBG397445"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="UniParc:UPI00003B6643"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSE0"
FT                   /transl_table=1
FT                   /translation="MSKFHRQDGASGTTNNNMYVTTTGGGKNAPKQIFVAHRRSQSELT
FT                   SLMIEQFTLQKQLEAVQAQQQQLLAQQQQLAQQTQMYASQAQAQPQPGTGQGQGQGTGQ
FT                   GVDAMLGANTTAAAVAAAGMANQSGQNQAHHAMGGGFLPQPPNPHYSTGNSGNSGNGGN
FT                   GGNSASGGLGSNQSLASPNNLMAGGNRSRTHSRNNSGYYYSNTYDGASVTTPSGPNAHR
FT                   RTGSQSSVYGHSRRHSLGLNEAKKAAAEEQAKRVAGINDSLSGVNVKIEPVSPDLGSQE
FT                   QSSFEFPQKTHRRSNSNLSPASYKFPASTPTSSANTGNDDDFTPTSSMNRRSRNRNSEY
FT                   NIGINSNWRVQAQQQQQQQQQQGQQQYQNTQRSPFRHRASNSRDFNSFSTLEPPAMFQQ
FT                   GHKPRNSNSSIHSFSSNSGGGNNQNSRKSLFAPYLPQANIPQLIQEGRLVAGILRVNKK
FT                   NRSDAWVSTDGALDADIYICGSKDRNRALEGDLVAVELLVVDDVWGSKKEKEEKKRRKD
FT                   ALQQDIIPLNSNDDYHNDASATPNTGAPSYNSDDVVLSMRSDGDLGSPTKSSIKRKGSL
FT                   KQRPTQKKNDDVEVEGQSLLLVEEEEINDKFKPLYAGHVVAVLDRIPGQLFSGTLGLLR
FT                   PSQQANNENAKAPQSPKIAWFKPTDKKVPLIAIPTELAPKDFVENADKYTDRLFVASIK
FT                   RWPITSLHPFGILVSELGEINDPNTEIDSILRDNNFLSNEYSDPKDPSKEKTTFHPLEV
FT                   SDSAVAARKQFDNAHGYSVLCIEENGSISEFATHLRRDNEGNLELGCHVVDVTSYIEEG
FT                   SSLDRRARKRSSGVYMPQKVVDLLPETLNDAISLKPNKSTLAISVVYTLDPSTLKIKET
FT                   WIGTSNVTPTGKMSVSELDKRYNTGSADPVSSALKDIATKFYADRINWPEAQLSPALSL
FT                   LDSLDDEKVKADLNLFSSSIGGSVISELQRKVNATVAEKLYTKLGDLAFLRRQTAPVAT
FT                   KIASFIKKVEHFGYEIDTFSADTILKSILKIDDPDVRTGVEILLFKTMSRARYFVAGKL
FT                   DPDQYGHYILNLPLYTHFTAPMRRYADHVVHRQLKAAIYDVPYSDDMDSLKITSEYCNF
FT                   KKDCAMQAQEQAIHLLLCKTINDMGNTTGQLLTMATVLQVYESSFDVFIPEFGIEKRVH
FT                   GDQLPLLKAEFDVVSRVLELHWQPGIDSATFVPPDEKNPKSYRNSIKNKFRSTTAEIAD
FT                   TEFDRMSNNDSLVSDSLSKELSKLSLSVPQLRLPERKDGKNALNNFLATVNTRTENDNY
FT                   IQEIYELQKIPILLRAEIGMALPCLSVRALNPFMKVEPKH"
FT   CDS_pept        complement(127948..129645)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197943"
FT                   /locus_tag="CAGL0H01309g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAG59788.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG152036"
FT                   /db_xref="HOGENOM:HBG657947"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSD9"
FT                   /transl_table=1
FT                   /translation="MNINDIKELVDQVSVEDVVNCVVNKTTRYLDDTPWYNILKDYVFL
FT                   IVLYKFVKKIYYYLAGYGLLKSMQLLYKSVANWIFQRLLESPLLRGSVNKEVSKAVAGM
FT                   EKELIKNDDQLADFEVLPKEGLSSESINSELDKLNSILPHTSWEQGRVSGAVYHGGKEL
FT                   IKLQSEAFEKYCVANQLHPDVFPAVRKMEAEVVSMTLKMFNAPETGCGTTTSGGTESLL
FT                   LACLSAKVYGLKHRGITEPEMIVPVTAHAGFDKAAYYFGIKIHHVDLDPVTYKVDLKKV
FT                   KRLINGNTVLLAGSAPNFPHGIVDDIEGLGKLAQKYKIPLHVDCCLGSFIIAFMEKAGF
FT                   NDIGSFDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSELRKHQYYVDSKWTGGLYGSP
FT                   TLAGSRPGALVVGCWSTMIHMGESGYKDSCTRIVSTARKLKDHIRNKLPQLEVLGDPKL
FT                   SVVSFSSNKLNIYELADRLAKSGWHLNALQKPAALHLAITTLSVPTIDTFIETLTEAVE
FT                   QMSADPTSTPSTEGTSALYGVAGSVKTTGVADKLITAFLDTLYKVKSD"
FT   CDS_pept        complement(130263..132407)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112869" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446665"
FT                   /locus_tag="CAGL0H01331g"
FT                   /product="Similar to uniprot|Q06629 Saccharomyces
FT                   cerevisiae YDR295c PLO2"
FT                   /protein_id="CAG59789.1"
FT                   /db_xref="HOGENOM:HBG057939"
FT                   /db_xref="HOGENOM:HBG203241"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniParc:UPI00003B6645"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSD8"
FT                   /transl_table=1
FT                   /translation="MDKANIHYLPIGLTTSQVDLIEILISLHAHSLLKECAKRYNNDSK
FT                   GADVLKTEDHQGKYPIIPQKRMTYMLDANIRAIANHPSLLVDHYIPRQFLRMEPTEISI
FT                   TSSDKFKKLNTILSMIIQRDRKQFPKPLKVCLISHSIKELDLIEGLVLGKYFKIKRFSG
FT                   TPLYDEKHDLPYDMPPKSAASSRTSNTSGGKRGRHLSTRSTESSTTDVTINTKSTNSNS
FT                   TNTASVASSPNDSDSKTTDSTSTYTGYTKDTYHYSRKIKKQLHPDIYIDDWLFLTTTRH
FT                   LTHDPTLLNNINVDLIICFDPLLDPSLPGVSSIRNVNGKSNPIPLIKLVVCNSPDHFML
FT                   ERTLLKNEELIKSKQAEDGKLDDDSLEYVNTVDGLMHFLLTRSKYYRSMHGSDELQTDV
FT                   DYQRLITSLLRNENCNNVVPQLRIESFDFKKAFNEQASIFEPRLSKLKYSNSELKIFNT
FT                   VFDIKSYQSTLMKQTVERLKDLENEKEENEKVILRKRLHSTETQNELDGLKQEIGVFYK
FT                   KFKDDEKSMIDSEKRLERANAETSKLRERISAVEEQKAKLESLINLSTDQEMSSQMEEL
FT                   NELIRKTRVNLKELRTQNEQSSNENDELRSQYQLDSSKAAESASTLSALRTELEDLNKL
FT                   LSGPALKLKVNALTAEEKRVRKELYQIQAKSKYLKHYIELMESQYSLKTNGAPNSSVGG
FT                   RTSNNSTRIRSTRSATPSYT"
FT   CDS_pept        133494..134099
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446666"
FT                   /gene_name="MHR1"
FT                   /locus_tag="CAGL0H01353g"
FT                   /product="Mitochondrial homologous recombination protein 1 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59790.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG057941"
FT                   /db_xref="HOGENOM:HBG395969"
FT                   /db_xref="UniParc:UPI00003B6646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSD7"
FT                   /transl_table=1
FT                   /translation="MSLMNKAVSRFRTAGWLEKAGYSPWLYLYRNLERGQVMYSQLPEY
FT                   GERNIKTQFKRHQWENKTPSLRRDIWRVMCVVQMPNHQDSVQVYQNLCRLRYMRDVLYR
FT                   EEAQKHRKLNDKGQVWYSGQYRPTYTQEAVADLKESIDKSGSAGPVTLVWEDMWRMGER
FT                   SVWEELDLEIKHRALPKLGNVIRDEHAMLKQLQLESLE"
FT   CDS_pept        135473..136495
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203350" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351134"
FT                   /locus_tag="CAGL0H01375g"
FT                   /product="Similar to uniprot|P38992 Saccharomyces
FT                   cerevisiae YDR297w SUR2"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59791.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319731"
FT                   /db_xref="HOGENOM:HBG382907"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI00003B6647"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSD6"
FT                   /transl_table=1
FT                   /translation="MSVNGTLFEQSFNLKGGYDYMHTVSAPEIKLTPREDLTSYCSDGI
FT                   LALAAPVIAYWAQSAFFHIIDVFHLAEKYRIHPSEEIEKRNRATRLQVLREVIFQHIVQ
FT                   TVVGLIFLKFADESVTGFEQNEMWHWRQQAPGFIPDAAVYYAYMYGVSLIKLSLGFLFI
FT                   DTWQYFWHRVMHLSPFMYKYFHSIHHELYVPYAYGALFNNPVEGFILDTLGTGIAMFLT
FT                   GLTHREEAVLFTFATMKTIDDHCGYALPFDPFQIVFPNNAVYHDIHHQQFGLKTNFAQP
FT                   FFTFWDNLFGTNFKGFEEYQKKQRRVTIDKYKEFLAKREAEKLEKIKNFSKKNENKKEK
FT                   "
FT   CDS_pept        complement(137328..137951)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000075825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446667"
FT                   /gene_name="ATP5"
FT                   /locus_tag="CAGL0H01397g"
FT                   /product="ATP synthase subunit 5, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAG59792.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG532379"
FT                   /db_xref="HOGENOM:HBG668108"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniParc:UPI00003B6648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSD5"
FT                   /transl_table=1
FT                   /translation="MFSRVFVRAASNAAKAGVKPPVKLFGVEGTYASALFTAASKETSV
FT                   ESASSSLVKLSSLIKEDAKLKHIMENPALSTKDRAVVVDSLVKSSANLDKPVVNLLKVL
FT                   AENNKLGLFDKISSQFSILNDAHNGLIRGSVTTAQPLDSKNFKRLEKALQQSSLVGQQK
FT                   TLKLDNVVKPDIKGGLIVEVGDQTIDLSVSSKIQKLNKVLEETI"
FT   CDS_pept        138944..140512
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351135"
FT                   /gene_name="BFR2"
FT                   /locus_tag="CAGL0H01419g"
FT                   /product="Protein BFR2"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG59793.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="HOGENOM:HBG057942"
FT                   /db_xref="HOGENOM:HBG398283"
FT                   /db_xref="InterPro:IPR012617"
FT                   /db_xref="UniParc:UPI00003B6649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSD4"
FT                   /transl_table=1
FT                   /translation="MGKLLADKLGKLANKPVVGDVDIEDDRVFEHRESGSDSDMDSGDE
FT                   ELKKAHYAQVGESKLRKQLDSEKNLQELDTKYVGSVGSREDIYGENASSGSDSGSDSEL
FT                   EDDESDAPANDLQSNDESESVESESEESDHESGSESDNGEVLRKIVEKETRQAMNRISD
FT                   LTKRDASKGYSILSQNKFFENILDTRIKLQKAMNSANVLPVTKASWKLELKEDSENKKL
FT                   LEENLSMVENLLNRVINFRIDIQAKEGISTDSKLETSKKRDITDLNESTDALDKDLKKY
FT                   RTAVLQKWSAKVSSASGSSAMKSSKFKAVNQSADAQVENQLADTPRLIKRTCLNRRNVL
FT                   PINFTEDMEQGRLTKFESTSNTGENNDEDENADIPKNYDPRRKDNNAIDISTNPYIFDD
FT                   GDFYRVLLNDLIDKKTSSANLGVTSSATNSAIIVSKSNYKLKKNVDTKASKGRKLNYSI
FT                   QEPIANYEAPVSSGYKWSDEQIDEFFAGLLGQKINFNEDSEQDSESDVGDEEEAIKNDD
FT                   IQIFA"
FT   CDS_pept        complement(140740..142023)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446668"
FT                   /locus_tag="CAGL0H01441g"
FT                   /product="Similar to uniprot|P32264 Saccharomyces
FT                   cerevisiae YDR300c PRO1 glutamate 5-kinase "
FT                   /function="RNA binding"
FT                   /function="glutamate 5-kinase activity"
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59794.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004349"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="HOGENOM:HBG273629"
FT                   /db_xref="HOGENOM:HBG507643"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="UniParc:UPI00003B664A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSD3"
FT                   /transl_table=1
FT                   /translation="MTETRVGGKPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKL
FT                   RRLGHNVVIVSSGSIGVGLHILGMEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQS
FT                   IAQILLTRNDILDWSQYRNAQNTVEELLKMGVVPIINENDTLSVQEIKFGDNDTLSAIT
FT                   AGLIHADYLFLLTDVDCLYTADPRSDPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGG
FT                   MQTKLVAAELATNAGVHTIIMKSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLE
FT                   EYEKLDRMGVPFHTKFLANSISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAG
FT                   LLPVGVIEIEGSFHEMECVDLKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQ
FT                   QSDEIENELGYCNSEYIAHRENMAFPPH"
FT   CDS_pept        142420..146505
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446669"
FT                   /gene_name="CFT1"
FT                   /locus_tag="CAGL0H01463g"
FT                   /product="Protein CFT1"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59795.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG057944"
FT                   /db_xref="HOGENOM:HBG203242"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI00003B664B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSD2"
FT                   /transl_table=1
FT                   /translation="MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRS
FT                   GRLYLMEEHKLSGRINDVALIPKHSNGSNGNGINLSYLLLSTGVAKLSLLMYNNMTSSI
FT                   ETISLHFYEDKFESATMLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGINEDEDED
FT                   YINNDKSKINDNSKKSLFKRKKGKTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFT
FT                   KSTIGVLYQPQLAWCGNSQLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWH
FT                   TIAPTLSGSLILGVNEIAFLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGS
FT                   KFALIPSNENERSVENILLFDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNP
FT                   SSVSIIWADGRLDTYTIFIGFQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYN
FT                   NEDDDDDDDDFNLYSDEENDQVNNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVG
FT                   KVSSIEDNVKGLPNPNKQEISIVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWN
FT                   LHIKGKDKFLITTDSTQSQSNIYEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVT
FT                   TNHLYLYDLTFRRFSTIKFDYEVVHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVP
FT                   LPEILTEMVITSGLILKSNMCNEFLSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIF
FT                   QLNGIDQLQDSLYISTYQLPDEIIPDPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYK
FT                   KSRSRHSRFYRNVGRNDHPITGAPDNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPY
FT                   IIMKEDDSLPRIFPFGNIPIVSMSRWGEGSVICIDDIKNARIYSLNQDNIYYGNKLPIR
FT                   KIKIGSMLQNYKTLNSIVYHERTQLYLVSYTKEISYEAKAEDGSLLIGYKPELPNAKAF
FT                   KSGVLLINPKSWEVIDELDLPDNSLVNDMKSSFIQIDTRTKRKREYIIVGIGYATMEDV
FT                   PPTGEFHIYDITEVVPEPGKPNTNFKLKEIFKEDIRGIVSVVNGISGRFLISQSQKIMV
FT                   RDVQQDNSVIPVAFLDVPVFVTSLKTFGNLIVIGDAMQGIQFVGFDAEPYRMITLGSSI
FT                   TKFEVISVEFLVNNGDIYFLVTDRDSIMHVLKYAPDQPNTLSGQRLVHCSSFNLHSLNN
FT                   CTMLLPKNDEFPRDQRYSRSFQTITAQVDGSISKIVPVKEETYRRLYFIQQQIIDKEPQ
FT                   LAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRFKDMSMNRRSHIVQKLGKNSNLEVWR
FT                   DLIDLEFSLRSLKPTDQN"
FT   CDS_pept        146756..147409
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351136"
FT                   /gene_name="GPI11"
FT                   /locus_tag="CAGL0H01485g"
FT                   /product="Glycosylphosphatidylinositol anchor biosynthesis
FT                   protein 11"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59796.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057945"
FT                   /db_xref="HOGENOM:HBG203243"
FT                   /db_xref="InterPro:IPR009580"
FT                   /db_xref="UniParc:UPI00003B664C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSD1"
FT                   /transl_table=1
FT                   /translation="MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRKT
FT                   WLTIPWHLIALVYIYVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYS
FT                   LAAISILACIVLSIPVVVIIILFGAPLLELLWETWLLALHCSFLAYPAVYSVLNCDFKV
FT                   GLWKRYFILIVVGCWISCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYGAYL"
FT   CDS_pept        complement(147689..150073)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446670"
FT                   /locus_tag="CAGL0H01507g"
FT                   /product="Similar to uniprot|Q06639 Saccharomyces
FT                   cerevisiae YDR303c RSC3"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59797.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057947"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B664D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSD0"
FT                   /transl_table=1
FT                   /translation="MDIRGRKMKKPPACAQCRRRKVGCDRVRPVCGNCARAGKGDCFYP
FT                   DVPGQYIQNNGGSPLPQNGSGRPEEISTVDQIREYNTRLQLSNMDGNELPQAPKQYIPR
FT                   TSTFPHNKEVPSGSSMRSNVNWVQGPAIFVDEGVNYGQDEAVLKELEFIKKRLMELKEI
FT                   SGRDITGINLDWTVTKPNDTIETKKNKKRKENFLTDAEFDLESGYESEFNKYRDMDPSF
FT                   LDDSEIFDILENCETDTHRDEIMGYLDSKCSNDLFNFNTVCCLDPFLYKQFLKRIDRTV
FT                   CGKYQDNLKNWKEKTITGSQYKKPTYVVKFPNKANTKEFINIFNSIVQESSSLIPILNL
FT                   AQLPESIEKLFSMGSTFDVTKHVLSQLFQLGEINICLLLCYQAIVSSVLINLTEEMNII
FT                   FQEIKAMFSILESNIFTINSEIERRSDVENHTEYLRYTALWKFYFSISPSFADSVDYNE
FT                   DVNLGISLGTSHEHSDTSNILMWNFIEKNYQYRTLFRGQIPKLTLSHPLNTAFVRDPLY
FT                   DIDKKLLSHHGEIISNLLSRDEKLPISRVEEIKNDLNMEISNITKHLTTVAANISNVND
FT                   TILTKNLSIYLTYFLMLQYEKENDVENYKKTYLDFIMLTQETIFYIFSNFANMKFTGHE
FT                   FVYINKFFKVLESIAIMYLGGYERSERQYSKLSDENAKQENRFHSGLCFLILQKLHMLV
FT                   RDYSKNCKVVNPLATKLLSKLETIMSHRFEPVEIERKNIFESISTDLLRLFNTKLYRLS
FT                   ESLVKKEFYEGGVKYDPNHWDTMGITENNIDAVIDTYYSCS"
FT   CDS_pept        complement(150689..151306)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446671"
FT                   /locus_tag="CAGL0H01529g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG59798.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00003B664E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC9"
FT                   /transl_table=1
FT                   /translation="MKLNIIWTLCLLFGIVSAAVKPEVTHKVYFDIEHDGVSKGRIVIG
FT                   LYGKIVPKTVENFYELSISDDSNMGYLGSIFHRVIPQFMIQGGDFTHGTGIGGKSIYGS
FT                   TFPDENFDLKHDRPGLLSMANRGKDTNGSQFFITTVATPWLDGRHVVFGEVLEGMDVVT
FT                   YIENVKTNAQNRPLKDVVIADSGELETAPLGNKPRDVPDDEL"
FT   CDS_pept        151640..152755
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046827"
FT                   /locus_tag="CAGL0H01551g"
FT                   /product="Similar to uniprot|Q04430 Saccharomyces
FT                   cerevisiae YDR531w"
FT                   /function="ATP binding"
FT                   /function="pantothenate kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /protein_id="CAG59799.1"
FT                   /db_xref="GO:0004594"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG077363"
FT                   /db_xref="HOGENOM:HBG736409"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR011602"
FT                   /db_xref="UniParc:UPI00003B664F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC8"
FT                   /transl_table=1
FT                   /translation="MTLMRFKDCDYSRRLFTIAIDIGGSLIKVVYSPLDSQVIHFATVE
FT                   TAKVSKLLELLDDVIQEHNSGDFSSTQIVATGGGAFKYNDLIIETFPGIHSYTKFEEMQ
FT                   GLAKGLDFFIHQVPDEVFTYSDHEGEKIVETIASSPTAKPTIYPYMLVNIGSGVSMLKV
FT                   DAPNVFTRVGGSSLGGGTLWGLLSLITGAQSYDEMLNWAQEGDNTTVDMLVGDIYGTDY
FT                   NKIGLKSTHIASSFGKVFQDRDHPMINGNSKHRIRQEEIDHLEDHAKDNHTCNECINHR
FT                   NKKFKNEDICKSLLYAVSNNIGQISYLQAKIHNVQNIYFGGSYIRGHLTTMNTLSYAIN
FT                   FWSQGSKQAFFLKHEGFLGAMGAFLDACEGK"
FT   CDS_pept        complement(153035..154114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446672"
FT                   /locus_tag="CAGL0H01573g"
FT                   /product="Similar to uniprot|Q04431 Saccharomyces
FT                   cerevisiae YDR532c"
FT                   /protein_id="CAG59800.1"
FT                   /db_xref="HOGENOM:HBG124905"
FT                   /db_xref="UniParc:UPI00003B6650"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC7"
FT                   /transl_table=1
FT                   /translation="MEAQLHELQEEITRSSDLVLTEQDKRLQGTLREIDQSIRKLIETS
FT                   DYLKLSGDADSLIDIKQLEVKSRELDSLMDLLRKLYWREESLDLFLKYTINSDAEQVPV
FT                   FSDTDPKYQSLQDEVSHLRDDVMTVKNQEIDQITGEILQVAHEITEKQDQVNMLYLETT
FT                   NELDKCWELLDEWQRLQDDQRITKNEDNSNRKDTELNAMEECYEEWKTLEELAVLNDNL
FT                   QKQIDELEKVDNKAINSTQLAEESIVNTVQLNDLIDMWKRRIIASIHEDISEIVLYPYS
FT                   RKLQLRVANRYTIIIQLDKHQTHDGKSTIHDIDLFTEQDSRIIPMRELRKQVLQECKGH
FT                   SNILQALKNIINRVINNDN"
FT   CDS_pept        complement(155153..156436)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503363"
FT                   /locus_tag="CAGL0H01595g"
FT                   /product="Similar to uniprot|Q04418 Saccharomyces
FT                   cerevisiae YDR527w"
FT                   /protein_id="CAG59801.1"
FT                   /db_xref="HOGENOM:HBG059721"
FT                   /db_xref="HOGENOM:HBG397270"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="UniParc:UPI00003B6651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC6"
FT                   /transl_table=1
FT                   /translation="MDLLGDIVEKDVDEVSEVGELPDGGFPKLYKPEKVSSWKARLKRK
FT                   QQASQTGKVNELSSSRESMRAVEESAAQRIHRENLETMRKMSPEEIARERQELLESLDP
FT                   KLIQKLLKNVQKSDKIFAEIEGASGTWVGGKNEAVANVDDLPPLDEDMVNRALDLNATE
FT                   LPKETSASLPKDDESDKQESEDQDIAPPLDDDDVAPLEFQVAQTIDHMANEDLLKDVHF
FT                   VAPKVDENDDDDPLDINDPEFNEKLHKKFFPNLPKEVDKLKWMEKLPEDKGISTIEDVT
FT                   QCRFDFKGNLVPPNRPIDNTNSGLHHHSEDQHLAGYTIIELAHLARSQFASQRAIAIRT
FT                   LGRILYKLGKQEYNSQLTVEVNDESEAEDATKHIYMMFWDLVKDTKVIELLELGSDEKY
FT                   TKSLSIRNYAIEALWLWKQGGGNKYKNK"
FT   CDS_pept        156752..156919
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446673"
FT                   /locus_tag="CAGL0H01611g"
FT                   /product="Similar to uniprot|Q3E6R4 Saccharomyces
FT                   cerevisiae YDR524C-B"
FT                   /protein_id="CAR57986.1"
FT                   /db_xref="UniParc:UPI00017BD8CC"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN06"
FT                   /transl_table=1
FT                   /translation="MNNTRLMSMSFEQNPRLRPTATGGRNTATNTRNQSLACICTVLLC
FT                   YIGSQSFAVL"
FT   CDS_pept        157279..158328
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197944"
FT                   /locus_tag="CAGL0H01617g"
FT                   /product="Similar to uniprot|Q04412 Saccharomyces
FT                   cerevisiae YDR524c AGE1"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="CAG59802.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG124906"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI00003B6652"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC5"
FT                   /transl_table=1
FT                   /translation="MERLNRPSELWERIRALDESNKRCCDCGSRHNVDWVSINLLCVVC
FT                   IQCSGVHRSLGSHISKVRSLNMDDLHSNRELKYLLVNHLINRNVNSVYEARIPAGIKIR
FT                   KDAQPADRARYIVDKYMHKKYVERTMQATLTNSQMANDKDIRDTEIEDLVRHIRAKSIL
FT                   GLQRSLAMSKHTLKDLCLHYGIRSPTLFQLSLEQFEATSSGTLVYYISEYLLLNGLLID
FT                   DQRAVGKTKLDVSPGALEYWTSRQNMYDTYANAMMQNNGETNGGSNGLARDRTKNGRMS
FT                   NGLPRRANTQNDGKRRLYLDTQSSAFDNNRSSGPFSATSNKKRWSLASPTSILSIHKSL
FT                   SRRDSHKKS"
FT   CDS_pept        158967..160532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446674"
FT                   /locus_tag="CAGL0H01639g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59803.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6653"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC4"
FT                   /transl_table=1
FT                   /translation="MSKRFVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLENSEEEV
FT                   ELLAQEIFFLAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHK
FT                   TRFITREILKGLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLSSFRRDTFV
FT                   GTPYWMAPEIVAHDSEGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPP
FT                   KLHGDFSDDAKHFVALCLIKESAIRPTAADLLTTRFTTNTRVENLKDDVDLIKHVKLKI
FT                   NRHSKSPKFPLEVKIYEDGTDCASANYWDFDTSGLSVVPATASVDNSFASNEASRIDET
FT                   TEYHTGKGELVSAMTGSPISNNMISPYQDSYKSTVTPITPMPLGESFRKYSAPVKQQPA
FT                   YDIGSGMEIDQQTCLDGEPHSSTDKVAHEDYKKSVDHKVNVKNTTISIVGFDYYRNVIH
FT                   HSFKRMEDRAHDKRTKEVVLEILKHFAAVETTIPGFSEVFIEEISLRLEALRDYYEKHK
FT                   SQLA"
FT   CDS_pept        160886..162262
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351137"
FT                   /locus_tag="CAGL0H01661g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59804.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG204081"
FT                   /db_xref="HOGENOM:HBG429547"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="UniParc:UPI00003B6654"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC3"
FT                   /transl_table=1
FT                   /translation="MHCKSPNMKLALHWYFVLSFILSAIVAYENFVIMEEKKLLPFVKL
FT                   VRDNYTVELIPDDITLTDEQTADQCKESSITVNSPEELFYLQRRCDILEGNLIIGTDYQ
FT                   ERIIDLGFIKEIKGDLVLDGNANIFRLVGENLNTIGGTFTLRGTMSLVAIIFPVLRRIN
FT                   IIDWQVVPVLDHLELGSNLEGLQQLIISDSSISDLNVFKGVQELDIFNINNNRFLEIIN
FT                   SDLKRVSKQLRIHANADELVINMSQLESVDNITIRDAAGINLPELTYVNSSMEIIENFC
FT                   SDLILPKLKRVDGTLGIIGNPSLQNVSYQNLRVIQGGLMIANNSELTNLDFFPNLKQIG
FT                   GAIHFDGNFITANMPKLKLVKGSAFIRSTADYFDCKRWFTPVNGRAIVRGGKLKCIANE
FT                   RESTIRIGDDGSLIDNDDSPQYDDSPENKDRQENSAMLRSKIRGLLPLTTLLSMYLILF
FT                   "
FT   CDS_pept        162753..164852
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503364"
FT                   /locus_tag="CAGL0H01683g"
FT                   /product="Similar to uniprot|Q04411 Saccharomyces
FT                   cerevisiae YDR520c"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59805.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059717"
FT                   /db_xref="HOGENOM:HBG203339"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B6655"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC2"
FT                   /transl_table=1
FT                   /translation="MEVENANNGMNAGVTESVTHTQEDSKAPKENGSKNDNEDKKPRRK
FT                   KRKTSSCDVCRRFKTRCDFDVMYGKCYRCKVLNLECSLTMERQTEINKTQKLGVNALLN
FT                   NDDSKDLKPMNIDEITMKVRDMDYNYGVLNHKLDLILNMLQKSHNEGRLPSGNDKQGKL
FT                   VPFTSVYDDIRPSNDGYRIHEPPLKLINDLDARLFPLDALTQKAKMEREQRPSAVARVK
FT                   FLDFYKKHQELCHQLSKEFLMRSHFWIIPGGIKEIDETYANKHLFITSVFTIIAMSFAD
FT                   NDKYAQQQEELYPLVERLLTNTLTMFEKLTDYDIEAILYCSMFNISRKAKRYRQLKYNS
FT                   LVLSNFALYSLLNIVDFHRIKERVNAAEFDMKDLYHLRILNSLTACHLEYSISSGQIWE
FT                   QNSAIKEFNNLVVKFPQANFADDIKVSEINLNVVVNAIFMNFKTYFHRYLYKYSDNSTV
FT                   QEKQLLLFDELELWLKDWEELLAKDGAGVLLFTYDFYHIMICRSFITDNKDEVSKYPDF
FT                   LDNVLYTMKEHAFSLLRGFLRLPPSLIKGAPIFTTYELVYACLSLCDYIHLFDQPERQQ
FT                   VLSTCTRVYWHLSTIGEKMNEATDNVGTIIKSIIDTSKQSVSKTQDMATHNNHSSMRDS
FT                   MASSGSKLQTSPRQHNNTLSDTKSSGMQLPDVDQYNSFEEFFQGFFNNLKPSTQQIFES
FT                   SKQTK"
FT   CDS_pept        complement(165115..165525)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503365"
FT                   /gene_name="FPR2"
FT                   /locus_tag="CAGL0H01705g"
FT                   /product="FK506-binding protein 2 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAG59806.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG430304"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI00003B6656"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSC1"
FT                   /transl_table=1
FT                   /translation="MLSQIWILFTFMVCVIASKSKSDGLKFEITKKIPISKCKLKALPG
FT                   DMVSVHYTGSLAENGKVFDSSLRRNEPIQFKLGAGQVIAGWEQGITGMCLGEKRTLHIP
FT                   PELAYGSRGAGGVIPPNAVLDFDVELVDIARN"
FT   mat_peptide     complement(165118..165474)
FT                   /gene_name="FPR2"
FT                   /locus_tag="CAGL0H01705g"
FT                   /product="FK506-binding protein 2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSC1 "
FT   sig_peptide     complement(165475..165525)
FT                   /gene_name="FPR2"
FT                   /locus_tag="CAGL0H01705g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSC1 "
FT   CDS_pept        complement(165968..167569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046828"
FT                   /locus_tag="CAGL0H01727g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG59807.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG347446"
FT                   /db_xref="HOGENOM:HBG627841"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI00003B6657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSC0"
FT                   /transl_table=1
FT                   /translation="MVSVKSLALAIGVASAIQLPDAIAPDSSNIIKANISQFATHVKEN
FT                   PIVMVEFFTPWCTHSKMLQPRLSEAATIVKGVKIPILQVDCTQYGVLCDQQMIDFYPTL
FT                   KVYKNHRLVGAENYKGSQAGNEIANYLLNLKNNPVTNITSAQEVEKMKSETDMPIVHNR
FT                   GNLEIDEILRSVALDMSEKFAFIRDTVASENGTLEMYFPGTNRTAVYDGPQPPTEESIS
FT                   IWMHMENLPFFADIEAADFKNYMATKLPIAYFYYSTPQELNDFTGLFNELGEKYRGKLN
FT                   FVGMNPHKFQEHLKLLNLKQRFPLFVIHNVNNNLKYTLDQFTDESDKVMKKLESEDIKK
FT                   LVEDFVEGKAQPIIKSEPIPKTQDSVLYKLVAKTHNDFVYNNDKDVFVKYYAPWCQHSK
FT                   AFRPVLEEIAELFGSNPETKEKIVFAEVDSTANDIIDFPVAGYPTLVLYRAGSKPGSQP
FT                   IIFEGKRSLENVLDFIKSHSTSNLDGQALLEKQKQDEAKAIEDAQAAEAAEAVNAQAQA
FT                   ANADQKAFNNEIKDEL"
FT   CDS_pept        complement(168305..168634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446675"
FT                   /locus_tag="CAGL0H01749g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59808.1"
FT                   /db_xref="HOGENOM:HBG124907"
FT                   /db_xref="UniParc:UPI00003B6658"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB9"
FT                   /transl_table=1
FT                   /translation="MFASGYDRMQHAVEPITATVEPVPMVDAVQKTDKPVPQEEARQEI
FT                   NSDAIASRSQDSLVSNTISTKNIQVRDTSLSALVKNAQQYKGALDKRNEEIKKRKREQK
FT                   QRYGW"
FT   CDS_pept        168840..170054
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446676"
FT                   /locus_tag="CAGL0H01771g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAG59809.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG059564"
FT                   /db_xref="HOGENOM:HBG734807"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI00003B6659"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB8"
FT                   /transl_table=1
FT                   /translation="MKLKVSLRIVSVQLNSQIGQIDETLRRTTVLIDRLKQEVEGQKPP
FT                   DLVVFPEFALTGYNFKNRSHILPYVCKAGEGPSFELAKRVSKLFGCYTVIGYPEKCEQK
FT                   LYNSAIVTGPDGSVHFNYRKAFLYETDEQWGCEENPKGFEQFKMKFRARPIDQDSAELS
FT                   PVDIDLNTSIGICMDLSPYRFEAPFQDMEFSSFNLEKGTELIICPMAWLHSRSITEHTD
FT                   SEKITPKDIECLLSEQGLSIFGSQGQYQFDFDNRATTKPVSQDITDINRDNPVYSNLDE
FT                   PDMSNINYWLLRFLPFLSLDVRRNWFQSFADQLLPLKNSYMGMTPKHPWGFAGKNAALV
FT                   IANRCGVEDCKTIFAGSSGIFKFNGSEDKDNNTDSTNQSVKLFGNLGKGYEGLLMRDID
FT                   LMIDR"
FT   CDS_pept        complement(170210..173017)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446677"
FT                   /locus_tag="CAGL0H01793g"
FT                   /product="Similar to uniprot|P40355 Saccharomyces
FT                   cerevisiae YJR061w"
FT                   /protein_id="CAG59810.1"
FT                   /db_xref="HOGENOM:HBG059565"
FT                   /db_xref="HOGENOM:HBG202357"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniParc:UPI00003B665A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB7"
FT                   /transl_table=1
FT                   /translation="MLNNAGYSKDKMRDTEKYPINTVYDRHEHSIIHSLPAVKRIKLWL
FT                   RFILKRLIVLLLLIQAFLTIRVWLDPEGEHIQYIHHFIKHHEPNKSINPSKLYEKMMFN
FT                   TEMIWPDEYSYKNNLLTVQIGQNKGQILQSIDDLKFYDNDPRLIWSVLLDYLSKEGPDQ
FT                   IPFSWYDWSDYQQYNRILALSDEVKSRVNCAVMYSPGFDKQLLLDIEAEINEPLFQVNR
FT                   HRYSEQYWYKVLARKAKFINLVDYCSDGITSRFDLPVNIKKPQAHATPEQYEFQNKAFM
FT                   MRSKLHMPFSLTILNKDRSFFQVPISTDINPQNIIESELLAKFIEKNKVNEDDQDLVFN
FT                   HTILFDQFLESKSNEKYKLKNPELTDRIHDELLVHVKENDFIFDPLERIAYLEKEEHLT
FT                   THQRKYLESLKYSITVDPLLQKKHFNEARDLLLYSKSGSHRDARFFYNSFNPDIDGIEY
FT                   QMKMNSLIRNFLKFTKANGLITWLSHGTLFSHLYNGLTFPWDDDFDLQMPIRHLNMLAE
FT                   HFNQSLILEDPREGNGRFLLDVSSTITIRTNGNGNNNIDARFIDVDSGIYIDITGLSVS
FT                   SQYTPKYAENYIVDRPNDKSKSSELEYHNYEPFKYGFNQDNFDDLSTRVRNNEILSMEE
FT                   KDTLLKLAASESQRKRKNKRFVDEELSSEQRFTNHLEKKLYNCRNGHFISFDSLSPLYN
FT                   SIYHGQSALIPRKPIQHLEHEYKLTKTYGFLTFEGNIYLPGMKLWYSFKDIRNIIRLAV
FT                   DQSVPIPTNLHQLRGIDHYFLLKAFLIQNMHDAIAITHNTFEATSFRLKELEIMFDRNL
FT                   SFERIVDAFKVFRREKGRNIMNPFKDPTLFSYEKRLFNKLVKDKDVLAIAKIKENVCSK
FT                   LILRTWHSIQEILEKRYNGFEVIVNDNEPHNLNYAGLNYENDENLSNYPVFESDSDLIE
FT                   NIIVQ"
FT   CDS_pept        complement(174644..175972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503366"
FT                   /locus_tag="CAGL0H01815g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59811.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124908"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B665B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB6"
FT                   /transl_table=1
FT                   /translation="MERSNRSRKSRRQEVSEDILERELKQYVNSSERMHESDAVERSPK
FT                   RRKGSHREVDIETTVHTTVHYDEKEEVNGSDLNDDEQRRAIEGAASEDETHAVEGEHED
FT                   EDERENHVNDHDDNRDPNVDDELHRADADHQEHDEEDRDEDQHQHQHQEQEQEQEQGHE
FT                   PEHEQEQEAEHEQEPEQEQGQEPEEEHGHEHDHEENMESIREIANDSGDAAAAVSTIRI
FT                   HYQDLSGNSRGDTTINVGPENPELYASLSSRSDVKTENKKKRGKQTKGDESIQDWRKIR
FT                   KESHKEVERRRRETINLAIDNLRKLLPKPEYSKAGILNSAAALIQKLKESESSQMNKWA
FT                   IQRIVTEQTKTAHQKSNEKLAAALDDAYQELTRLKSILKENNIKYEDKFVIPEDTLREA
FT                   KELESELNRAQEEIDQIDPRASAEPEEEEEERDEEAGEDESKE"
FT   CDS_pept        complement(176352..178736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503367"
FT                   /locus_tag="CAGL0H01837g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59812.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124890"
FT                   /db_xref="HOGENOM:HBG202364"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B665C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB5"
FT                   /transl_table=1
FT                   /translation="MTNINDKEEVHHSPSVMTLKKFGRKLMNHPQVSSGKPVLDAQGEP
FT                   IRPLSKRSTSPTGKTLVRNSSRSPSRARSSSLSKKVPARATEANFTRGPVSSAKSSVAL
FT                   NELIKHSHNPYVITEEHSQRAPNQLQRKPSAGGGSGIAGRREAHTHHGNKPASMAGHAN
FT                   QGHSLSRNPSKSGLHADANMVYNPYGMNPNLRRPDTAYIDTLKENAGDLSFYMHDGNEK
FT                   IRMLPLPIEDPNKFLPEEMQQFSINLADNFVFDAANKPIGSGGSSEVRKVKSAYKAKDV
FT                   YALKKLNMIYHETPEKFYKRCSKEFIIAKSLSKNIHIIKTFYLLKVPTTTYTTRGWGFI
FT                   MEYGVKDLFELMARSGWRNVPLEEKYCLFKQVAEGIKFCHDNGIAHRDLKPENVLLSKD
FT                   GVCKLTDFGISDWYRKDPNDPNSPLKTTEGMIGSPPYTPPEVMYWDAKKHYAESLKKPY
FT                   DPLKMDPYALGIMLITMVNNIIPFLDSCNTDLRFREYETSYENFIAHGNPAFRQKGVYK
FT                   PGPGSEYSLAKQFRNTEASRVAWRLADPKPETRYTMEDLFNDPWFQNIKTCVYPDDAYT
FT                   VTEPELRKATTQEGLVYANQLYAKDTIETAAGTVGATFEDASDTIPVHTGNHGASTGTE
FT                   KTHEEGCNASSPKPRSMVEIAEHPVLHKEKPTEHHGKVTFSMDDDNDNDNDKDNEEEPK
FT                   ENKLDAMIESPAPTKAQQSPKAQDATRTTSTLRTPEIHVEPQVQRGSPVSSMASRSTTA
FT                   SPPHKEMSELSVSKKRVVHNHFDIPHSSVNTHPSMVSLFSK"
FT   CDS_pept        179000..179443
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446678"
FT                   /locus_tag="CAGL0H01859g"
FT                   /product="Similar to uniprot|Q00381 Saccharomyces
FT                   cerevisiae YJR058c APS2"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAG59813.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00003B665D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB4"
FT                   /transl_table=1
FT                   /translation="MAIQFILCFNKQGVVRLLRWYEKVPAGHERTQDVIAQIYRLISSR
FT                   DHRHQSNFVEFSERTKLVYKRYAGLYFVFGVDLKDEESIYLSHIHLFVEVLDAFFGNVC
FT                   ELDIVFNFYKAYMVMDEMFLGGEVQEVSKDALFERLSALDRLE"
FT   CDS_pept        complement(179511..180167)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229079" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503368"
FT                   /locus_tag="CAGL0H01881g"
FT                   /product="Similar to uniprot|P00572 Saccharomyces
FT                   cerevisiae YJR057w CDC8"
FT                   /function="ATP binding"
FT                   /function="thymidylate kinase activity"
FT                   /biological_process="dTDP biosynthetic process "
FT                   /biological_process="dTTP biosynthetic process "
FT                   /protein_id="CAG59814.1"
FT                   /db_xref="GO:0004798"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006233"
FT                   /db_xref="GO:0006235"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG626009"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="UniParc:UPI00003B665E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB3"
FT                   /transl_table=1
FT                   /translation="MREMRGKLILIEGLDRTGKTTQVDALAERLRGCGLKVVAAKFPNR
FT                   ESEIGQLINRYLTNRDFQLPDQAVHLLFSANRWEYIEELKQQLNDGYCVVLDRYVFSGV
FT                   AYSAAKGTPGMDLQWCLQPDKGLLKPDLTLFLTNEDRESIANRAGFGEERYEDSDFQLK
FT                   VKQKFHEAFHAYCQEGELRTVNVTGKGIEQVSAEIWDVIEPLLHETRATNEFKYF"
FT   tRNA            join(180340..180379,180391..180427)
FT                   /gene_name="tRNA-Tyr (GTA)"
FT   CDS_pept        180615..181229
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503369"
FT                   /locus_tag="CAGL0H01947g"
FT                   /product="Similar to uniprot|P47115 Saccharomyces
FT                   cerevisiae YJR056c"
FT                   /protein_id="CAG59815.1"
FT                   /db_xref="HOGENOM:HBG124909"
FT                   /db_xref="HOGENOM:HBG202243"
FT                   /db_xref="UniParc:UPI00003B665F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSB2"
FT                   /transl_table=1
FT                   /translation="MERLNSLERSLPPEQPPTEKAIATLNSELSQEFKLAANSVTKLYR
FT                   LANERASLVRHQGYLDCVEDVLSLIDGSTGSNGSNGSKEPTVEDIREWCLKRRQEMLSS
FT                   KDGRVDSHRSDGRGGQGRVAPKVDFHLQKSFLGKTEVPQGGKIEVPTFKLGKPPLSVEH
FT                   HARPGRRRQLNTPAATNTTFTSTPNNENSEMHESVPKKPKL"
FT   tRNA            181552..181623
FT                   /gene_name="tRNA Asp (GTC)"
FT   tRNA            join(181861..181898,181918..181963)
FT                   /gene_name="tRNA-Ser (GCT)"
FT   CDS_pept        182137..182961
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446679"
FT                   /gene_name="YNG2"
FT                   /locus_tag="CAGL0H02035g"
FT                   /product="Chromatin modification-related protein YNG2 "
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59816.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG058785"
FT                   /db_xref="HOGENOM:HBG396187"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00003B6660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSB1"
FT                   /transl_table=1
FT                   /translation="MDPSLLLDQMLQDVSNLPAEFRYMLEEVGLEDEQCLELRKRYQQK
FT                   EGILHKYIKQNGSLAANPKEDELLAEVEQSMAQVRELQEEKCQRANTILFLVSRHLNKL
FT                   QQNIIMLEEDGLLAPAEDEMESGPDFSRESSVVGSTVSERKRKAASEDHPRRKKQSRSM
FT                   SNTHREKSYNKGDDTADVKSPASTEREGTLDLQNYQEELFSSMNDNEKEDQNLYCFCQR
FT                   VSFGEMVACDGPNCKYEWFHYECVNLTEPPKGTWYCPDCKQEMSKKLKKKKQ"
FT   CDS_pept        183306..183974
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446680"
FT                   /gene_name="GAR1"
FT                   /locus_tag="CAGL0H02057g"
FT                   /product="H/ACA ribonucleoprotein complex subunit 1 "
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="CAG59817.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="HOGENOM:HBG124910"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="UniParc:UPI00003B6661"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FSB0"
FT                   /transl_table=1
FT                   /translation="MSFRGGFRGGRGGSRGGFGGRGGARGGRPIQQGPPDTVLEMGEFM
FT                   HPCEGDVVCRSINTKVPYFNAPIYLENKTQVGKVDEILGPLNEVYFTIKCGEGVQATSF
FT                   KEGDKFYIAPDKLLPIERFIPKPKVAGPPKPKNKKKRSGAPAGRGGARGGFGGRGGSRG
FT                   GFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGRS
FT                   "
FT   CDS_pept        complement(184473..185357)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446681"
FT                   /locus_tag="CAGL0H02079g"
FT                   /product="Similar to uniprot|P38805 Saccharomyces
FT                   cerevisiae YHR088w RPF1"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAG59818.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG055396"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI00003B6662"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA9"
FT                   /transl_table=1
FT                   /translation="MAPEEIKIKNKLKRQELFAQIKDQKNKERHKMRHARSKEERENPE
FT                   LKEKRLKENVTKTIDNMRVYDETIGKEIEGDEDDLMKFFNSSSNEPPKILLTTNVNAKK
FT                   SAYEFANILIEILPNVTFIKRKFGITLKEMTDICIKRNFTDIVIINENKKKVTGLTFMH
FT                   LPEGPSFYFKISSFVEVKKIVGHGKPTSHIPELILNNFQTRLGKTVGRLFQSIFPKNPD
FT                   FEGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTMKLRRVQRGIKEETEWEH
FT                   RPEMDKEKKKFYL"
FT   CDS_pept        complement(186150..186539)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446682"
FT                   /locus_tag="CAGL0H02101g"
FT                   /product="Similar to uniprot|P38804 Saccharomyces
FT                   cerevisiae YHR087w"
FT                   /protein_id="CAG59819.1"
FT                   /db_xref="HOGENOM:HBG191672"
FT                   /db_xref="HOGENOM:HBG396535"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniParc:UPI00003B6663"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA8"
FT                   /transl_table=1
FT                   /translation="MSLNELFHGNQHDDTKKKPRRNSSTEVLQYFYKGKETDLVIYVTS
FT                   QAAADDYLASPSPSKLANVVEVFKVFTNLDGKGATGTFGEASKAQLENEFGKGKKVEEV
FT                   IGLILKEGVPNGKTNRVKTEGNFQK"
FT   CDS_pept        complement(188454..190121)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046829"
FT                   /locus_tag="CAGL0H02123g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG59820.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG124911"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6664"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA7"
FT                   /transl_table=1
FT                   /translation="MSYNRYMEDAYRYGSAAGTMGASAAGAQMSPVSVSPMSMNAGMNT
FT                   GMNTGMNTGMNTGMNTGMNTGMNGGMNGGMSTGASTPGSQLYMGDLDPSWDEAVVKGIW
FT                   AALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAHASNALMKNGMEIPGFVHKKLKL
FT                   NWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKV
FT                   MYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRAIKIGIAGGNNNNNSNSNYNN
FT                   QRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHFTDPNNTTVFVGGLSPLVTE
FT                   DELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQGFPIANSRVRLSWGRS
FT                   AKKTALIQKALLRSRETNYQQQLPQQGQPLQSQLQLQQQQQQQQQQLQQQQPLLYGYSP
FT                   VNLNNGSGLSTSQNMLSDIYQPEEQNLNGYDLLPGRENLNYVNVLPSRDLYAYNQIGNQ
FT                   PIVNNGMPNLSVTNDLSVNNTTAALERLNSGTASFSFV"
FT   CDS_pept        complement(190804..192690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446683"
FT                   /locus_tag="CAGL0H02145g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59821.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124912"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniParc:UPI00003B6665"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA6"
FT                   /transl_table=1
FT                   /translation="MMASDDRAVIGNALKSIDELTYFLATAPVNWQPGQVIRRYFLNEE
FT                   LGYISCVFWDNIFYITGTDIIKICIYKMLLFGRVVLQKKKFEEGIFSDLRCLKIGEHAS
FT                   LEQPKSPFLDFLYKNMCVKTQKKQKVFYWFSVPHDKLISDALERDLKRESNGMNQLITT
FT                   RAVREPALTFKYNRSIAGSVFQQARNYFVLRSRIIFSDVFSTPIDVNRAPNSNQRVTGN
FT                   PNDLGVNLSSSQDTVETSSQKYAASNQSYSSVHTPIPSSDTTPHTQHADLRNMKPSNDR
FT                   AVSKTSQVPPKDNETVNISKQQFMPALIDPTTGFFEGVQYYISNMGSKEYMCKQRNTPA
FT                   VNLNADIKQSSPDNLIEKEEDPHASIQVEGPLRCSCGYSARNTGRSTASSSSSDNSALQ
FT                   STDDGSDPGILQSRPPPPPSPPPPQFKPEQDPDRGSPTNSASRMGTQVEQKDSFHEYTT
FT                   SSNEETIRSGVSVAHTQRSGSQFDDGLASAETYDKDDYNIAGRTSGSDHDDYDNHSIES
FT                   ALDIVLPAGTEGNTSSMISTDDEFYSTFMEPFDASKYFLSPMDRMRSGFLISPQSMQPD
FT                   ITFAQDEEQKSQHQLQQHQHPNTHPPQLQHQLQHQRRPRTLRQGKYLKKSIR"
FT   CDS_pept        complement(196897..197907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503370"
FT                   /locus_tag="CAGL0H02167g"
FT                   /product="Similar to uniprot|P14693 Saccharomyces
FT                   cerevisiae YHR083w"
FT                   /protein_id="CAG59822.1"
FT                   /db_xref="HOGENOM:HBG124913"
FT                   /db_xref="InterPro:IPR021211"
FT                   /db_xref="UniParc:UPI00003B6666"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA5"
FT                   /transl_table=1
FT                   /translation="MSSTTMKVPTPVKWVFDRFPVVQYQTIPQSKAIAYSDTVNRCFEF
FT                   RDVKSSMHNPEYDGGNSKNDNSGNDNFQLGVYSVHGFEIGGTDVMLARDPLCLYAQLSL
FT                   CKKNNLRLPTKFEEGNNEKKNQPKLDAESTLDSHFTTDVAGIRKPGNKVVILSEKAHKD
FT                   ERLPILIETTMNGQSKNIKRYVRSMDSIMIILDSKLESAELAIGNLLDTTVYDAFLLCT
FT                   IHNNLVYETYGCSPDTLHTLSKRNRFFTRHPQISSLSLGQIYTPSPSDLEKQLAMAKDI
FT                   LLLLQSTHDKFSDYLRLKVASYVLALLHLPSFGEFLRAECSKLLDDSTTIVKDFV"
FT   CDS_pept        complement(199107..199700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197945"
FT                   /locus_tag="CAGL0H02189g"
FT                   /product="Similar to uniprot|Q03525 Saccharomyces
FT                   cerevisiae YMR269w"
FT                   /protein_id="CAG59823.1"
FT                   /db_xref="HOGENOM:HBG103978"
FT                   /db_xref="HOGENOM:HBG124914"
FT                   /db_xref="UniParc:UPI00003B6667"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA4"
FT                   /transl_table=1
FT                   /translation="MDGKSYLKSYGWQEGEGLRKGSLKKPILVKHKRDKKGLGGAVGHN
FT                   DGEAWWERLFDGQLKNLDVSTDSNSDGEIVFKQNSVVASGVPKSSSPLYQWFVKGTGLK
FT                   GTIDEKPDLKESKTVTVVSDSFKVSKKRKYDEDYKVSKKHKKDKKAKKDKKAKKDKKAK
FT                   KDKKDKKDKKDKKDKKDKKDKKDKKAKSKSKGGN"
FT   CDS_pept        200049..201194
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446684"
FT                   /locus_tag="CAGL0H02211g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG59824.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG203513"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6668"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA3"
FT                   /transl_table=1
FT                   /translation="MGTQHGNHSGPKRSPKRIRERCTVLVENVPKSYNQGKIKKFFKDC
FT                   GDVLQVNSYESWREGNRCQMARVEFADEDGARSALTRTLRNMGSNTIEVNELKDSTVWM
FT                   TNYPPTFQQRDIRNIFKDHKIVALNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQLLNG
FT                   KDINGYKLVVKKSNPENRDKRSDAPVLERREIIIRNLPKTMLVKDTLLDIFKKYGAIDD
FT                   LRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSALEMNNHVIDDIKISVNLSDSHAYLERK
FT                   EVNRIINSKHTEKYAAIYPISDKTSKEQIRNFINDKNAVLVEELKNIYLVTDYKAVFLK
FT                   FERESTAAKAMLQLNNSTFDRKTIKCTTIRELMNFSSVNTN"
FT   CDS_pept        complement(201264..202160)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197946"
FT                   /locus_tag="CAGL0H02233g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="inorganic diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="phosphate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59825.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006796"
FT                   /db_xref="HOGENOM:HBG355416"
FT                   /db_xref="HOGENOM:HBG434750"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniParc:UPI00003B6669"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA2"
FT                   /transl_table=1
FT                   /translation="MQCYKMAFKKLALINQCRRAYGSIRQGSKYSTTYRQYLKLEDGSV
FT                   GSYFHDVPIGIQKDKCYVNMVVEVPRWSSGKFEISKELKLNPITQDVKKGKVRFVNNIF
FT                   PYHGYIHNYGAIPQTWENVTSSSSLPGVKEPLFGDNDPLDCCDIGSTVLKMGDIKTVKV
FT                   LGSLALVDDGELDWKIMVINTEDPMHEKINNLADVEKYCPGLLDATRYWFKNYKVPTGK
FT                   PVNEFAFNGEFQDYDKTMKTIEQCHQEWKGLVAGKISASPNILLPTTERKGTSISVKDD
FT                   RLPDTPVPDHVNKWYYV"
FT   CDS_pept        complement(202569..205325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161488" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446685"
FT                   /locus_tag="CAGL0H02255g"
FT                   /product="Similar to uniprot|Q03516 Saccharomyces
FT                   cerevisiae YMR266w"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59826.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG175905"
FT                   /db_xref="HOGENOM:HBG327532"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI00003B666A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA1"
FT                   /transl_table=1
FT                   /translation="MSSDHVTSTSTQQVVTALITNGVIFGAFVGAFVLLRLKLKRIYEP
FT                   KSSFDLINDEKKPEPLPSGIFSWILPLLKKSDNFVLQQAGLDGYFFLRYLFILAAFFAV
FT                   SIMYIFPILIPINASNGAHETGLNQLAYQNVKHRHRYYAHVFCGWVFYWSFLFVVYREL
FT                   MYFNSLRQAVLSSPRYASKLSSRTVLFQTVPGEYLNEQEFSKLFEGVKNIWIARTQGDL
FT                   PKKVEEREKLAMTLESTEIAFLKKCLKQLKKNKDGQLDIHSLVTDKKLRPTHRTTRFIG
FT                   KKVDSIDYLKEEIKKLDDEVKELQSCHEDEKTLNSIFIEFESQYQAQIALQIRAYHAPL
FT                   YMSPAYVGIEPKNVVWFNLRLFWWERMVRELGSVGAIIALVILWAIPVAFVGMISNITY
FT                   LTNKLHWLRFIYHLPDVLLGLLTSLAPTVALSLLMMLLPMFIRGMAKIQGATSSQQVEY
FT                   FTQQSYFAFQVIQVFLVTTITSAATSTVTQIVEEPTSAMRLLAENLPKASNFFIAYIIL
FT                   QGMSIASGSLLQISPLAMFYALGYLLDKTPRKKWTRFTTLGSVDWGTTFPIYTNLAVIV
FT                   FSYAIISPIILLFGACGFLLLYIAYLYNLTYVWQEASDARGVHYPRAMYQTIVGLYIGQ
FT                   ICLLGLFAVGKGWGPIVLQAIGLAVTTIIHLYFNKTFDKLMRVVPVDTMKSSDGISDTP
FT                   SYKNIYQQSSCAPIEENHEPHKLFGSSRAHLALKSSGYASSSPLAKDVSYRDSFHSDNT
FT                   LENEDAPIRTSSPRKDINVLDTTELLADGHVKKIPQVSSWKRFFLPHIFLSFKAVKHRI
FT                   PEIYNLEDPDELKDEDDIRNAYNFPAVSAELPVLWLPRDPHGISTYLIDDIASVIQASD
FT                   EGAVINEDGKITILGNPPKEGLVEEKISHLSKQESHSENPFETPEEL"
FT   CDS_pept        206023..206397
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446686"
FT                   /locus_tag="CAGL0H02277g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59827.1"
FT                   /db_xref="HOGENOM:HBG124915"
FT                   /db_xref="UniParc:UPI00003B666B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FSA0"
FT                   /transl_table=1
FT                   /translation="MSHSVRCWLSFYLEMLCLLAAKVLILFELYDEKVWSGPSKTLCTM
FT                   QYGLFEMGNWKGEVKIQNCETKCKTVNDMIIVPKTIAFIIAVMVTSLDLTRFYLSSNAK
FT                   NGAYRYYNCVDWSLLNLTVQ"
FT   CDS_pept        206827..208236
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446687"
FT                   /locus_tag="CAGL0H02299g"
FT                   /product="Similar to uniprot|Q03508 Saccharomyces
FT                   cerevisiae YMR265c"
FT                   /protein_id="CAG59828.1"
FT                   /db_xref="HOGENOM:HBG124916"
FT                   /db_xref="InterPro:IPR018812"
FT                   /db_xref="UniParc:UPI00003B666C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS99"
FT                   /transl_table=1
FT                   /translation="MTSSLTEHQVLEEWNSIPGEVHVPIVSAAEITKLHIYDFDNTLFN
FT                   SPVPNPQLYTKRVENLLRSSPHISSFGSWWDDPRPLEIIAKLMNHDSERAAFWNENLLR
FT                   LARLSWRDTSTVSIVLTGRKEKNFHSLFGKLFQISRDKWATEQIAKDDNKYSADDYLFN
FT                   AICLKKQREETNTFDYKCKCILSFLDRYPNLEEVTIYDDRIHHINKFKNFFNSLLNTKI
FT                   KWIIVPVAPRFHYLPIRDENTLIPKFVNEQERAESGLVLNLSRTPMQVGYFLTVGSQKK
FT                   LLHWGLNYLRQHFKDTKVQLSNFAEYPMYIPCTAPGNGITASQARKCFTHFDEIQISKN
FT                   NDNEKRSDEDIIKYFCSQKTMLSEWSTSFKVVAIAIREAPIQASSRKAQNNKAMEIYYR
FT                   TIPVGPKKEAWTSWPEFIIVGYNYDKNIQVQMEEINSVLTNPKSLRWHNVKVGIKIKTY
FT                   FGFFSKRDTDL"
FT   CDS_pept        complement(208420..209031)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446688"
FT                   /gene_name="CUE1"
FT                   /locus_tag="CAGL0H02321g"
FT                   /product="Coupling of ubiquitin conjugation to ER
FT                   degradation protein 1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59829.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059174"
FT                   /db_xref="HOGENOM:HBG397394"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI00003B666D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS98"
FT                   /transl_table=1
FT                   /translation="MEHSAAVVVATLILGIFVVKWFAAPKEHPSAQRLPNTQLPSSSNN
FT                   QQRTAGSSNGRGSQRRVSSTSRRNITPEMIETVRNVIPALHPEQIRYDLESTGSVEQTM
FT                   ERYFNGESFPFPPGYTPARESSANGQHNNIDEPSDIRKRSNIRPDNLLSKFNVDMSVDM
FT                   SDMSIKELEIDERKKLLVWEARKNMEKRLETDTELASLIK"
FT   CDS_pept        complement(209419..209955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197947"
FT                   /locus_tag="CAGL0H02343g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59830.1"
FT                   /db_xref="HOGENOM:HBG192164"
FT                   /db_xref="HOGENOM:HBG397393"
FT                   /db_xref="UniParc:UPI00003B666E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS97"
FT                   /transl_table=1
FT                   /translation="MARANNSNSESETKTRNNNQGNAGSSNASNTTSAGSNSQSSRSNA
FT                   KQRLTAAQQQYIRDLINEHITNNDPTLEEKPHPLDFEQYSEEFIRAYKDHFGLNVPDQM
FT                   TLQGYLLGSELGKRTISYKRNVSSVPGHRITKTEAASKIKKHFNSLSIKETECIPNFIY
FT                   KVRNQKKKFKMEFRG"
FT   CDS_pept        complement(210361..211257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446689"
FT                   /locus_tag="CAGL0H02365g"
FT                   /product="Similar to uniprot|P38430 Saccharomyces
FT                   cerevisiae YMR262w"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="CAG59831.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG191883"
FT                   /db_xref="HOGENOM:HBG203511"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI00003B666F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS96"
FT                   /transl_table=1
FT                   /translation="MLVDAHCHLDGSADSRGCAEYARNVRVCLMSTNPQDAEMLSVGIG
FT                   LGNAVCAFGVHPWFSHWFYVGDAPGKLEHYSRVMQADAADEGFLSLVDELPDPIDLDQY
FT                   IRDHFPKGRWQVIGEVGLDKLFRVKRRDGTLSRWHVSMDHQRVVLDRFLDLAVRTGLSV
FT                   SLHGVKAHGSLLDRCEKKLLNTPCNICLHSYTGPADTLTALWIRKFGHERIFVSLSQYI
FT                   NLDDKHRAVTENILDICPKTCILPETDFEINKHDAQRLEMSLRTVYNFIGQRWGIDNYE
FT                   ELMQTNFESFYGHSIAQ"
FT   CDS_pept        212116..215460
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446690"
FT                   /locus_tag="CAGL0H02387g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="catalytic activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="CAG59832.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG059172"
FT                   /db_xref="HOGENOM:HBG325476"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6670"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS95"
FT                   /transl_table=1
FT                   /translation="MTLIVASLFLPHRPQFEVTASAGETQELIENNLVKLNPLASNEAS
FT                   PQARPNLDNYIRNTRSALNVPFAQGRNVSQESLLSLNNAGNTSGNIDDLVSSEQFLVNL
FT                   TANATASGTPNPSYHTKGNMGRPNLGAGGSAEEFFSTSNPPSNRGASPVLSIASAPQVQ
FT                   NNLDSTLNNRGSPPPQQLDSQMADPTAHLLKNVSKSLLTQSLHDSTKEASAPMPSSSAN
FT                   SMGQSRYNHANTSIGTAVTPKSRPLPGHSNSSSIIDFSLSRNKQHAPALPALRRIQKNK
FT                   VGSPTKPSPLNTQPQSSNLKYSKTLHQMHGDSAYNSDWTTGDDSDHLEEHEEPDNDDDL
FT                   RQEYLVPQFGGFSTTSKVRETLLKSSRELFAQLPWTIVNSDKGNGSLKNAVNTAVNEKT
FT                   TKENVKWVGTMGIPTDEIPDEIVENIAKVMEEQYNCGAVVTDDITFKGAYKNYCKQILW
FT                   PTLQYQIPDNPKSKAFEDHSWQYYHRLNQQFAEKIINVYKDGDIIWIHDYHLMLVPGMV
FT                   REVFPDAKIGFFLHVSFPSSEVFRCLAHREEILEGLIGANSLGFQTKEYARHFLQTSNR
FT                   LLAADVSDDELKYDGRIVSVKQVPVGIDYFTLREKLKDENVLQWRHLIKERWHGKKLIV
FT                   CRDQFDRIRGLYKKMLAYERFLKDNPQYIENVVLVQVCIGKSTDLELERQIMVVVDRIN
FT                   SMSPNISLIQPVVFLHQELDFPQYLALNSEADLFMVNALREGMNLTCHEFIGCSSDKNA
FT                   PLILSEFTGSSSVLSEGAMLVNPWDIKQVAACIKEGLEMSREEKKRNWKKMVKSVITHD
FT                   SDSWFVSCLQNLNNSWEFTKERSTVFNLRFETFSDDYNDTSKRLFIFKISEPPNSRMIS
FT                   VLNELSSKNRVYIMNSFSKVVNESLYSRVNNIGLIAENGAFVRLNGDWYNIVEDVNWRA
FT                   EVVKILEDKVERLPGSYYKIADSMIRFHTENAEDQERVSGVIGEAITHINTLFDDAGIH
FT                   AYLHKNIVFVQQTGLSLNAVKFLLRYYNTAASGDNVTPMINSEQSPRSRSDSISVSQKP
FT                   IDFLCISGSSSPVIEPLFKLVKDQRNSGMLRHGHSIVYGDTTSSYAREHVNGSNGLFNV
FT                   LNRLMRS"
FT   CDS_pept        215958..216419
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223675" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446691"
FT                   /locus_tag="CAGL0H02409g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAG59833.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG411380"
FT                   /db_xref="HOGENOM:HBG521228"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniParc:UPI00003B6671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS94"
FT                   /transl_table=1
FT                   /translation="MGKKNTKGGKKGRRGKNDSAGPKRELIYKEEGQEYAQITKMLGNG
FT                   RVEASCFDGIKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLK
FT                   SQGELPENAKINETDNFGFESDEDANFEFGNADEDDEEEEDEEFDIDDI"
FT   CDS_pept        216932..221182
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446692"
FT                   /locus_tag="CAGL0H02431g"
FT                   /product="Similar to uniprot|Q03496 Saccharomyces
FT                   cerevisiae YMR259c"
FT                   /function="binding"
FT                   /protein_id="CAG59834.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124803"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019442"
FT                   /db_xref="UniParc:UPI00003B6672"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS93"
FT                   /transl_table=1
FT                   /translation="MPNQELNSIKDFLLKTNPSKINQENKDDILETYINYFTIVKNELL
FT                   YSASLTDEDRLFLTDTLSINILRSTQTIKNKKLDTSTFESRLHTEIFTEELNNQIFNYV
FT                   VNFWAETGPVQMNALRDLFAKFMGLNKIIQDDASFQEMCHCWLKNISKIPNTLKVQYYL
FT                   IEALSNDIDLFEIMEDKPDFFQTSLSLMNLDSLSTPISKCLVSMLLNIFKIHLQSDKSR
FT                   LNEWVNLWKGSLLKYLGIKEYSKNITIYILEPLLKSMPKEAFSILVDSGFENNNQLLLS
FT                   VIRLGQELNIIEDPFLRNEMIAMSTLEDLLKTNAQKLLTFQVLIYSKKSSKPIDPRIYH
FT                   LVLQSMNSFFLEVDVGMRNYFWSSFKGLLLRVRDSTYALHRDANKLQKANKFPEEVQQK
FT                   LSTVTLAREFLSKVYEIVIFHLLPGSSYQSHHLGLKFLRLFLELGIDKKATNLIIELQD
FT                   DREFPFSLDIVDDKHLQDTLLSLLISKFPDIRESSRKLLELMNKPQNSKLELNESMKND
FT                   IEIQAAIYLDLYQHCELGASLHQYSYMICNDKGKYMDSFILKIKRMLSIHDYNKSEFIR
FT                   QPIGGYFLGLSSLMKQYFLLHKNKNDNQYFETCFDLVCTNWSYMKEISSYNSSNDILPE
FT                   SYRNCGVKDSIITTQAFRAIKEASGLLEILMESCELDADNISSIGDILIDQLFTVRHSG
FT                   AFQAVLPAFKLCTAMAKKKVPLLLNEWLDKSIDMVETKTQHITRRSGGIPFIVSIILGT
FT                   SADKSMLDLAFKRLVNIAIEPITEFQDVIDHPQVNAFNCIKSLFTEAKLATIILSHVSK
FT                   SLELCLMSFTSSIWAIRNCSMMLFTAIQNRVFGKSGKDYPARLFFNRFVDVDKLLLESL
FT                   NKTTTAIHTHSILSDRHIEVLYLIVTLLSRLESTPGYTGLADFISLLKNNIDCKDWKVR
FT                   DLIARTLAKYEFENLLSHEFLLEWDCSNQNNLHGKLLFTKYCLQQGINKNLEQFKLKDI
FT                   CVFLISKLDETILRNKCYITIKECTEIVLLLLESNMFDKSEIDQMCSIFGMFLCNTIEN
FT                   PSQDGTKQLALAATLQVLLQIESQANIQCILQLVLLSNWYECHLIAMQYINSTMDLSLY
FT                   SDEMYSSVCTIAKNNNNLPEVRKLALKTAVYLNFDKSLQLILSVFENNRVESLRTQSIE
FT                   QIGNYITAEIFEKWWPLLQDMFLDNQIEDIRLSALRSVINAPQLLDHPKVVFRMLLTLN
FT                   DDDEDIRLECAHFINRALLAENDIQFDTAPYHTAISVMHRGKIDAKSTHQLAKIVMDSI
FT                   INDMNKFNNMENTSTIGDHLFDKEEDNIFRNRVLENMIMVKIIACNADNELREAIKTFL
FT                   ISYCPSIISIIANSHTSGSLFHWVTHIDHFTKIYTTRLLLSEFCPEDVSAFDSALIKLG
FT                   IPHNTIFTMKNIIV"
FT   CDS_pept        221539..223194
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446693"
FT                   /locus_tag="CAGL0H02453g"
FT                   /product="Similar to uniprot|Q04847 Saccharomyces
FT                   cerevisiae YMR258c"
FT                   /protein_id="CAG59835.1"
FT                   /db_xref="HOGENOM:HBG059766"
FT                   /db_xref="HOGENOM:HBG203509"
FT                   /db_xref="UniParc:UPI00003B6673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS92"
FT                   /transl_table=1
FT                   /translation="MMNSSMDNDYQANLNSVLPLVCEYLNQNDVFNLTLCCTTFNKSLQ
FT                   RHLFKSIIIQTEPVLRDVRSHLDWNTTYITGCRNIIKSNDQNDIYVYDRVEELIRSGKL
FT                   HLIEKLVIEKDIFFDKDNGNALLIKLIERIIEIDLIKVLEIKDYDLFSNFYDSYLKLTH
FT                   LTKIEVIELDDLENTKSLFTLREIVLTLINDNERQIINLSENTKKILRSNIKSVHINDV
FT                   DYASGEIINLLKRNHISFPKAQNISFKHVHRLECGPITDINLGNIFDLKKIKALEAVIN
FT                   CEEYGHCSCLDEFLTKIRDDLIVINKLALSQKHFITVPNHKEQEDWDIIICRFLVNIPD
FT                   VDSNLSTLIIKHDPPFEGFAEDSVDGNYIRRKNLFMSVFPVLKALRSLWAPVVLQTISA
FT                   YEVPMADILWNGCECEYCKKWLPVFDQYLMNHQYYSKDEGDYKDIIPTPFAAFTGYSLA
FT                   KRVIDDVNSLLELTTRAPHMFNWDFHTYDAIRHFETYECHFDERVFPMLGTAISHFFYN
FT                   YMDFLVKHLPNLAFTQFSGIYFTVKDQKYDCIYD"
FT   CDS_pept        224077..226485
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446694"
FT                   /locus_tag="CAGL0H02475g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59836.1"
FT                   /db_xref="HOGENOM:HBG124804"
FT                   /db_xref="UniParc:UPI00003B6674"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS91"
FT                   /transl_table=1
FT                   /translation="MMRKWIIQGNLIKHFSRECAEDPLVNSIKLIILRHDYSTNKVGIS
FT                   VKEQVPREQNDENNKRAQFYDESFRFLTGTPMHITNRRLTSDLENISFICKSSPSFISE
FT                   EEYTRIYRIIQDPGSSEYLVSSSILSISNHKHKLIPLPKLLSMIHILSENGYLNEIHML
FT                   FGNCKAHLSILKSDQPEDLYRQFLELMLDVEYKLLNFHSIEKIFSEYIKMPNIKAKYMT
FT                   YGLRAFIENNDFQLAKAFFFQALTHSDNFPMTPKELHSFLSGISDHNDLTNTLLIFYSW
FT                   ISAKCKQLDDNPNFPLPETMQLIHRMILLFQDRVQLTQFCSNVVVKQSGYLDSVDYKLT
FT                   VYFDKVRKVLADTGPPNKDRPEIFKGIQQYIDLLDGMTDKRELFFKRLLCICTDSHDLD
FT                   KFMEIVALIEADKEVDMEIFVKDMVGKIIARKRRFGTALKYYEDLVLNGIEGKKFPIKH
FT                   EYLSSLWIAIVSDYPTLAEPIKQELFLTLNTDKYKRAYPWLKYFLQEVSQLKEWKLLGG
FT                   VSWNVLHLRISEYDKLKELDKFIKSADCLEIEHIIQQTLRDGLVPNFHFNYSLIKLLLK
FT                   GSLVSSAKTIDDTMRKNYYSIPEKLNILWLRNDIDTMKKNMNSLTNREYKRMISSMLDD
FT                   FVNSRVLSLGFKDYIQLTHLAMDYGLYGMAFKLLKSGKMIFQEKNGTNWKLYYLASLKL
FT                   HTQTLQLDQFMAVLQSWIKNKDAYVITPGCLRRLKSYSRFFKKNSGNMDNFDADKLKEL
FT                   EQNIQVLKTKYLENKYKGLNDMHRMCQFIKTALDRDAKTITTQNANGST"
FT   CDS_pept        227288..227473
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197948"
FT                   /locus_tag="CAGL0H02491g"
FT                   /product="Similar to uniprot|P10174 Saccharomyces
FT                   cerevisiae YMR256c COX7"
FT                   /protein_id="CAR57987.1"
FT                   /db_xref="HOGENOM:HBG398812"
FT                   /db_xref="UniParc:UPI00017BD8D9"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN07"
FT                   /transl_table=1
FT                   /translation="MANRIIELQKLFQSSTKPIWWRHPRSAFYLYPYYGLLAVAVVAPL
FT                   LYIPNAVRGIKAPKNN"
FT   CDS_pept        complement(228026..228775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446695"
FT                   /locus_tag="CAGL0H02497g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59837.1"
FT                   /db_xref="HOGENOM:HBG124805"
FT                   /db_xref="InterPro:IPR020401"
FT                   /db_xref="UniParc:UPI00003B6675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS90"
FT                   /transl_table=1
FT                   /translation="MVLDSKWADAPDEDEVVEVKRDMRKNKSVSRPNSRQRTRNSTNDQ
FT                   ETTPRESAKEESRPNSGRSLLDRIDKSFLVNSEDKKAAGHAIRDDRHMSPLPKEPKSKS
FT                   SGTKSASRNSLLDRIDQSYLVDNKSSSKTSATPSPPSTASSNYSRQKSPDTAQTTPGCT
FT                   RPSSRNMQSRTNGENGKKTDPAANKVKMELLKKKIEEQKKLLNERTHKEKQKELLAAFL
FT                   EGDEQFAWDDEKEEDELINKLKSSQIS"
FT   CDS_pept        229511..230665
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248677" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503371"
FT                   /locus_tag="CAGL0H02519g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG59838.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124806"
FT                   /db_xref="HOGENOM:HBG396365"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI00003B6676"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS89"
FT                   /transl_table=1
FT                   /translation="MADASKTIVKESDFEINDGNDASSAGSATEAGMVARLNQEYLKPN
FT                   VGLIFLIVSQLFNSLMVVSTKVLELDREGLEPDEPSIQPLQILLVRMIITYIGTLIYMK
FT                   INSSSIEYVPFGNPAVRPWLIMRGAMGFFGVFGMYFSLMYLTISDAVLITFLAPSVTII
FT                   LAWIILRESFSKAEGIGSFVSLAGVVLIVRPTFLFGNPTTSDGDIDETTDPHKRLIATL
FT                   VALWGVVGISSVWIIIRYIGKRAHAIINVSYFSLITGLIALFGILFVPSVHFQTPRTLK
FT                   QWLLFANLGICGFCHQLLLTIGIQKERAGRGTLMSYTNLIYAVFWDVLLFGHWPSFWSI
FT                   CGMILITGSTLYIVKMKANDAKPQAVNNNSIQTEFDLEDLSSVR"
FT   CDS_pept        231364..231687
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446696"
FT                   /locus_tag="CAGL0H02541g"
FT                   /product="Similar to uniprot|Q04814 Saccharomyces
FT                   cerevisiae YMR252c"
FT                   /protein_id="CAG59839.1"
FT                   /db_xref="HOGENOM:HBG059772"
FT                   /db_xref="HOGENOM:HBG203505"
FT                   /db_xref="UniParc:UPI00003B6677"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS88"
FT                   /transl_table=1
FT                   /translation="MMYKVGVRSINSVRQLSRFRRWHELDLAEQHKFIHKFAENYRKRY
FT                   PGSKTNLSFRGLMKDIDTYKDSPSVFGIFYNSICDNIDHGRDNGRFAHDSFRKLVLHRN
FT                   DST"
FT   CDS_pept        complement(231892..232068)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197949"
FT                   /locus_tag="CAGL0H02563g"
FT                   /product="Similar to uniprot|Q3E6R4 Saccharomyces
FT                   cerevisiae YDR524C-B"
FT                   /protein_id="CAG59840.1"
FT                   /db_xref="HOGENOM:HBG124807"
FT                   /db_xref="UniParc:UPI00003B6678"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS87"
FT                   /transl_table=1
FT                   /translation="MKVSNVVLGAIAIAAVNAQNASNHSSSSKNAANALPANNAYTAGV
FT                   AGAAVAGALAFLI"
FT   CDS_pept        complement(232974..234755)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000070228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446697"
FT                   /locus_tag="CAGL0H02585g"
FT                   /product="Similar to uniprot|Q04792 Saccharomyces
FT                   cerevisiae YMR250w GAD1"
FT                   /function="glutamate decarboxylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glutamate metabolic process "
FT                   /protein_id="CAG59841.1"
FT                   /db_xref="GO:0004351"
FT                   /db_xref="GO:0006536"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG048455"
FT                   /db_xref="HOGENOM:HBG365574"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS86"
FT                   /transl_table=1
FT                   /translation="MLHKHTDKQRLPVNIVDHHHIDPCLQDFKLLSKELQDIASNSEKL
FT                   KALGSKENKESHLLSMKYVIPKEGVPADQAYDMIHNELTLDGNTHLNLASFVNTSTTHE
FT                   VRKLISENLTKNLADNDEYPQLIELTQRCISMLSGLWNANPEEEPIGCATTGSSEAIML
FT                   GGLAMKKMWEKKMKAAGRTDTSKPNIIMSSACQVALEKFARYFDVECRLVPVSRKSHHM
FT                   LDPNLLWDFVDENTIGCFVIMGTTYTGHLENVAEVGDVLTAIEKQHPEWANKDIPIHVD
FT                   GASGGFIVPFAFSREQLKAYGVPNWGFDHPRVVSINTSGHKFGLTTPGLGWVLWRDESH
FT                   LAPELRFRLKYLGGVEETFGLNFSRPGFQVVHQYYNFMNLGYDGYRDTFKRSLFVARVF
FT                   AHQILRSPIFNDYFEVVSSIHESIDGDKVPDAANDYWENPEKYKPGVPLIAFKFSDKFQ
FT                   KEYPEVPQALLSHMLRTRGWIIPNYPLPHSTDGSDKCEVLRVVFRNEMSLDLAQLLLSD
FT                   IQAVLRKLQGSYSGLKTISHESDSDKRRDYVYKMLLALASPDADIGEDEDEETKEKKAS
FT                   KKEEIKQRLKRNYRGTC"
FT   CDS_pept        complement(236058..237278)
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000159915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503372"
FT                   /locus_tag="CAGL0H02607g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="adenosylmethionine decarboxylase activity "
FT                   /biological_process="spermidine biosynthetic process "
FT                   /biological_process="spermine biosynthetic process "
FT                   /protein_id="CAG59842.1"
FT                   /db_xref="GO:0004014"
FT                   /db_xref="GO:0006597"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG436692"
FT                   /db_xref="HOGENOM:HBG610629"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="InterPro:IPR018167"
FT                   /db_xref="UniParc:UPI00003B667A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS85"
FT                   /transl_table=1
FT                   /translation="MTVTIQELTNHSYIDHELSATLDSTEAFEGPEKLLEIWFFPHRHC
FT                   IPKDENGDMKTLRSIAVEKWVAILKLVKCEVLSIKSTEKMDAFLLSESSLFVCDHKITL
FT                   KTCGTTTTLFCLEELFRIVEEELGWDMRAKKEENVGKYHPHKVFYSRRCFMFPLKQRSI
FT                   HKRWSDEIEYLNKFFCYGSSYLVGRSDQSNHWNLYVTETNKNMNITDDCGEDDEDETLE
FT                   ILMTELDQTCAQQFSCKREVKTVEQSQQDENTSEDEGHLSGYKMTNATRLDRVYNNEKN
FT                   VSFHHDAFAFTPCGYSSNIIMDEEYYYTLHVTPEKGWSYASFESNVPVRHVSNNKQDNI
FT                   SVINHVLSVFQPRDLCITFFCKSMDNESFKKLMKTSGEIPNYTKKDRIIYDLDDYHLLY
FT                   IRFERNC"
FT   tRNA            238083..238155
FT                   /gene_name="tRNA Ala (AGC)"
FT   CDS_pept        238495..243129
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141962" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446698"
FT                   /locus_tag="CAGL0H02651g"
FT                   /product="Similar to uniprot|Q04781 Saccharomyces
FT                   cerevisiae YMR247c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG59843.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058131"
FT                   /db_xref="HOGENOM:HBG203502"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B667B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS84"
FT                   /transl_table=1
FT                   /translation="MSFGVNTFQKYRDDSGLGHNGVAVSLNYYDGLPESSLLNSLSSNE
FT                   LKLIFKSLMKRDDTTKEKALNELMGLVEHYDHNSFLFDDIMLLCWSQLYAKLCMSELKN
FT                   IRLVCQQVTLGIITKMRKSVAKYFKDLIPFVLLGTCDTDSAVARLCATGIKTCFNDDED
FT                   KVTALYSLFDIPILSLTKAILVTETPQTLTDERYSTPDDADFKYQRVVVSAINLLLAAI
FT                   ERNKAILEDETFNEIMDNENLWKLMSIKNLNSIKTYESLIRLAITLSEEEFLTSHKHVL
FT                   KLISKKLLKSLSQFNDKNILKVNYICPLILTLFMCLNKYKNGKFWSYDKISKDRLVGFL
FT                   STAMKSPTVGFFPTFFRFYTSVESQDILDKELEWWPLIRIGNKNLCNKSFLGRDGAKIL
FT                   KEYWSCRVQLNNSSFSNKNELLIEDIKEVINSTDITNVVEVKQLFRNYLNNTAILHEID
FT                   VLLASHGNLTRDIKLKFDNFLNLFFLEATESDVISMSKTLIKAWDNKEGPPESTLFVSN
FT                   RLIKNGKEHPESLYFFFERLLDLMNEDNHSEISNLFVSYSSIIKVPDEKVISLFGSFIM
FT                   RVTIISKNVNSVKDILCQIPRIYCEKLCSADESTIKKIFDTIIQSYSGDTNVQFFQSPI
FT                   INIFTIHRLFEVFVSKGEFSKLVSDINYLDSTCKQYLYAQETFYDHTLNELNDMQFFTL
FT                   LKEACLVLGVNDEIDANIVKVLLRKIKKSFSKQSSEQYFEVLDILLKHNKDTINVFLPS
FT                   DPLKLLKEFNPSSLLLCDGNFGANVAFFLSGPTLEDYEKAKPLLHQAMFIDTYLSKNNK
FT                   TDLDAWIIFLTIMSEIAADYNYLSESPEYIFQDLENTIYKSVERPFSFLSILNLLNNVE
FT                   AKNNSWLSKLIDFEESNSMVAYYSGMIVRRILINEVDYMSSSDKNFISQELYTFLSKAL
FT                   REKEHGLKLFYATILLATSKDVVMPEALIKVGALLISQIVGISEMELIKGKSKVLLILF
FT                   SMLAGSINISEPVLPIPKLNMALKTLDNILDSDIAYDEEFIIHRLLIMKFIGAIVSQSN
FT                   LEQAHSQALKLAERLIADGFSMSLLEETPMKPELQYLATQLHKYCIARNEWECTEEYRS
FT                   EIETGFMDTMLNSVSVFKNNHCSAQYYIMCEGIFSARKTNEQIKNLDSMIEQFVSMQLC
FT                   CNIGYMRLLVAILEKTIYEKQQINLIEFELENQKLGKDKTQDDNQEDERSFEEYKIPEI
FT                   LMTSLITNLPSEYLEYENQYRFLNYLWTWYLTVSYFKDVSYNMRELYMDQLKEKDLITQ
FT                   MLDFIVDQIDFDDTTYWKTVEINDISNYEIHNNQLEPFIEAVNDECKKLLVHLMYKIFS
FT                   ASGTLSAKWYMNIKNKSLSSKIDRFVSEFVSPILISNELREVENKKESLTSKDDSLTIK
FT                   INEKLHEVKASFLIDEQKLEIAFKLPVNYPLENIQVIGISRVGISEQKWKQWIMSTQHV
FT                   ITGMNGSVQDSLELFTKNVGLQFSGFEECAICYSILHAVDRKLPTKTCSTCKNKFHGAC
FT                   LYKWFRSSGNNTCPLCRSEINFRR"
FT   CDS_pept        complement(243231..244034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248442" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197950"
FT                   /locus_tag="CAGL0H02673g"
FT                   /product="Similar to uniprot|P36144 Saccharomyces
FT                   cerevisiae YKR060w"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59844.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058484"
FT                   /db_xref="HOGENOM:HBG396247"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="UniParc:UPI00003B667C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS83"
FT                   /transl_table=1
FT                   /translation="MAPSLCDSAFARKGVDALISYATNQDSNNDIQLIIHTEKKLGIKK
FT                   DYIPRVIPLKHNKMSKVKDMRILLITKDPANKYRDVLTSNELTSDTFKEIISVKNLKRR
FT                   FRGSKLTSLYKEFDMVVADFRVHHLLPAILGSRFYHSSKKTPYMVRINKEVKHKGAKMD
FT                   ETIDPVYLKAQLKSICRNTSYMPNEDNCINVKVGFVSTHTAKQILENIQDVIEFLSDKN
FT                   MKPSGGVIKGSIKSLQVKTASSASIPIYQYNENKEKNIPNDRLVL"
FT   CDS_pept        complement(244561..246210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197951"
FT                   /locus_tag="CAGL0H02695g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAG59845.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG124808"
FT                   /db_xref="HOGENOM:HBG202382"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI00003B667D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS82"
FT                   /transl_table=1
FT                   /translation="MGKENVAVATLLYSADYLPGVFTLGFQLRKLIDAGGCGCVKTCIV
FT                   VTKLLYNDILSDISKNLLNCLYDDIVLVDPLDYQHITQDMNKENLKMLERPELSFALIK
FT                   ARIFELTQYEQVLYLDADTLPLNSGIFDLFDQLADQTSEQVAAVPDIGWPDIFNSGVMM
FT                   IVPNRDVVAELNNYILNVVSIDGSDQGILNQFFNQNMRLNDFGRIANYSTKEWIRLPYL
FT                   YNVTTPNYGYECPPAMKFFGPHIRLVHFIGKHKPWSKWSQEQFQKSSYAAQWRAAYLDF
FT                   QIQYDLVDLLAHTTIKDEDEHIEPQQDECEEHIEENQPDEYHHEQTQYNERLEKIDEIN
FT                   EDECDIIEEEQQPIEKPPTPIQLPLDFKEWLTTFISKEDEEQQHNEEPSVEESQGNEPE
FT                   ETHFRGVHYEEHMIQHHEEETINRQVSHPKEDAANEAAREIEQPKDRYDRKVEIIEEED
FT                   IKDHELDDLIDDESSTNKQEDDDEIVDEQEESRLASELEVKDSKMDVQESRSHNIHNQN
FT                   NNNNYRFEWENTNYLNTVERSFPEDIFEYSVE"
FT   CDS_pept        247359..248030
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446699"
FT                   /gene_name="PUS5"
FT                   /locus_tag="CAGL0H02717g"
FT                   /product="Pseudouridylate synthase PUS5 "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG59846.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG059816"
FT                   /db_xref="HOGENOM:HBG202484"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B667E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS81"
FT                   /transl_table=1
FT                   /translation="MSARLKVVYDGMHYMIVYKSAGVLSQPGLASDSRPVLMSELRGLL
FT                   SETLDLYSVQRLDACVTGGTVVAKNKRAAMMFSRYLKQGGGSGYGLTRRYLARINAQPV
FT                   CDEGTIESPGMVTYYRRVRDDCVVVELKTGKKHQIRKHLALNLNCPIVNDTYYGGSVVK
FT                   GVNGQIALHSAFVRTRIGKNMQDHLVGIEPQEQTLWKSILTENGMLPDDIVRTLTRDKL
FT                   F"
FT   CDS_pept        248511..249908
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046830"
FT                   /locus_tag="CAGL0H02739g"
FT                   /product="Similar to uniprot|P10507 Saccharomyces
FT                   cerevisiae YLR163c MAS1"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG59847.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG407991"
FT                   /db_xref="HOGENOM:HBG476859"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00003B667F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS80"
FT                   /transl_table=1
FT                   /translation="MFRQAVKGIRTLRNFSHCRPRLNALPQTRTSVLPNGLTVASEFIP
FT                   NKSTATVGIFVDAGSRAENERNNGTAHFLEHLAFKGTQNRSQTDIELEIENIGSHLNAY
FT                   TSRENTVYYAKSLEGDVPKAVNILSDILTRSVLDPKAIERERDVIIRESEEVDKMYDEV
FT                   VFDHLHEIAYKQQPLGRTILGPIKNIKSISRKDLKSYITENYKGDRMVLAAAGAVDHEK
FT                   LVDYAQKYLGHIPKSESPMPLGSPRGPLPVFQRGERLIPENTLPTTHIALALEGVSWSA
FT                   PDYFIALATQAIVGNWDRAVGTGTNAPSPLAVAVNKGNNTLANSYMSFSTSYADSGLWG
FT                   MYIVTDSNEHNVQAIIDEVLKEWRRIKAGNITDDEVNRSKAQLKAALLLSLDDTTAILE
FT                   DIGRQIVTTGKRLSPEEVFEKVDNITKEDIVLWANYRLKNKPVAIVALGNTKTVPSVDY
FT                   IEKQLNA"
FT   tRNA            250359..250431
FT                   /gene_name="tRNA Ala (AGC)"
FT   CDS_pept        251169..256526
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197952"
FT                   /locus_tag="CAGL0H02783g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59848.1"
FT                   /db_xref="HOGENOM:HBG124809"
FT                   /db_xref="InterPro:IPR018844"
FT                   /db_xref="UniParc:UPI00003B6680"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS79"
FT                   /transl_table=1
FT                   /translation="MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGT
FT                   FNNTFNGQSQPDSSIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEIND
FT                   KCKAMYPSLEADLDILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVS
FT                   SYRSIKRRRLNPESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLA
FT                   RQLYPPSAIFEPQNSDDEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQDT
FT                   VSRSATVDPDKSRQQRLLSGTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINE
FT                   PSHSRRITSGMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKKPFIETERYYSE
FT                   DSSETESNSGEINAKSSLHRQTSIADNNGSPLRTNFLNEAVHLADLPELQKSEKASKPR
FT                   KQVYGSITVNSSNLQPIPNNINNYVETNATKVRSTVNDFGISSSSDDETTSETHSKMSD
FT                   EDYESSDSNKTIFEDDDDDDDDDDEANSTVVHIPTKPVLTRKSNKKIFQRDELLRLMEG
FT                   DRDGLPVSIKRELLKMYPDFPPQKHDKKLGPESKLHPSHNAIPKSPGSDGDKQKNSAQI
FT                   PHIEYSSEESSDSLSEIYVEEVDETTKGQKKKPNRRNKNSEEPLSELHPLKETVIDIKQ
FT                   NGNRSVKENITESLDSNKEHGESVGKNDFDVNNTEEMSRHQVNSNLHELPIKVHSTDSL
FT                   SETNARNESGDNAYNYKTSKSADQNDDLASTANNDIFKSLVDFRSLVAKIKKDKSENNP
FT                   NGSAMRDNSQGSSNSPVLNSTSFPNVVNNAAFGSTYTRKDTDKNVSLKDNSKLVSSAVN
FT                   ASASQNEQGPPIYPPETERSGKELIESKIKGLPPSKLIQEKSSTFRTPHSKSAQTTSPI
FT                   AEVVSGHEVAVKQIEDMQQFKPLDVRKSTSTSLLKKIPAKDVPVTQVKNTPSTKAVQDK
FT                   ETVGPATQHKSTQLEANSVPKKVPAKDVPVTQVKNTPSTKAVQDKETVSPATQHKSTQL
FT                   EANSVPKKVPAKDVPVTQVKNTPSTKAVQDKETVSPATQHKSTQLEANSVPKKVPAKDV
FT                   PVTQVKNTPSTKAVQDKETASPATEHKPSKRVDRKVLDSTQKEISITQNNSVQSKKVVQ
FT                   DNTVDVASHKQQDPYVSARDTLYTKLTGGEQGDNHLSTSKATAKVDLPTKKLPNASNGN
FT                   VVISQSPSDINASQTSTKNKVTPSSVENQSGSSKNPNIASKNKQDITTSEKDNSISSQF
FT                   TSEVDKHVEGNDSKSGIHVRSFDNVKSAPSEKDLNSNTAPPVNNSQKTNGRNGLDEQLE
FT                   QRVETVTRLPSPVKNKIREQQNRVNGKSQQLEAVTSPETTAVIGRLDGNNSNVIGNQSK
FT                   KQTGTKEETDKKIRVTHNNTKRDSATTADLGSMGLGSRSKNEGLIDVSSNMDPISTSDN
FT                   MNLNTKVAVGSSSPALVDTQMNRMNRNPDTDSVNSVSSQLVNKAGIVRGISGHNHDTAT
FT                   EESSTDDSSTDESSDESSSSEDESKDYRKTRRLIVDVPKGPVIDKKITSSSIDQEHQNN
FT                   SVQQNDNKIEGKKIEATTSGSNSTKKEPFVGVLQALPEKIRPSLSSLSDLVSRGIPDVR
FT                   ESTIKGRSTAHQIVGGKGNSSNVSFSLGVSSSQQKSLGYKPTVDKQASGVTKQIPVKPL
FT                   SNSESSSESSTSESSSGSESDSDSDSDSNTSSDSDSDSSSDSDSNDGKSKKKSKAVDSF
FT                   ISAKSASSALKKKKKSTGFASLIRDSKKR"
FT   CDS_pept        complement(256682..260341)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446700"
FT                   /locus_tag="CAGL0H02805g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAG59849.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG505437"
FT                   /db_xref="HOGENOM:HBG526359"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI00003B6681"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS78"
FT                   /transl_table=1
FT                   /translation="MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAV
FT                   RFVLSDDYSNLKREERQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEV
FT                   RIRRTVGLKKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER
FT                   LQLLEEVVGAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYN
FT                   SLERDRKVLRYTLHDRELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEE
FT                   IKNLQKSLKLKATVDLEQAKAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLK
FT                   LITEIIDSKKSKRRKISPRFDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEE
FT                   RDEWINSKIKELSESINTMKASTTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAE
FT                   IEDIEKELINLRRKYTANIDARKEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLA
FT                   NGFKNVKEICERLNLGTESVFGTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASI
FT                   LMNELFRMKGGRVTFMPLNKLKNGNQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVF
FT                   GRALVVKDLTNGLSISKQYKLSCITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALS
FT                   KRQLLEISAKLTEIKNELTEMDNDIDSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNE
FT                   LLFLQQEKTNICEKIDSVDLNLGVSGEKLTQLKIDLTKTFNNELTTEEKKEIEILSKEI
FT                   LENQNKLNLTSETLSHLSVEIDTITAELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSE
FT                   ELEGRASEADNQLTIQKRALQSIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQ
FT                   KDVDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISG
FT                   MRNINKRAFENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVS
FT                   KNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQD
FT                   EQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSN
FT                   NAQFICTTFRSDMVDAANKFYRVKYENKQSSVIEVTKEEAKRFIKGGNKLSEI"
FT   CDS_pept        261006..262976
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446701"
FT                   /locus_tag="CAGL0H02827g"
FT                   /product="Similar to uniprot|P40358 Saccharomyces
FT                   cerevisiae YJL073w JEM"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG59850.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG058747"
FT                   /db_xref="HOGENOM:HBG202190"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6682"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS77"
FT                   /transl_table=1
FT                   /translation="MVVLRKLFGLVPLIGFTIAESTCEYKALSNEAQSLKNDIDSLNSY
FT                   DTLISIVEECLVADKHKDYDDLIKLSYQLYYKNGLIQLSAGRYHKAVALFERALGGNTN
FT                   TGDSYFLLIAKKLQQIYIDFGLWSNITSTTLPITEKIDPALKETYEERQRVYHDTLNRI
FT                   KETFSKNKNEQHLEELFDSLTEISPYNREVIYMAIDYYNANIITNNRVDLTRVIKLKEK
FT                   YETLLEVHSTSLTLNERLETHFKISVIQIFLLGQDPLIQGSSSHLRRCLNIDMDYGPCK
FT                   DLIKLSSRLNKVNPDMRLVKDPEAYKNGHIIIEDWKNVVDFYINNKPSLKLFTLMKGAK
FT                   FDTKTNYDLLKRLQFHLLSTLTGQQEQPEKLITMFFVNLDVILCQASSFLSKKDKKETS
FT                   KMCLHALSSIGLETKEAYRESLSNGSPLPAETVIDLWNSYPHMLIYTMTNIVKKYGKKQ
FT                   RGSDNLVEQVSKFWNENNLRESKNPYVVNLNNLMEKVDKNKREQQFRQQQQQQQRFFQQ
FT                   QQQQQQRYQQQQASGLTDSQTAKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQ
FT                   LSEEEEKKNDEKMSEINEAYEVLNDEEKRKEYDSIRSGSRQFQPRNNFRTNQRRGGYQG
FT                   FQGGFPGGFPGGFPFGSGFGF"
FT   CDS_pept        complement(263305..263952)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246603" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447796"
FT                   /gene_name="PSF2"
FT                   /locus_tag="CAGL0H02849g"
FT                   /product="DNA replication complex GINS protein PSF2 "
FT                   /biological_process="DNA replication"
FT                   /biological_process="chromosome segregation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59851.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="HOGENOM:HBG211367"
FT                   /db_xref="HOGENOM:HBG395978"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR016906"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI00003B6683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS76"
FT                   /transl_table=1
FT                   /translation="MALPAHLQETFSPEEVQFLVEEETVKIFPRITTRQKRRDKNRGAY
FT                   GDVDTKWSMLTTENDNLNNMVAMRSTEVKLWIALLLKQQNKCSIVAPSWLTLRELNRKI
FT                   QQETNNSDRFCDLPWNWLVIANVLFAKAADDFHDPVHELRSKVQDLREIRQTKVLKGLK
FT                   QLNASHLQLDNLSLLEINELRPFIVRTMDKLREIHDSANTDGGVVDGDEEEI"
FT   CDS_pept        264299..265999
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047103"
FT                   /gene_name="ARG2"
FT                   /locus_tag="CAGL0H02871g"
FT                   /product="Amino-acid acetyltransferase, mitochondrial "
FT                   /EC_number="2.3.1.1"
FT                   /function="acetyl-CoA:L-glutamate N-acetyltransferase
FT                   activity"
FT                   /function="acetylglutamate kinase activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG59852.1"
FT                   /db_xref="GO:0003991"
FT                   /db_xref="GO:0004042"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="HOGENOM:HBG189640"
FT                   /db_xref="HOGENOM:HBG202191"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011190"
FT                   /db_xref="UniParc:UPI00003B6684"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS75"
FT                   /transl_table=1
FT                   /translation="MWAHLFKHGFKYEQQNSLSKSLILSVLNSTATKREAKDYLIKYAN
FT                   GSSNYHYLLLIRNIATQSERSLHRLSDSIRRLKFLGISPVCVLLPSGRIQTEVEKMDKL
FT                   ITLSQLKPLVLDYGLSRAFDGSYESIMQTALDTEYCTTRGIVPIVKPYIYDQSTASRGL
FT                   ISDPVLFMDQLSRDSSLKFDKFFILNRSGGIPSGERNQNSHIFINLSQEYQKIHRTLTS
FT                   SIRTIVERQPRSEDLLDRLELYVRESDIISLEAEYKEHMENLQLMNTVLSNLSSSATGV
FT                   ITTINAASSPSDTVNPLVHNLLTDRSIISSSLPRFKNKSGNFLSPSGQDWYEMPVEIET
FT                   DEETLQGEDSVFVTTVLKKGVDIKEFDYSHLTSENTVNLPKQFQIKLHDESTYNNSCSK
FT                   YKLDLVKFKNIIDKSFGRELDLNHYLNRINGKIASIIIIGDYEGIAILTYEGPPDNKFV
FT                   YLDKFAVLPHLKGSLGISDIIFNLMFKKFPREVVWRSRANNVVNKWYFQRSVAVLDLSM
FT                   ELDEGDMQESEFKLFYHGDPESSLKSIVAIDRLRDLAKYVRNIKPSWVK"
FT   CDS_pept        complement(266139..268742)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503611"
FT                   /locus_tag="CAGL0H02893g"
FT                   /product="Similar to uniprot|P40361 Saccharomyces
FT                   cerevisiae YJL070c"
FT                   /function="deaminase activity"
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAG59853.1"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="GO:0019239"
FT                   /db_xref="HOGENOM:HBG058746"
FT                   /db_xref="HOGENOM:HBG204231"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="UniParc:UPI00003B6685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS74"
FT                   /transl_table=1
FT                   /translation="MAPSVLQRRPSLLHDDYEHAVTADSTAKIADSLKGKGIVPSANLN
FT                   KLVQTNKISIDDLDMISLGTAFDQQMEAGSPMYWDPQGEEEIRTKCSTISDNPMLNILK
FT                   GIEHVSYNARPVRAREIDSADVDAENNPFNKIVMSRTKYVVNSYQNSASNVKFDDKRAF
FT                   VYPKPLPKFWKYENDKRLTLEEQKEEKQSYYVSARNEFDDEEDLINLPEAVKPNQTSAK
FT                   FLGGVHHTGEFFDYDLYKKALKKHKKKIDDDNASDPSRKFCDFNFYQKIPDFAEFREDF
FT                   DFVVELLQNNHFDNLAKKRISYLNDKFELFQHLKSKTEILENKKVPYRDFYNSRKVDCN
FT                   FLLSGCITQRQLSEFIWEKLNKEPERIVYKFSTGETIKLSELFEIGCTSAEPIALGLKI
FT                   VDDDFLEWYETVYLQQFHLIPSREADVQLEGKELRFFLLAKTFLEFDNILEGEYFAEVF
FT                   IKYTVHTWEKSKYQLGQVSVDFQFYDSQEDNWWYKFSNWIKRWNLISYNIRWNVQISRV
FT                   YSKLFKLGRVTCFNDMLDMIFKPIFDHTNNSDNNPDFHYFITNICSLDLVISENDDYLW
FT                   KEFSDINQTPAEWVAQGDNPPVAYYMYYIYQRLGHFNYMMNRRSEPCITLRCYCSDLDN
FT                   RSSQFTDRYITDQTESLICNLLLCNGGLMNAEYIWSAPALLTYLFYLLQVPVIIAPLSS
FT                   VTMPSMQLERQGRKYKSDLSSLTGFCQGEITKRDITVSDDHSYGSNPFMRMFKLGMKTS
FT                   LSSNSVLFNSSYTMEPMIEEYSVAASIYLLNAADLCELARNSVIACGYEGWYKAHWSGI
FT                   SVRPDKYFKENVGGVDVWYDTAEDTSIKHNVPMIRRQYRRDTLDQEWDFLEELFN"
FT   tRNA            269346..269417
FT                   /gene_name="tRNA Cys (GCA)"
FT   CDS_pept        complement(269645..271477)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447797"
FT                   /locus_tag="CAGL0H02937g"
FT                   /product="Similar to uniprot|P40362 Saccharomyces
FT                   cerevisiae YJL069c"
FT                   /protein_id="CAG59854.1"
FT                   /db_xref="HOGENOM:HBG330582"
FT                   /db_xref="HOGENOM:HBG353816"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6686"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS73"
FT                   /transl_table=1
FT                   /translation="MSKSAVDMKQVPPPDEEEELLAKLVFGDTTDFHSGLADFDTEFAL
FT                   NEEKKLNEEDNIADGESSSGSGEDEEGDAMEQLADDQLFYVDDGEGDGEEMDVDDNGDS
FT                   ASDNDEGMTSDEEEEQAWVDSDDEKLSVPITSNNRTKKLRQNYQDSHISGADYVRRLRA
FT                   QFEKIYPRPQWADSISDSEGDLSDGDYDSNSEQLNSVINGDVNALSKILESTFTYRDNI
FT                   TTKLLPEKSLDILRLKDANASHASHSAIQSLSFHPSKPLLLSGGYDRTLRLYHIDGKSN
FT                   PLVTSVYLKGTPVQTCCFYVSHNNTSSKLPQEQKIYTGGRRRYMHSWDLSASFNNARSE
FT                   KAASVAKIDKFSRMYGHEETQRSFEKFKVGYLYNFTTNSSQGIVVLQGGSGWINIIDAN
FT                   SGVWITGCKIEGNLVDFCIDYQPISKGRFQTILIVTNTYGEIWEFNLSKNNEIIRRWKD
FT                   NGGIGITTIQVGGGTSSDHLLPMSSRKIRQNRWLAIGSESGFVNVYDRSAIRSNADLKN
FT                   AAISPIATLDQLTTSISSLNFSPDGQILCMSSRAIKDALRLVHLPSGKVFSNWPTSGTP
FT                   LGKVTSVAISSNGEMLAVGNEQGKIRLWRLNFYQ"
FT   CDS_pept        277540..278319
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503612"
FT                   /locus_tag="CAGL0H02959g"
FT                   /product="Similarities with uniprot|P53147 Saccharomyces
FT                   cerevisiae YGL096w TOS8"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG59855.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124811"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI00003B6687"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS72"
FT                   /transl_table=1
FT                   /translation="MESVQTTLPSIRSIIDSLSKDTETTGGRGVYDSNPRNVNYTDYNR
FT                   QQNRLNLLDYQSLKDVPVKSSYSWGALPHEFKVTKPYHRSGKVNLVIRREESQPLSPPY
FT                   SPNGSIGLSAAIPMKLCSSTSSSVSTTSTTTLTSVNSPPSSVSSSPSASSPEVGQGAVK
FT                   KRANLPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRKVFA
FT                   DYYDITNQKRIVSAGVVKKQLPDASKRRTAMDRVHSS"
FT   tRNA            279537..279608
FT                   /gene_name="tRNA Glu (TTC)"
FT   CDS_pept        complement(279887..281656)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447798"
FT                   /locus_tag="CAGL0H03003g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="CAG59856.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG028551"
FT                   /db_xref="HOGENOM:HBG559243"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI00003B6688"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS71"
FT                   /transl_table=1
FT                   /translation="MNLFDVGHFYIDRMVNSKSKGGVADITERSRIKALLLDKNTKSTI
FT                   SMCATQSELLHNEIFLIDTLENENRDPERHLRCIVYVKPTNDSIEFLSRELRDPKYGDY
FT                   HIYFSNSVSKAQLEKLAESDDMEAVSKVEEIFQDYFILNEDLFSFDINPAELTINNSNV
FT                   WGETSLTNCKDSLVSLLLSLKLKPDIRYEVNSKRCTKLANELAKIIEQNEKTLFHFPNM
FT                   DTPPLLVLLDRESDPLTPLLQPWTYQSMINEYVGLKRNVVDLSGMPGIDQDLQKVTLSS
FT                   MQDRFFYETMYMNFGELGDQVKNYVDSYKLKSQSTSQINTIEDIKNFIEKYPEFRKLSG
FT                   NVSKHMSIVGELDRQLKELNIWEISEIEQNLSVHRDNTEDFQGLQDMLRNQKINNYYKV
FT                   KLVCIYITKHFDLKDRINVLIKTISETVSPQEINFLHRFQKIIEEYNNHLNSSANSAEG
FT                   EGKRDDLLSELAKKFNTRMASKGFLNNTQKSNNNVYMQHIPEISTILSNISKSTLSKER
FT                   YGFIGNNGVNSRLVDNNSARDVVIFVVGGVTYEEARFVHQFNETMKNKMRVILGGTSVL
FT                   STRDFMDSMRNKV"
FT   CDS_pept        complement(282101..285382)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000230585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047104"
FT                   /gene_name="PAN2"
FT                   /locus_tag="CAGL0H03025g"
FT                   /product="PAB-dependent poly(A)-specific ribonuclease
FT                   subunit PAN2"
FT                   /EC_number="3.1.13.4"
FT                   /function="nucleic acid binding"
FT                   /function="poly(A)-specific ribonuclease activity "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59857.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0004535"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG059316"
FT                   /db_xref="HOGENOM:HBG735259"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6689"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS70"
FT                   /transl_table=1
FT                   /translation="MNNWQHSFNNARPLDEHLHKPYLQYDGIEKHLTKFIFDDHANLVW
FT                   TGDTYGCVSSYDVNFQPYVRQRAHIGGSPVKDLMSHSSGVLSLSSDSLHLQDRRGTTLL
FT                   NLTNIDIAAFNDLQTMCYMSADQTSKVYCAGTDIGTGLSLIDLQRGTLETNIPYFSKVN
FT                   FIKSSKKLAAIGKLSGSIDLFDPGSNQVIKSFISHSSCITSMDIQDYTLVTTGQSNGFY
FT                   NTFADPFVNVYDLRTMRQLPPISFSKSTSMGTVGADFVQLHPVLPTIVMIASSSGAFDF
FT                   VDMANPSLRTQFANPGNGIKCIRLSSNGDHLGVLESNDMFSTWKRPNSSVNFTNMPELL
FT                   TYPSYPNDGPLANISIDDYNYPLSTVGMPYYQEKLLSTWSTVIFRSPGTVPRDIDKILT
FT                   DLKNSKKSKKLVADGVNFYPYSVAKYGHKDALQPYISLRDKRYQRSTGSVPDDVLITKS
FT                   VDGELPPAFKNLPLVVTKYATDSFDFESVNKTPYCGLDNDVDNPFTNALIQLYRFIPEI
FT                   SNFLISTLKHEHFESPLLTDMAYLFDMMRNTIDGICRTTNYQMSLNDVLEKNNLSLHTI
FT                   SESNMLQKINSLSLNDDGGKKQLSIQELNDFLLSELCEEEVKFIDQNFVLQHCYCCEFA
FT                   VKTKGCMTYGQTSGSLYKPSITIGPNACTQKNGKVSYPHSILGYIEHGLKNSIVLNKKC
FT                   EQCGIKENLEEDISIQELPPILSLSLEFDDNAMKLAKTTKNWLPKEFYASIMKNKPLVR
FT                   GSVNDIRTNTMIYKYELHGYIARISDPDRGDHYVTFSRIYNEESKMFRWYLFNDYLVTE
FT                   VDESIVYDLGKHWLKPEVVIYGDAEELRKPFNYLKDVEIDDSILYKDYFSAAIRESIQK
FT                   EYELLTRNEAPRPGSLIAIDAEFVTLKNEKYDIDCRGAKTVVQSKVSALARISVVRGNE
FT                   EQFGVPFIDDYIIIEKNIDDYLTKFSGILPGDLDPKTSNKHLVPRNVAYRKIWLLMQLG
FT                   CTFIGHGLQNDFKHINISVPKEQIRDTAVYFLQGKRYLSLRYLAYVLLDINVQEGNHDS
FT                   IEDAYTALVLYKKYLELKSNGMMDQVLNKLYEEGRTTNYKVPLKL"
FT   CDS_pept        285868..288093
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351377"
FT                   /locus_tag="CAGL0H03047g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59858.1"
FT                   /db_xref="HOGENOM:HBG124812"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="UniParc:UPI00003B668A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS69"
FT                   /transl_table=1
FT                   /translation="MKKSILKGSPTKIIRSEAETPDHNEGNESNKSNILQSQITQRVSF
FT                   LPDVTLHSFDISPTKNMATSTQKPAYENDGNASMDLTEPISLEVQAGASTTEPKEETME
FT                   FTAPQNINNVENTLTAQLHSERTRKSQSELDLSTDIISQAMEMTQVLPNETNNLRKANN
FT                   DANDAENEDGMEFTQIVPNIHEYSVKRRRLNDDTIEKLVSPATPPDNTSEQQIYGSDSE
FT                   IIEKMSPIKIIYATEQRPASVPKQLFDDKEPNLQSPHKSENHENEKTITHSFSLKNFLS
FT                   DIDYRLLENIKDIFKQKNTAITLNTLDYSIQQNLRLGQVNSVYHIDVPTWEIKTFIINE
FT                   LRARINQSKSMDVLENDISKTLNINSIALKYTSQSEAGIDTSLKTILAVKEFSEMETQR
FT                   DWYEWRLKQLDGFREVLTDNLEILNEEYTNVKLELQKVKELKLKISDLKDTLQREIRIL
FT                   TEVSYEKQKNGPSLDDKIKFAKIKKTLLHHQIEVNKHDEIQRKRQQLEDDINSKTKQLI
FT                   EINQSISKVTSKRKTINPMDIKKERTLLANFNLLQALSNIGCIRNSNDIIVLEFKLLGG
FT                   MKILIDNSIISANEPSGITLSPEFQREPLFRYLFEEIMKEIQVKVKQNKKGNLFEMLIS
FT                   KVIDYIPIYNSFHLFSLIFNVKYEMENEVSKNLKISDIDYYSNANISYTIPINDILKCC
FT                   RNNNSILSIKVRSESKISHDRVIKRITEKGSRIFPWLNNTNINLEIL"
FT   CDS_pept        288746..292597
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198202"
FT                   /gene_name="NUP145"
FT                   /locus_tag="CAGL0H03069g"
FT                   /product="NUP145"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAG59859.1"
FT                   /db_xref="EMBL:AAO25607.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG059312"
FT                   /db_xref="HOGENOM:HBG204295"
FT                   /db_xref="HSSP:1KO6"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="UniParc:UPI0000005C89"
FT                   /db_xref="UniProtKB/TrEMBL:Q874M1"
FT                   /transl_table=1
FT                   /translation="MFGKPSGAAFNFGNTSTPTNTPASSTTNPLGQSNPLNNNSINIGT
FT                   STPSPSVGLFSNSSNNQQNGGLFGRTANGQQSSGLFGNNASAQQNSNLFGNSSSTQQNG
FT                   GLFGNTNSTQQSGGLFGNKPQQQTGGLFGTSTAATNNVANSGLFGSSNTYKTQTTGSLF
FT                   DNKQGSLNIANSGTGLGLGNKTAGLFGNSSNTNNTSGLFGNNQPSGLFGNSSTSNNILM
FT                   NKPITNNLGANGQPQNNGILPTSNPYGFTMSSNTTPLTTMPEPLTGTLIKENSINTEKG
FT                   ASNNKRSASMSSAAPKNTSSYGQSTLISKLSSRLSSGQASKAIQGVFSPSSVKPWLGEQ
FT                   TSKPNRPTDLKDNILGLTVIQNNSNKKIRDISNQRENLSELRKLKIDSSRSASKKLKLL
FT                   SGGSHVTKSQNLDMTEGARKQNPSADTARNDFSPSSELKSYSIPKMPLNDENVNKNNSD
FT                   YWCTPSPEQLRLLTSDQLSSVSNFVIGRRNHGYITYSMPVDLRKFSDNFEINLFDNIVK
FT                   FRSSKTVEVYPKNTEKPPVGYGINVPAVITLENVYPIDRKTKKYITDSSRLTEFQKFAQ
FT                   KLRSLRDMEFISYNPFGGVWTFKVQHFSIWGLVNESDAEIDEDDDMEDILDINKLSPQS
FT                   NESQLNVSAINTGNLIDEKVYEPDIEEEDFEGLEQNEILDVAKNWDEQLRLANQGRRSI
FT                   FLLPTDRAENELDLLLSNFNDAKNKTREIEQERRLNTKKYNPCSFGNGHLVIGDNRSRK
FT                   ILITNQVLVKDELPAVLTDRTIFDNELKTTLIHSRSSNNYPCVFKKELIFKDVLQCILP
FT                   TSESYKLWNFSSILFDPIQIDCPMEAKDATLKYKRRDNICNWIKDHVRDNVYQKIKVST
FT                   TPLEKIFLHLLINEIETAAKIAIDSDNSHLSILISMLGSNDPRLKALAHTQIEQWSGIG
FT                   SNVEIYVAKIYKLLSGELFKGPFSLIENAEDVNWLVLVGAALHYGEVDELSLEDLIGNS
FT                   MACLSDHCSGVFYLLLKLFCSTRNADQVLQEILKESNALGIDFLWHCLQALESNGIADI
FT                   NNPFCDQITVQYAQNLELSGHIPEALYICAHIKDDHLAKKLFESIIFSNIHHLTLDGKP
FT                   LAIMSKLMVPNEVIYRSMAQYAKYRKCHQEELEYLLKSKDTRLAKEVFITKVAPSYILG
FT                   NDDSKLLSLTSMLEQFDRNSTQRNDLKVYDYYIQFKKNSENSNIIKSLASELPQFYSKH
FT                   QMFENVTACCNIISNNVLSAVLDLDNDSKTKEFSNLVCNMPLGQPERKYATLHFCSRT"
FT   CDS_pept        complement(292976..293980)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198203"
FT                   /gene_name="NBP35"
FT                   /locus_tag="CAGL0H03091g"
FT                   /product="Cytosolic Fe-S cluster assembly factor NBP35 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59860.1"
FT                   /db_xref="EMBL:AAO25609.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG411641"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI0000005C88"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q874M2"
FT                   /transl_table=1
FT                   /translation="MSTEVISTSVVSEPTQEILPAEYSLDAPEPEHCPGPESEMAGKAD
FT                   ACQTCENKDICESLPKGPDPDIPLITENLSGIKHKILVLSGKGGVGKSTFTTMLSWALS
FT                   ADDNLQVGAMDLDICGPSLPHMLGCTDEVVHESNTGWTPVYVAENLAAMSIQFMLPEDD
FT                   SAVIWRGNKKNLLIKKFLKDVVWDDLDYLVVDTPPGTSDEHISINKYMKESGIDGALVV
FT                   TTPQEVALLDVRKEIDFCRKAGINILGLVENMSGFVCPNCKGESQIFKPTTGGGEALCK
FT                   ELGIKFLGSVPLDPRIGRCSDEGESFLDEFPDSPATLAVLNVVEELRDAVGDV"
FT   CDS_pept        294578..295441
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351378"
FT                   /locus_tag="CAGL0H03113g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59861.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG124813"
FT                   /db_xref="InterPro:IPR014751"
FT                   /db_xref="InterPro:IPR015381"
FT                   /db_xref="UniParc:UPI00003B668B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS66"
FT                   /transl_table=1
FT                   /translation="MKGRIDPLYSHIEYISGNSSGLASNSGQLTMFQKTGEISRSIAVL
FT                   TVNEAKESEIDLFQVSKQLYCNLVKSNEDVKALNERIFQLEMNYDNLQSDFDEMVDNIK
FT                   RRDKLSRDVMIGLLNEKKARIRILTSLMERAGVSLPDGDKSDSELLNSHVQDAVSELNS
FT                   PGKRRVAAWRDKKSIKRLEPVKKKLKIKEEESLPEIGSDFEDFEFFGISKSPEKKHHLT
FT                   TENHSGESSTSKDNSVAGGDTESDTSIKQETTNKVNTLALTNDVVAANSSEEETDTDIS
FT                   TEKLTP"
FT   CDS_pept        complement(295680..296159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000926" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351379"
FT                   /gene_name="MFalpha2"
FT                   /locus_tag="CAGL0H03135g"
FT                   /product="Mating pheromone alpha2 "
FT                   /function="mating pheromone activity"
FT                   /biological_process="mating"
FT                   /biological_process="pheromone-dependent signal
FT                   transduction involved in conjugation with cellular fusion "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAG59862.1"
FT                   /db_xref="EMBL:AAO25610.1"
FT                   /db_xref="GO:0000750"
FT                   /db_xref="GO:0000772"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007618"
FT                   /db_xref="HOGENOM:HBG192181"
FT                   /db_xref="HOGENOM:HBG204297"
FT                   /db_xref="InterPro:IPR008675"
FT                   /db_xref="InterPro:IPR016326"
FT                   /db_xref="UniParc:UPI0000005C86"
FT                   /db_xref="UniProtKB/TrEMBL:Q874M4"
FT                   /transl_table=1
FT                   /translation="MRFLRFISTVALLITGLATAQPVGEELGETVEVPSEAFIGYLDFG
FT                   ATNDVAILPISNKTNNGLLFVNTTLYNQATKGEKLSDFTKRDANPDAEAEAWHWVKIRK
FT                   GQGLFRRSADASPEAEAWHWVRLRKGQGLFRRSADASPEAEAWHWVRLRKGQGLF"
FT   CDS_pept        join(complement(297881..297891),complement(297272..297680))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000036561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503613"
FT                   /locus_tag="CAGL0H03157g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG59863.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B668C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS64"
FT                   /transl_table=1
FT                   /translation="MSKVPRSFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTI
FT                   LGPPHSNHENRIYSVSIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLKDW
FT                   KRLYNMETILLDLRKEMASPANKKLVQPEEGSTFK"
FT   CDS_pept        298166..300139
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198204"
FT                   /gene_name="MAD1"
FT                   /locus_tag="CAGL0H03179g"
FT                   /product="Spindle assembly checkpoint component MAD1 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59864.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059309"
FT                   /db_xref="HOGENOM:HBG204298"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniParc:UPI00003B668D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS63"
FT                   /transl_table=1
FT                   /translation="MNNSGSGGSSPFVESPDLVSDGHLHTERKDTPIDVDNWKYKYDNL
FT                   LNQYEIEKVRWQKEQYDSEKSHEALHLQLEKARNEIDQLVESKRFLEAQLQSQHPQNTQ
FT                   KEWSHEDNKVNNNSMNNDYMLLEEKYKSDVFHLDNSVNELKLELTSCRSLLKKYEEVIE
FT                   QQSEQIKEIKKTLKKKEQELDEIEVNRLKQAHNATNTEEIRQQTNENASFSNGYNTLMS
FT                   MKNSVNYWKNENQQLNQKLSEYSDIYQQLQEAQLEIMELKANLEEWNKFLSNKKQQDNS
FT                   NDYSIDHFIIEFESQRRELNMVTEELAEVKKSYYNSKILNDELALERNQLLKLKDDYEN
FT                   NIINLEKLNHELEQQKVLLEEECSLLKNQIPTKENLNQQIRSTNRNDAEYDSLLDNYKQ
FT                   ETENLTNELKRLNDSLIEQNRNQGTEMKKRKLRNGDHININYSQRLNELQQNNLSLEKD
FT                   NEKLRLVVEKLEGKLDDLRKTKPKNIRILQQRDSPLLKLQFVRRKENELLREENQNLLT
FT                   MIENITENRNESFDKIPLTSYNSLKYQYEISMDTNKKQEKKFSRLKQIFNKKSLEFIDV
FT                   VNSLLGFKLEFQQDGRVKIYSCYMPNKYLIANLVDNTLKSNLDTVISDWDSLLNDWVVE
FT                   KGQLPCFLASLTLQLWKMENDS"
FT   CDS_pept        300358..301131
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351380"
FT                   /locus_tag="CAGL0H03201g"
FT                   /product="Similar to uniprot|P53153 Saccharomyces
FT                   cerevisiae YGL085w"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG59865.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG059308"
FT                   /db_xref="HOGENOM:HBG329968"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI00003B668E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS62"
FT                   /transl_table=1
FT                   /translation="MTNRSQDKHILVNRDALIDGTIVSVLVTGSAITLYKGYTCYLKQL
FT                   TNASQIPTKVFRRKWLYGKVTSVGDGDNFHFFHMPGGVLGGWGWIRAVPKLTKNEKKTA
FT                   SLSFHWGTNKLKQQNATYKNKRNLPTISVRACGIDAPECAHFGNPAQPYSEDALIWLRH
FT                   RILGKKLWIKPLKTDQYGRCVASIRIWTWLGYSDICLEMIKEGLAVVYEGKTGAEFDGR
FT                   EGKYRRHEFIARAKKKGLWSQKRLQTPGEYKKRYQ"
FT   CDS_pept        complement(301252..302976)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047105"
FT                   /locus_tag="CAGL0H03223g"
FT                   /product="Similar to uniprot|P53154 Saccharomyces
FT                   cerevisiae YGL084c GUP1"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59866.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG326114"
FT                   /db_xref="HOGENOM:HBG356915"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI00003B668F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS61"
FT                   /transl_table=1
FT                   /translation="MVLEKILPLVDVEHLDSRVLPRPVKGNKKSETTKTNTIIQNAGPS
FT                   RWGSMEFKFYYLMFVIVVPNMIWAGYRTSSEHNINYYKYQDLLSSGWLFGRKVDNSDAQ
FT                   YRFFREHLIELAALLVLHTTIKRIVLALCPISKIRFDTIFGVLFLYGAYGVNSIRVLAH
FT                   VYIMFSIAHIFKNSKRLAILFTWVYGIGSLFINDKYYAYAFSNFSPSLRFLDEHSKGLI
FT                   PRWDVFYNFLLLRMISYNIDFLNRYNTTTSKSKEENIESKKENEMKEVLLYDDKARMNV
FT                   ILPVNDYNPLNHIAYITYAPLFIAGPIITYNDYIFQSRNKLPSLTKNFILWYAARFLCT
FT                   LFLMELVLHFFYVVAISKRKAWEGDSPFEIAMIGLINLNIIWFKLAIPWRFFRLWGLLD
FT                   GIDTPENMIRCVYNNYSALAFWRAWHRSYNKWVIRYIYIPLGGSKSRIVTSLAVFSFVA
FT                   IWHDIELRLLLWGWIVVLFLLPEMFATQYFVQYSKKWWYRHICALGGALNIYLMMIANL
FT                   FGFCLGSDGMKKLLADMFGTCNGLTFLLLSFGSLFIGVQLMFEIREEEKRKGIDLKC"
FT   CDS_pept        303335..305686
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141821" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047106"
FT                   /locus_tag="CAGL0H03245g"
FT                   /product="Similar to uniprot|P53009 Saccharomyces
FT                   cerevisiae YGL083w SCY1"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59867.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059307"
FT                   /db_xref="HOGENOM:HBG204299"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6690"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS60"
FT                   /transl_table=1
FT                   /translation="MVFWSSKSGINSKYTFSSSPTFTSDPWSVYTGRPKSSSALGRVSL
FT                   FQFDKKQFENYLLNYGIIKSKSSSQDKMLIQEAYQILKNQVNNLTKLKHPNILTVVEPI
FT                   EEHSKTFLFVTEYVTDCLESLYNNDSTNYGRFSDSGENILSSNGASLPDNILIQRGILQ
FT                   IVNALEFIHTRAGSVHLDLQPRSIFINENSDWKVSGLGHLVKLGDNLQGGMSTDFFLPK
FT                   YDPRIPSFMHINFDYSAPELIMDNTVSFKNDFFSLGLLIYFLYSGKSLLHIENSESQYK
FT                   LEYNKFERKISTMSWDNVFSKVPPQLRVLIPKLMSRDIISRYDTLGDLLDSEFFDNPLL
FT                   KMLNFLDDLPTKNNSEKLVFLKGLDEYLDQFPSSLLQKKFLPILLDLLIQLCQDKELDG
FT                   ECISHDISLIIKIASNLSQLSFHEKLYPIIVGNKENFNILLEKSNTILIENMKILQEKF
FT                   KAADYDQNFLRPLLVYVLQTMQSESAVNSQEMLLNQLDLVLKTFDFPTVKNFLLPLIAK
FT                   LFVKTTSLTIKNSCVTSFQILIEKKSIDSYTVTEDLLPLFKTMKTRDPRILMKCLSLFK
FT                   LVPSLVKDEVILVEQYLPLLWNYSMASTLNKSQFTEFTKVVNKISADIQSIHINKLKEG
FT                   SNENYEHDNSDKNKAFTKIIEAQSQPKREDRDTTLAKSIATPAIQPRRKETPPKPSILD
FT                   KRPITCSIPARRTNPSYNKSIPTASITSPPNDSQPQQSLDDEFDDFVSAATTPKPHSIN
FT                   NNTSPVVTPSAPGLTSLPPGFSIPLQPKKN"
FT   CDS_pept        306150..308477
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351381"
FT                   /locus_tag="CAGL0H03267g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="translation"
FT                   /protein_id="CAG59868.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG124815"
FT                   /db_xref="HOGENOM:HBG204043"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS59"
FT                   /transl_table=1
FT                   /translation="MPESSETPIPDSNESVVNDVSHQTSVIEENSVNEHELENAMNQTE
FT                   DKQDEHRSNLEEYQSINQGENVHNKEGDSDEDENKDEDGDEDEDEDEEALARDLYSDDQ
FT                   TIGNNGSSATTGNNEDQTVKEQDNENETSQEQYLQPSSEDEEELKNDDDDVVNNEPTVL
FT                   EDNLENTEFDGDHVNEQGTEDQNSSESKSTSNENETSGDVEQQQPANANIVAQILSESF
FT                   EKENVDANLIEKQVKFIEDSHLLEKTQFQKLTDTEKITVVLKLLNSNTETKFQATNKKA
FT                   NAVVDSNGLRLFPKPDITKPMTPEESVRYNDYLKGENKITEMHSIPPKSRLFIGNLPLK
FT                   NVSKQDLFRLFSPFGHILQINIKNAFGFIQYDNPKSVRAAIECESQEINFGKKLILEVS
FT                   SSNNRPQYDHGDHGTNSSSTFISTSKRPFQHEDEEPVDMYAENNNAHKKPKRRTPSCVI
FT                   FVKRTADRNYANEVFNKFNNMTGLETDMVFLKPRLELRKLVNDAAYEGVWGVILVNKTR
FT                   NLDVQTFHPGPRGETKFDEYVSVSADDAAAIFNNLKVIKNRSGGMPPLAGPQSGYPQQS
FT                   VPNMMPQPQQGYYGNYNYGQQPKPQQQANFYPQMPTQNTSYGQPGMAPAVQGYGAPTSQ
FT                   PPMNMGGGSYSRYDNSSMQQPMSNNQPMNQQQLLAAIQNLPPNVVSNLLSMAQQQQQQP
FT                   DSQQQILNMIQSMQTPQQNQQQQQQQQQPVNMPPQNSFGGNVQPSNQPTNPVSPSAAAN
FT                   QQDQQPANNVQSLLDSLTQLQK"
FT   CDS_pept        309091..310248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047107"
FT                   /locus_tag="CAGL0H03289g"
FT                   /product="Similar to uniprot|P53155 Saccharomyces
FT                   cerevisiae YGL082w"
FT                   /protein_id="CAG59869.1"
FT                   /db_xref="HOGENOM:HBG204300"
FT                   /db_xref="HOGENOM:HBG494130"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniParc:UPI00003B6692"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS58"
FT                   /transl_table=1
FT                   /translation="MDDYYSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHNR
FT                   VTSQLKSIFDNCNEIAVEDLLDELANIGLQLGVMSNYGQDKEQLIATLKEFRKGLHINP
FT                   KFNGSFTDSLETSVFSGFNVALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAYEIR
FT                   KDQNGVALNTNAQQVLDDSAYIKSFLARSATQLTEYGLQHLKEILVEKSFAVLFRNDRY
FT                   FTLYKNAGELFILVTNPSQSRNNNIVWQSLHSVNGARDLYYNGVFVEINPDNDQNTFDD
FT                   VVVPQSNPFSDPQTNQEFQNIDRNDTFDAQQVEDDELLARQLQEEEDRQAAGLMQNAYR
FT                   RNGPRNKYQIDDESKKKKKRNSIIPKMPSLGKKKKDGKDKNCIIM"
FT   CDS_pept        310699..311430
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351382"
FT                   /locus_tag="CAGL0H03311g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59870.1"
FT                   /db_xref="HOGENOM:HBG124816"
FT                   /db_xref="UniParc:UPI00003B6693"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS57"
FT                   /transl_table=1
FT                   /translation="MPSVIGIIRFQINKGGKKQKVALVGRSSKSRLVKFNGNNIPKICI
FT                   DDPLISSLHALISAKLQTRKTNITQLDIIIKTISHSAILVDTISHRIVPKLVIRDGERF
FT                   GLIPGPASNNQIEPKYMVQIHIILVDNEYGIYELQLFDVSSGIFSPIQLGIAAIKGLEH
FT                   HYDSSPNAYLYQKQTARLATKKMTKHVQKRIIKLRHQKNRNLLNKQMKHMFVGTLVGTI
FT                   LGSCGVLGLIAYFGDEIESFL"
FT   CDS_pept        312090..312488
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503614"
FT                   /locus_tag="CAGL0H03333g"
FT                   /product="Similar to uniprot|P53158 Saccharomyces
FT                   cerevisiae YGL079w"
FT                   /protein_id="CAG59871.1"
FT                   /db_xref="HOGENOM:HBG335382"
FT                   /db_xref="HOGENOM:HBG627499"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI00003B6694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS56"
FT                   /transl_table=1
FT                   /translation="MSQPVQRAATRSIIQKYINKETLKYVFTTHFWGPVSNFGIPIAAL
FT                   YDLKKDPTLISGPMTLALVAYSGVFMKYALAVTPKNYLLFACHFINESAQLGQGYRFID
FT                   FNYFKSDEEKNKIIEEYKVKAEQANEKK"
FT   CDS_pept        312934..313545
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447799"
FT                   /locus_tag="CAGL0H03355g"
FT                   /product="Similar to uniprot|P53158 Saccharomyces
FT                   cerevisiae YGL079w"
FT                   /protein_id="CAG59872.1"
FT                   /db_xref="HOGENOM:HBG059301"
FT                   /db_xref="HOGENOM:HBG104221"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="UniParc:UPI00003B6695"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS55"
FT                   /transl_table=1
FT                   /translation="MSDEIEDRPRTRSRTPSVDTQSYTINEEAHHIITDSDSSSSENED
FT                   GEGNETNSSDDSSESGSVERFLDEIVPTTSTSFIPNDTPDPATLFDITEYIFDSIVQST
FT                   NACDFSEAFALQAKTSAVINSKSMELKNLIEQTKVRLPELQAKFKNGTQTLRTIRKNLD
FT                   NAKSRIQVMNDVLQTDYPIEFNQARDKILERTLDSDEEVI"
FT   CDS_pept        complement(313755..315377)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447800"
FT                   /gene_name="DBP3"
FT                   /locus_tag="CAGL0H03377g"
FT                   /product="ATP-dependent RNA helicase DBP3 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG59873.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS54"
FT                   /transl_table=1
FT                   /translation="MTVEESKKRKLTDDVAIKQNEKKIKKDKKVKDKKDKKDKKDKKDK
FT                   KEKKEKKEKKEKNDKKDKKDKKDKKAEQVDKLSETTEQPSKQVKIGAYVENEELSKQPQ
FT                   SVIDEFFKENEVSVEDPSKLNLRPLLAFNQISLDKEVQNEIAKFPKPTPIQAVSWPYLL
FT                   SGKDVIGVAETGSGKTFAFGVPAINNLLTSSSKPKGIKVLVISPTRELASQIYDNLVLL
FT                   TQKVGIDCCVVYGGVPKDDQRRQIAKSNVVVATPGRLLDLIEEGSVDLSPVDYMVLDEA
FT                   DRMLEKGFEEDIKRIIGQTKSKDRQTLMFTATWPKEVRELASTFMKEPVKVSIGNRDEL
FT                   SANKRITQIVEVVDPRSKERKLLDLLKKYQSGPKKNDKVLIFALYKKEASRVERNLNYN
FT                   GYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVE
FT                   DYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDLIKFGTHTKRKE
FT                   HGAYGAFFKDIDMSKKPKKITFD"
FT   CDS_pept        complement(316110..317780)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447801"
FT                   /locus_tag="CAGL0H03399g"
FT                   /product="Similar to uniprot|P19807 Saccharomyces
FT                   cerevisiae YGL077c HNM1 choline permease "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59874.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004756"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6697"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS53"
FT                   /transl_table=1
FT                   /translation="MSPRDIERTSITSQQDSILDGQFEAKNGKKIIEQEQSIDGEVHLR
FT                   KSFSLWSILGVGFGLTNSWFGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLGEL
FT                   SSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAGSLFTSASTTLSAATELVGMYVL
FT                   THPEFTPKRWHIFVCFELLHLFLMLFNCYGKSLPLISASSLYISLTSFFVITVTVLACS
FT                   SGKFNDAKFVFATFYNETGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIP
FT                   IAIMGTIAIGFLTSFCYVIAMFFSIRDLDALLASNTGAPILNIYEQATNSKAGAIVLGC
FT                   LVLITSFGCIIACHTWQARLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHLMSSALIAL
FT                   IGVLYLASTTAFNSLITGCIAFLLLSYIIPVICLLMRKRQIRQGPFWLGKFGLFSNIVL
FT                   LGWTLFAIVFFSFPPVLPVSKDNMNYVSVVIVGYTVYAIAYWEFKGKKEFHAVEEEESE
FT                   DDIDVNESNIEIINDYHDSNSVNNIIHHHYDKVGLDTKH"
FT   ncRNA           complement(318361..318419)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snoMe28S-Am982"
FT                   /db_xref="Rfam:RF00535"
FT   ncRNA           complement(318912..318995)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR39"
FT                   /db_xref="Rfam:RF01197"
FT   CDS_pept        complement(319316..320386)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447802"
FT                   /locus_tag="CAGL0H03421g"
FT                   /product="Similar to uniprot|P53159 Saccharomyces
FT                   cerevisiae YGL075c MPS2"
FT                   /protein_id="CAG59875.1"
FT                   /db_xref="HOGENOM:HBG124817"
FT                   /db_xref="UniParc:UPI00003B6698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS52"
FT                   /transl_table=1
FT                   /translation="MSEVDVPELLFERVWLQVDRDRDGFIYAKQMPSFITQCEQVIKDT
FT                   VNTNKTDFHMTRFKNRLKLPLLPKLHMDLIDAFAKETPYYKIYKESFSDMLNKLTGNNF
FT                   STVINKIFEDCDGFPASFISALEVKADVKSSPRSKADSLGSPIKVDLLRNLKPQEEPET
FT                   PRRINRKYKSLELQLESMKRELEDKEKTIMNNERNLTELRSTISKLKEKYDLLSEEYEQ
FT                   RHIHGGNNGTAIKHDVVIGELKSRLQEQNRLIRILQEQIQFDPQLKRETRVHDNKSKNN
FT                   TFNGAIAYVIPFLLFIFVIRSLITKEDIGDATMALPWWERNNLASRLAWYFRDVFSNDS
FT                   AKFLESDAYDKVFGIH"
FT   CDS_pept        320888..323008
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503615"
FT                   /locus_tag="CAGL0H03443g"
FT                   /product="Similar to uniprot|P10961 Saccharomyces
FT                   cerevisiae YGL073w HSF1"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59876.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124818"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B6699"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS51"
FT                   /transl_table=1
FT                   /translation="MSEHNNENLNLHEGLNLDDDDLENMLKNPNLFTTSPGIDVESIPS
FT                   ATNQNSVNGQDDKSGIKSQNSDTNEVIEDIVNPSIDPYVSTPHNDEMASPEDDIDSINN
FT                   KDSNKLMTSLVRQNYGPHLGRDNADINSSNFRSHYQNLFDDNYLKTDMGSPVNKNKRKR
FT                   EDDDDDQLYSSQILRGPLSPGGNAHKVDNRLMSYGSNNLNSRQQTPGMENTPSVLNRRF
FT                   QNKTRPAFVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASF
FT                   VRQLNMYGWHKVQDVKSGSIQSSSDDRWQFENEFFVRGREDLLNRIVRQKGTSANATPG
FT                   TQSNMKYGNGNQIRGLPNVNGQTLRLMNEANMGNTMDITAVLGELEQIKFNQMAISKDL
FT                   MRINKDNELLWKENMIARERHRTQQQALEKIFRFLRNVVPHADQKLLMDVAEPVSSRIE
FT                   EAQDISDAPSVSSKSFDFDDGKEDRSRYIPLQDEDGKRPLYLLKNRTMSENSNKSSGGR
FT                   LASTHNDSSGRISEIPFEEDDLSPPRHEVTDVGHISGQKNVAIDKLKADLHEQEARIKY
FT                   LEDMVENKTLDSHLNDSMTMPMMPSPSTMLMHDMVEPSTIALGKEATDTSEGKHHGHDQ
FT                   QGQVQGQDQVQGQDQMHSQDQQNDMSAIGGLSELSPGLSPGLSSGLSPGFDIGDYLNSS
FT                   QNHMTPMYEDKK"
FT   CDS_pept        323129..323524
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047108"
FT                   /locus_tag="CAGL0H03465g"
FT                   /product="Similarity possibly noncoding "
FT                   /protein_id="CAG59877.1"
FT                   /db_xref="HOGENOM:HBG124819"
FT                   /db_xref="UniParc:UPI00003B669A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS50"
FT                   /transl_table=1
FT                   /translation="MSCRCPSTLENQLLWHNFKLIGRPSHRLYLLPLLCVCLSLLLHPS
FT                   YGPSFPACEQGRKKARKKKFRALVNCSLSLGQADNAIYIEHIDLILEKYSGAGTYTLKL
FT                   LPPERREFVLFLSEERFVGYSASASYL"
FT   CDS_pept        324020..325627
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447803"
FT                   /locus_tag="CAGL0H03487g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59878.1"
FT                   /db_xref="HOGENOM:HBG124820"
FT                   /db_xref="InterPro:IPR014842"
FT                   /db_xref="UniParc:UPI00003B669B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS49"
FT                   /transl_table=1
FT                   /translation="MDSNQLIHLDSVPNFKDKNEIKPWLQKIFYPQGIEIVIERSDSLK
FT                   VVFKCKAAKRGRKSQEELTEEERLRQEALAREHEMKRKSMGNKRCVSRYNHCPFRVRAT
FT                   YSLKRKKWSVVVLNNTHTHPLKFNPLSEEYKKFKEKLRADNDVDAIKMFDELEYRTQHN
FT                   LPLPTSIIPCDCGLTNEVKSFDVVLPKTMVPDELSVKASEISLKKVLEEDENCTFLTNL
FT                   KKSSAISKNKGVKRLKPKHSLSGNTETLRKNLLWKSNQIYYSETAVNSPMLDSSPNLFG
FT                   NQLSLSTPDLVAADAGSNGSQISTKAFSDFIDDPFTVGTNGNGADFQPFTASNTGNAIT
FT                   NLDEIDFTNIFARSTNNNHKHPYNSTAIDRNDSPTSNAPLSVKNAYDGLDDCWSIYMSP
FT                   NTTHDDTPVDISPASSKLHNKMPRIPEQRSDSLQPNVRFNDTALKHESLFTDDLINKSS
FT                   PRHDVGDEFLFDKMLNKELTSLNEFTENKHSDYPVNAGSFNLDVFGPSVDNNDSLSTLD
FT                   FTKPMNDNFVKLEEDHIM"
FT   CDS_pept        complement(326276..326644)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198205"
FT                   /gene_name="RPB9"
FT                   /locus_tag="CAGL0H03509g"
FT                   /product="DNA-directed RNA polymerase II subunit RPB9 "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59879.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniParc:UPI00003B669C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS48"
FT                   /transl_table=1
FT                   /translation="MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYIEEAGSPLVYR
FT                   HELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCL
FT                   ACSHIFTSDQKNKRTQFS"
FT   CDS_pept        327227..327757
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447804"
FT                   /locus_tag="CAGL0H03531g"
FT                   /product="Similar to uniprot|P53163 Saccharomyces
FT                   cerevisiae YGL068w"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59880.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG313694"
FT                   /db_xref="HOGENOM:HBG746222"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR015607"
FT                   /db_xref="UniParc:UPI00003B669D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS47"
FT                   /transl_table=1
FT                   /translation="MSLRLVAKRSIAVPRVSRLVVRPMLTRFNSTAAEAGVSEVDPKIS
FT                   KIVEDISKLTLLETSALVTELKSKLNIPDISFPAAGSAPAAAPADGAAKAEEAEEAKPE
FT                   EKTVFGIKLESFDAKSKAKIIKEIKGLLGLSLVEAKKFVEAAPKILKENVAKDDAEKIK
FT                   TTLEGLGAKVSLE"
FT   CDS_pept        complement(328668..330155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447805"
FT                   /locus_tag="CAGL0H03553g"
FT                   /product="Similar to uniprot|P29295 Saccharomyces
FT                   cerevisiae YPL204w HRR25"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG59881.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B669E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS46"
FT                   /transl_table=1
FT                   /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSR
FT                   HPQLDYESRVYKYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKT
FT                   VIMLALQMICRVQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHR
FT                   HIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKK
FT                   QKYDRILEKKLCISVETLCAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLE
FT                   YHNDHLFDWTMLRYTKAMVEKQKDVLMLDTSSTANANKESGNNNNESNTTSNTKDSKND
FT                   SFNKVKLLAMKKFASHFHYCKNDDKHYPTPEEIKQQTVQNNNAAASLPPELLSAIDKGM
FT                   ENLKQQQNQQQQQSQQVQMQPLASAELNQDQLPPQGPEPLLQRQRKETQGQFVPTQEPV
FT                   NRATHYPPNVQTNNMPQVQQQNISPQNPKPSGDNIWL"
FT   CDS_pept        331303..332847
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503616"
FT                   /locus_tag="CAGL0H03575g"
FT                   /product="Similar to uniprot|P53541 Saccharomyces
FT                   cerevisiae YNL012w SPO1"
FT                   /function="phospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAG59882.1"
FT                   /db_xref="GO:0004620"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG057962"
FT                   /db_xref="HOGENOM:HBG512126"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI00003B669F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS45"
FT                   /transl_table=1
FT                   /translation="MLLSTGFLRGLDAMGLYHYSDYIAGISGGSWSVMDLVVNKFQLGK
FT                   LISGWDLSTSMLPGMPDVDIGDDDTDFISDMHLDHLLQPNIATQKRSLFKRDNVVPSPL
FT                   LKIKQILFPNNTLASENLFEKLSKFKNALQFYIDLHLHIRSKRINGFPISFTDYWAQAL
FT                   VQNIKYRQLPTHLTYSKSVRTSNYFKNYLVPIPIIVANCRNGFLKNVIFEFTPWEFGSW
FT                   EQVLGLFVNIEYLGSRIINGVSHQCYKGLDDLGFIAATSSSIFNNALIYVWKLASKSSK
FT                   DAIAAVKTVLAVFGLGTTKFESALQTSSQITAALDTDYAVYRHNPFYKYSNIKNELAQN
FT                   DYLYLVDGGEDGENIPIRTLVPRNVDMIMIMDSSSDKKNYANGDKLKIVLNQMKEKEGI
FT                   YYRYPTKIVTSQKRPTIIGCKPPRTSDTKLAPILVYYPNSERSSTQVTNTSTFKMIYTS
FT                   EEQQLLIDHGYTLVTGHGEHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYCDS"
FT   CDS_pept        333100..333801
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447806"
FT                   /locus_tag="CAGL0H03597g"
FT                   /product="Similar to uniprot|P39931 Saccharomyces
FT                   cerevisiae YLR250w SSP120"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG59883.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG057964"
FT                   /db_xref="HOGENOM:HBG397303"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B66A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS44"
FT                   /transl_table=1
FT                   /translation="MKFSRSVFALLAVLVSANADVKAKDDVNVEVEKPPNGMSWEEWHM
FT                   DHEHELKKYTPEQFFALHDVKKKGYWDENDILGLYGLNRDEVIGAGDGMGEHDNSEKID
FT                   ETTAKNVVKFIMKLLDVNDDTRILRDEYLEFARRGKKLPDLGVGVGHHSDFEREYEIHH
FT                   WNKYHKDKDVNVKNVHKEDIEHELLHHEHDIEHQEKIQRGAARGTVITDDQLEARIELK
FT                   NIPSRFKNGYF"
FT   CDS_pept        complement(334111..335553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503617"
FT                   /locus_tag="CAGL0H03619g"
FT                   /product="Similar to uniprot|P53980 Saccharomyces
FT                   cerevisiae YNL011c"
FT                   /protein_id="CAG59884.1"
FT                   /db_xref="HOGENOM:HBG253412"
FT                   /db_xref="HOGENOM:HBG327741"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="UniParc:UPI00003B66A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS43"
FT                   /transl_table=1
FT                   /translation="MKVVVFSGGTATNSLTPCFNELSINQGEDLTYVLPISDNGGSTSE
FT                   ILRVLGGPAVGDIRSRIVRLIEDPALTKLFGYRLPQDTQAAKDEWNKIVEGTHIIWKNI
FT                   PVESRDMARPFLINVQSELLKKSKNSNPFHFGKASIGNFFLTGVRLFLGSVDASIELMM
FT                   RIGRANTHLNVIPCINTNHTHHISALLTNGEVITGQSQISHPSKPQEPQDKVEAKKNNE
FT                   NISEETLSSNRGSSVSITKDKFVQLLENNDESSSLNQDTTDSVEESGNTWTDINDTEEE
FT                   EFANPIYILPALKESQINFDKMDDCTLPAPIKRILYINPYGEEIRPVGNPRAVAEIKQA
FT                   DMLVYSIGSLMTSLLPIIILGNIADVISETKSMKKVLLINNKYDRETFFLSGISYIKMV
FT                   VDSMRRAIEVYRTSKDPSKTERKSIHINWNDLITDVVYLSEGEIKFNEDQLNMKGIRCH
FT                   EVKGKQMENEILTNILQKIHKL"
FT   CDS_pept        336494..337219
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198206"
FT                   /locus_tag="CAGL0H03641g"
FT                   /product="Similar to uniprot|P53981 Saccharomyces
FT                   cerevisiae YNL010w"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAG59885.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG001206"
FT                   /db_xref="HOGENOM:HBG324596"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B66A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS42"
FT                   /transl_table=1
FT                   /translation="MVKAVIFTDFDGTVTKQDSNDYLTDTLGFGKEERLKVFEGVLDDT
FT                   KSFRQGFSEMLESIKTPFPECIEILENKIELDSGFKDTFHWALENNVPVVVVSSGMKPI
FT                   IKDLLTKMVGEDSIHKLDIESNEVEIKDNKEWRIIYKDESPFGHDKSRTINAYKKKFEA
FT                   DLKDGEERPVYFYCGDGVSDLSAAKECDLLFAKRGKDLVTYCKRQNVPFHEFDSFSDIL
FT                   ARMKEVLAGEKTVTELMQN"
FT   CDS_pept        337533..338789
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351383"
FT                   /locus_tag="CAGL0H03663g"
FT                   /product="Isocitrate dehydrogenase "
FT                   /EC_number="1.1.1.42"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="isocitrate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG59886.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006102"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG020077"
FT                   /db_xref="HOGENOM:HBG596047"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI00003B66A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS41"
FT                   /transl_table=1
FT                   /translation="MAGKIKVKNPIVEMDGDEMTRVIWGMVKDKLIYPYLDVDLKYYDL
FT                   SIQHRDETEDRVTVDAAEATLKHGVAIKCATITPDEARMKEFHLKKMWKSPNGTIRNIL
FT                   GGTVFREPIIIPRIPRIVPTWNKPIIIGRHAFGDQYKASDAVIKEPGKLELVFTPASGQ
FT                   GNPKTIKVYDYKSPGVALAMYNTDESITGFARASFELAIKRKLPLFFTTKNTILKKYDG
FT                   RFKDIFQKMYDEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGFIIAMKNYDGDVQSDI
FT                   VAQGFGSLGLMTSTLLTPDGKIFESEAAHGTVTRHYRQYQKGKETSTNSIATIFAWSQG
FT                   IIHRGKVDQTPDVRLFGEILERSTIDTVQIDGIMTKDLALILGKTERKDYASTEEFIDA
FT                   VARRLKREFNSHFNKPSKL"
FT   CDS_pept        339203..340627
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047109"
FT                   /locus_tag="CAGL0H03685g"
FT                   /product="Similar to uniprot|P33322 Saccharomyces
FT                   cerevisiae YLR175w CBF5"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAG59887.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="HOGENOM:HBG427337"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B66A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS40"
FT                   /transl_table=1
FT                   /translation="MSEEHIIKPETTSPSTNASEWPLLLKDYDKLLVRSGHYTPIPAGS
FT                   SPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVC
FT                   IDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVKRQL
FT                   RVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGA
FT                   LSENDNMVTLHDVLDAQWVFDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNAVCYG
FT                   AKLMIPGLLRYEEGIELYDEVVLMTTKGEAIAVAIAQMSTVDLATCDHGVVATVKRCIM
FT                   ERDLYPRRWGLGPIAQKKKQLKADGKLDKYGRVNESTPEDWKKSYVPLDKSEASESSSD
FT                   AKKVEEQVKEEVEEPKKEEKEDEKEDEEPKKEKKEKKEKKEKKEKKEKKEKKEKKEKKR
FT                   KAEDEGEEKKKKKSKK"
FT   CDS_pept        complement(341230..342279)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198207"
FT                   /locus_tag="CAGL0H03707g"
FT                   /product="Similar to uniprot|P25294 Saccharomyces
FT                   cerevisiae YNL007c SIS1 heat shock protein "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG59888.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B66A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS39"
FT                   /transl_table=1
FT                   /translation="MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKF
FT                   KEISEAFEILSDPQKREVYDQYGLEAARNGGPAFGGAGGFRGGGFSSAGGAHAFSNDDA
FT                   FNIFSQFFGGSSPFGAADDGFSYSSFGGMPGGMGGMHGGMGGGMHGGMGGGMGGMGGMP
FT                   GGFRSASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGW
FT                   KAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFN
FT                   KTIQTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDK
FT                   QRQAIDENF"
FT   CDS_pept        342948..343859
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208395" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198208"
FT                   /locus_tag="CAGL0H03729g"
FT                   /product="Similar to uniprot|P41318 Saccharomyces
FT                   cerevisiae YNL006w LST8"
FT                   /protein_id="CAG59889.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG317546"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B66A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS38"
FT                   /transl_table=1
FT                   /translation="MSVLLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKK
FT                   LLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDI
FT                   RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQ
FT                   SLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHM
FT                   ATCSADHTARIWSVEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST
FT                   RDIIRQYGGHHKGAVCVALNDV"
FT   CDS_pept        complement(344104..347169)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447807"
FT                   /locus_tag="CAGL0H03751g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG59890.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124821"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B66A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS37"
FT                   /transl_table=1
FT                   /translation="MRDSNEKAGSYVRYTGDDSIPSSNTQSTVNQQQQYQNRQRQQMNI
FT                   LTAGQPTPDYNSQQVMNANQGRIYDRSQMTQYIPNANIPYGVIDNQTQQQQQQQQHDYT
FT                   MIRHQIPQQQQQRPFLPSLISDQHKGIINTNPMAPSNIHYQRVPIQLPYILEQRQHVPN
FT                   RLPSTMQQQYINASQIQEQHLIDDSNARALAASEGSLALQHPNFLGQVNLGSSSSSGST
FT                   SGYLRGISDSASITSVSTPVSSVSAVTPLSSTSTHSGKRSMRITKPHSGKSQDGKPTKG
FT                   KRGRKPNSKNAKSLLSNTDSGHHSEHNTTPEIVAKKIAEENIDKTVGEFAVQVREAELQ
FT                   VLNLDNQNGSKLEKQSAEQARERSKQAFASLWLMKNCILQPGAYVRRGRIFAQYVSSCA
FT                   QNGLKPLSQATLGKLIRSLYPKLTTRRLGMRGQSKYHYCGLKLTTDDSLSMLLEQQQKT
FT                   SSSRPPQLKRNVVHRHYSDSSLPGGNRNSPSPTSIIPNDRDIKTKLKDDWSQNGVDQIN
FT                   SRRHLATKSVTRYSAPTIIGPSRDSPRLSDSPMSLTGSATTVSSTAQSDFHLPIGGSAT
FT                   YFENGNIFYNPLTKNLSSFISTPGSRFVVSDAHSHHDGDVASAQQTEKFDLQQRESRRP
FT                   GLFWSKSVERWLFISDLLKDWLPGGEEESSVSGENKNSSSATGNITETEDTRIEDKDGE
FT                   PVSGVDVDHDEKPDVKSDSDSTLEAGIVVVSGRRLPEIPLGIIPAGTDTDITAALQSLY
FT                   HIHCNTLFENVRFLNFERLANNLFLSSSGAISPQMYNLLISEELYDWIIECDTLTYVAI
FT                   LNYISRMLLQFKSIDQTTQDKWEILANTFYDIISKSTIDLPSTLVNKKLETVTTFLRLL
FT                   KQQLKLLQTLRSLDDKYFGANCNTEELERSWEEKILPNALESLELISGNENYNIGSNLV
FT                   KFFRENILTLLPNADNSDQHGMQTFFNDLCAFYQSMDGVTTFQLADCTSQLFGKTVGNL
FT                   VIDEESYTPAWLLLGSFSTQLTGYLSDLSKFV"
FT   CDS_pept        354848..355801
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447808"
FT                   /gene_name="RLP7"
FT                   /locus_tag="CAGL0H03773g"
FT                   /product="Ribosome biogenesis protein RLP7 "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translation"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59891.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG359947"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI00003B66A8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS36"
FT                   /transl_table=1
FT                   /translation="MSDITNEKKPLNSDPEILLRKRRNADRTRLEKQELARQRQEQRKK
FT                   EQIKNKKKFIRAESLVANSLATSREKERIKRISKLEHKKLKGDVSHLPSEKNFFLKVTE
FT                   KPQSEETDDLIDEDEEDGFEREKVAYNGEEQLLFVLRVKGPVAASIPHKAYRILSTLRL
FT                   EEVNTAVFIKLTETTFSLLKIIAPYVIVGKPSLKSIRSLIQKRSKIVYKREDEEEAKEI
FT                   ILNDNNIVEEKLGDCGVICIDDIIHEIATLGENFTKCNFFLQPFKLNREVSGFSSLNKL
FT                   KKLEQREVEKKTRKVSNASTAPIVQIDIDALIAKIN"
FT   CDS_pept        356535..357632
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000021112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351384"
FT                   /gene_name="LEU2"
FT                   /locus_tag="CAGL0H03795g"
FT                   /product="3-isopropylmalate dehydrogenase "
FT                   /EC_number="1.1.1.85"
FT                   /function="3-isopropylmalate dehydrogenase activity "
FT                   /function="NAD or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /biological_process="leucine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59892.1"
FT                   /db_xref="EMBL:AAB62089.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003862"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI00003B66A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14429"
FT                   /transl_table=1
FT                   /translation="MAVTKTIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHH
FT                   LIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLY
FT                   ANLRPCNFASDSLLDLSPLKPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKY
FT                   SVPEVQRITRMAAFMALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQH
FT                   QLIDSAAMILVKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTA
FT                   FGLYEPCHGSAPDLPKGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSGIRT
FT                   ADLKGTNSTTEVGDAVAKAVRELLA"
FT   CDS_pept        complement(358071..359525)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447809"
FT                   /locus_tag="CAGL0H03817g"
FT                   /product="Similar to uniprot|P25374 Saccharomyces
FT                   cerevisiae YCL017c NFS1"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAG59893.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG000049"
FT                   /db_xref="HOGENOM:HBG635316"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI00003B66AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS34"
FT                   /transl_table=1
FT                   /translation="MMSAAGRHVRRYTPGATLGAAAAAAKAIKMTDNVSLETHTDIQAA
FT                   AKEQADVRASAQGQSGDEVLKSGETVLHHAYKEDSGYGTRPIYMDMQATTPTDPRVLDV
FT                   MLKFYTGLYGNPHSNTHAYGWETNKEVETARDHVAKVIRADPKEIIFTSGATESNNLAI
FT                   KGVGRFYKKTKKHIITTRTEHKCALEAARGMINEGFDVTFLSVDNQGLIDMKELEEAIR
FT                   PDTCLVSVMAVNNEIGVMQPLKEIGALCRKNKIYFHTDAAQAYGKVPIDVNEMNIDLLS
FT                   VSSHKIYGPKGIGALYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAARLMH
FT                   EEYNADIAHIDKLSSKLVNGLLSLEHTSLNGSAEKRYPGCVNVSFAYVEGESLLMALRD
FT                   IALSSGSACTSASLEPSYVLHALGKDDALAHSSIRFGIGRFTTEEEVDYVLKAITERVK
FT                   FLRELSPLWEMVQEGIDLNSIQWSGH"
FT   CDS_pept        359987..360835
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503618"
FT                   /locus_tag="CAGL0H03839g"
FT                   /product="Similar to uniprot|P38921 Saccharomyces
FT                   cerevisiae YNL003c PET8"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59894.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B66AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS33"
FT                   /transl_table=1
FT                   /translation="MLNGFLISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNGGY
FT                   RGVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGE
FT                   IAACMVRVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPF
FT                   TCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKK
FT                   SIPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLSTNKKPTRNE
FT                   A"
FT   CDS_pept        complement(361189..362520)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447810"
FT                   /locus_tag="CAGL0H03861g"
FT                   /product="Similar to uniprot|P38922 Saccharomyces
FT                   cerevisiae YNL004w HRB1"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG59895.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B66AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS32"
FT                   /transl_table=1
FT                   /translation="MSEAQRSRSRSPVRRSLSSYATRRGFERPSNDGRPPAERGPRPGS
FT                   SRGGRGHERRRFNGAGPSERGGVNKFRRDKEKAARTKGDFGPRLARELDSTYEEKVNRN
FT                   YTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIITSRGHHRGMGTVEFTSGEEVDEAI
FT                   RKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYELMIL
FT                   NLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGFE
FT                   IEGKVLEVRGQIPDPTQISSTRKTDDLTVNQDNEDIEMDIDTAEGGDEKALKADVSSDG
FT                   GARAQNKFSSDDYVKTEDKSKIILCDNLPGATTEGDLYDLFETLGKVKTAGFINTDNAG
FT                   ETVSAIVIYNEQDDAEVCYGRLQGYNYGGCDLKISYVKDKNIDY"
FT   CDS_pept        362859..363965
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447811"
FT                   /gene_name="MRPL2"
FT                   /locus_tag="CAGL0H03883g"
FT                   /product="60S ribosomal protein L2, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59896.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG057965"
FT                   /db_xref="HOGENOM:HBG397775"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI00003B66AD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS31"
FT                   /transl_table=1
FT                   /translation="MFSGLHTSKYACQVVVQIRTATKRAAGSRTSMKDSAGRRLGPKKY
FT                   EGQDVKPGEIIMRQRGTKFYPGENVKIGRDHTIYAVEPGVVRYYLDPFHPYRKFIGVAL
FT                   SRDMKLPKPHFEPNVRRFGRIELDNPKAIAKEENALSRKEYLSRDTLLKDLTEREAKRH
FT                   EMMDNYWNFISSELKLNIIPERKEMASNYLLRYRTGLKNGFDLQEAQFNAKYYLQQMLK
FT                   LKAKRKEWNEEKLSEQLHNLDETTALLNKSVSFSNKWVIIPYISEEEKLTRKDELIKKL
FT                   TELGTAIKSKSDKKAVLELFKDASHFLTQAQEVRLRRQFMKPVQPEIMNVNVAEKADKK
FT                   TTVIRRFNYEKSKIDIIPRTKTAFFKRL"
FT   transit_peptide 362859..362918
FT                   /gene_name="MRPL2"
FT                   /locus_tag="CAGL0H03883g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS31 "
FT   mat_peptide     362919..363962
FT                   /gene_name="MRPL2"
FT                   /locus_tag="CAGL0H03883g"
FT                   /product="60S ribosomal protein L2, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS31 "
FT   CDS_pept        complement(364290..365192)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447812"
FT                   /locus_tag="CAGL0H03905g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="acetolactate synthase activity"
FT                   /function="amino acid binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAG59897.1"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG083524"
FT                   /db_xref="HOGENOM:HBG335310"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniParc:UPI00003B66AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS30"
FT                   /transl_table=1
FT                   /translation="MIRTVLSNSVKRSLVRHSSSSTSAMTYKQLHKHTARPPLPVVDTP
FT                   AWDANSAVSSILYETPAPSRQPRKQHVLNCLVQNEPGVLSRISGTLAARGFNIDSLVVC
FT                   NTEVKDLSRMTIVLKGQDGVIEQARRQIEDLIPVYAVLDYSNSEIIKRELVMARVSLLG
FT                   SEYFEDLLVHHHKSTANLEDSHEIVSEIREKKFHPSNLQASEVLRLKHEHLNDITNLAK
FT                   NFGGKIVDIGETSCIVELSAKPSRISAFLKLVEPFGVLECARSGMMALPRTPLQTEVDE
FT                   EDIDGKISDIVDISQLPPG"
FT   CDS_pept        complement(365612..367018)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047110"
FT                   /locus_tag="CAGL0H03927g"
FT                   /product="Similar to uniprot|P25604 Saccharomyces
FT                   cerevisiae YCL008c STP22"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG59898.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG049846"
FT                   /db_xref="HOGENOM:HBG057973"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI00003B66AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS29"
FT                   /transl_table=1
FT                   /translation="MSTPLPESVVQWLFKVIQPIYKQPKLVFHDAVQTLTEFKNLRPRT
FT                   RVFTDEDGSPRLLLCLYGGIPIEQGLDVPVLIWIPESYPIAKPLLFIDLELLDKDLQLA
FT                   TNESVEPDGRVHTRLLRQWNPQSANLFNVIQDLADMCNAIAPIQPVTFSSTVAPGTTDA
FT                   EKSPPVPPKPALPPKTTDNAIKFAGQTSSIPGPNGIPKIPERMPLQNPTQETDTTIRPS
FT                   KASINPTGNGTMGPPPLPEKPQQSNALHDQLRQLNLQEPPHHDDHANPVQNTQRTFVNA
FT                   VPNEVPMVDLLDSMDEKPVSDAYTQSLEKLKMTIHELSTLDQNYKKEQIESRIPQLQTA
FT                   IKQFDDLYNHESEKLNWIKSSIIESRESLQKGIEDVDKETLLVEKFIAENGTTLDSNTV
FT                   YTTEVPALDQLYTLVARDRALTDTIQVLARLLNCGALEFDAFIKKVRELARDQFMARLH
FT                   IRKIIALLQE"
FT   CDS_pept        368426..369616
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351385"
FT                   /locus_tag="CAGL0H03949g"
FT                   /product="Similar to uniprot|P33309 Saccharomyces
FT                   cerevisiae YNL001w DOM34"
FT                   /biological_process="translation"
FT                   /protein_id="CAG59899.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG049937"
FT                   /db_xref="HOGENOM:HBG629960"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI00003B66B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS28"
FT                   /transl_table=1
FT                   /translation="MKIISITKDSANKEGATIVLLPEDKEDLFTVHQIIDKDDEVIFKK
FT                   KFTTNLDEAGKKKSTDLVKLRLKIVSSEFEMRDEYLRYKGVTVADDNGNSNVDIPVGKF
FT                   LSFTVNYSFPFTIIKQNFDSFMEKTLQNAANPESRSDTAAIVLQEGIAHVCLLTASSTI
FT                   LKQKIEYSMPKKKRATDVMKFDEKTEKFYKAIYESIKKYYDFSKIKLILLCSPGFYAKT
FT                   LLEKITQYAQEERNKSIIDHQSLFLVAHCSTGYLQGISEVLKNPLYSTKLSDTKYAKDA
FT                   AIMDEFMEHLNNDDFKAWYGEAEVEKAAEMGAIKYLLITDTMLHNDDIKKRKKFLALYE
FT                   NVESSGGKGVVFSTLHSLGEELDRMTGVACILNYPLPDLDEDLEDEESENDNEFEI"
FT   CDS_pept        complement(369916..370704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000030539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047111"
FT                   /locus_tag="CAGL0H03971g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="negative regulation of transcription "
FT                   /protein_id="CAG59900.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016481"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG341443"
FT                   /db_xref="HOGENOM:HBG686708"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="UniParc:UPI00003B66B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS27"
FT                   /transl_table=1
FT                   /translation="MVKVAIITYSCYGHITTIAREIKKGVEAAGGEVTLFRVPETLPDD
FT                   VLEQMNAAEKPEDFLIANGETLTDYDAFLFGVPTRFGNVPSQWAEFWDKTGAIWVQGSL
FT                   WGKPAGVFVSTGTYGGGQEATVKTCMNYLVHHGMVFVPLGYKYTFAELSNVEDIHGGSP
FT                   WGAGTLAGADGSRQPSSLELRMAKTQGKTFYETASKLCDKKPSTKSSKNMDSKPSAKQN
FT                   TSATGKAEVKTSGTTTQQKPTETRPKEKTKFNPSKNCVIM"
FT   CDS_pept        complement(372155..373573)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000130831" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447813"
FT                   /locus_tag="CAGL0H03993g"
FT                   /product="Similar to uniprot|P00890 Saccharomyces
FT                   cerevisiae YNR001c CIT1"
FT                   /function="citrate (Si)-synthase activity"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG59901.1"
FT                   /db_xref="GO:0004108"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="HOGENOM:HBG127450"
FT                   /db_xref="HOGENOM:HBG309523"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI00003B66B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS26"
FT                   /transl_table=1
FT                   /translation="MSLSSAARATPALRAQAYKALTSTRAFSATSISSEKTLKDTFADI
FT                   FPKQAEEIKQFKKEHGKTVIDQLLLEQAYGGMRGIKGIVWEGSVLDPEEGIRFRGRTIP
FT                   EIKKELPTIGGSSEPVPEALFWLLLTGEVPTESQVKAFSADLASRSEVPEHVLKLLDSL
FT                   PKDLHPMAQLSIAVNALETESKFAKAYARGVNKKEYWSYTFEDSLDLLGKLPVIASKIY
FT                   RNIFKDGKICQVDPNADYGKNLAHLLGYTNKDFVDLMRLYLTIHSDHEGGNVSAHTTHL
FT                   VGSALSSPYLSFAAGMNGLAGPLHGRANQEVLEWLFTFREEVKGDYSKETVEKYLWDTL
FT                   NGGRVIPGYGHAVLRKTDPRYTAQREFALKHFPDYELFKLVSTIYDVAPKVLTKHGKTK
FT                   NPWPNVDSHSGVLLQYYGLTEASFYTVLFGVSRAFGVLPQLIIDRAVGAPIERPKSFST
FT                   EKFKELVKSIESKK"
FT   CDS_pept        complement(377281..378264)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198209"
FT                   /locus_tag="CAGL0H04015g"
FT                   /product="Similar to uniprot|Q06704 Saccharomyces
FT                   cerevisiae YLR309c IMH1"
FT                   /protein_id="CAG59902.1"
FT                   /db_xref="HOGENOM:HBG124822"
FT                   /db_xref="UniParc:UPI00003B66B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS25"
FT                   /transl_table=1
FT                   /translation="MTRKKTCSVQFNPRNTIVTYSDDDTIEILPLKLDGQRKTVNNIAT
FT                   SGGLRLKSILRNFPESSVSKTGMQDCGIFDTTEKAQAETRRVDTTQMEYYQTETDRNEE
FT                   LEALRLLISRCFTLCNMDLEVPTDLDYDSVCKMFSLLSRAIPQNFKERTQEVKRRLDEQ
FT                   QIASNREHIRLLSMLKEENGRLRKLLGYFAHQEEKRRGIKPIQESIRMLIEDSVSKQEM
FT                   ELELSLLKEQYEEQKVKYLKLKESSLIPSINVAKEIDHTERNYVNIKRERELNEIVERQ
FT                   QNNIQELESKCCILINERSSVQNQVNKLRRELREAKLLLSVQKDKR"
FT   CDS_pept        complement(379169..381916)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198210"
FT                   /locus_tag="CAGL0H04037g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59903.1"
FT                   /db_xref="HOGENOM:HBG124823"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="UniParc:UPI00003B66B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS24"
FT                   /transl_table=1
FT                   /translation="MSVYISLNQNTEVQKNAKLKPSLKSYSSFDNAIRNDSKLGHTRSL
FT                   SNISTISSLSTASSLKNVRFATNLTTVKSFDSNSEPISISHENSPTLKPLRESESSNVS
FT                   STSLNNVLYLSDYDDFTKHQDLNFLGIKSKSTISFFLDDEEDDEEDDGIHDDDLKNFFG
FT                   KIFPAAYNVNTSNKNLGPPDCSNTNQQRAGLLDSNNSSTCKIIPNFSTNVCQTDNSAGH
FT                   YFNDLNGSTNNQAQTSRRTSITHVADDNLQNCELASEVNWLLTFVDVNPGQHSFENSDG
FT                   NIKLVSLAQDSTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISAEI
FT                   DEFEFKINLSSLKYILQFKRILQFKSNDTYLNMELCCRYDVNGETYYDNNNYRNYNCVL
FT                   KASKEHTIANDVIVTAEEQEKKELARKESPKKISQNKKSSSPSRNNYSKNFLKSRRRVI
FT                   SRKFSENTDYYNTSPLKHLYHSDPTSYIKPKRLNEVLYDSTSTIPTDLNQRIGINATCQ
FT                   SLHEPLTERERFISEFDYANLNDSMDTLTTVNLMNHSIANIELNSEPVEPIVPSITNKI
FT                   EENISNNPILQEVTDPITESFNEPITIEPVRSNENEVSDDKQSVVTDTTIDIEALKLSG
FT                   ESPISFRTVDSPIEYYDCYSTSNNSVETITKPTPASPSGLTAKDLRSIDAPKSFQDSIS
FT                   TSYNIPMENSEPEDDLSDRTTTIESTEDPVFNTKWDNIVVDTELEDTGNQILLPEVANS
FT                   SQEAKDTETSRKSDTDQAPHSPDTDYQKFLNSNYFCRPSSSSSSVSTTDSSSSSSTSIL
FT                   TDNASSLASVPSSITTSDSELSSFIFNKATINAKVQGKLAGSTQLYSNLIFPLSDSHEA
FT                   RPINRIRTGRYSLEENKILSQFANERPANHDTDVMNTTLVNSGN"
FT   CDS_pept        complement(383247..383690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447814"
FT                   /locus_tag="CAGL0H04059g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59904.1"
FT                   /db_xref="HOGENOM:HBG124824"
FT                   /db_xref="UniParc:UPI00003B66B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS23"
FT                   /transl_table=1
FT                   /translation="MYKPFPVIIPFFSAPYFIVLPVASQYPFPHDEFEISAIPSEGCFE
FT                   DSDGWELVKGLVLSFFRIPVVSSLFCREGFPPPPIRSRCSIASNSTNAVPEIEDHSLEI
FT                   SRRKIERCSGSSIDLNRSAHKKQPQRKFQEGIVTVNIRSARFF"
FT   CDS_pept        complement(385778..387163)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000012351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447815"
FT                   /locus_tag="CAGL0H04081g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="hydroxymethylglutaryl-CoA synthase activity "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAG59905.1"
FT                   /db_xref="GO:0004421"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG236384"
FT                   /db_xref="HOGENOM:HBG578402"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniParc:UPI00003B66B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS22"
FT                   /transl_table=1
FT                   /translation="MTEIKKQRTDFQAARPTNVGIKGIEVYIPSQYVSEAELEKYDGVS
FT                   QGKYTIGLGQTNMSFVNDREDIYSMCLTACSNLIKNYNIDTDKIGRLEVGTETLVDKSK
FT                   SVKTVLTQLFPGNGDMEGIDTVNACYGGTNAVFNSINWIESSSWDGRDAIVVCGDIAIY
FT                   DKGAARPTGGAGTVALWIGPDAPLVFDSVRGTYMEHAYDFYKPDFTSEYPVVDGHFSLT
FT                   CYVKALDQVYKAYSKKAIARGLVQEPISDEACNVLKHFDYNVFHVPTCKLVTKSYGRLL
FT                   YNDFRGNPSLYPDVDQSLATLDYEKSLVDKSVEKLFVNVAKPHHATRVAPSLNVPTNTG
FT                   NMYTGSVYASLASLLSYVDQEQLQGKRIGMFSYGSGLAASLFSLVVRGDISDIVSKLDI
FT                   DNKLQSRECLTPQQYEAAIELREKAHLQKSFKPTGSIDHLRAGTYYLTEIDDKFRRSYS
FT                   TKE"
FT   CDS_pept        388457..390460
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351386"
FT                   /locus_tag="CAGL0H04103g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG59906.1"
FT                   /db_xref="HOGENOM:HBG059572"
FT                   /db_xref="HOGENOM:HBG203530"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00003B66B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS21"
FT                   /transl_table=1
FT                   /translation="MLLEELPSEVLINVFSYLDEKDLYTLQGLSRRFASLIGDEELWKN
FT                   LFITRLHTSYFPSFSKSQRYSHEYVARVSGVKQWQHNRLIKTRYNLSPTPLHVTHLRNH
FT                   PNQVAIEELIFQYPKLACYHDGIITLVQLQSKRSKIKNRMVYIPCTTPQGCSTMHFNIN
FT                   SAVFGRFDGRVFGKLLTNKSYLQPVTEFDSSHSACVTAIATTNSTMIDSTTKDWSVSGS
FT                   ENGEIIWWLETKKYKSLKFANSPILRLSLVNKNITIALDEKSIYVIEDMERVHTLDIPH
FT                   DPVTNKRISIHFFKIDYGAQTLCLADTQSIYMISFNLTKDFGQVKVLKLKDPSETITDV
FT                   IMDEETAKREQDPQLAGGDGCFVALCTSNMRILVLNTRKSSFVTVNAEQLYQEVKPLRE
FT                   FQFNDHIYATQITNLVLVLALAGTIEIYDVLSGELIKTVQKTEKIPQFLRVSQGRMIVS
FT                   SGNTIHYLQYIPDEDDQSESHKKSHGSSRLRSNKWNETLHSEMEMYNEKLKQEEERELE
FT                   NARLMEAYGGDMDGDDEELQLKIALLESQNLNSQSAEGTDDNARADPTTEEEDEALRAA
FT                   IEESLRMQRLQEEVRTAVSMEDDEEFLRAVEQSSRDDEERRTRRGQRRTLTDLGHNEPT
FT                   TEETSNVQHGDINDEELQLAIALSLSEINESQ"
FT   CDS_pept        complement(390841..392418)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351387"
FT                   /gene_name="ALO1"
FT                   /locus_tag="CAGL0H04125g"
FT                   /product="D-arabinono-1,4-lactone oxidase "
FT                   /EC_number="1.1.3.37"
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAG59907.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG221253"
FT                   /db_xref="HOGENOM:HBG323831"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI00003B66B8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS20"
FT                   /transl_table=1
FT                   /translation="MDLKTFGGRRNFVFRNWAGIYSSRPEWYFQPSSVDEVVEIVKAAK
FT                   LKNKTIVTVGSGHSPSNMCVTDEWMMNLDKMNKLLDFVENEDKTYADVTIQGGTRLYKI
FT                   HKILREKGYAMQSLGSISEQSIGGIISTGTHGSSPFHGLVSSTIVNLTVVNGKGEVLFL
FT                   DEKSNPEVFRAATLSLGKIGIIVGATVRVVPAFNIKSTQEVIKFETLLEKWDSLWTSSE
FT                   FIRIWWYPYTRKCILWRGVKTNEPQTKSRYSWWGSTLGRFFYQTLLFISTKIYPPLTPY
FT                   VERFVFRRQYGEVETLGKGDVAIEDSVTGFNMDCLFSQFVDEWGCPMDNGLEVLRSLDH
FT                   SIAQAAANKDFYVHVPVEVRCANTTLPKEQPETSFRSNTSRGPVYGNLLRPYLDNTPSQ
FT                   CSYAPIHSVTNSQLTLYINATIYRPFHTNAPIHKWFTLFEDTMSAAGGKPHWAKNFLGS
FT                   TSFAQGQVKAEGQYQDYEMRGMATRVKEWYGSDLETFKKVRREQDPDNIFLANKQWALI
FT                   NGIIDENE"
FT   CDS_pept        392825..393643
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447816"
FT                   /locus_tag="CAGL0H04147g"
FT                   /product="Similarity"
FT                   /protein_id="CAG59908.1"
FT                   /db_xref="HOGENOM:HBG124825"
FT                   /db_xref="UniParc:UPI00003B66B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS19"
FT                   /transl_table=1
FT                   /translation="MNETLTGRCSYTIAGWVSRSRFGHKEVLAQVPHQLLWEVYRYVVN
FT                   MGNDTLELYLLFLQLEARDMPQHFSQKLSIRDVSVVELSHLLGGSATKLPLDLQVHACR
FT                   DVDDMRQLVDLQCLHGLSVMCPVGDLILSYWITRLKNLKGKWTQLKWLVVPTSVSAMHV
FT                   YKLLEAIPSLETIACGLDADHVRQVPQLRKRLHLTDPLIKTESQIQIALLTERFTTSRP
FT                   SYKATVNPVTISDTHSVYQVTPIDTVSTSNMRKRPRLNTKRISASQYFGI"
FT   CDS_pept        394311..396407
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447817"
FT                   /locus_tag="CAGL0H04169g"
FT                   /product="Similar to uniprot|Q04533 Saccharomyces
FT                   cerevisiae YML082w"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG59909.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG262693"
FT                   /db_xref="HOGENOM:HBG634482"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B66BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS18"
FT                   /transl_table=1
FT                   /translation="MKKWTGSASMKLEYSRPLPTWEDVLRYEKTSASAVFDNDEDLNGY
FT                   PRWCLHSSVKRLCDVLGNKYSKENEKCLCFPSYGVAKRCREYIKKKEGLNTKVRILQLA
FT                   TSKPLNSEEMKSKCEFKIAVVFVTKNLFHHVRQYWKLTGEIVSPRLADYILNELFIAER
FT                   SSFATISNGKNKDQQMQNKKSQINFTLANRALACVRKRLVTNVIDANDELGEDNYHFQN
FT                   DDDDDMEPTFLDTVRSNDNVNVNNHTRIDDQLLRNGFEFSDSEDEDTINHNNPFGDSTD
FT                   SEEDDAFVSLVPPEPIAIDISDTPIDSPLPDSSNNASATFIDPSAATIANDNIPNDIDP
FT                   EDEVFIFPSGIASIFTAQRVLQEYDLLRVNRIRYQTESSNGTGTQKRIVLLGDICPDIV
FT                   KMFQEFNDVIIINNQKGAFSTLNDLEVLLNSGEQILGVFLAIPTNPCLELTNLQRLKEL
FT                   SDLFVFPIIFDISMGSGVLNYNILKYGDIICMSLLTRFTNIEVMAGAMIVSKKRSPKFH
FT                   EFFLSRMNEELLESQLQNTSQQTYSQNQFISPGATFWVEDAVLLDRGSCKWHDRNIKIN
FT                   YTAEYLVKRVLRQHEGKVFKRVLYLNDEAWQENNYYNMVKYSREDCGYGGIIAIEFEKE
FT                   NQLAKFYDSIEHIYKGTPVLGGNDITTVAAFREHNGRHLLRVCVGLENIKILTKVFQSA
FT                   LSKI"
FT   CDS_pept        complement(396831..397001)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447818"
FT                   /locus_tag="CAGL0H04191g"
FT                   /product="Similar to uniprot|P81450 Saccharomyces
FT                   cerevisiae YML081ca ATP18"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="CAG59910.2"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG124826"
FT                   /db_xref="HOGENOM:HBG398405"
FT                   /db_xref="InterPro:IPR006995"
FT                   /db_xref="UniParc:UPI00017BD8F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS17"
FT                   /transl_table=1
FT                   /translation="MIKRFQFPVLKTYWPFFAAGAVVYYGVSKAATAMSNSEEFINDPR
FT                   NPRFHRGEKPL"
FT   CDS_pept        398544..402509
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142036" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503619"
FT                   /locus_tag="CAGL0H04213g"
FT                   /product="Similar to uniprot|Q04545 Saccharomyces
FT                   cerevisiae YML081w"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59911.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059110"
FT                   /db_xref="HOGENOM:HBG203537"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B66BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS16"
FT                   /transl_table=1
FT                   /translation="MMSVGSVPVDNGANFAPIPKKSRTIKTDKPRPHLCPICTRGFVRL
FT                   EHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQYKLHPTLVSKNNEGSLDNSRNNSV
FT                   SPGSDNSSDALKAEAAINDNIIKVSGNRATILPTPSNPLAKTTAELRKAAKVAESTGSS
FT                   KESTPSTKYAKKVNKKRKTKNKEAGSNGNSSSTSPLVSPSIFPQPLNLNQKKDNNLSVP
FT                   ASRNKRHASFSASSAFTYFPDNVSLNGNDQEHQRENIEDLGEGIPHLVGFSTPQLSAQE
FT                   LIRKVMQTGTMDFEPLDLPPSLFGDENGQQMLGMQNGDSDFGVSLFNSNGVTKSNNERV
FT                   GFINGKKKANTVDNTSTTNYIGDLPSSSMNNSNMKHANSSASLAAALSSMFAIPNQSST
FT                   NLANSGPSHQILTDLVTMGSSFGGSNGFNKNLHNNTSELDLFNYKNWKNNSYHDIFEAP
FT                   SASKQKKRATFTTNDVTEIDDQIDGQNFKSPQSIPDSNQRGNTNTTSPDEDWTTKFIKD
FT                   SDLEKYFDMDADHFNDIGFFHSNINDANQNSIKSNLPSGIASSQNSSNETSAINSSSNL
FT                   PRLGNSVASPINSLSNKSAVNTPPVNIEQPSVNKAKNVEFKEFRELFNSHIDNYGLPNH
FT                   MSKRTFEEEDIGAALERSVSSLFTSRQVELFRKNVNAANLSLFSNPSSASSSLNGSPRN
FT                   SSEPLQKKQKHIPPPLAFFTEKFREQIVTMNNLTQTMFPSVNVLNHYVNLYQKEFHPYF
FT                   SFIHLPSFVPSTENYPFLLSVAMIGALYAFHSNHAMILCKVARHNIRVYLEQTVKNQKV
FT                   TPLWLIQSLVLLTFVGIFSDDLNVARSMNTQLMTLIRLIKKTNLNMPLENYCKPPIASN
FT                   HALDYQNNPATFAKYKAQYTTPEQLEKDFQYFILAQTRIRTCHVVLIISNLFTSLVGLE
FT                   CCFHSIDLNCGVPCYHESLFSCPSSNEWAGKLEKYNIVLDSKFSLIELSNGEAKYANCM
FT                   MYLSNGSQYVYDNTKVSKKTLLSLLITIHEKIFIERNNIRHENGDNIPLNDAKWRMSSR
FT                   PMISVMVKHWESMYIKNGGLLVPTDENIKIINRDPAMRLIVPLHSFALIRKCLDLTPVM
FT                   KQIYMHNWVGMNETMQLICCDWESLRESTTYALNIIDFWVITMDGLRNQSIGGTPIFTI
FT                   TCIFSAVLIVAEYMKHLEDWSNDVSSDINSQPNLKVSDRILWFKIFKVLKKVEGHLSSR
FT                   DVGSETYSQFLRTQANGALDIGSLDEAYIESATKPDREISETLEVIKNSRLSTRSLYFG
FT                   VRILGDAPVWPIAILFALALQCRAIHMEKSADKTLLH"
FT   CDS_pept        403035..404273
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047112"
FT                   /locus_tag="CAGL0H04235g"
FT                   /product="Similar to uniprot|P53759 Saccharomyces
FT                   cerevisiae YML080w"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAG59912.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058012"
FT                   /db_xref="HOGENOM:HBG629132"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI00003B66BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS15"
FT                   /transl_table=1
FT                   /translation="MPEKKLPMKLKGRELFEKIGNPRHIVAPMVDQSELAWRVLSRRYG
FT                   ATLCYTPMFHAKLFATSEKYRREMWCDLDGDSKLDRPLVVQFCANDPEYLLQAAKLVED
FT                   KCDAVDLNLGCPQGIAKKGHYGSFLMEEWDLIHKLIKTLHENLNIPVTAKIRVFPDRQK
FT                   TLDYAKMVLDAGAQFLTVHGRLREQKGQQTGLADWDIIKYLRENLPDNTVFFANGNILY
FT                   PEDIDRCISQIKCDAVMSAEGNLYNPGVFNVHYIGDKDKTYPRVDVLLREYFEIIRNEC
FT                   KESLASRKAMKSHFFKLLRPFLPHYTDIRSNIAALNAKSDLKEWEDKVVIPVEEAVQEL
FT                   FKNPDIEDMIITHDKELWGGSYKTIPYWRCQPYFRPVNGVTGDKRIVQELESKKRKAEF
FT                   SLDSQKEKEFKTE"
FT   CDS_pept        405073..405231
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198211"
FT                   /gene_name="MT-II"
FT                   /locus_tag="CAGL0H04257g"
FT                   /product="Metallothionein-2"
FT                   /function="metal ion binding"
FT                   /protein_id="CAG59913.1"
FT                   /db_xref="EMBL:AAA35273.1"
FT                   /db_xref="EMBL:AAA35274.1"
FT                   /db_xref="EMBL:AAA35275.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG049851"
FT                   /db_xref="HOGENOM:HBG124828"
FT                   /db_xref="UniParc:UPI00001688A8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15114"
FT                   /transl_table=1
FT                   /translation="MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQTC
FT                   KCQTCKC"
FT   mat_peptide     405076..405228
FT                   /gene_name="MT-II"
FT                   /locus_tag="CAGL0H04257g"
FT                   /product="Metallothionein-2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15114 "
FT   mat_peptide     405094..405228
FT                   /gene_name="MT-II"
FT                   /locus_tag="CAGL0H04257g"
FT                   /product="Metallothionein-2'"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15114 "
FT   CDS_pept        406327..406485
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447819"
FT                   /gene_name="MT-IIB"
FT                   /locus_tag="CAGL0H04279g"
FT                   /product="Metallothionein-2"
FT                   /function="metal ion binding"
FT                   /protein_id="CAG59914.1"
FT                   /db_xref="EMBL:AAA35273.1"
FT                   /db_xref="EMBL:AAA35274.1"
FT                   /db_xref="EMBL:AAA35275.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG049851"
FT                   /db_xref="HOGENOM:HBG124828"
FT                   /db_xref="UniParc:UPI00001688A8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15114"
FT                   /transl_table=1
FT                   /translation="MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQTC
FT                   KCQTCKC"
FT   mat_peptide     406330..406482
FT                   /gene_name="MT-II"
FT                   /locus_tag="CAGL0H04257g"
FT                   /product="Metallothionein-2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15114 "
FT   mat_peptide     406348..406482
FT                   /gene_name="MT-II"
FT                   /locus_tag="CAGL0H04257g"
FT                   /product="Metallothionein-2'"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15114 "
FT   CDS_pept        406981..407532
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447820"
FT                   /locus_tag="CAGL0H04301g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG59915.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00003B66BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS12"
FT                   /transl_table=1
FT                   /translation="MLSRISMQKRFLSSTVAKLGKKVYFEPSVNGSRIGRIEFELYDDV
FT                   VPKTAENFRALCTGEKGWGYKGVPFHRIIPQFMIQGGDTDLTNGFGGKSIYGNKFADEN
FT                   FTKTHDKPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKTIESYG
FT                   TMSGQPRAKIVVEESGEIKE"
FT   CDS_pept        407884..409122
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447821"
FT                   /locus_tag="CAGL0H04323g"
FT                   /product="Similar to uniprot|P47160 Saccharomyces
FT                   cerevisiae YJR125c ENT3 cytoskeletal adaptor "
FT                   /protein_id="CAG59916.1"
FT                   /db_xref="HOGENOM:HBG396132"
FT                   /db_xref="HOGENOM:HBG527255"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI00003B66BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS11"
FT                   /transl_table=1
FT                   /translation="MSLEDTLANLSLYDAKKYFRKAQNVVYNYTDMESKVREATNNEPW
FT                   GASSTLMEQIAQGTYNIREREEILGMIFRRFTEKSGSEWRQIYKALQLLEYLIKHGSER
FT                   FIDDTRNSISIVKLLESFHYIDSQGRDQGVNVRNRAAALTALLADDSSIRAERKKARET
FT                   KKKYKGVAGGVTSMNTGLEANTRAGFNSSRSHGISVSADFDSDESDDGVYKSSNRSGGF
FT                   RDNVDDRENSNEGTTTTANVMQSNSDEDFFSSLKKPEVSQNNHANLDEDDEDDDEFTDF
FT                   QTAVPVNSTLNNTATSHGNTTNNNEFDLLGMNMNSTATYPKPSTNDVIPAIAQDKKKDD
FT                   PFSSLFSSAKTLPAEPKKAQTQQNQPISSQTDKADEDEFNDLMSSGPTTTSAQTSAPTP
FT                   SQSNAGEIDLLSF"
FT   CDS_pept        409583..410062
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447822"
FT                   /locus_tag="CAGL0H04345g"
FT                   /product="Similar to uniprot|Q03630 Saccharomyces
FT                   cerevisiae YML077w BET5"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="cis-Golgi network"
FT                   /protein_id="CAG59917.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="HOGENOM:HBG357445"
FT                   /db_xref="HOGENOM:HBG396637"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI00003B66C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS10"
FT                   /transl_table=1
FT                   /translation="MGIHSFWIFDRHCNCIYDREWTLLSNSGSGTINSKQNDETAKLLY
FT                   GMVYSLRTITQKLSHGSMKNEIRTIATGKYLVHIFCTASGLWFILLSDFRQQSYSQVLH
FT                   YIYGHIYVKYVANNLLSPIDFAENKNETRGQGFRKITNRNFIKSLEAFLAPMVAK"
FT   CDS_pept        complement(410256..413093)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142350" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447823"
FT                   /locus_tag="CAGL0H04367g"
FT                   /product="Similar to uniprot|Q03631 Saccharomyces
FT                   cerevisiae YML076c"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59918.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124829"
FT                   /db_xref="HOGENOM:HBG203538"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B66C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS09"
FT                   /transl_table=1
FT                   /translation="MEENCVRADASHTYEPGPNDYVVNNKHLTVIVGVEPDDIRLSQPS
FT                   QLEVNENGNMKRNTFACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIFDLAKRKR
FT                   KRVRRSRHENSVGNNKYQKRKNSRNSESQSSSDNYEEPRVPLAIPNIQQTPISIIENPE
FT                   SIRNQNWPIVDSNQYPKTSITLGQPQSSNDLNAIMRTPTTISVSQRYPQTDINSLLGSY
FT                   PTRNNAYDESTVPLGSNIPLIPTTSNDVVRPSNNTLKTPNVGNVGSLFNNHIDTANPTI
FT                   LSPLQNNTYDRQQYAYSSNSNKGGSHFDSVKSPKNSHINRLTHSFKKQLQSLVYHQKEK
FT                   IETTSTLLGQWAKTWQDMIDRSDLLPVTGDPVSAGIITAEEAELRLERFSTDITFFAGL
FT                   SFINTGNNTNVNIMRTEKPMLFSVVMSCSSILLAPHETNPVTTMRLDTFVLKQITSNIF
FT                   KRRVDAVQLVQSLLILCLWYNFLEWPSRTKYHFFNYVCSIITKELNHRPHPGRVFDVFP
FT                   EKEPQPEYPVYVYRLILLVYITSLNVCIFLRQPLHTPYNECIDIAWKQAARDSKLQITE
FT                   DHKEDAHVLVVFTSLCRVLENIHVKLHELEKNDEFLLYDTSKMIQRYHTQLDELYTEIP
FT                   LNRDRVVAFFYSIKAYLYQYTLEDFIKKNVNSLKKGDPVPDDITAAFKSCYNCCVQCLE
FT                   NFMKLDSKLIASLPLFHSSRMVYIVGLILLKLRFKVVTSAAFHHLLHDTDKAVALVRRV
FT                   ADALEKASKLFPYNYPLYKLQYVVALFCQTYAKRVIEASESSTVKAKSNPHTQFNTQLL
FT                   RNEYASVTKTPVTDTENTVSADVLPFPADSAPTQGKLTRNSTDDSNTPINNDISSGIVG
FT                   YKTEKEDLNGTNNNPNNGLLNPQVKVNLESQTLNSSPSSSLNNFNDYLTDMNSLLWGVN
FT                   TLNDEFWSDLFLPGI"
FT   CDS_pept        414418..414975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447824"
FT                   /locus_tag="CAGL0H04389g"
FT                   /product="Similar to uniprot|P38812 Saccharomyces
FT                   cerevisiae YHR100c"
FT                   /protein_id="CAG59919.1"
FT                   /db_xref="HOGENOM:HBG059228"
FT                   /db_xref="HOGENOM:HBG398571"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B66C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS08"
FT                   /transl_table=1
FT                   /translation="MNFNATFNALRVIYNHSLCIPRLRIATFNQLPIPIKPHIKVVVVD
FT                   KDNCMALQDDDKVWHEYTAKWEELKRVYQDRVLIVSNSAGSSDDKGYLQAKTLEKNTGV
FT                   PVLRHKLKKPGCRDEIIEYFKERGLIEKPDEIAVIGDRLFTDILMANMMGSYGVWIEDG
FT                   VKISNSAFSKLEKNLYTRWTKN"
FT   CDS_pept        complement(415101..418124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447825"
FT                   /locus_tag="CAGL0H04411g"
FT                   /product="Similar to uniprot|Q08162 Saccharomyces
FT                   cerevisiae YOL021c DIS3"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="CAG59920.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG211083"
FT                   /db_xref="HOGENOM:HBG434190"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B66C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS07"
FT                   /transl_table=1
FT                   /translation="MSGGAEVLVRQSKRKKLSDGLAVTQKVFVRSRNGGATKIVREHYL
FT                   RNDIPCLSRACSKCPEIVAPDAHNELPKFVLSEKPEKGKLDGIGEHYAVLDTNIVLQAI
FT                   DLLENPECFFDVIIPQIVLDEVRNQSYPVYTRLRTLCRDSDDRKRFIVFHNEFSEHTFV
FT                   ERLENETINDRNDRAIRKTCEWYADHLKSSGISIVLVSNDRLNRVEANRSNAKEKKYQT
FT                   LNLVEYVEKLPNANEIKDLIPSSNSFDGQDKESISDFSYPEYYTNARIMGGLKNGVLFQ
FT                   GSIQISEYNFLEGTISLPRFSKPVLIRGQKNLNRAFNGDQVIVELLPQSEWKAPSTITL
FT                   DSEHFDVNDNADDGNDEESGDVKGANSAVIMSDKQRRLLAKDAIAAQQSKKVSPTGRVV
FT                   GIVRRSWRQYVGQIAPNSVDLQNGGTQYVFVILMDKCLPKIRIRTRRAKELLDKRIVVS
FT                   IDSWPETHRYPLGHFVRDLGGIETVQAETEALLLEHDVEYRPFSKKVLDCLPSEGHDWK
FT                   APEKLSDSAAIAKDPLLPKRRDLRDKLICSIDPPNCVDIDDALHAKMLENGNWEVGVHI
FT                   ADVTHFVKPGTALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVLWE
FT                   LDQDANIVNVDFTKSVIRSREAFSYEQAQIRIDDPNQTDELTQGMRALLQLSKKLKQKR
FT                   LDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDSFP
FT                   QTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKALADSLDRCVDKNDPYFNTLVR
FT                   IMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIGYE
FT                   PLSLTHRDKTKMDMICKNINRKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVFNN
FT                   GIVVLVPKFGVEGLIRLENLTDDTDSADYDEVEFKLTFTQQGTNAKREISVFDKVEVQV
FT                   KSVLDPVTSKRKAELLLK"
FT   tRNA            418419..418492
FT                   /gene_name="tRNA Val (AAC)"
FT   CDS_pept        419033..421033
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351388"
FT                   /gene_name="INP2"
FT                   /locus_tag="CAGL0H04455g"
FT                   /product="Inheritance of peroxisomes protein 2 "
FT                   /function="receptor activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG59921.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124830"
FT                   /db_xref="UniParc:UPI00003B66C4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS06"
FT                   /transl_table=1
FT                   /translation="MDSGATSFNVLGEWRRTVQSKLLGERHVGFVAEENKLHCGSIKDR
FT                   DSVVLTPIANIQQGTVNYNHMFDNLIWVSDVQFMEELQYTLISSPFLNDIHHHQMPLSV
FT                   ANSIMDFHRDRRFHRESFIFSVPTKLGYLKARYGDKKLELRKNINFMDVHKTVYSILKH
FT                   LRNNNKKCTWRILSVLMIILYLGYEQAHFHNQYPKYSFLTQLKAMMGKLQQFDSIQRKY
FT                   FENINITKEFDKTGNEIFQLLHSITHIASMKLYHLSEFLLRFTNIGKLSKYCGVYGIDM
FT                   NLAYLTNVRILTSTKQELHLLQDKIEFLRKFLLCCFLSVEHQDYNEKVKNIIFSTYLLK
FT                   LFPGYTEDNNCKSLFSSQWSVLSTVIVKFNQDLSFLYSVLNENKELIYSTETREESETD
FT                   EMLKERYKFRYKDKNQSLMLKALSQIHLVEEQLISVQDADDNEETKCLINDHIKNLQQL
FT                   ILCCNNKTNSGTNFSNRHTSLQGKGLFLDVLKSPEEKFTPIFQEMEVSRIGIKNVSDND
FT                   DLESILTDNENYEHIEPAHFIDDRNNGGAFTIYEDSTCYADDCYKNASELRKLNDEQLR
FT                   RKLNEKIQLFATENKKNRNQIRQQKSLELLRSNSTLTALNELKSNTNYESLDKGVKTKK
FT                   RAHFMEQELYSEETIPFYYEINDFLYNQANQ"
FT   CDS_pept        421857..426737
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503620"
FT                   /locus_tag="CAGL0H04477g"
FT                   /product="Similar to uniprot|Q12674 Saccharomyces
FT                   cerevisiae YMR162c"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59922.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059444"
FT                   /db_xref="HOGENOM:HBG676968"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B66C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS05"
FT                   /transl_table=1
FT                   /translation="MTEPDKKRKRSWSLRTQMFNKHLFENYHNDDNVEMNDIDEETEND
FT                   EGHIGDFNSIDGQTKIRNHQSPRLVTKILDMLFDRRTQVHSVDGRHIPISLDHSSAISD
FT                   IYPVDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQM
FT                   IPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDND
FT                   LDLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVP
FT                   ADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDP
FT                   NNDLYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMN
FT                   ALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDA
FT                   GTAPTIMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATIL
FT                   EELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQLSNKNDIDVI
FT                   SIDDQSFLSKLGYTSQSNPKRYMDINDFPDRRTSVEYKGNATVKYTGRPSMRSLYVPPK
FT                   KETNASNSQDASDIPEDIKSTFELIYYIQSNPKSLFAKKAKMFILSLAICHICLPKRTE
FT                   EGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLKTFPDGFDELPRFENFE
FT                   ILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERLHNKEMALDMLDQVENNT
FT                   KYRKDAEAELVIQHRKSLERAVNDDLPRTSLRNSISRGPRESLSLQAARKSMSRKSNQL
FT                   QDPEMQLGTIDQFLDSVQKTDKEIDAVVSQARKSLAKQRLEKYGPRLSMDSPQIVAAEK
FT                   SPQVSNGNDVLLNYIGSDALISNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFE
FT                   QWRTRYHEAKTSLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGI
FT                   KMWMLTGDKRETAINIGYSCKLIHDYSTVVILTTSDENIISKMNAISQEVDSGNVAHCV
FT                   IVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLA
FT                   IGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAK
FT                   FILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLK
FT                   PVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFLNIVAWGETSLSDNTLYP
FT                   LGFVNFSATVALINVKAQFIEMRNRNWLAFTSVILSCGGWLVWCCALPILNRSDGIYDV
FT                   TYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQKSEIRKK
FT                   LELGAYNEMKQGWTWTQDQSTFDKYKDIVFNRSRSASSATEVNSMTNLAHGNSEDDQYL
FT                   SSRFANDDIHTSYSGNSATSPPKPTRGNSLKLLSLNITGNSRSSEEYEVLPSGKLIKRQ
FT                   STELQKATNNSENMASKLTKKLRFKMKDEEDDEEIDRIIRDRMKDLE"
FT   CDS_pept        complement(427509..428207)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233608" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198212"
FT                   /locus_tag="CAGL0H04499g"
FT                   /product="Similar to uniprot|P48353 Saccharomyces
FT                   cerevisiae YMR161w HLJ1"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG59923.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG124831"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B66C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS04"
FT                   /transl_table=1
FT                   /translation="MSYNEEQEKVVLSVLSHDKHAFYDILNVERSSSDVDIKKAYRKLA
FT                   IKLHPDKNPYPKAHEAFKLINRAFEVLSDSQKRQIYDQIGRDPDDRSSGIPSSAAAGGG
FT                   RGAAAYGPGFEEFNPFQQFFFQQRQQQMFPQEDLFDFLFNGGMGGGPGASFSFGGPGGF
FT                   RMYTTGNGPFQRARFRRADPREAYRQQQQRRQGNQENELVNSELYEMLRILAPFLLLFL
FT                   LPLLERFIFG"
FT   CDS_pept        429542..429937
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503621"
FT                   /gene_name="RPL32"
FT                   /locus_tag="CAGL0H04521g"
FT                   /product="60S ribosomal protein L32 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59924.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG069834"
FT                   /db_xref="HOGENOM:HBG497568"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="UniParc:UPI00003B66C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FS03"
FT                   /transl_table=1
FT                   /translation="MAASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRR
FT                   RFRGNISEPTIGYGSNKKTKFMSPSGHKVVLVSNLKDLETLTMHTKSYAAEIAHNVSSK
FT                   NRVTLLARAKALGVKVTNAKGRLALEA"
FT   CDS_pept        complement(430462..431010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447826"
FT                   /locus_tag="CAGL0H04543g"
FT                   /product="Similar to uniprot|P40075 Saccharomyces
FT                   cerevisiae YER120w SCS2"
FT                   /function="structural molecule activity"
FT                   /protein_id="CAG59925.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="HOGENOM:HBG124832"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniParc:UPI00003B66C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS02"
FT                   /transl_table=1
FT                   /translation="MSYFKLIRFIVSNSSHLMLISTASTMYTRIDPEQLVFEDVVQCRR
FT                   VLRVRNVSDENIIYKVRTTAPDLYIVRPNVHTILQGQELELEFVYLGQETSHSGRDKFM
FT                   IITAPVGDTSYDKQVLETDWDKIVSGELKHRAVSKKIPVLMTSEEGVRGAREYIPTRKY
FT                   VIMLCVMLVIVAYILKKLF"
FT   CDS_pept        431195..431647
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447827"
FT                   /locus_tag="CAGL0H04565g"
FT                   /product="Similarities with uniprot|P38175 Saccharomyces
FT                   cerevisiae YBL090w MRP21"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59926.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG124833"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniParc:UPI00003B66C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS01"
FT                   /transl_table=1
FT                   /translation="MLRFYRSFSACRAVLNNGKTINPFDKLADKQSLLTTGMMSGFGMR
FT                   QDKKSNILVSAEDMQLREEALETPIRGVQAGRTVGVINGDTATAVRRLTTKLIANGVPM
FT                   DKRKQRFHMKPGKAAELKRSQRHRRDFKKGFKRLIEIVKDARRKGY"
FT   CDS_pept        431944..433281
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447828"
FT                   /locus_tag="CAGL0H04587g"
FT                   /product="Similar to uniprot|P40074 Saccharomyces
FT                   cerevisiae YER119c"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59927.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG210671"
FT                   /db_xref="HOGENOM:HBG332582"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00003B66CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FS00"
FT                   /transl_table=1
FT                   /translation="MSTARSGVVTLLHTACGAGILAIPYAFRPFGLVPAIFMLLFCGLC
FT                   SMMGLLLQSRIAKYGPLKNVSFFSLAQVVNPASSILFDAAIAIKCFGVGVSYMIVVGDL
FT                   MPKIWSRVSSSGLLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCILV
FT                   IVHFAHQTTELRELKGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFT
FT                   YVRYIAIVSILVAFVLYVVIGSTGYLTFGDNITGNIIALYPDTLSTTIGRIAIVLLVML
FT                   AFPLQCHPARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEE
FT                   CMDTKRFMIITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGYFGWSLIGTE
FT                   YTSNGNQLPLRKSTVIFKYIGLVMTIWGIIIMITSLIASLFFGASH"
FT   CDS_pept        complement(433499..441790)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447829"
FT                   /gene_name="TEL1"
FT                   /locus_tag="CAGL0H04609g"
FT                   /product="Serine/threonine-protein kinase TEL1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59928.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG124834"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR015519"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021668"
FT                   /db_xref="UniParc:UPI00003B66CB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ9"
FT                   /transl_table=1
FT                   /translation="MENYQIRTLQDQLTSSKLRDRNAGLQELQSILKDNPGFIANEQIN
FT                   GLLNTLLSLLENEAGKYIDSIEDDTDSRQRKENISISRFSNITYTLRLFIETVIEKFKL
FT                   SHLKLTISAVKDLFYNDARIIVPVINDVTYCILAIVKSEIFGNKIGPSQWLDVAEYTLW
FT                   LIKITSSNRSNIRALTNSLDTFYVLLIKGSISLSKVAKEALVIITNLIVFEKGETATTN
FT                   VLLSISSNLVARLHCQHYYDTTSLIIECWKLYTRIGKTNNFNLLNDISKIDIFGGGLLQ
FT                   NQIPIMPGQEIMGSRISHSVVLSTLQDYIPMKVKEMLDVDHSLTIGIYDDLNNSNMDLT
FT                   YNTFAKTHCKDLAWLRLFGLYDTLCLYYRLSNQERENNATQILKKIKYEGSLQSNLNQC
FT                   NSLLDYSQSLLESGDPLIQLLGCKLFFLLNLDHPIACNTELIDRLCINTNNISLTSWHL
FT                   ACIFTNISYDLWNFDETLYLKVLKYITPLLSTSEVNIMACLIFNKLLHSLTREPIDELS
FT                   SLVNSIIASPDSVLPIEISSVTCEAWQHIFVFAINNLKVDNSLLLDSFSKWINHNITQT
FT                   IHIEHLKLIFEFFLWSLDVVVGSTSHNKQHNTYNLLNLKTSDSALAIWYFYENQRKFLT
FT                   QTIQTSSQASVNTKSMVCPITSTNIKIQWLLNIIDNYFTTSKNHSLKYTFAISLIYFIN
FT                   FIEKSGKVYTYLNQELNQRLNSILIELDFLSFDKWEEGKQFIEIICNQETFFNRLHNDV
FT                   VFKDNILLSLINLFEKEYSHFLNADNGSTAKTGNDIYLNQRSILRFRTDIKLMTQFFTC
FT                   VDSNVPGKIGIYLDRLLLYSMGPNESLVLDELLSWVTNPSNNQYYEVHSLEKLCQFLAK
FT                   SLLNSKYQLSDFSMIRLGLFLTSTIELWVNVKYNILNSDCNDFLIWITNNLVQNNFGET
FT                   GTFVVLIRLFISVLKHNSTVNSSCAIKTQDLYSMLIFCMRNVAYSTLGNIVDELKAYMS
FT                   KKSHKNRKTILDDLVELFEPMPESVEKAASSCFVLFGLLDCNDTNFVYTLDIFSNYGNI
FT                   PHISFFLKKAVKNYVNNYYQGNKIQLLNVHILEVIRQWTKRNDTDRQLYFNSVIGSLFG
FT                   FGSIQEFERQYNREICALIFSRSDSESLERNFFSDRNTSKCEMLRRSLYLLIPLSYYDN
FT                   GVGDMVFNKLKDSFRGQLESVLSSNFIIVMRYALKLCDCSDYTSVLNEMQRPNQSSSLL
FT                   ELFMDSEMKNAINRMNIYITVHSVIKIFKNCGRSRQTLLLDLRTLILWIISDIQKSESS
FT                   WEQNNHLRQLQLLVFLYEDTFLQSVLHIELMNWLSYLLKIENIEADVFLLLNCLLSLIK
FT                   PNSLDKPDSLTLFFLNVLHFYVRNKECLKIGDEDMNMLSNNLSTVNSIALKLLTNGQVT
FT                   DLIYNQVGDLTSQMYFAEEVELFALLMTFAPPMPDYVSHKMNKKFIEYVYKSNNLIDID
FT                   NFSLWFSDYSTQYSSLILELEENSSFCEKDGFGIDDMEIVYDFSDSAVSAMYSVLFRSL
FT                   ISIKPTIGFKSFALSNIICHLISINILKDKDLLSKFLRATKMKIAFSAKEIDETIIEHF
FT                   GKSNCGCVISEHYLESEFFDTNIPYKDWLVKLCMFFISQISLNSKEIQWFIPLCYESMD
FT                   FCKQNVCIFFLAAFSFDHRRMSSTWKHIFSRLNDLTMASDCLAKLTLLLSFIRLIRSGA
FT                   LQGRKEYSNLYQKIEFKGVIDAALKIKDSKFALQLFEEAYMCENGDYDVALLTSIYEQL
FT                   DDVDMLYALPTPISLNGFIKNANRLSPHSLKALQLNGAYFDANFNHLVDNGSHQLVNTL
FT                   TGMGFNALADIADLRTSCDNPADAYLRCLQLDKWDLPKPKAIDCKIVSFYNTAYDLRNT
FT                   NIEFVDLLQNAEIQLYKAKANFSSKLEWFETIREYVKTKRAIISLKTDTDISRFKIDHV
FT                   INPDRYLENALISDIKINWQFRYLMLKIYVEREKFANEAMKCIPILELIHQTELSVDFH
FT                   IQQTSLSRILSMEAAMKRFHIADTNLVEQLSRHVSYVTALALREFGETKAPLTILSKLL
FT                   SDKSYKLNYNTFVSDDEVRAQLIWDSYQAKVKSGIQIFENDVEHWDVSINNIRSAPDTI
FT                   YKVANFLNLEISRLNGSDQLKEKQKSYRRTRQELKDIESVVKSSNLSNEELLVGQKHYH
FT                   NLKTHMENDRLAIENICLTRKKLIKRALDYYVQILILTNNYDYDVLDRFCGLWFENDDD
FT                   DDINTDLTSKLSQIPTWKFLPWVNQFTSKLSLLKSKFQKQLWYIMKRLLYKLPFETGYA
FT                   VINLQLYEKYSDKLDEKISEKIKAANLIFDQLQNSQISVKEGEYLRTIQEFCYATLEIA
FT                   ELKVKGKNAQISLETLNIGRYWITELPKKNLPLPTVTRTINSSQYTLDSSRNIVKVIGN
FT                   ITITSTGLSLPKVMTLLLSDGSRHKVVIKYGSDDLRQDAIMEQVFQQVNKIFGKDVEMR
FT                   RSDLHMRTYNVVPLGPKAGLIEFVNNSLSLHSILTDIHKDDNYSWLEARRSMKDVQSKS
FT                   DKERILTYLDITKKISPKFRNFFFNSFIDANGWICAKRKYTKGVATSSMVGYILGLGDR
FT                   HLNNILIDTTTGEPIHIDLGIAFDQGRLLKIPELVPFRLTRDIIDGFGITGVEGIFRRT
FT                   CEQVLNVLSRDSEKVMCVLNILKWDPLYSWAVSPFKKHKYMYDDNLEGHMTTATNNSKV
FT                   IERKLTPKLDSDENQQSYRALKGVQEKLDRNGLTIEATVEKLIQEAVDESNLALIFNGW
FT                   SPFY"
FT   CDS_pept        complement(442448..444214)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142347" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447830"
FT                   /locus_tag="CAGL0H04631g"
FT                   /product="Similar to uniprot|P19880 Saccharomyces
FT                   cerevisiae YML007w YAP1"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG59929.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG203368"
FT                   /db_xref="HOGENOM:HBG252482"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR013910"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniParc:UPI00003B66CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRZ8"
FT                   /transl_table=1
FT                   /translation="MAEVDNGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRER
FT                   KERKMKELERKVVDLENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEK
FT                   HKGGAAGAGNGAATGSVSTSTRHTDLAASNANRVSKDSSILPGAKIIRQDLESFNENRH
FT                   FNVTGQLTPPGNTSSSTTANSVAANAKKQSIPHSDSSDSNESKNTWNTDPTSSEDWLDD
FT                   VMTSHKQISRGQSGSGIDFNNFFDEQVSEFCTKLNQACGTKACPIPQSKSAATTPLPGT
FT                   SSNGNSNSPMIINDTMGDVSLNMQGNEHGNATNNLVTDPAFLSNTWDDMSPASNQHSTG
FT                   GAPGFGQLGFGDNLLGNDILFSPNSPAYSPSVLGSGRTQEVYRSPAVQKVVEKENESKS
FT                   VNFPFINSSLAFPGDYDNNFFRETTDLNFDDNDQDDNFTNSNDLVNDYFTTNIPDTDNS
FT                   DSALIANGLVKEEPSMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDE
FT                   DDENDNTVVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINA
FT                   DDVQVALNKHMS"
FT   CDS_pept        445529..446647
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351389"
FT                   /gene_name="ERG6"
FT                   /locus_tag="CAGL0H04653g"
FT                   /product="Sterol 24-C-methyltransferase "
FT                   /EC_number="2.1.1.41"
FT                   /function="sterol 24-C-methyltransferase activity "
FT                   /biological_process="sterol biosynthetic process "
FT                   /protein_id="CAG59930.1"
FT                   /db_xref="EMBL:AAX73200.1"
FT                   /db_xref="GO:0003838"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="HOGENOM:HBG061165"
FT                   /db_xref="HOGENOM:HBG316404"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="UniParc:UPI00003B66CD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ7"
FT                   /transl_table=1
FT                   /translation="MSESELRQRQAEFTKELHGEGAESRTGLTALLSKNRNAQREAVSK
FT                   YLRHWDGKTDKEAEDRRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGENFQAAM
FT                   ARHEQYLAYMAGIKKGDLVLDVGCGVGGPARTIARFTGCNIIGLNNNDYQIQKAKYYAK
FT                   KYNLQDHMDFVKGDFMNMEFEPNSFDKVYAIEATCHAPKLEGVYGEIYKVLKPGGTFAV
FT                   YEWVMTENYDENNEEHRKIAYEIELGDGIPKMFTVDVAKQALKNVGFEVEVSKDLADED
FT                   DEIPWYYPLTGEWKYVQSLSDIATFFRTSYFGRKFTNCMVSIMEKVGVAPQGSVEVTAA
FT                   LENAAVGLVEGGRKKLFTPMFLFVAKKPEDAK"
FT   CDS_pept        complement(447256..448080)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447831"
FT                   /gene_name="TIF35"
FT                   /locus_tag="CAGL0H04675g"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit G"
FT                   /function="nucleotide binding"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59931.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG028217"
FT                   /db_xref="HOGENOM:HBG381036"
FT                   /db_xref="HSSP:2CQ0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017334"
FT                   /db_xref="UniParc:UPI00003B66CE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ6"
FT                   /transl_table=1
FT                   /translation="MSQAAPEIIENPDGTKSIITYKTENGEKYKIIQKVRDVKITERVH
FT                   RSVAERRSWAKFGAEKNSPPGPNNSTTQFGETVELLLDRNWRKIIEARTQKLKASASKT
FT                   ITCRLCGNAHYTMNCPFKTILSEISALEDPAAAAAGPGLPEEVPAGKADSGITATGAYV
FT                   PPSRRAGARDPSSDAYRDARERDDSCTLKILQLNENADENTLRNELLFPFEPIQKVVVV
FT                   RNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRVDWSKPKVPAPQ"
FT   CDS_pept        448407..448619
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000004839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198213"
FT                   /locus_tag="CAGL0H04691g"
FT                   /product="Similar to uniprot|P36533 Saccharomyces
FT                   cerevisiae YML009c MRPL39"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAR57988.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG751058"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI00017BD8AB"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN08"
FT                   /transl_table=1
FT                   /translation="MAKVKAKNTVVKLVSTALTGYSRFISVKKGAPLVTQVRYDPIAKK
FT                   HVLFKESKKRKVPERKPLDFLRTSK"
FT   CDS_pept        complement(449219..452251)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503622"
FT                   /gene_name="SPT5"
FT                   /locus_tag="CAGL0H04697g"
FT                   /product="Transcription elongation factor SPT5 "
FT                   /function="transcription elongation regulator activity "
FT                   /biological_process="mRNA processing"
FT                   /biological_process="positive regulation of transcription
FT                   elongation from RNA polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59932.1"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0032968"
FT                   /db_xref="HOGENOM:HBG189876"
FT                   /db_xref="HOGENOM:HBG396081"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR017071"
FT                   /db_xref="InterPro:IPR022581"
FT                   /db_xref="UniParc:UPI00003B66CF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ5"
FT                   /transl_table=1
FT                   /translation="MSDGSVEPVKADDAVVDSSKRTHEEMSAENTEPVSEQAHGTGSEN
FT                   GDGENSLENSLEKDNAEKDNAESEKGSPSVTETAADDDSSKTDGNGEENQDAEGLAEDY
FT                   DEEDFDEDEDDEDEEPAAKRRQQERNRFLDIEAEVSEDEEDEEDEEDSELVREGFITHG
FT                   EDEDDEEGVAGNRRGDRLHRQLDQDLNKSSEEDAQRLAKELRERYGRSSSKQYRAAAQD
FT                   GYVPQRFLLPSVDTATIWGVRCRPGKEKELVRKLLKKKFNLDRAMGKRKLKILSIFQRD
FT                   NYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPSKSDDVALEEGSYV
FT                   RVKRGIYKGDLAMVDQISENNLEVMLKIVPRLDYGKFDEIDPVTQQRKSRRPTFAHRPA
FT                   PQLFNPTMALRLDQANLYKRDDRHFTYKNEDYIDGYLYKSFRIQHVETKNIQPTVEELA
FT                   RFGSKEGAVDLTAISQSIKKAQAAKVSFQPGDRVEILNGEQRGSRGIVAKSTTTIATVN
FT                   LPEFPLKPLEFPVSALRKIFEPGDHVMVINGEHQGDAGLVLTIKQGQVTFMSNQTREEV
FT                   TITANNLSKSIDSTPTSSEYSLHDIVELSAKNVACIIQAGHDIFKVIDETGKVSTITKG
FT                   SILSKINTSRSRLTTVDSSGNEIKIGDSIVEKIGARREGQVLYIQSQQIFVVSKKIVEN
FT                   AGVFVVNPVNVEAIASKDNMLNNKLDLSKMNPDIISKMGPPKSSMPSAAPVRTGREVAL
FT                   GKTVRVRSAGYKGQLGIVKDVNGDKATVELHSKNKHITIDKRKLTYYNREGGEGITYDE
FT                   LVNRRGRLPQARMGPSYVSAPRHMASGASGVVADNNGALAGGMTPGWGAFDGGKTPAVN
FT                   SHGAGTSGATSAWGGASTWGGQGAGGSSTWGGQGGATSTWGGQGATSTWGGASAWGNKS
FT                   SWGGASTWAASGEANGGVSTWGGGDRSTYGGASTWGNNATGGTSTWGGNNQEQNNGGNR
FT                   SAWKDQGNKSNYGGGSSWGNQ"
FT   CDS_pept        452786..453319
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447832"
FT                   /locus_tag="CAGL0H04719g"
FT                   /product="Similar to uniprot|Q04231 Saccharomyces
FT                   cerevisiae YML011c"
FT                   /protein_id="CAG59933.1"
FT                   /db_xref="HOGENOM:HBG058773"
FT                   /db_xref="HOGENOM:HBG203366"
FT                   /db_xref="InterPro:IPR014841"
FT                   /db_xref="UniParc:UPI00003B66D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRZ4"
FT                   /transl_table=1
FT                   /translation="MSSKVKLTYEQVKKFTEAKIPNEVEDEILTRYAEFSLEGDMVVKD
FT                   MVPYFESLELPRRFYKHVRKDQVVIEGTDIVDFDKLLKLTYHILVFMDNETLIDSLWEL
FT                   LIRSSGKDRNGSVRDIKDHVLSIKDFQKIENYLGDAQNISLIDMVSVATGGKRVYITYL
FT                   DFAYVLGKLGYLRF"
FT   CDS_pept        complement(453435..454148)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447833"
FT                   /gene_name="ERV25"
FT                   /locus_tag="CAGL0H04741g"
FT                   /product="Endoplasmic reticulum vesicle protein 25 "
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59934.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="HOGENOM:HBG559015"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI00003B66D1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ3"
FT                   /transl_table=1
FT                   /translation="MFKLLFGGTRDQQGAASFFGDNNEIVKYVMKFLLLLLLAPFISAL
FT                   RFDLKAESKPEQMCIRDFVSEGELVVINIDTDGSLNDGNVLNLYVHDSNGNEYRRLKNF
FT                   VGEQRIAFTAPATTSFDVCFENTLDSNRGNRNAKRAIELDIESGSQARDWNKISATEKL
FT                   RPIELELRKIEELTDEIVDELNYLKNREERLRNTNESTNERVRNFSVLVIIVLTSLGAW
FT                   QVNYLKNYFKSKHII"
FT   mat_peptide     complement(453525..454103)
FT                   /gene_name="ERV25"
FT                   /locus_tag="CAGL0H04741g"
FT                   /product="Endoplasmic reticulum vesicle protein 25 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ3 "
FT   sig_peptide     complement(454104..454148)
FT                   /gene_name="ERV25"
FT                   /locus_tag="CAGL0H04741g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRZ3 "
FT   CDS_pept        454589..455740
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447834"
FT                   /locus_tag="CAGL0H04763g"
FT                   /product="Similar to uniprot|Q01560 Saccharomyces
FT                   cerevisiae YDR432w NPL3"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG59935.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG124835"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B66D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRZ2"
FT                   /transl_table=1
FT                   /translation="MDKPVEDQEVPQQEQEDVPPPPPAEAPQEQEQQQEQEQPQEQEQE
FT                   QQQEQEQPAEEMNVEHQDAPVHHEPMPYESQFPEPPQPYYNQPPQGVPTFHQQEGELSN
FT                   TRLFVRPFPLDVQESELNEIFGPFGAMKEVKILNGFAFVEFEEAESASKAIEEVNGKTF
FT                   ANQPLEVMFSKMPVKRFRITLKNLPEGCSWQELKDLARENNLETTFSSVNSRDFDGTGA
FT                   LEFPTEEIMNDALEKLNNIEFRGSVISVEIDDNPPPIRRSNRGGFRGRGGFRGGFRGGF
FT                   NGPRGGFRGGYGGPRGGYGGRGGFNGPRGGFRGGYNSGGFRGGYGAPRGGFGQGPRGGY
FT                   GAPRGGYGGSRGGYGAPRGDYGAPRDSYRTRDAPPRERSPTRQ"
FT   CDS_pept        complement(456705..458723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503623"
FT                   /locus_tag="CAGL0H04785g"
FT                   /product="Similar to uniprot|Q04228 Saccharomyces
FT                   cerevisiae YML013w"
FT                   /protein_id="CAG59936.1"
FT                   /db_xref="HOGENOM:HBG058772"
FT                   /db_xref="HOGENOM:HBG203365"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI00003B66D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRZ1"
FT                   /transl_table=1
FT                   /translation="MPIINHAGEEFHLSHEEEEKLNNFQGITNFPEDDLPLVIKLLQNH
FT                   GWNLEAALSRYFDDEWKESVKLINSGAHSSAEFATGRVPENIAIPMRNDTPIDIPNVET
FT                   PSFFHDEIMRNEASPGPFLGSHYVPSLPLIRKLPTNYRDNLKVVGLTTGVNVWDIYNLT
FT                   ASGTTNELLGPLIVILLLVPKIVLRAGLSLFSLLWGIIAFGFTNNLNNDSKSKVYHIPN
FT                   APLKKYFENPEQKTEQSYAEIVKGYMATHIDDDNKISMIESLLPNENKNFNDLLEEAQS
FT                   EFKYLLVLLLGNLDSYSPSQLEGKKLSKDVTDIDINSHRFLNRVLIDDAVLKTLADYKD
FT                   ELLVYVGSVSDVEPWFISQELKLKYTPDSFLVANVLNSNGSVNGSTRLSILSKIRMTSA
FT                   KRFSSSLKNTIERYRPELLVSRTDVQELRLAREIKQKQEEAYQNSLMQDRNKEEKRLQE
FT                   EKERKELETMLAKKQREQALLTALHELRWLSKCIEKTTHLQQQNSISNGGNKNIATLQI
FT                   RTADGKRIIKKIAGDMTLRSLYEEIGCHLYLELQDEDQRKWLQQIQSKLCDIRDNSDSS
FT                   SILISLTETDENSIEKLMDIVHNEMHSIFDELPPNLRGVEDLEIKFELISPFPRTNIPM
FT                   DENKVISDIKDIWPKGNLLVEHIDEDLSTSESDDETN"
FT   CDS_pept        complement(459074..459883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209191" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351390"
FT                   /locus_tag="CAGL0H04807g"
FT                   /product="Similar to uniprot|P49957 Saccharomyces
FT                   cerevisiae YML014w"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAG59937.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG269993"
FT                   /db_xref="HOGENOM:HBG607740"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI00003B66D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRZ0"
FT                   /transl_table=1
FT                   /translation="MADLKEEEYVHKVYNEIAPHFSETRYKPWPIVTDFLMTRPMGSVG
FT                   IDVGCGNGKYLNVNPNIYIIGSDRSSGLIQCAHEIDPINYNVLVADGMRLPHLDNRFDF
FT                   AISIAVVHHWTTRERRISAIKHILSKVRSGGQALIYCWALEQGNSRRGYHEGMEQDVLV
FT                   PWVLQEKKKKEPTKKQSSQRAKPDLTNVAPQDRAAFVANWKKEQEQLRLKEEEAKQKNE
FT                   EQKEDVKYRFYHLYKKGELEEDCEAAGAIVVRGGYEKDNWYVIAQKA"
FT   CDS_pept        460201..461295
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503624"
FT                   /locus_tag="CAGL0H04829g"
FT                   /product="Similar to uniprot|Q04226 Saccharomyces
FT                   cerevisiae YML015c TAF40"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59938.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG058771"
FT                   /db_xref="HOGENOM:HBG203364"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B66D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY9"
FT                   /transl_table=1
FT                   /translation="MATTQGPLDTIPKANYPPLLTKANYMSTKQLINEVLSEDREYVTW
FT                   KLNQLRTGGNDAPGAKLLQTVAHHNNRQFHKKNAKVMKKRYPNQISGVPPNLTFVQDLY
FT                   EKEMKKESEDIDKSLREMHQPSIPADEQFKLLVTNLDEDQTNRFEVFHRTALSKTQVKK
FT                   LATTVVNQSINENIRVFLQAIGKIFAGEIIEKAMEIKEKWLLSLMHREFDRKEETAMRL
FT                   KKLLKKLTKMVDKNGIVGDDEPGNGMELTAHDLNNEYPSSVDEEEEDIYLDDEPDAMKK
FT                   IQDVNSLLRSQENTAEIRLRLISHYNELVRQFNELDVSVEKYNSSPLLPEHIREAWRLH
FT                   RLQSETIPPASWRTQGSGNGQMFR"
FT   CDS_pept        462566..464314
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447835"
FT                   /locus_tag="CAGL0H04851g"
FT                   /product="Similar to uniprot|P26570 Saccharomyces
FT                   cerevisiae YML016c PPZ1"
FT                   /function="cofactor binding"
FT                   /function="magnesium-dependent protein serine/threonine
FT                   phosphatase activity"
FT                   /protein_id="CAG59939.1"
FT                   /db_xref="GO:0004724"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="UniParc:UPI00003B66D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY8"
FT                   /transl_table=1
FT                   /translation="MGNTTSIESKIDFGQNRHVKPHLKNNNHVDDIYKRDTLPPSMAQM
FT                   EPRSPILVVNGKHLTDIKEIANISSQIPETMMAANAEAASLQESLSNEERAAYLPTFSK
FT                   SSSYVSSLHSRKSSLLSNSTTLGTPATSPGLNESSSSLANDYFASKRRPSLPDQTLGQH
FT                   LTRPSLLDSHRSYSSDNCLSTINSNSTELQNTTTHHNDRLRDIFPFSRPKSPNGFEIRI
FT                   PLSSDDVSSSSESKLSLHRHHSSKDIPGDQTGYVMINGKRKKQVNIDEAIQRLLDVGYS
FT                   GKKNKAFCLKNSEIIQICIQAREVFLNQPALLELSAPVKIVGDIHGQFQDLLRLFTKCG
FT                   FPPSSNFLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDE
FT                   CKRRCNIKIWKYFIDTFNTLPLTAIVAGKIFCVHGGLSPVLNTMDEIRNMSRPTDVPDF
FT                   GLINDLLWSDPIDSPNEWEDNDRGVSYCYNKVAINKFINKFNFDLVCRAHMVVEDGYEF
FT                   FNDRTLVTVFSAPNYCGEFNNWGAVMSVSQELLCSFELLDPLDSNSLKQVMKKGKQERD
FT                   LANSFD"
FT   CDS_pept        complement(465069..466424)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198214"
FT                   /locus_tag="CAGL0H04873g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG59940.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124836"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B66D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY7"
FT                   /transl_table=1
FT                   /translation="MAVEGMVDFSKSPNDHQNITLPPISSFDNLIKAAEKQYMGERLTP
FT                   VPSGIFTALGNRVKSREVINPIGTRNNSGILSYQFLSESPLGPSRMHSKIDLNMIHSDT
FT                   TSEIDSISASKSTIRNSVFPIEAFNSEKRNSTGRVPLIKPTWCSLNDSEQSSTQSSRTT
FT                   SAEISRSNSSIQLPSLSFNKKNVVMSNSDNSTEAMQGNALTPNSIEYSHKPILEAIDKM
FT                   KALESLKEEPHPSIFSEEHTPPTLSVPSVKTDMKVTKKRRRKQCPICHGFFANLTTHKA
FT                   IHLEPDIKPFVCSVCQRGFVRQNDVMRHEKMHWKDKILSSAVKSEDNKSGVTGSKLTIA
FT                   DKEHLKSLHCIKGTYECPYNSALIELDLELYPYKGKEVNFITTQCHKTGVFSRCDTFKN
FT                   HLKALHFEYPQGTRRSERSFVSGKCKHCNMSFANVDEWINEHVGKNCGHTYH"
FT   CDS_pept        complement(468101..468802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047113"
FT                   /locus_tag="CAGL0H04895g"
FT                   /product="Similar to uniprot|Q12318 Saccharomyces
FT                   cerevisiae YLR376c"
FT                   /protein_id="CAG59941.1"
FT                   /db_xref="HOGENOM:HBG124837"
FT                   /db_xref="HOGENOM:HBG202565"
FT                   /db_xref="UniParc:UPI00003B66D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY6"
FT                   /transl_table=1
FT                   /translation="MEILKHCRIYPISSFCATTETYFKIPEDLVNQHLALRTRKLGHIH
FT                   VVEHSFRLSKVKKKLITTNLDENSGLILLIDVISCWKQFARSLVNNGQSIAYLSSASLC
FT                   QFDGLLNFLGQLIDSPDEALKRCIFTDSYSCLQQPLTGIIIDNLSYYQTPVAMREFSAL
FT                   QKMLKSLRSTFGCWTMTTSYGLEYYNGVEGGTSTLYTSSGTSFTRLPVSYIKDTDLVLM
FT                   RDTEDTYHLVK"
FT   CDS_pept        469160..470116
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154339" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503625"
FT                   /gene_name="SLU7"
FT                   /locus_tag="CAGL0H04917g"
FT                   /product="Pre-mRNA-splicing factor SLU7 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG59942.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG124838"
FT                   /db_xref="HOGENOM:HBG203150"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="UniParc:UPI00003B66D9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRY5"
FT                   /transl_table=1
FT                   /translation="MHNKKVTKDEKKNTKTKDVNEHIPNYIKNLPWYYQDIDKNSKNNS
FT                   KEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEFEVIVENKKTTIDGIIKRRKDEKD
FT                   WDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEESAYDTDEEIEMMKLGLTPKDLEQ
FT                   NIKGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTGEGKE
FT                   LNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLEVLRKQKELDSLKLTEEQNRQ
FT                   EQRKLKRKAKLLKKKAKKPKGTPQSDSTKAQLMDMYG"
FT   CDS_pept        complement(470386..471423)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503626"
FT                   /locus_tag="CAGL0H04939g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="fructose 1,6-bisphosphate 1-phosphatase activity"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59943.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="GO:0042132"
FT                   /db_xref="HOGENOM:HBG000332"
FT                   /db_xref="HOGENOM:HBG731261"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="UniParc:UPI00003B66DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY4"
FT                   /transl_table=1
FT                   /translation="MPVATERRASMDDFDTDIITLPRFIVENQKTVKTARGDFSLVLNA
FT                   LGFAFKFISQTIRRAELVNLIGLAGASNSTGDEQKKLDVLGDEIFINAMKGCGFIKLLV
FT                   SEEQEDLIVFPTETGTYAICCDPIDGSSNLDAGVSVGTIVSIFKLLPGSTGSIKDVLRS
FT                   GHDMVAACYAMYGASTHLMLTMGNGVDGFTLDTNLGEFILTQPNLRIPQLRPIYSVNEG
FT                   NRLYWDELIVSFIDSLKEGQESNKGKPYSLRYIGAMVADVHRTFLYGGLFSYPGDRLKP
FT                   DGKLRLLYEAFPMAFLVEQAGGKAVNDQGERILDLVPKHIHDKSSIWLGSSGEIDKFLK
FT                   HIGKE"
FT   CDS_pept        474182..475621
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351391"
FT                   /gene_name="SEC61"
FT                   /locus_tag="CAGL0H04961g"
FT                   /product="Protein transport protein SEC61 subunit alpha "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59944.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG436076"
FT                   /db_xref="HOGENOM:HBG589438"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniParc:UPI00003B66DB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRY3"
FT                   /transl_table=1
FT                   /translation="MSDRILSLFKPFEAFLPEVISPERKVPYNQKLIWTGVSLLIFLVL
FT                   GQIPLYGIVSAETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQLLQVSL
FT                   DSKEDRELYQIAQKVCAIILTFGQALVVVMTGNYGSPSDLGIAISLLLIFQLMFASFIV
FT                   LLLDELLTKGYGLGSGISLFTATNIAENIFWKAFAPTTVNSGRGKEFEGAVIAFFHLLA
FT                   VRKDKKRALVEAFYRENLPNMFQVIATVFVFLFVLYLQGFRYELPVKSTKVRGQMAIYP
FT                   IKLFYTSNTPIMLQSALSSNIFLISQILFQKYPSNPVIRLFGVWGIRPGTNGPQVPLSG
FT                   ISYYLQPIGSLKMALLDPIKTVIYTAFVLGTCALFSKTWIEISGTSAKDVAKQFKEQGM
FT                   VINGKRETSVYKELKKIIPTAAAFGGATIGALSVGSDLLGALGSGASILLATTTIYGYY
FT                   EVAAKEGGFTKNLVNGFSEMM"
FT   CDS_pept        477828..478913
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000283479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447836"
FT                   /gene_name="MPG1"
FT                   /locus_tag="CAGL0H04983g"
FT                   /product="Mannose-1-phosphate guanyltransferase 2 "
FT                   /EC_number="2.7.7.13"
FT                   /function="GTP binding"
FT                   /function="mannose-1-phosphate guanylyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59945.1"
FT                   /db_xref="GO:0004475"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG495575"
FT                   /db_xref="HOGENOM:HBG688195"
FT                   /db_xref="HSSP:1J2Z"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniParc:UPI00003B66DC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRY2"
FT                   /transl_table=1
FT                   /translation="MKGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEAG
FT                   VTDIVLAVNYRPEVMVDTLKKYEKEYGVNITFSVETEPLGTAGPLKLAEKILKKDNSPF
FT                   FVLNSDVICEYPFKELAEFHKSHGGKGTIVATKVDEPSKYGVIVHDLGTPNLIDRFVEK
FT                   PKEFVGNRINAGLYILNPEVIDLIEMKPTSIETETFPKLVNEKSLYTFDLEGFWMDVGQ
FT                   PKDFLAGTGLYLQSLSRRHPEKLSTGSNIVSNAIIDPTAKISPDAKIGPDVVIGPNCVI
FT                   GSGVRIVRSVLLKNCVVKENSLIKDTIVGWDSTIGRWCRLEGCAVLGHDVAVKDEVYVN
FT                   GAKVLPHKSISANVPSEAIIM"
FT   CDS_pept        479837..481195
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447837"
FT                   /locus_tag="CAGL0H05005g"
FT                   /product="Similar to uniprot|Q06705 Saccharomyces
FT                   cerevisiae YLR380w CSR1"
FT                   /protein_id="CAG59946.1"
FT                   /db_xref="HOGENOM:HBG324518"
FT                   /db_xref="HOGENOM:HBG540797"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI00003B66DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY1"
FT                   /transl_table=1
FT                   /translation="MTTSKDTMSSNKKESHLPLEREVVLSPEKELLLKQAWVYLLQLWG
FT                   VSVNGDIVFKDAHHGDIDGLSTQMSALSTGSSEPKKKKTSLFGRLTGSDHHDTSKHATH
FT                   ETEHHTRHTQIPYVKDGVHPEFTKLELDSKATYKEFWESLRLEPADPNILRFLKARKWH
FT                   MDKTIHMIAKDMSWRTKSGYDINSILDGGEYEFVKTKKKGVIKNLELQKAIVAGKDKDG
FT                   KPYILARPKLHYSSDQTEEEIEKYALLVIEQAKLFLRPPEIAQCSIVFDLGGFSMSNMD
FT                   YGPVKFLITCFEAHYPECLAHLFIHKAPWIFTPIWNIVKNWLDPTVATKITFTKNVEEL
FT                   ARYIDIKQIPTYLGGELDLDMEHYEMPDGSKDELLRDEETRDKLLKEREQLIQNFLKLT
FT                   AEWIESDDNEKQSISIRNKRALASEKITQNYIQIDPYIRSRSAYDISGALVLQ"
FT   CDS_pept        481654..483762
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447838"
FT                   /locus_tag="CAGL0H05027g"
FT                   /product="Similar to uniprot|Q12748 Saccharomyces
FT                   cerevisiae YLR381w"
FT                   /protein_id="CAG59947.1"
FT                   /db_xref="HOGENOM:HBG124839"
FT                   /db_xref="UniParc:UPI00003B66DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRY0"
FT                   /transl_table=1
FT                   /translation="MEPLISTAIDNLLSANATVTTDFIKVQLEIIYHQTIKFGLTNLEL
FT                   RNIIHFITTTQLITDETKLYIIHNCLYPCEVIGKEVVMEILSKLGTTTIYSPYELTTPK
FT                   TVQTALCEWLVNAFFLVDIEQIREFDSFWIHLWKYSYLQKWLTYIIVWTANPHNVKQWK
FT                   IRMIHNIAINLGYSESSGYAVIILKKYQQICGYSAEINDILPTLRFPYRRIIKVQNIKL
FT                   RNRFFKNTSDILITSTPDTFNMEKLENRMQMLINSLLIDEIKSSQGVKPSIIDKNIDIE
FT                   LLIPKNSTQLIDRWNLMQPSDIVISSELFHPNNKINYYILAFISTKRSPQFVEDYITDY
FT                   FMRHLSDNEDNFGNAYKSFLAFVKLLLLIYPNISLSLTKTIGNGTQYDVKKSVLMGVLP
FT                   AILPKSKINIECIQKCIFNIISSNFNTQNLLSQKSLNLSVVTTRLYFDLYFLIFLNSEL
FT                   AADLSSLFHRAGTLGFRRTIETTYNFGDISSSVYYLNLVTSIIDSNELYKSVPGLIIKP
FT                   NILKSLIMVFDPLLLNSCCKYLTQSKGALSVNIQDKDLIRCHNQLLLDTTNYLWRNKIL
FT                   SSRSLFDISTKFIKQVVDNLYLPDCDKKDKNVFGLPGVPTTGFVFLQAVRRLEGTHGAR
FT                   SHYNTDYTSSGFKKFKSNQEEKGDWLHDIEDFDEFRRVVLKEFTSIDCVKEIAVFLYTF
FT                   LKSLTSNL"
FT   CDS_pept        complement(483870..486593)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503627"
FT                   /locus_tag="CAGL0H05049g"
FT                   /product="Similar to uniprot|P11325 Saccharomyces
FT                   cerevisiae YLR382c NAM2"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59948.1"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG521010"
FT                   /db_xref="HOGENOM:HBG693845"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B66DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX9"
FT                   /transl_table=1
FT                   /translation="MLVKIWPSQRSIVRIAAAGLQNSRSVHSGQTISERLVEIGEKWKS
FT                   KTLEGVPRNARVPFIPIKENDKRDMYILSMFPYPSGMLHMGHLRVYVISDTLNRFYQQR
FT                   GYNVIHPMGWDAFGLPAENAAIERGIDPSEWTKQNIKKMKEQMNDMLANFNWEREVTTC
FT                   DPEYYKFTQWLFLQLYKNGLAYRKDAEINWDPVDKTVLANEQVDANGRSWRSGAIVEKK
FT                   KLTQWFLGITKFVDQLRDDLKYLEEWPNKVKTMQNNWIGSSTGMEVNFKLNKKIGKFEN
FT                   VTVFTTRAETLFSVEYVVLATDHPITQHYAKQKSDLREFLHKLPELPEDTKTGYRISDL
FT                   TVENPITHEVIPVFVAPYVISGYGDLPAAVMGCPAHDLRDYEFRKINLNTNEEPFGCII
FT                   PDLSRLGQDSIPYTSKSGTMNERCGKYVGWDVNATRDAISTELENKNLGKRTTRYRIKD
FT                   WLISRQRYWGSPIPIIHCNNCGIVPVPEEDLPVTLPYVQGLHQKGNPLSNISDFVNTEC
FT                   PRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNKVLPFSPEKANKSMPVDIYIGGVEHAI
FT                   LHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVTQGMVQGKTLIDPETGKFLTPNDIDY
FT                   LSSSSTPKIKGKNIAPILKYEKMSKSKYNGADPNECISKHGPDATRAHILFQSPISDAL
FT                   RWDEEKIVGIERWLDKILQLCMSFASNPDKIVGMTGIPPDQYNTDEITLYNNVSKMVNS
FT                   ITKSFSENLSLNTVISDYMKLTTLLENAKKNTKIRDTVTINYVRDLIKCIYPVVPSIAE
FT                   EASCILQTHLNVNVNIYEWPTAREVIKSSLMNLKIFINGKMRFMYATDQSISKLDDMSL
FT                   LKLLSKTEDGARLIPAKKLKQIIRKKDLISLIFEKQ"
FT   CDS_pept        486899..490231
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503628"
FT                   /locus_tag="CAGL0H05071g"
FT                   /product="Similar to uniprot|Q12749 Saccharomyces
FT                   cerevisiae YLR383w RHC18"
FT                   /function="ATP binding"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAG59949.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="HOGENOM:HBG059053"
FT                   /db_xref="HOGENOM:HBG202567"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniParc:UPI00003B66E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX8"
FT                   /transl_table=1
FT                   /translation="MTQELRKRSFEHVDELLNQASNEVNYDSNKRVRRHEYSAMTQYSS
FT                   MPNSRVDTEADAALGRRVDCAHRDIGLISPPPGYIKKLTLHNFMCHRNFDVELGPGLNF
FT                   IVGKNGSGKSAILTAITIGLGAKASETNRGSSLKDLITAGCNSSRITIYLSNSGIGAYV
FT                   PKGKQYGDTIIIERTISRTSTAGFSLKSENGTEISNKKRDLQEILDYFAIPISNPMCFL
FT                   SQDSARSFLTASTPTDKYNHFVKGTLLQQIKDYLERATEVHNESAAAMELHTESLRELQ
FT                   ERYDKAKTDLRQISKTSDLNERLKLLTGKSLWLNVDENVMNINKLKNKISHYENEISKL
FT                   TEKSDSRMNQIDSLKSEITIIEQGLSGKLSKMVEKEEQFQLMNEKIREAKSKYEQEENN
FT                   EKEILDNIERCKSIIKKLNKSISELQEKQEKEQGGDKDNMLQEIEKLTASNSELKKDIE
FT                   AYMTKIQDINAKLRTVKMESLKTIDSIDTQIREKQNEVKDIKHGRTNFLRNFDNNMEHL
FT                   IKEISNNKSKFDNLPIGPLGNYVSIKSGYEKWAPSIQRYMTTTLSSFVVSSHRDNGLLR
FT                   QLMKKCNVRSSNFSIINYKLQNAHFFDNNKLNQKYPTILDALDFIDGNLAAVFVDMNKI
FT                   DRVLLIENMSEARKFLLENGGDTKVALSIRDNNYGYQLTGGTRIDSVKYQDKIRVKVGT
FT                   SSEDNIAYINTVIRNLQEEKQSTQSRYKDRLQIINNELKECETALVHTKDTYRANNEKI
FT                   KSFKTNITREVDTGKLNMQIEEKKNQEVAVESYLETRKSIQLHLADMVEDIKPLQEQYM
FT                   IYKNELDQSKTEIENDRELLRRSKDKILKYQDHIKELLESVKNIEKNIPKIADNIRVLE
FT                   DGVGLQKQKAQEICPRAELSNDLPHSQEEIKQEITNIQQKLQEAEKMMGMSQQQIVDNY
FT                   NNAKTKFIDASKKYKVIEEVLGKLTRTIKIREQNLERTQQITFFEADNDFKASMRIRKF
FT                   AGHLDFDKKEKKLSILILTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALD
FT                   EFDVFMDQVNRKIGSKLIVKKLKDIPNTQTIIITPQDIGGIAEIDDSVRILRMRDPKRT
FT                   TIN"
FT   CDS_pept        complement(490310..494308)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447839"
FT                   /locus_tag="CAGL0H05093g"
FT                   /product="Similar to uniprot|Q06706 Saccharomyces
FT                   cerevisiae YLR384c IKI3"
FT                   /protein_id="CAG59950.1"
FT                   /db_xref="HOGENOM:HBG059056"
FT                   /db_xref="HOGENOM:HBG396953"
FT                   /db_xref="InterPro:IPR006849"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B66E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX7"
FT                   /transl_table=1
FT                   /translation="MRNLITLNKGRLLPVATSELSENETVFTVLDSTFDTMTDSITCVL
FT                   GSLEMGAIEVQQFMKDGSRNVLASFNIQNFNDRLLSFIHFGDINQLVFIFEMGDIITAT
FT                   YDSVTFDPAQTIVEIAGSIDNGIYAAQWSPDEETVVLITKDRNVVLLSRLFEPIAEYHL
FT                   ETDDLKKSKHVTVGWGKKETQFRGKGARAMEREALASLKASGLVGNELRDPTMPYMVDS
FT                   GEITSLDSKEVTITWRGDCEFFAISTIENVELPEEPGHEIQRRAFRVFSRDGVLDSASE
FT                   PVDGMEHHLSWRPQGSLIASIQRKSFLEEESSLELIFFERNGLRHGEFDTRLPVDEFVK
FT                   ELCWNSNSDVLAIVLSNRIQLWTSKNYHWFLKQEIYSESISFAKWHPEKDLTLMFESGN
FT                   GVNIVDFAYKMTNGPTLEPFDNGTVMVVDGSTVNITPFALANVPPPMYYRDFDAPGNVL
FT                   DVACSLSNEIFAAITIDELVVAYVPSIDDMKKGQHPTVVSELSKATFASAIDSLRQVAF
FT                   INDNVIGILLDSENLSHIVLVDVQDVSQPVLLKTVEIFDKIVLMKTSFDYNHIVYETRD
FT                   GSVFEVDVEGELKQITKFPQLVIDFRVKRVHNMLEGKEDNWESESSEVIAFGLTSFGKL
FT                   FANNTLLTTAVTSFEVTDKFLMFTTAQHRLQFVHLNNTNFKQLPIVPDQVEDERIRAIE
FT                   RGSLLVTSIPSRAAVVLQADRGNLETIYPRIMVLSEVRKEIKDQKYQEAFLTCRTHRIS
FT                   LDLIHDYDPDSFISNLDNFILQVEKVDHLNLFISCLTEDDVSSTKYKETLTSDMALPYA
FT                   VAAEPLTEMQEYMKKKMFDPATSKVNKICKAFLDTLLSKDEYMKKYINTILTAYATQNP
FT                   QDLESALLLIASLSTEEDKDSSVTYLCFLQDVNVIYKSALATYDVKLALLVAQKSQMDP
FT                   REYLPFLQSLYEETENRRKYMIDDYLGNYEKALGHLISTESDSTIVSDEIINYVETHNL
FT                   FLNALATFRYETNKQNMIYKSYAKDLQSKQEYKDAAIIFEMLGEYQNAVNAYKSAKSWK
FT                   PALSIAELKFPDDVQELANDLVSSLTFEHKYEDAAQVELIYLKNVREAVKYYCKSYKYD
FT                   TAILTATNTNNIKFIEEIVDTELADGFGVIAELLADCKGQINSQLRRLRELRTKKEEDP
FT                   YAFYGQETEQADDVSIAPSETSTKESFFTRYTGKTGGTAKTGASRRTAKNKRREERKRA
FT                   RGKKGTIYEEEYLIQSIGRLIERLNQTLSDSYNLVEALCRRNKREQAYQIQKNFLEVIQ
FT                   LLNENVKEIYSISEKDRERIDENGEVYLIPEMKIPEIPVFTINRAVSF"
FT   CDS_pept        complement(494729..495118)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447840"
FT                   /gene_name="SWC7"
FT                   /locus_tag="CAGL0H05115g"
FT                   /product="SWR1-complex protein 7 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59951.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124840"
FT                   /db_xref="InterPro:IPR020195"
FT                   /db_xref="UniParc:UPI00003B66E2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRX6"
FT                   /transl_table=1
FT                   /translation="MTESEYSSKVRLLILQILLQHQQSLVMKNKDLDIKKLLVEPVIDI
FT                   EVMNNCQSNTFLKLNAPTVSKLTVRNLRFLVEEWLSEGIPNVPKEETTIITLANYYYSK
FT                   RINELEEKELPTIRSEAKELFDRLK"
FT   CDS_pept        complement(495715..497208)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198215"
FT                   /locus_tag="CAGL0H05137g"
FT                   /product="Similar to uniprot|P54115 Saccharomyces
FT                   cerevisiae YPL061w ALD6"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG59952.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B66E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX5"
FT                   /transl_table=1
FT                   /translation="MAYKTAATKTIKLPNGLTYEQPTGLFINNEFVESSDGKTMTIENP
FT                   STQEPIVDVFSATKEDVDYAVDCAERAFEKSDWATQDPKVRARYLSKLADLMEEQLELI
FT                   ASIETLDNGKTIALSRGDVQLSINCIRDAASYADKVDGRSIDTGDGYMNYTIREPIGVC
FT                   AQIIPWNFPLMMLSWKVGPALAMGNCIVLKPASATPLNALYFSSLCKQVGIPAGVVNII
FT                   PGPGGMVGTALTTHPKVRKVAFTGSTDIGKDIAVKASASNLKKITLELGGKSAHLVFND
FT                   ANLEKTLPNLVNGIFKNAGQICSSGSRIYAQAGIYDRLLKEFKAYIEKNIKVGNPFDES
FT                   NFQGAITNKEQYNTILKYINIGKEEGAKVLTGGETAAEKGYFIKPTVFYDVKEDMRVVK
FT                   EEIFGPCVTISKFEEIEDGVAMANDSEFGLGAGIETENLSTALKVAKMLHSGTVWINTY
FT                   NDFDSRVPFGGYKQSGYGREMGSEVYECYTQTKAVRIKL"
FT   CDS_pept        complement(501094..502551)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047114"
FT                   /gene_name="TIM50"
FT                   /locus_tag="CAGL0H05159g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM50"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG59953.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058716"
FT                   /db_xref="HOGENOM:HBG395644"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B66E4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRX4"
FT                   /transl_table=1
FT                   /translation="MLSLFRCAVTRAPHIASKGISVQISRNLANSLIVQNKRRLNTKSY
FT                   FLQEQKKDDKKAQSILTDDLLFKAGIDVEEGKKEGQQKQHETEEGNEEQQSENSSNKKR
FT                   KRRMTSADKKKERYANYFYIFTFSSLAGLGLYMCRDWEENEDDEMKKDIDNGYTPDLMY
FT                   KRFRARFNSVFTYFQEPPFPDLLPPPPPAPYQRPLTLVITLEDFLVHSEWDQKHGWRTA
FT                   KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCVYKDGVH
FT                   IKDLSKLNRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADDKLLRLIPFLEYMATQQ
FT                   VEDVRPILKSYHNKRELPAEFEQRVQKLKNKFEQDQKKKNDSNWLLKLLGLAPVINGIG
FT                   GGNKFPLDMIREEGEKNYVRFMKLIEEEKEKMRIQQEQMSGQTFTLKDYVEGNIPTPEE
FT                   QMKMQLEKQKEIDALFEQKKKEQQANK"
FT   mat_peptide     complement(501097..502446)
FT                   /gene_name="TIM50"
FT                   /locus_tag="CAGL0H05159g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM50"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRX4 "
FT   transit_peptide complement(502447..502551)
FT                   /gene_name="TIM50"
FT                   /locus_tag="CAGL0H05159g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRX4 "
FT   CDS_pept        complement(503256..503948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047115"
FT                   /locus_tag="CAGL0H05181g"
FT                   /product="Similar to uniprot|Q02767 Saccharomyces
FT                   cerevisiae YPL065w VPS28"
FT                   /protein_id="CAG59954.1"
FT                   /db_xref="HOGENOM:HBG023306"
FT                   /db_xref="HOGENOM:HBG559171"
FT                   /db_xref="InterPro:IPR007143"
FT                   /db_xref="InterPro:IPR017898"
FT                   /db_xref="InterPro:IPR017899"
FT                   /db_xref="UniParc:UPI00003B66E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX3"
FT                   /transl_table=1
FT                   /translation="MNQIPTALNEEVPLFENSSSSQDKETLEGVADVYSIIVALDYVEK
FT                   AYLRDSISSTHYTQSVNKLLAQYKTYMSMPDISEYVGDLHDFKEKYNIIASNAITRLER
FT                   GIPVTVEHAIDIDTNNDGSNGSLESKSQGGKYNAKNVAEATGNFITIMDALKLDYKAKD
FT                   QLHPLMAELLLSINRVTNHDFENRSKLVEWIVKINKMKVEETLDEHEVRELLFILNQAY
FT                   KSFYSLLG"
FT   CDS_pept        complement(504258..505685)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447841"
FT                   /locus_tag="CAGL0H05203g"
FT                   /product="Similar to uniprot|Q12194 Saccharomyces
FT                   cerevisiae YPL066w"
FT                   /protein_id="CAG59955.1"
FT                   /db_xref="HOGENOM:HBG058714"
FT                   /db_xref="HOGENOM:HBG203913"
FT                   /db_xref="UniParc:UPI00003B66E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX2"
FT                   /transl_table=1
FT                   /translation="MTVPIISLMPSYNSMIRGCPGISDTLPRIECQLRVRSNNGSEFRI
FT                   AKIEVILKSVETVFPQSHVSYSFTPIGKSKSKPRKNESISYHYKKSFYLANDEKCKAAK
FT                   NKNTQRISKPLIGVDFPLTISLPADINDTNFNSRFGTCVTYLECNLLYYDLEKVGPSFD
FT                   SVPPELKNFITTVNVERYTNLPLKKLFPAIEKNFYSPDKKLKAKVYVENPCITTDDLLK
FT                   IKLKVMPNQHSSSTAPEYENSVLFKKKLKVKSVTFQTKEIFQCHSETYESKEYVLDTET
FT                   KNYNEIITMNGFETANDIHICTKDVLFKEFENTMLEPELLYKLPKQPEGNMTNRNVPTK
FT                   LLQNKVDAIPFRYHCSISTNGKYYSIGHAIDIKIKIGSGKDFEFSIPITISQWLKSHTK
FT                   YIQQAIIQEREIASHAKRFYSGYGGLQKHSNGMIEYPTLPPIIYDSREHNNSKNFHIFQ
FT                   LTSGNGKSQLKKLPIID"
FT   CDS_pept        506003..506608
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447842"
FT                   /locus_tag="CAGL0H05225g"
FT                   /product="Similar to uniprot|Q02754 Saccharomyces
FT                   cerevisiae YPL067c"
FT                   /protein_id="CAG59956.1"
FT                   /db_xref="HOGENOM:HBG124841"
FT                   /db_xref="HOGENOM:HBG203912"
FT                   /db_xref="InterPro:IPR022036"
FT                   /db_xref="UniParc:UPI00003B66E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX1"
FT                   /transl_table=1
FT                   /translation="MALQPMNWASIKQNIESGELQNLKRSPIETEKYHEHKRILAEKNI
FT                   EIGDYILNKLGWTLNELASVNDISEEEKLSLSFSRKDLYKLSVNDFPYNFEPQVSHLLI
FT                   WSKINLPLYNKNESSTDMNPEMKTKIETFIHNNLSKYLDLDMKDDYCWFINYRNLQSIK
FT                   GIAHVHLLIRCVDENGPQGNRCQRIKNEILNEGFEPIS"
FT   CDS_pept        506947..507891
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447843"
FT                   /locus_tag="CAGL0H05247g"
FT                   /product="Similar to uniprot|Q02749 Saccharomyces
FT                   cerevisiae YPL068c"
FT                   /protein_id="CAG59957.1"
FT                   /db_xref="HOGENOM:HBG124842"
FT                   /db_xref="UniParc:UPI00003B66E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRX0"
FT                   /transl_table=1
FT                   /translation="MELRKRKKVNYSESKGRIGGLKTVVVQPDSPPHNFNKDVKPKGLP
FT                   QKIVRYTPMINKRKASKRINKPTSKKVPHVMGNYDNSCRIKKLTFERPSFNDYSNYKQP
FT                   EPALTGLIHSDARIDWINAKKFLANHREKLRKLAKFQYELYYKDITKPEYKGPQAFASL
FT                   KLPDDMVSYSNIIKSIGSLLHEVENLETNKNSQKLYKPTIEISAEALKTIREQTSNNDR
FT                   IERTAELHDIDIEDIKQILRKNEINTTLHQMNMLKSSDFQIMHTLMEKRYFPYDDSSLL
FT                   WPTKYKKELKRYSSSELDQNDPLQLSIPLFTDF"
FT   CDS_pept        508560..509558
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17447844"
FT                   /locus_tag="CAGL0H05269g"
FT                   /product="Similar to uniprot|Q12051 Saccharomyces
FT                   cerevisiae YPL069c BTS1"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAG59958.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG029802"
FT                   /db_xref="HOGENOM:HBG397395"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI00003B66E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW9"
FT                   /transl_table=1
FT                   /translation="MTLEKLKTLIESPPAWSQSDENSINQPYNHIASNPGKNFRAKLIH
FT                   LFNQFYLLDENIIQTLTQIVEILHNSSLIIDDIEDNSQLRRGVVASHMLYGVPMSINTA
FT                   NYMYFVAMDLLRNLSHDAVTSNDLMKIFNEELLYLHRGQGLDIYWRDSLPKVVPTEEMY
FT                   FNMVMNKTGGLFRLTLKIMERLSEYWQGQKSLVPLGNLLGIIYQVRDDYLNLTDSSMIE
FT                   TKGFADDISEGKLSFPIIHGINYAKIHDPNNTLLLDILCLKTKDENLKKNAIRYLSDCS
FT                   KSFEYTSSVLKKLTTLLHSNSYFPDVTNDSTNSQTEAIKQVYNIMEKLANV"
FT   CDS_pept        complement(509813..511519)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000992" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198216"
FT                   /locus_tag="CAGL0H05291g"
FT                   /product="Similar to uniprot|Q02866 Saccharomyces
FT                   cerevisiae YPL070w"
FT                   /protein_id="CAG59959.1"
FT                   /db_xref="HOGENOM:HBG058919"
FT                   /db_xref="HOGENOM:HBG203910"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI00003B66EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW8"
FT                   /transl_table=1
FT                   /translation="MTHLFTPPINSSKFDPSLSIKESYKGHSAQGSIASNISSTESSNS
FT                   ELGKDDSKGSKSPKLSKEEIDQISQIGELPDELSAMIDAFIDDLKQPKYERPLSVPQLS
FT                   SLFQAFYIRFDKHSFHYLQSKKTTSSSTNVSTFFNARETLTSGIGGLFSRSRSSSASTN
FT                   VSTRRNRRSSSIFSNESGSNNVTQMLSPEEIQRQLKTDALNNLKIEKYKDLCERDLFNR
FT                   ILQVGTSVPISSPSKSANVNGNSTLANSTMTRDVHAKKNESFSIVSLFRNSPEFGEYDK
FT                   LIDERVNLLYRFDKEEFFSLSDFLDIPKGNDEFDSIQSIANIKMVLDDFANNVIAPGEK
FT                   CKCLLKMYEIMENSKAMSNDDFLSLLIYYVIKCPMLHIFLNMEFVRLFRIKKKLVDSEL
FT                   FAITNLEAALVFIEGLTLDDLPQLLRDNLTDREKSLFAVPISRKVKLPELGRHEIDIEK
FT                   DAELTKRIEVSRTASYEGFRSVFDSSLRNIIDRIRAYPISNGTESSPWINTDLKKEVPT
FT                   QLSSFKQAPISNYTPSIPENWKQFKDYAFEDLTISNLREIFEIYKEMVDEN"
FT   CDS_pept        512084..512563
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21047116"
FT                   /locus_tag="CAGL0H05313g"
FT                   /product="Similar to uniprot|Q02864 Saccharomyces
FT                   cerevisiae YPL071c"
FT                   /protein_id="CAG59960.1"
FT                   /db_xref="HOGENOM:HBG124843"
FT                   /db_xref="UniParc:UPI00003B66EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW7"
FT                   /transl_table=1
FT                   /translation="MGFSRNFKGDSRKRPHSPDLYAIGEFKKSKLIEDLERLSLNDDVV
FT                   SENNGLQIVDHNKFRRPHKDDTSHPGDRKWVITQIVDLMRAESLQVIPWIDYKQFAYNE
FT                   WLKWYKIKLLSDDTLMIDIDNLLENDFYMRVEPTSNYRGQIEGNNETEDMDIDID"
FT   CDS_pept        complement(512683..514134)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20198217"
FT                   /locus_tag="CAGL0H05335g"
FT                   /product="Similar to uniprot|Q02863 Saccharomyces
FT                   cerevisiae YPL072w UBP16"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG59961.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG124844"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00003B66EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW6"
FT                   /transl_table=1
FT                   /translation="MLLVPILQTNKDLFKTIIDQLFYGFRRSNSFKAGVGLIGLLVSYI
FT                   VYPSVKNILFSKNINGSLASRPDKYTTGLVNKGNYCYANSVIQALSSIDYFSDYINKFV
FT                   IGIDENEISSAGLEKTDTEALLLHRALADLLRKLQMVIFEPTNADIKHLVSVLEWKVSG
FT                   RLSRAQNDAHEFLQVLLEQLHVELSNSHKTSSCKFPFAGTIIESYKCLQCQHETAPKKS
FT                   TFNIFEAPLPQKYEIDLNDVLMRNSNEIIDDYKCMVCLIRSVITLERAHGFSGTAESIK
FT                   GKLLALEKKLPDITINEEFDIELQNYLDTYCKYGFKNNVARRSILKQCKFVNAPDIFVI
FT                   HLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKRVRYRLKSIVIHTGSHY
FT                   SGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRRMKSTTIYPFWLISDTN
FT                   VKEKRISDIVNEQKSVYMLFYERIL"
FT   CDS_pept        complement(514513..516825)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351392"
FT                   /locus_tag="CAGL0H05357g"
FT                   /product="Similar to uniprot|P40328 Saccharomyces
FT                   cerevisiae YPL074w YTA6"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG59962.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG058916"
FT                   /db_xref="HOGENOM:HBG203907"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI00003B66ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW5"
FT                   /transl_table=1
FT                   /translation="MIGPEKFAIPSGFSLEQSLNLLHSIARDQYQNLRNNLNIAIEKKD
FT                   NIELPRLSKSLESLLYYVNDGMKRIEKAFKLKTNILTVGENDSTLKESVEDLQLLGYDI
FT                   RLARRDAQLTLNGIEDQANGRSLTKLWRRNSTRKIKNESLDDSTAIKEAERILENRKRK
FT                   LAEKQELERKRLLELENQRKKLMDLQVRQQVDLEVASKLEEEELKRKELELLEREREER
FT                   LAREKALKEQEEAKLKEMEEQERLRKEVQRQIELHKEQERKERERQEKLERQKEVELTS
FT                   VSNRGKKQVSSSNDRSDIVMNRRSIDMGSANRDHDRQTERKNNGFHIGRAAQVAWTQFQ
FT                   PDDIRKRYPVSTATTMLKKPVSTIPKLQSYHAPKKRYEYTKPVINRVHIKAPKKAQTSV
FT                   ATDSNSREVFTKAIRRTKSQSAPSSPVLADQPRRSVDSKRPAKSSESPKRYMNERIQSV
FT                   MDTLEGVDKMACEHILNDILVVDEKVYWDDIAGLRNAKNSLKEAVVYPFLRPDLFKGLR
FT                   EPIRGMLLFGPPGTGKTMIAKAVATESNSVFFSISASSLLSKYLGESEKLVRALFYLAK
FT                   RLAPSIIFIDEIDSLLTARSDNENESSRRIKTEVLIQWSSLSNIVAQNENSGGLSDNRV
FT                   LVLAATNLPWAIDEAARRRFSRRVYIPLPDYDTRLMHITKLLSKQPNNLTISEYEEVAR
FT                   MTEGYSGSDLTALAKEAAMEPIREVGDRLMDIKNETIRGVTFEDFKNALATTKKSVSQQ
FT                   SLKQFDDWSTEYGSTGV"
FT   CDS_pept        complement(517605..520658)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194052"
FT                   /locus_tag="CAGL0H05379g"
FT                   /product="Similar to uniprot|P07261 Saccharomyces
FT                   cerevisiae YPL075w GCR1"
FT                   /protein_id="CAG59963.2"
FT                   /db_xref="HOGENOM:HBG058915"
FT                   /db_xref="HOGENOM:HBG398813"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI00017BD8BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW4"
FT                   /transl_table=1
FT                   /translation="MNFLGLSPITKGDTTNVSKTNKADEESVSNLNRGMSAPSLSTSIF
FT                   AMPRTIPTTNNDKQKQNWNVISENQTNPAQETIDARKFNEDATSPKQVDITNNKLKSLL
FT                   LKQEEHSNINSADTTTNFYAISQYILQSYFKANSSDLASLKLVDLIVDQTYQDSLTLRK
FT                   LNETTAMQPYQYFNTVSRNPDISRCPIFALAVYFVIRWSHPNPPITINNYHLISLLDSN
FT                   FIDPNAKLVNNENPDHQQLSQNTKILRSEIFHPSPDMIELVFPWLPALKQDMLLIDRTN
FT                   YKLFSLCELFEFMGKVIIQDLRYLSQHSMLLPKIVEFISKFIPELFENEQFKSSSEDEF
FT                   MMERQGSDFQPNSYDTNLQSISREGTQNGYINNSVLEKMIESQFVSLSKKLTTENIRLS
FT                   QEITQLKSDLNSVTSMCNQILQLQRKIANGENQTRDRSMGNSVNGEGNIIILDKNALNS
FT                   QLINQLVHSADDTSQQKGLESSQLAPIGTFNSLQSKLQNSEAQKRKLPFPSHQAATSNI
FT                   VNVPMNNANGGASPYSPSINMQPDSPYNKRYRLEDKSTPSQNALDSLLSKSVASPRVGG
FT                   SSVNGSNIMDSPRSNRNNSIDKKFFMTGQYNSPGGNQGTFTDGSFNRILSDIPYKAASR
FT                   EETIIKPLSPNVPILPVNTTISHRRQQGALKKLVERPTLPITESTTSLPPSPDAQSAID
FT                   SNQLPKPQLASRASTIVDPDLSVEVMHTIPAPGHSNLQHTLEKGYEGKSSRDDIEKNKK
FT                   METQKRRKGDGASKPEHLPPLKYKLSRDNKTIWDLYAEWYIGLNGQPSIRKLIEDYGYR
FT                   RWKVSDDSHFFPTRRVIIDYIETECDRGIKLGRFTNPNQPREDIRKIIVGDLERFRINN
FT                   ALTLNSLSVYFRKLIKENNEICIFENFNNWQVRAMTEEEKIRYCKRQHGPADRNVTTTN
FT                   ESHSSVTDSQRPNMIAKQTFNNPIENPTTTSIERESSSSSEKNSSPRQEDAEVGNTLPK
FT                   NADADDDRNNEHNDNVTNNEFNDKDETA"
FT   CDS_pept        complement(523211..524047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431211"
FT                   /locus_tag="CAGL0H05401g"
FT                   /product="Similar to uniprot|P46961 Saccharomyces
FT                   cerevisiae YPL076w GPI2"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59964.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="HOGENOM:HBG141903"
FT                   /db_xref="HOGENOM:HBG714597"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniParc:UPI00003B66EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW3"
FT                   /transl_table=1
FT                   /translation="MSKAPWERKLWKQQDYPDNHTDSEFYVLLKEIQASKYNNADRQII
FT                   DQRIIRQDFLSFYHLVMNTSFVYVVFCYLYYYERDPLPPCIGMTALVTLLYVVNQRSHR
FT                   LLTFKSSMLITFTMLILSPVIKSLSRTSASDSIWTLSFWLSVSYLYVNSSSKTENNTPT
FT                   NLSTNILLANVAVLASRLPTTTEVFCFMLLCVEINIVLPTLVSPHNILFSLGTHITVYT
FT                   FVTTTLGITYMVSTLAVAIAFQLLFPKWFIYWKLHYHRYDNALLSGWDPAKPIIDR"
FT   CDS_pept        524310..525314
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042900"
FT                   /locus_tag="CAGL0H05423g"
FT                   /product="Similarities with uniprot|Q02831 Saccharomyces
FT                   cerevisiae YPL077c"
FT                   /protein_id="CAG59965.1"
FT                   /db_xref="HOGENOM:HBG124846"
FT                   /db_xref="UniParc:UPI00003B66F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRW2"
FT                   /transl_table=1
FT                   /translation="MDGIERVNSVRQHYNDDVPSFVIDNVSDIDTESAGTEPYLNAFDN
FT                   KDHNNTEFETGRSDNFFNFNYNDNDNDIDNYNDNEIGNDNDVELDLVEDSKDNFMMMVP
FT                   RTLPTSGISEHLWQKRIRANPSDGAQTLEPPSGPVDLLSSADTSQRLKWAGAGPGPNAL
FT                   TMTTSLLNGEKLLRAATYPETEQEQKQARRLHELETPRLVVPPNVDSQERLWQEVGELE
FT                   QIKSFARQVNMFESMFPHGFESNLNELRKLQNGLVHELRNYNAELEEQERKEIAKQAAA
FT                   SILTFTPPASIHSTDTALLNHSSSDIRLGGFSGANLKAEKYLRQLFEKITDMG"
FT   CDS_pept        527157..528824
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000261371" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194053"
FT                   /gene_name="PGI1"
FT                   /locus_tag="CAGL0H05445g"
FT                   /product="Glucose-6-phosphate isomerase "
FT                   /EC_number="5.3.1.9"
FT                   /function="glucose-6-phosphate isomerase activity "
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59966.1"
FT                   /db_xref="GO:0004347"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG001533"
FT                   /db_xref="HOGENOM:HBG352954"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniParc:UPI00003B66F1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRW1"
FT                   /transl_table=1
FT                   /translation="MASSNTYSNFKLATELPAWSKLQKLYDAQGKSLNVKEEFQKDSAR
FT                   YNKYAKTLTNYDGSKILFDFSKNLINDEILATLIELAKEAKVTDLRDAMFAGEHINFTE
FT                   DRAVYHVALRNRANKPMKVDGVDVAPEVDAVLQHMKEFSEQVRSGEWKGYTGKKITDVV
FT                   NIGIGGSDLGPVMVTEALKHYAGVLDVHFVSNIDGTHIAEVLKVVDPETTLFLVASKTF
FT                   TTAETITNANTAKNWFLSKTGNDQSNIAKHFAALSTNETEVAKFGIDTKNMFGFENWVG
FT                   GRYSVWSAIGLSVALYIGFDNFEAFLKGAEAVDKHFVETPLEDNIPLLGGLLSVWYNNF
FT                   FGAQTHLVAPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFSTYSTGSILFGEPATNAQH
FT                   SFFQLVHQGTKLIPSDFILAAQSHNPIENNLHQKMLASNFFAQAEALMVGKDEAQVKSE
FT                   GATGGLVPHKIFSGNRPTTSILAQKITPAALGSLIAYYEHVTFTEGAIWNINSFDQWGV
FT                   ELGKVLAKVIGKELDNTEKITAHDASTNGLINQFKEWL"
FT   tRNA            531206..531289
FT                   /gene_name="tRNA Leu (TAA)"
FT   CDS_pept        532144..532872
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042901"
FT                   /gene_name="ATP4"
FT                   /locus_tag="CAGL0H05489g"
FT                   /product="ATP synthase subunit 4, mitochondrial "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="CAG59967.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG057729"
FT                   /db_xref="HOGENOM:HBG328743"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniParc:UPI00003B66F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRW0"
FT                   /transl_table=1
FT                   /translation="MSFRALTMRSAVARTALNNTIRSARVATPYLGIRHSSSTPTPDPK
FT                   TKAASLIDALPGNTALTKTGILGTSAAAIIYGISNQLYVINDESILLLIFLGFSGLVAK
FT                   FLAPLYKDFADARIKKIGSILNSSRERHVDAVKDRIESVSELQNVSETTKVLFDVSKET
FT                   VELEAKAFELKQKVELAHEAKSVLDSWVRYEASLRQLQQKQIAEGIISKVESELTNPKF
FT                   QDRVLQQSIAEVEQVLANIK"
FT   transit_peptide 532144..532248
FT                   /gene_name="ATP4"
FT                   /locus_tag="CAGL0H05489g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRW0 "
FT   mat_peptide     532249..532869
FT                   /gene_name="ATP4"
FT                   /locus_tag="CAGL0H05489g"
FT                   /product="ATP synthase subunit 4, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRW0 "
FT   CDS_pept        join(complement(535102..535108),complement(533744..534321))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431212"
FT                   /locus_tag="CAGL0H05511g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG59968.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG053230"
FT                   /db_xref="HOGENOM:HBG588353"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00003B66F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRV9"
FT                   /transl_table=1
FT                   /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRI
FT                   SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIEDF
FT                   LERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSP
FT                   FGGARPGRVARKNSGKASEGGEDAADEADEE"
FT   CDS_pept        538045..543759
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194054"
FT                   /locus_tag="CAGL0H05533g"
FT                   /product="Similar to uniprot|P32333 Saccharomyces
FT                   cerevisiae YPL082c MOT1"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAG59969.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG015252"
FT                   /db_xref="HOGENOM:HBG356018"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="UniParc:UPI00003B66F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRV8"
FT                   /transl_table=1
FT                   /translation="MTSKVSRLDRQVILLETGSTQTIRNVAADQLGELAKQHPEDILSL
FT                   LSRVYPFLSSKKWETRVTAARAMGGILSNASVWDPNEGEVKEEEESHMNSEIKKENQNN
FT                   DHAEMENTVIKEEPDQDNGVSVPNHTNNDNNIETVNAKVKLEQDIQLKLEELIKEDSSL
FT                   LDDNKNADNCLTLSNWHLNELFKSGKVFLASSINDYDDKKVASNSPSTLSSDIEDASMK
FT                   KENDAENHCSKSSNIEGGNSSKKSARMLAMAKRKKKMQKSKTTTTMEVNLSESSLSKKL
FT                   MDDPSAVKSDAVKMENPKLAITDQADPNAIMVEAVVPKILEKHEKVAGLVWQFQGVFEL
FT                   LLQNLMHDNWEVRHGATLGLRELMKKHAYGINRIKGKTRKENNDRNYQGLEDLATRLLT
FT                   IFALDRFGDYIYDTVVAPVRESAAQILAALLINLPDDLALKVYMKLEDLVFQNPEVTGL
FT                   PNKIWEATHGGLLGIRYFVSIKQEFLIEQNLLDKVVQTVLYGLNQNDDDVKSVAASILT
FT                   PITAEFVKLDTDTLDIVLTTIWNSLIHLDDDLASSVGSVMDLLANLCQYKEVLDVLKHK
FT                   ATEQPLEWSFKSLVPKLYPFLRHSISSVRKSVLNLLQSFLSIKDESTKHWLNGKVFRLV
FT                   FQNILFEQNPDILNLSYEVYTSLLTHYQLKHTEKTLDHAFCKHLQPLLHLLNTPIGEKG
FT                   KNYSMESHYILKPSPRYQLHPEKKRSISEANNASDIPNPRPNENINIDIPMINGDVTLL
FT                   GEQKIMNTRVLAAKAFGFTLAMFQEATVQSFFANVLVRCLDLPYATPRMLTAIIVNRFC
FT                   KFWVDRHDDVPEVPKFVSEIFGATMNEQLNNPSKLPVFRELIPSLKALRTSCQNLFATF
FT                   VDVGMLPQHKLPSVAIVVQGESEAGPEAFGLETAEKVYHDYYDKMYKNLGNSYKLLAKK
FT                   PLEDAKHRVKQSIESAKESKQKRICSILSNYASSVLMFSELPPKLNPIIRSLMDSVKEE
FT                   PNEALQKMSCESVIYLIHELLKCNKAPVANKIVKNLCGFLCVDTSEVPDFQQNLSYQDR
FT                   LYTFIKEPDAFVINENVELMKVAEEARLKRKGGIYAMGTLLEICGSSALDDIPQLKKVF
FT                   LEPLENISDVSSIDVIKGQAVTDYFGIVRVLFPYMDQSLQESVVIAKFPRMLDFLKCPY
FT                   SVIRYSVARTFADLAKYKPIKVMPFLIKNVLPMINDAGSLFNRQGATELIFHLSVSMEA
FT                   DILPYVIFLIVPLLGRMSDPNEDIRNLATTTFASIIKIVPLEEGIKDPEGMPEELMKGR
FT                   ERERDFIKQMMDPSKAKPFKLPVAIKATLRKYQQDGINWLAFLNKYHLHGILCDDMGLG
FT                   KTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIV
FT                   VYAGGPSVRQPLRKQLSSADIIITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKL
FT                   AKAVKLIKANHRLILTGTPIQNNVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNS
FT                   KTSSKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYED
FT                   FAKKQKNVVEKDIQNTADVDSKQHIFQALQYMRKLCNHPALVLSNDHPQLKQIQNYLKQ
FT                   TGCDLHDIRNAPKLTALRTLLFECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKD
FT                   MLDMIENDLFKRYMPSVSYMRLDGSVDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLN
FT                   LTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMN
FT                   IASTVVNQQNSGLASMDTHQLLDLFDTDNVPSNNAGEVAESGDKLPDDVANETGLSGKA
FT                   KEALGDLKELWDPSQYEDEYNLDNFIKTLK"
FT   CDS_pept        544199..545527
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347317"
FT                   /locus_tag="CAGL0H05555g"
FT                   /product="Similar to uniprot|Q02825 Saccharomyces
FT                   cerevisiae YPL083c SEN54"
FT                   /protein_id="CAG59970.1"
FT                   /db_xref="HOGENOM:HBG059998"
FT                   /db_xref="HOGENOM:HBG203905"
FT                   /db_xref="UniParc:UPI00003B66F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRV7"
FT                   /transl_table=1
FT                   /translation="MEKLDITDGFADREDIIEAEDEEEDMVQDWTEISRMVLSNNPISL
FT                   PRRGDKEYEPDGSNIQEVQLSKAKDIMFDTLRNSIRGSVIKSQVKAYYNIDKHKAYVPH
FT                   PKGSFLQTMGWADSNGVFWLDFHELVYLSERGTVTPYWGSDDSNDDDGNLDIPLSIEDL
FT                   YLLFKSQEDYDNFLVYSQLKRLGFIVLLEKDNRYHATSFFPPVSEHTSMMTAIGSNIRS
FT                   SISSVFVLNKALFSGTFLYSKWNYILRRFTTNDQLYNSIGSLIPTQTVPKSDTELREYN
FT                   GILNGNPPSNLKIVFKLWKPQVNFKKKSPALPDYQIVVYNKNNKNQQFPSYLSLKNIFS
FT                   KLDYKFDFLQEIDDDFWDKNTFTNGVPRLEYLTSIGRNLDKKNSKGKKSGQVSSTPFNN
FT                   KKKKPKGRSKLSAIKQGYRSFLLAVVDNGLVSFIRISETEFRY"
FT   CDS_pept        complement(545740..552456)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194055"
FT                   /gene_name="SEC16"
FT                   /locus_tag="CAGL0H05577g"
FT                   /product="COPII coat assembly protein SEC16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG59971.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG124847"
FT                   /db_xref="UniParc:UPI00003B66F6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRV6"
FT                   /transl_table=1
FT                   /translation="MTPEAKRKKNQKKKLRQKQKKAAEKATDLPATDQSVNISGAEDAL
FT                   TSNSNVSTPDYTSNFEISVTSTQEVNVDSQLSQNQNSDNFINEQKENDPQSETVFDSHE
FT                   DIESEMKDNYHNDIKNTTEAITFDTAQNIIGGSIDSSNTVKSEDKINESSSKISDPDCQ
FT                   EDILKLELEGQPLESSCNDDKESVVEGNNENDNNDDLVNDHPTAEDGSDFFDNLASNNT
FT                   EVELSSTQNSNLLTENRLESEEFGKPEKLDYPKELSYSEEVDLVEEVDHVEEVDHVEEV
FT                   DHSEEEDLVEEVDHVEEVDHSEEVDHSEEVDHVEEVDHSEELLTSSVSTQTGMAENTIR
FT                   HVDESNLGQQKMEERNINSDTHKDATARVSDFHANDEFETGPAAQINSLIEMNDDEQSV
FT                   NDLQDESSLLQEETTFSQIPKNEVNTENQENIGSESVSKINVANENSMESAIEDLFPSM
FT                   HNTNEQNPWELPQQGENVVENEVSHEENQRITETTKDDSDNIDRILCDREDKKEDSFDD
FT                   LFGNNEVGDDVPWLQESMKSEEGEKHHQSSTAKEESPANVRTSDNTASQDNDTLPSESV
FT                   KSNQQQNVESSSDRQQTSADTVKKFSFLEEDDDLLDDDDSFLESEEEIEELESNETVQI
FT                   NELTQEMSTSAESKKLNHNPYRPSSHSSINTQMDPKYNNYQTVPNSSTAPTGIVRPQQI
FT                   TTFLPTNNAQTNTPGTILSPIQTTNEKVKKLTEEKKKSDAYDFPINLVSSTVKKGHAKP
FT                   VGVFTNQFSRNGSTPTTPKINPHSRNSSVNPAQIIPKNPYASIQQPNPVIAPTTNMINN
FT                   PINMMPTARMRGNSAVSTTSGKSVGTSVATKQNPYSPQITKSPRASISQPAGIPNNSKY
FT                   GPISPSTSQFNSLGQVLDSGLVHSSTTPMGSTLSPISTKLNANNQPSPQSKQYPGNSSY
FT                   LPSQNDSRSKYAPAFSTGQYAGYSSHSKPAVNQPALPFPRKQSESAGDANPPINTVLPP
FT                   GIRKTNVLLESQQNLRQNANYPTYAEHSHEQTNSYNVHGASNKKIVNNNALLVKQFPIF
FT                   NWGSNNKVIYGIPLGQNDSVMMPTNSPLQNLRMIGAEILIKPTQLIKSFPGPLCGSKVK
FT                   KSDVEQWLLTASKDADVDEEAALLLSLLKLKLSTTSTFKDMATLLYDTATLHEYLAQPL
FT                   TSLNQAPNAFSLDPESQFRVLSFLQVGAHDDALRFSLEKKDYSISLLIGSLLGKDKWCE
FT                   VVQRYLSEQFTAIANNSNLWAHLLPLIFQVFVGSSKTAVSRFYKNQEEANWAAENWRGI
FT                   VAAVLINITDHSQPKQTASIQTPPAVVTEFLIEFGIFLKKLGMNLPASILFVIANVPLS
FT                   NVPILPDSDVHFRSIGSTNNVLGAILSETYEYTISQDLKFKGYPATLPLKLFHAYCLQE
FT                   EGLTSLAYKYVDYLSSATKSMTKKDAESLNLSHHLSILTNRLAGSSSSWLGKPKLSSVW
FT                   GQIDKSFNKYIGGDDDLPKPATEKKVFDSYTPSSSTNSSMIDLSHSVSNFMPAQINQLS
FT                   RNNLNSENKMSTVPDLTAFGEKNAFEPPTNTWTGMSLQGSPQRAVSNMKPPLSNRPNLR
FT                   RIKTELPSGEDELLSMTVKQGKKSYAPDNLNRASNSSNETLKSSQSANNSVPYHQSTPN
FT                   LIGMQSVEQKKSYYPSNQRAMRKSAMPTQPENLEISRNARSYEPHTKTKKVYKPNQTLE
FT                   EEPPIQSYNDDVVSQNQFEEAPNLQNDQEKILQPTASPEGLSQTRISNYSPERPPLPVY
FT                   SEDSKNMDPKNISDLVKEQQITDKSLEHELEQLPTENDADYKISNANEDNAINEEEREI
FT                   GNGEVELNVDQSQSHLSASIPQTQNDRESTTVSISPGLGLEMDVDKEDSNAPAPKLFSE
FT                   KPNPSPYAPPTVGKKGTKKTSYMPKGKTESFIAEPEISSYESSPLDMYAYSGYRPQEKE
FT                   KSTSSIVEESSQISNEDAPDKSSIAARQAVELKQDEVSKKPITTKLSTPKSLPIPPSPF
FT                   ANPLANNNTTGVLPTENFEPVIKVSRNTTARAFTPVPPASDQYDDVVEEDSDDSDDSED
FT                   DSPMQSNNSNNGNSERNENKQNDNYSDDEMPTKKKSHDNNDAGSGWFGWLKKDTNEKKA
FT                   VKAKLGNQNSFYYDEQLKRWVNKNASEEDKQQLATPAPPPPIVKRKDTEPKTKPRSISG
FT                   VTPHLDTGIGSSIPPISGNAPPKPKSGPSLAAKTNGLDDLLNLTAAAPATSTRRKKKGG
FT                   RGYVNVMENL"
FT   CDS_pept        complement(553388..554332)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499455"
FT                   /locus_tag="CAGL0H05599g"
FT                   /product="Similar to uniprot|Q02896 Saccharomyces
FT                   cerevisiae YPL087w YDC1"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /biological_process="ceramide metabolic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59972.1"
FT                   /db_xref="GO:0006672"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="HOGENOM:HBG196338"
FT                   /db_xref="HOGENOM:HBG735397"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniParc:UPI00003B66F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRV5"
FT                   /transl_table=1
FT                   /translation="MQFSWPYPDPETIDGYWGKPTALIDWCEENYVVTPYIAEWCNTIT
FT                   NAAFLVVAFYCTYSAYTNKLEKRFIFIGLGFSLVGIGSWLFHMTLQYRFQLLDELPMLY
FT                   ATVIPSWSIFVENQENLIKNVDERKAKSLRIQFIYSALLFGFVSILTWLYIVVRVVEIF
FT                   QILYGVLTVMVVIASGILTYRDVHDPVAKRNLFTTMCLGIVPFVLGFICWQLDIHLCSL
FT                   WIHIRRTYLELPLGILLELHGWWHLLTGTGVYIYVVYLQYLRVMTQGRGDDYIFIYRWS
FT                   FFPELVKKGLTVRTPYSLEFWGPRADVKATKKE"
FT   CDS_pept        556498..558378
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347318"
FT                   /locus_tag="CAGL0H05621g"
FT                   /product="Similarities with uniprot|Q12224 Saccharomyces
FT                   cerevisiae YPL089c RLM1"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59973.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124848"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00003B66F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRV4"
FT                   /transl_table=1
FT                   /translation="MGRRKIEIEPIRDDRNRLVTFIKRKQGLFKKAHELAVLCEVDVAV
FT                   IILGSNDTFYEFSSVDTNQLLDAYQNKPELHHDCCDPSAFGDFKKNKTTILHHSRSTAR
FT                   PTNTTTKDISMSQIEDTTGDEDEDESNTKDEDTNNYTYHNKEPDNRYNSSISDISKTRD
FT                   NSQFISNNNRGFPKRPFVQTMDSFDNNSSDNSSSDTNNTKRMRFDNQNSSGRFSVNQNS
FT                   TTALHDSNQNPTQLEQQSLQQQGLPQPPQLQQQSLEQQQQQQPQEFQPGNSTGLSNNLQ
FT                   QHVQKQFQNLFMMTKGARQMPKPIGLSQSFSSMNGGQPSDEDSLTPVMNPNSSGSSDQN
FT                   NGSENISNEMMSENKENSTIQEDLSAESNERNDTPSEGGPPKPNLTVDIPSNQFVNSAT
FT                   IHDDTSSVSTNGQRQYQIQLNGINSNDNLLKNLSPISSNPLSAFDRSNQSKLIWKTPSG
FT                   LTPGLPAVLSFSPTTTQFQGTTPINTMLPTRNSIASENQLESLNNPNFLQSQSSSLGDA
FT                   SAMKKPSLQPLHTITGNGNDVPAMGPPTGSMPSKYIQDLMVSSPNNPSMPMFPDWSLGP
FT                   TNRGAQQPQENTYDPSHGNTGLTPFLQTGQTPTTRFFSFNSDMSEERSTK"
FT   CDS_pept        join(559430..559435,560151..560855)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431213"
FT                   /gene_name="RPS6A"
FT                   /locus_tag="CAGL0H05643g"
FT                   /product="40S ribosomal protein S6 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG59974.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG022722"
FT                   /db_xref="HOGENOM:HBG316337"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniParc:UPI00003B66F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJH3"
FT                   /transl_table=1
FT                   /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDEF
FT                   KGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGP
FT                   DLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRREVT
FT                   KGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAERKAE
FT                   KAETRKRRASSLKA"
FT   CDS_pept        complement(561332..562762)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347319"
FT                   /gene_name="GLR1"
FT                   /locus_tag="CAGL0H05665g"
FT                   /product="Glutathione reductase "
FT                   /EC_number="1.8.1.7"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="glutathione-disulfide reductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glutathione metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59975.1"
FT                   /db_xref="GO:0004362"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006749"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316802"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI00003B66FA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRV2"
FT                   /transl_table=1
FT                   /translation="MIVKRLFRTMAPVAKHFDYLVIGGGSGGVASSRRAASYGAKTLLI
FT                   EGKALGGTCVNVGCVPKKVMWYASDLATRLTHAHEYGLAQNVPLSKESITFNWPEFKKK
FT                   RDAYIHRLNGIYENNLKKEGVEVVFGWAKFNKDGNVEVTKHDNTTEVYSADRILVATGG
FT                   KPVYPEKVPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSDSHLVIRG
FT                   KTVLRKFDEIIQNTVTDYYVEEGINVHKETNVDKVEKDEKTGKLSVHLTNGQVLEDVDE
FT                   LIWTMGRRSLLGIGLENVGVKLNDKEQIITDEYQNTNVPNIYSLGDVSGRVELTPVAIA
FT                   AGRKLSNRLFGPEQYRNDKLDYTNVPSVVFSHPEAGSIGLTEDEAIKQYGKDNIKVYTS
FT                   KFTAMYYAMLEHKSPTRYKIICEGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADF
FT                   DNCVAIHPTSAEELVTMR"
FT   CDS_pept        complement(563698..565053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347320"
FT                   /locus_tag="CAGL0H05687g"
FT                   /product="Similar to uniprot|Q2VQ77 Saccharomyces
FT                   cerevisiae YPL092w SSU1"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG59976.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124849"
FT                   /db_xref="HOGENOM:HBG203901"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI00003B66FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRV1"
FT                   /transl_table=1
FT                   /translation="MRRLMKQLVRDFEPFMFVMVMASGISSNLLYDFAFPSHWMRVCSY
FT                   IMFGIACAIFIVLQIYVFVHAYYSIKKDSFKVYFKRYYAGVTYGPFWGAYPMGLATIIN
FT                   YISFLANNEAAGTGNAKRLIVLAYALWWYDQLISLLTAWGVSFLIWQKYDFDKNDISPH
FT                   VTPNQKSAAETLKSVLLLGVIPLVVASSSLGGFTMSPIFIKYFGRHIQLLNIFVCALSL
FT                   FHALIFVFFIITIYIWSLYVNKIPPMGQVFSMFLILGPLGQGSYSFLLIGENVEKYTHL
FT                   YYRPGHPYYNELLVEIIPWCFKIIFLLLVLALVSLGYFFTFLCFISILSYSKTKDATGP
FT                   KVKRIYTFHKGWLGMTFPMGTMSLANKEIYVIYNNYVPVKTFRYIGAIYGGVCICWTII
FT                   CLTLTLLQSIIKPVYFRYSKWKETEENTSTEKSLESSNDIQESCQDDFTRLV"
FT   CDS_pept        complement(566262..568199)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431214"
FT                   /gene_name="NOG1"
FT                   /locus_tag="CAGL0H05709g"
FT                   /product="Nucleolar GTP-binding protein 1 "
FT                   /function="GTP binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG59977.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG211316"
FT                   /db_xref="HOGENOM:HBG628350"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR012973"
FT                   /db_xref="UniParc:UPI00003B66FC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRV0"
FT                   /transl_table=1
FT                   /translation="MQLSWKDIPTVAPANDMLDIVLNRTQRKTPTVIRPGFKITRIRAF
FT                   YMRKVKFTAEGFEEKFDDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAVSRAKTL
FT                   VEQVSRDYTRLLKFGQSLFQCKQLKRAALGRMATIVKKLKDPLVYLEQVRQHLGRLPSI
FT                   DPNTRTLLICGYPNVGKSSFLRCITKSDVEVQPYAFTTKSLYVGHFDYKYLRFQAIDTP
FT                   GILDRPTEEMNNIEMQSIYAIAHLRSCVMYFMDLSEQCGFSVEAQVKLFHSIKPLFANK
FT                   SVMVVINKTDIIRPEDLDEERAKLLQTVTELPGVEIMSASCQLEDNVMNVRNKACEKLL
FT                   ASRIENKLKSQARITNVLNKIHVAKPQARDDVERTPYIPEEFKKLKKYDPEDPERRLLA
FT                   RDIEAENGGAGVFNINLKDKYILDDDEWKNDIMPEIMDGKNVYDFLDPDIAAKLQALEE
FT                   EEERLEKEGFYDSDEDESYGGFDQEEIDEIREKADWIRNKQKKMIAEARNKKSLRNKAM
FT                   MPRSKLVKSFGDMEKHMATLGHDMSSLQDKHRAAAEKSRYVETGADVVFGQNDSMASGS
FT                   NGGKLRQSDRLLDGVADGSMRSKADRMAKLQRRQRNRDARQGEADRHATASLPKHLFSG
FT                   KRGIGKSDFR"
FT   CDS_pept        568634..569407
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042902"
FT                   /gene_name="SEC62"
FT                   /locus_tag="CAGL0H05731g"
FT                   /product="Translocation protein SEC62 "
FT                   /function="protein transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAG59978.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0030176"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058262"
FT                   /db_xref="HOGENOM:HBG395377"
FT                   /db_xref="InterPro:IPR004728"
FT                   /db_xref="InterPro:IPR011553"
FT                   /db_xref="UniParc:UPI00003B66FD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRU9"
FT                   /transl_table=1
FT                   /translation="MDQSAVLAIASFVRNRSELKARKGLFQDKPTDFFRYKRFVRCLKS
FT                   DAYKKKSLKQPDLYPPLPEDEEKFAELARGIFVEFIKNQLVVPGQKLHSYECKEHGLKP
FT                   SKDYPHLIMSTKATLDDNEYYLWHYNPKTLTDYLIVFGVIGVILAFVCYPLWPASMRRG
FT                   TYYLSLAAFGFLGVFFGVAIIRLIVFLISMLFIREKGGFWLFPNLFEDCGFFDSFKPLY
FT                   GFGDKETYTYIKKMKKQKKRQAKKEKLKKLKEKAN"
FT   CDS_pept        complement(569862..570908)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431215"
FT                   /gene_name="PNG1"
FT                   /locus_tag="CAGL0H05753g"
FT                   /product="Peptide-N(4)-(N-acetyl-beta-
FT                   glucosaminyl)asparagine amidase "
FT                   /EC_number="3.5.1.52"
FT                   /function="damaged DNA binding"
FT                   /function="metal ion binding"
FT                   /function="peptide-N4-(N-acetyl-beta-
FT                   glucosaminyl)asparagine amidase activity"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59979.1"
FT                   /db_xref="GO:0000224"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG191057"
FT                   /db_xref="HOGENOM:HBG396333"
FT                   /db_xref="HSSP:1X3Z"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="UniParc:UPI00003B66FE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRU8"
FT                   /transl_table=1
FT                   /translation="MVDPIYVEVADMFLKRYKDYVINLFKEPVPLNRVQKLLQENKFAG
FT                   ELFDMSNRLCTMYENGTWHSQVLETLDLDKIYANVDMMPLEDDSQYSDNLVKELLRYFK
FT                   QDFFTWCNKPVCKSCGASGDDINGAAIQAPTNEEAKFNCGSVEVYHCQKCNSEVRFPRY
FT                   NDPIKLLETRTGRCGEWCNLFTLVLKSFGLESRYIWNREDHVWCEYYSPYLKRWIHVDS
FT                   CEQSFDEPFIYSKNWNKSMSYCIGFWRYGVVDVSKRYILQNQLPRDIIKEDDLQFLCHA
FT                   LTKRLRTGLSDDESYKMYCRDDLEQLELNPSATPTKEMQKLKISKTGNKGRISGSAEWK
FT                   ESRGENGK"
FT   CDS_pept        complement(571450..572838)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431216"
FT                   /locus_tag="CAGL0H05775g"
FT                   /product="Similar to uniprot|P48527 Saccharomyces
FT                   cerevisiae YPL097w MSY1"
FT                   /function="ATP binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59980.1"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG249606"
FT                   /db_xref="HOGENOM:HBG288125"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B66FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRU7"
FT                   /transl_table=1
FT                   /translation="MIRCRMINLRKGRLFVSNFRRSYNVLRELRDRGLVSQVSAPEEKL
FT                   EEQLESGQKVKLYCGVDPTAKSIHLGNLVPLMVLLHFYVRGHDIVTLVGGATGCVGDPS
FT                   GRTTERSLMEDKTRLSNVSSISGQLEKFFINGLAYYNTKNKDRNETLPGKHIKENNYNW
FT                   WKDVKMLDFLANYGRHIRVQSMLARDSVTARLNTQNSLGFNEFTYQILQAYDFFHLNKT
FT                   YGVSIQVGGNDQWGNITAGIDLISRLSSRTKQAYGVTVPLLQTASGEKFGKSAGNAVFI
FT                   DPSISTPYDIFQFFLNTLDEDVPRFLKTFSFLTIEEIESMTKRHNEKPHLRLGQKMLAK
FT                   EITDMLFGVGNGDKAQSISNIIFGTMEDKEMKLSGLELIDMFREARILQQAKRGESLVA
FT                   LVSRLTHSSKSEARRKIEQGSIYLHTSRVKITKDINDYNDYLIDDKVLLLRIGKQKCFV
FT                   IEMQ"
FT   CDS_pept        573153..573494
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347321"
FT                   /locus_tag="CAGL0H05797g"
FT                   /product="Similar to uniprot|Q02889 Saccharomyces
FT                   cerevisiae YPL098c"
FT                   /protein_id="CAG59981.1"
FT                   /db_xref="HOGENOM:HBG113405"
FT                   /db_xref="HOGENOM:HBG395519"
FT                   /db_xref="InterPro:IPR018450"
FT                   /db_xref="UniParc:UPI00003B6700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRU6"
FT                   /transl_table=1
FT                   /translation="MPPMPQGLAQQQPSNWDKFKMGLMMGSTVGVCTGVLFGGFTILTQ
FT                   GAGPDGIMRTLGKYIAGSAATFGLFMSIGSIIRSDSEMPMSLQQTQDLQRRARLEVWKV
FT                   RNLYGLSRN"
FT   CDS_pept        573761..574255
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042903"
FT                   /gene_name="AIM43"
FT                   /gene_synonym="FMP14"
FT                   /locus_tag="CAGL0H05819g"
FT                   /product="Altered inheritance of mitochondria protein 43,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAG59982.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG124851"
FT                   /db_xref="UniParc:UPI00003B6701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRU5"
FT                   /transl_table=1
FT                   /translation="MIKTAKISTLRLAITRNARNLSFTTLVRSPEVDNSKIKTLEDLTR
FT                   LETLEGVDPELIKRLINEKTQEFNTQDELKLLKSMQMEQDRLNEVPLKRFTRPLWIFIL
FT                   MASTFYLGAHLVWWKLAYEKKEVELKHKVDSLETTLKDVMKEKATGPTPCNNKKSWYKF
FT                   W"
FT   transit_peptide 573761..573844
FT                   /gene_name="AIM43"
FT                   /locus_tag="CAGL0H05819g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRU5 "
FT   mat_peptide     573845..574252
FT                   /gene_name="AIM43"
FT                   /locus_tag="CAGL0H05819g"
FT                   /product="Altered inheritance of mitochondria protein 43,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRU5 "
FT   CDS_pept        complement(574382..575743)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431217"
FT                   /gene_name="ATG21"
FT                   /locus_tag="CAGL0H05841g"
FT                   /product="Autophagy-related protein 21 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG59983.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058622"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6702"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRU4"
FT                   /transl_table=1
FT                   /translation="MKVLRFNQDASCCVVNSGANELTVYNCDPFGKCFEFNISNVNGDS
FT                   NDNGIGYDSLEAGSSSIESQVIAEMLFSTSLLAVVDKGQGINTGKKLKIVNIKKRSLIC
FT                   EIAFPSLIVDVVMNRKRICVLLDNDQIFIYDISCMKLMETLDLWESNNEGNLNDHIKVG
FT                   ERASNMINENLKNGNELDRIRSKSNNNNDQTNSDNGRSRTYSINGSHKIKPQLTLSGND
FT                   NSILCYSKYSSSKQNPARILNDIVVYDALNLKPINYLNSVHKGCVLKTSVSIDGKLLAT
FT                   ASEKGTIIRIHKTGVDSDFASGPLLYKEFRRGSRPSHIHQLLFNKDSTLLVCVGDSDTI
FT                   HIFRTDDDGLALDGIDGDIGSDSGGSLELIKNRIPHEQVKKFFSRKIKSHIPNQNLHRD
FT                   FAHINMDRIVHTVVGFPEEFDNKIYVASDDGSFKTYTIPSKHGQCVLNKTSHFI"
FT   CDS_pept        complement(576149..577549)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431218"
FT                   /locus_tag="CAGL0H05863g"
FT                   /product="Similar to uniprot|Q02884 Saccharomyces
FT                   cerevisiae YPL101w"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="Elongator holoenzyme complex "
FT                   /protein_id="CAG59984.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0033588"
FT                   /db_xref="HOGENOM:HBG058259"
FT                   /db_xref="HOGENOM:HBG395566"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniParc:UPI00003B6703"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRU3"
FT                   /transl_table=1
FT                   /translation="MSFRKRGEVLAGGRLPNRAPLVPGRTPGGTPSTPGDAGVNRLSGR
FT                   MEQLNLRGGVRANISGRPLADGRTAASGPNKEPISAFGVNHPGIRPSPASSQPATSTGC
FT                   FDLDKVLGHMGLPLGTSLLIEERNFTEFNSVLVKLMCSQGIIHNRVEDNKEKNGNTHLI
FT                   ILSASQSLGKELPGVYKGSKKDIKKSKISEEQKKLSVQNLNEEKSTPSRYKDLKIAWKY
FT                   KFVDEQRGVKNAEAGDSLSSEYPNYNHQFDITSRLLPAPTSNELTFINPTEPVASIINK
FT                   LDRTIQQHSNKLIRIVIPSLLHPATYPPRMFLSSEVLLLMHGLRGILKKYSSRCVLMGT
FT                   ISTDIIDSFLLAQLENFFDSVLNLEPFGQDMMQFLERIYKTQPGKIQQGLLHIMKLPVF
FT                   SERGEMHVMKSELAFKNGRKKFEIEEWGIPVDDVEDDKPEKQNNPNETDMSNTIAAPKK
FT                   STKVSLEY"
FT   CDS_pept        577874..579214
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431219"
FT                   /locus_tag="CAGL0H05885g"
FT                   /product="Similar to uniprot|Q02883 Saccharomyces
FT                   cerevisiae YPL103c"
FT                   /protein_id="CAG59985.1"
FT                   /db_xref="HOGENOM:HBG058256"
FT                   /db_xref="HOGENOM:HBG395518"
FT                   /db_xref="UniParc:UPI00003B6704"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRU2"
FT                   /transl_table=1
FT                   /translation="MFCSVGRIPFQRCRLHARSLSISPLTKKEKRRIGYGSLAVLSFLV
FT                   PYTAYAVFVTVSAYSEIDTRLDLSEVVEKKDGLNYQGTLIKYSPLQVLGRYENPFAEYR
FT                   IQTIYEFFINRVVELFQRNRGGIPAERAHMNQLMPVHKPTWSEDKIKIEDEQLIKYQLL
FT                   TEHDDLKTMNVNVDSKDDNIPVYSTWLGQSCNFVSYNGLKVLTDPLFSDYLIHKKLGPK
FT                   RITDMPANIEDVPKPDIIMVSHNHPDHLDQESIEHWKNSETLWIVPKGLKSYMDKNKIK
FT                   NYIELSWWETCELEKDNEIYHISCTPAMHWSGRSVLDTNQSLWCSFLLSHNKKPILFHA
FT                   GDTGYVKDLYVRIKDRFGAGCKLALLPCGQYCPEWHQKPRHINPREVIKIMKDMEANQV
FT                   LGVHWGTFVLSGEYFLEPKERLEMLAEFDGIRDKCYCPELGKTIKIE"
FT   CDS_pept        complement(579444..581423)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000275159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431220"
FT                   /locus_tag="CAGL0H05907g"
FT                   /product="Similar to uniprot|P15179 Saccharomyces
FT                   cerevisiae YPL104w MSD1"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG59986.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG000997"
FT                   /db_xref="HOGENOM:HBG396032"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR018153"
FT                   /db_xref="UniParc:UPI00003B6705"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRU1"
FT                   /transl_table=1
FT                   /translation="MFAKGVNSKLLRRWYQLPAKELIRDKFEFETSNLRVRELVTGADI
FT                   VLNGWIDSKPKRISKSLIFGQLRDSNGDRVQLVDTNSLLRKCKVEDVVQVRGKVQLKRE
FT                   TGSSNLDNKKFEVVVDHVKTLNAANKKPSELKELRDTSPELVPPEFRYIQLRTARYQNY
FT                   LRTRYEVSKTLRQILDQDGFTEIETPTLFKATPEGAREFMVPTRVSAKIKQVDKIVPMF
FT                   YALTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQKDVMS
FT                   VIEKCITSVWKKFRTKESTGLLTLDRNHSLTPTDASNLYRMTYKEAMTNYGIDKPDLRA
FT                   PSLRILNMKELGAYSNINPAFPIFEIMIIKKAFTDKNDYKKKWSFLSNDDNYNYRKPIV
FT                   VPISTDLETKNWYEKFMRIASFENTHMLNKAIRLEVGDIVVGSNREIDTRIFENPTPLG
FT                   RARQLILQNNETKDIVRETNKDVAVWVVDFPLLSPKETEIKNTKHKEMYPIYEDRTVIS
FT                   THHPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLK
FT                   ISNYQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFPKSITGSDLVV
FT                   QSPSTIAEDILRDYKIEYLSRNSE"
FT   CDS_pept        582132..584999
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042904"
FT                   /locus_tag="CAGL0H05929g"
FT                   /product="Similarities with uniprot|Q02875 Saccharomyces
FT                   cerevisiae YPL105c"
FT                   /protein_id="CAG59987.1"
FT                   /db_xref="HOGENOM:HBG124852"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI00003B6706"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRU0"
FT                   /transl_table=1
FT                   /translation="MSYSNMDSLAYNLRSLDVNTVQNSTDGINLTGFNPHDPGHKTGNT
FT                   AADNGNASIGTPATPSTPGNYPLGMQGPNPNQYQMQFQPLQQLNRTSSLIENMGVQRAS
FT                   SPFLARSQSNLSVFQNSTPVNSSVGNNILSPSGDVPSMNPNMNMNMNMNMNMNMHMNSA
FT                   TPTNAQALEKDWFQQQYPQRSQLQRPNVLPQQSNLYSPLSQQHTPVAFNNSAQIQQPNM
FT                   AIGSQSSIGNHMGMAPPPPPHFVITESQWKYIDPSGQLQGPFRSSEMTTWYHLGYLAST
FT                   LEIARVPTSPEPLDINDKFIKISDLIEKVHNAQEPFQTFDFIVAQSSNISKPPGLATNA
FT                   NFLNTINPDPALNVGQQLNVSQNIRQQQQQQQVPTQPLVPLPQTIKVKKQAVDAIDRIE
FT                   SPDYNFEELLNLRSTEKDNEYYYRETTIRVPVNRHLIKKLDPNENVNTTQYNVFPPITY
FT                   DLGILEQLKLQGEYDAAQKKQHAEKQENKPMVEEDMKSNTTTEKVKSKDVSKPADSDTK
FT                   IVSNTSEDNADQIDKHKLEEKRRIEKANEMARKLLEEQEKENESKKRKEQKQSKKQKKK
FT                   AEQKLVPTTETETISDNKNEELIEVPNRQNEENNQSEPQITTKPAPWANKNTAVQVDSI
FT                   PTIEELQKLKQSKKKASSKDPDVRNKLLQLHEEIMQEERSKEKMTSVLKWADKSSNSQP
FT                   SSSIDLKEQVKNSKKNRNSPAPIANKLPTLGSGLEELKNPTFIEEQKQIWEQIQKAPQK
FT                   GKKTDITSSLLSSNSSTRSATSTGSNPWKTVASQSSQAVNTSAGTPPVKPVVSKANSTS
FT                   TSSVNSLNRGKQIGSSTVNPIMKARQPVNLYPGNSSISARQEFIKWCKTQLKLKQGVNA
FT                   KDVLEVLLSLPAGLEAKEIIADTIYSYSATMDGRRFATEFISKRLECESQIKDPLNWSE
FT                   VLALPEGSSDDWEFQVVTKKKTRKY"
FT   CDS_pept        complement(585256..585942)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347322"
FT                   /locus_tag="CAGL0H05951g"
FT                   /product="Similar to uniprot|Q02873 Saccharomyces
FT                   cerevisiae YPL107w"
FT                   /protein_id="CAG59988.1"
FT                   /db_xref="HOGENOM:HBG124853"
FT                   /db_xref="HOGENOM:HBG397133"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI00003B6707"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT9"
FT                   /transl_table=1
FT                   /translation="MMITMRATMRANMTMRRFSSCRKISMTFEGNTRGIAATPEERMQR
FT                   IFGGRLKGEPPKSTSRILTGGSKLIAGVEVPEKPGQPDNCCMSGCVNCVWELYNDDVRY
FT                   WKQKRNEAALKIRDSTEVWPSNWDPPLDKLEMKNLPPTLHGKKMKLEEDLAKQHQTVAN
FT                   LFPKRTNPLPKSVQQAKQRNLAKKIHTPVEENDGWDDIPVYIKAFAEFERQRKLKKNKI
FT                   QPQTSH"
FT   CDS_pept        complement(586329..586826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066023" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499456"
FT                   /locus_tag="CAGL0H05973g"
FT                   /product="Similar to uniprot|Q02872 Saccharomyces
FT                   cerevisiae YPL108w"
FT                   /protein_id="CAG59989.1"
FT                   /db_xref="HOGENOM:HBG124854"
FT                   /db_xref="HOGENOM:HBG203897"
FT                   /db_xref="UniParc:UPI00003B6708"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT8"
FT                   /transl_table=1
FT                   /translation="MQVVQLTEEFTRLNGVKDQAITKPVSLDDNTGEVVVRTSTGKSKI
FT                   RKGQTEEEYRHQLKLYFEDERGPQVTEIGWLDEYIVDQDKIFSEESLFHDLSIKHNRQT
FT                   VSGICHKLYYQRDYENCVSLAQKLRDLFEPYNTKNKIHRELEELDYMISKCNERLGSKE
FT                   FQ"
FT   CDS_pept        complement(587125..587868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194056"
FT                   /locus_tag="CAGL0H05995g"
FT                   /product="Similar to uniprot|P39721 Saccharomyces
FT                   cerevisiae YAL049c"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG59990.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG067473"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI00003B6709"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT7"
FT                   /transl_table=1
FT                   /translation="MASKMLGQCCFKGFYRKGETKGLHKDIFGVDSYVVGLENPSDKVV
FT                   VIMTDVYGNRLNNVLLTADQIAESGYQVYVPDILFNNPALDLNVPLDIPAWMASHPVDR
FT                   AHNLVTKYLSDLRKHVNPKFVGIIGYCYGAKFAIKQIDSASGIVDACAIAHPSLVTIED
FT                   VAAIGKPLLISAAEEDAIFPEEMRHMTEAKLKEIGARYEIDLFSGVEHGFASRGDVSNP
FT                   VVKFAMNKALADQLYWFDHFASGGQ"
FT   CDS_pept        complement(588556..590229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347323"
FT                   /locus_tag="CAGL0H06017g"
FT                   /product="Similar to uniprot|P38124 Saccharomyces
FT                   cerevisiae YBR008c FLR1"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG59991.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B670A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT6"
FT                   /transl_table=1
FT                   /translation="MNYLHNFKDTLFVDLLEVLNIVTIGEEHVNQLNLSGDASLSASSE
FT                   SSNMSFNSGSEENSQEKSVEDLEKQNCEINIHKNSDKEADTKKDPFLVTFNGEDDPLMP
FT                   YNWSTNKKALIIIQTMLLTCVNYMGSSIYTPGQLEIQNEFHVGHVVGTLNLSLYVLGYG
FT                   LGPIVFSPLTEISSIGRLPVYMITFFLFTMLQIGCALAPNFAGLVILRFITGVLCSPAL
FT                   STGGATLGDIVSQNYLALVLGLWSIGAVAAPVLAPLLGASMVVAKDWRWIFWLLFFCCC
FT                   ATMLLLTFFFPETSSDTVLHRKAARIRKLTGDNRYYTEKEREEAQLPKKQFLIETLYRP
FT                   FSMMITEPIVLAFDLYIALCYGAFYLFFEAFPIVFGGIYHFTLVEQGLAYFGFCVGCIF
FT                   AYIILLVFSIKVAAKRFANNTFTPETTLILAMCIGWCIPLALFMFGWTAKVHWILPIIS
FT                   EVFFVLGCFNIFQASFSYLAICYPKYVASVFAGNGFARSSFAAAFPLFGQAMYNNLGTK
FT                   NYPVAWGSSLVGFFTIGLWVIPFVLYKYGPSLRSMSKYNR"
FT   CDS_pept        complement(592526..594295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431221"
FT                   /locus_tag="CAGL0H06039g"
FT                   /product="Similar to uniprot|P38124 Saccharomyces
FT                   cerevisiae YBR008c FLR1"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG59992.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B670B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT5"
FT                   /transl_table=1
FT                   /translation="MYIGAFQDTLFVDMLEYFGWVTVGKEYLDIYRPNGVPVAPNAVAA
FT                   SISGKEEMKQDNQTSTDSMSTSTQQETDASNEDIERAMDTDNGLDKAMSGGQGVFGTEE
FT                   DDSSTKDASKPEEADPFLVEFLGEDDPRKPWNWSFSKKTFVIVQLMVLTCINYMGSSIY
FT                   TPGQEQIQHEFHVGHVVGTLNLSMYVLGYAIGPIIFSPLSEVSSIGRMPLYLWTFILFT
FT                   ILQVACALVRNIAGLVILRFITGILCSPVLATGGASVGDVCFPRYVPRFLGAWAVGAVA
FT                   APVMAPILGAAMVVAKDWRWIFWLMLFMCGATLLSIIFFFPETSHECILHRRAKRLRKL
FT                   TGDDRYYTKKEKQEEALPVSVFIKNTLWRPIKMIALEPIILAFDVYIALCYGAFYLFFE
FT                   AFPIVFAGIYHFTLVEVGLAFLGFCVGCVFAYTALIIFQEKVIRKKFLEGKFRPELFLI
FT                   LAMCLGWCLPFSLFFFGWTARIHWILPIIAELFFVLSVFNLFQATFSYLAVCYPEYVAS
FT                   VFAGNGLCRGAFAAAFPLFGKAMYDRLSTKKYPVAWGSTLIGFITVVLSLIPFVLYKYG
FT                   PALRARSRFSPDS"
FT   tRNA            join(complement(595712..595750),complement(595642..595686))
FT                   /gene_name="tRNA-Leu (TAG)"
FT   CDS_pept        596149..597021
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042905"
FT                   /locus_tag="CAGL0H06105g"
FT                   /product="Similar to uniprot|P21242 Saccharomyces
FT                   cerevisiae YOR362c PRE10"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAG59993.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00003B670C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT4"
FT                   /transl_table=1
FT                   /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDG
FT                   VVFAVEKIITSKLLVPNKNLKIQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYG
FT                   SAIPVDAFAERVGQYVQAHTLFNSVRPFGVTAIFGGCDKNGPHLYMLEPSGTYWGYNGA
FT                   ATGKGRQTAKAELEKLLDKTPEMSAKEAAKHAARIIYMAHEDNKEKDFELELSWCSVSE
FT                   TNGVHKLVPKDILNEAIEYAKNEVNGDDDDSDSDSDSDNDNDNEKKDKDSDDEDVDTKK
FT                   DADGDIQLE"
FT   CDS_pept        597557..597820
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042906"
FT                   /gene_name="TIM9"
FT                   /locus_tag="CAGL0H06127g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM9"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAG59994.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="HOGENOM:HBG628226"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00003B670D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRT3"
FT                   /transl_table=1
FT                   /translation="MDQLNAKEQQEFQKLVEQKQMKDFMRLYSGLVERCFTDCVNDFTS
FT                   SKLTSKEESCILKCSEKFLKHSERVGQRFQEQNAALGQGLGR"
FT   CDS_pept        complement(598643..601264)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042907"
FT                   /gene_name="CCR4"
FT                   /locus_tag="CAGL0H06149g"
FT                   /product="Glucose-repressible alcohol dehydrogenase
FT                   transcriptional effector"
FT                   /EC_number="3.1.13.4"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="poly(A)-specific ribonuclease activity "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG59995.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004535"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058508"
FT                   /db_xref="HOGENOM:HBG444228"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003B670E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRT2"
FT                   /transl_table=1
FT                   /translation="MNDISMMGYPGMGQQQPQPQQAQQPQQQPISMQPHTMMNMMNTNL
FT                   PPPGMMMGGAGSNTGNENMINHGLMSGNPVSGIPNNNSHQLLDQLINKNPNNMGIPQQQ
FT                   QDSLAAQMQLPMGGMPMGNGSAHNGNVGMNNNNTGGNNNIPMGNANVLRNNNIIGNLGG
FT                   SSLAGGNMNSGMPGISTFGNTPGQLAAPPIQPNANANNPMYHPHLEDPSLMNNPIWKLQ
FT                   LQLATVSAQSVGQPNIYARQNAMKKYLATQVPPQNQTQQQAQAQSQIAETSKSLVDCTK
FT                   QALMDIMAPDDSKLKGMSAPNTASTTTNSTISTPTTSKIDMNNSREQPSTPSLLLQHKK
FT                   LSQYSIDEDDEVENRMVAPKDTKYNDQIWHAIDLSNLQIFNISPNLMKYDFLTRLYLNG
FT                   NGLESIPSSIRNLKNLRVLDLSHNKLKELPKEIGNCYQLKYLYFFDNQITTLPWELGNL
FT                   CNIQFLGCEGNPLDKELLKILTEKSFTGLIFYLRDNRPEVPYPHDRKFIEINADGEPEK
FT                   EYDTVQEAERNLSSDMQKKSFTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQ
FT                   ILNFNTDIICLQEVEAKTFEDFWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAF
FT                   YKTSKFKMLFKECVDFSGLWMKHKKFQRTEDYLNRAMNKDNVAIVMKLQHIQSGEIMWL
FT                   VTTHLHWDPKFNDVKTFQVGVLLDHMETLLKEQNPKQDVKKYPLVICGDLNSYLSSSVY
FT                   ELFSTGRVQHHHDGKDRDFGYFSEDNFSHNLALKSSYNCIGELAFTNFTPSFTDVIDYI
FT                   WFSSQALRVRGLLGEVDSEYVSNFIGFPNDKFPSDHIPLLGRYEFLKSNNTQNSNSGSR
FT                   KV"
FT   CDS_pept        complement(602526..603590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163478" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431222"
FT                   /locus_tag="CAGL0H06171g"
FT                   /product="Similar to uniprot|P31386 Saccharomyces
FT                   cerevisiae YAL020c ATS1"
FT                   /protein_id="CAG59996.1"
FT                   /db_xref="HOGENOM:HBG058507"
FT                   /db_xref="HOGENOM:HBG398181"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI00003B670F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT1"
FT                   /transl_table=1
FT                   /translation="MIPIKSLDLPTDIDVTKISCGGNHTVILLSTGRVLGCGDNSLGQL
FT                   CSDDQAKQIIGWKEICSGYNVIDVTCCWDSTTIVTADGKVYSRGSGLKGELGLGSSNLE
FT                   NKSNFELVMDCSKYAGYRVYSSFQNCILVLDKKEDNGSIVYAWGNNTKCQINEPKSRRL
FT                   ASPIVMYETFEIRVANVVMGKDFNLLMTPQGKIIHVNGKTPEDFTKDFETRWKFAKELE
FT                   VKSMWSSIHIRDKSDPNKIHSYGNNIHGQVFDQSQLSPSECIANFTTGSEHGILVSKDR
FT                   DHNDHELYQLSCWGWGEHGNCGSVQDHEEKQWVNDKHNVTSPLNPVAKAISRPMVYGGC
FT                   ATTWIVSNDTLAIL"
FT   CDS_pept        604422..607802
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431223"
FT                   /locus_tag="CAGL0H06193g"
FT                   /product="Similar to uniprot|P31380 Saccharomyces
FT                   cerevisiae YAL019w FUN30"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAG59997.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG190546"
FT                   /db_xref="HOGENOM:HBG398150"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRT0"
FT                   /transl_table=1
FT                   /translation="MSGNEGTEGQPGNNLSPVQYKTVSSSPLKPEASTQDAQKLREQFV
FT                   FKPNNNLSSAITSTGQTASSATSGTAAPVNPNAFESLVAEFPDFSQTLVQAVYKSNSFD
FT                   LSLARERLTRIRNQRKNWVSSKNLNSNVARGSRAASTGTGRLSGINNTSDSSKIVLEKQ
FT                   KKSIFDRYSSAVNSNAQNSGINSELFEKMQRNGSHKKRKLVRGDKLAGDESYVDSSNSQ
FT                   LAKAKQQLLKSRNKKFNLSDDEEEVGNDNGDFSDASGDEYEEHTPVANIDDQILEFLNN
FT                   SEIDDIMDLGEVSYERAKIIQSARPFTSLYSFSQQEFLTEEEKEKQAKLLAQPKKRGRR
FT                   GAAQRKEGEKVLDRVSQAMRGYNAIESVIKTCSQYGKLVSSQIKKWGVKVDAENGDDGE
FT                   LDFINVGSETEGDAIVEDFSSSAQTPAPEMSDSEGSEEIKLEDVNKKLESTTDNNNKDD
FT                   GATLETASEPKLDTMEEKDKTTDTSVEKTEENTANVKVEDTDKANDDPDSDFQADEEME
FT                   FIDEDEEDEEYDEELPVTRRTRNTGGNFRKEVVKKNSVVKFFRGRPKLLNPDVSLKDYQ
FT                   QTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYLKQIGQPSPHLIVVPSSTLENW
FT                   LREFQKFCPSLKIEPYYGTQQERADLREILERNDGKYDVIVTTYNLAAGNKYDVSFLKT
FT                   RNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKELMSLLEFIMPNL
FT                   FVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFILRRRKDQVLKHLPA
FT                   KHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIENNSSKNLIMSL
FT                   RKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFMTDFELHRLCCN
FT                   FPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDILEKVLSTL
FT                   NYKFLRLDGSTQVNDRQTMIDKFYDDNTIPIFMLSTRAGGFGINLVCANHVIIFDQSFN
FT                   PHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQVSSSEDQSDLI
FT                   DNKVSDLLEDIIYTEAQKK"
FT   CDS_pept        609128..612415
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113522" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431224"
FT                   /gene_name="GAL11"
FT                   /gene_synonym="MED15"
FT                   /locus_tag="CAGL0H06215g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 15"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG59998.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG124855"
FT                   /db_xref="HOGENOM:HBG202769"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="UniParc:UPI00003B6711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRS9"
FT                   /transl_table=1
FT                   /translation="MSSKETIPMHQRSQNVAELLTVLMDINKINGGDSTTAEKMKVHAK
FT                   SFEAALFEKSSSKEEYQKTMKSKIDAMRSTRDKRKRESVGSASMMANLGQDGTNNNNNN
FT                   NNNNNNNLNMAASFMGGDMFGRNQSPAQNSNANTNLNTNVGPGVNGPNGNDGTANPQMF
FT                   MNQQAQARQQAAARQLKNRQMGGSSAQQQQLTQQQQQLLNQMRVAPIPKELLQRIPNLP
FT                   PGVTTWEQVTALAQQNRLSAQDMSIAKDIYKIHQQYLIKAKLQQQQQRQQQQRQQGNPD
FT                   VNNNMAGSNNNNNNNLPMAQQQMQQRQQQQQQSQQQQNRNPNQRHNVLSQINQMFTADE
FT                   QRALLQEAMEACKNFQKTHFGGQMSDANKQAFIKKFINSKALKKLEAMRMAQGGNNNAN
FT                   LNKGQADMLQRQQANMQMNQQQQRAAQNQRRGPVMNDAVSQGYNNQMNSAADSTMNNSN
FT                   QPMNIGNNGVNMIPNQSQQQQQTNRPKEQTPQQPQQRIQSNRSVPMLNPTPEDVEVVRR
FT                   ISAEAAKTQLRLTDLTNSLTPQERDEIKKRLQKNQQLFAQVSSYAPQVYLFTKSESFLK
FT                   EVLQLRIFIKEILEKCSKGIYVVKLDTVDKLVIKYQKYWESMKIQLLRRQQLLQQQQQQ
FT                   QQQGMDPNRAQNSQQQQQQNQANMQQARNRKPTKNQTTPAIAASVAMNMNDKGASMSPA
FT                   LQKAGSAVPNFAQQMSPNMTPGTIPPTNVLSPHSQSHIPMVSPTMAKAASAAALKNDTA
FT                   SSSRRGSTKPRGKSTAPVTGKKTSNAPTPQVVPATVPSTTNLSAAGTPNIRNKSATPLT
FT                   AGLSPKSTIRSNSNTALASAKTPSPMTVSIPQPGNSSVFKKEEEYLSKLQLRKEEIRFR
FT                   QKQRLDILSSSPVDLFLTTVADCLGINDEEIELINKIPETTADNINNTGKKKLTKAAQK
FT                   LRDKEILNVSIQVGEKDKLIMSSKAPDKVMDYSISAMSLAAVFKNLSSTGSLNNIALSG
FT                   SNATTSKDIGNIYSHTGGVKRKFDEVEISPNSNGSPSASIMSESKKIKIDSPEDMFVTH
FT                   SSEAAKGTNNSSLMDSGKEGSCKSMAGSATEVNDTSIWDWNFWTSIE"
FT   CDS_pept        complement(613054..613962)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431225"
FT                   /locus_tag="CAGL0H06237g"
FT                   /product="Similar to uniprot|P31379 Saccharomyces
FT                   cerevisiae YAL018c"
FT                   /protein_id="CAG59999.1"
FT                   /db_xref="HOGENOM:HBG124856"
FT                   /db_xref="HOGENOM:HBG203630"
FT                   /db_xref="UniParc:UPI00003B6712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS8"
FT                   /transl_table=1
FT                   /translation="MSFAGSLILTGLGGVYYKFSRDQHFKPLEIAQKATIQDATSIYQR
FT                   QLVKLATRSAQVSAVIADDLFTGNMFVYPFKGMYELYSNFRDYAASTTALFSLYLVSYA
FT                   IVTMVYWATITPVYTALFIVLGPFGILIAWIHSILHTNMLTMMFLRVSHLNEGLVKNCV
FT                   DANGYQSLFRHTPIKYQVSPSTPYFWYFHLTKKLSEYLTGLIILVFLLIISSIPIVGPF
FT                   TFHFLVSPALSRVYFSKMLRLKGLSNIERYERIYQHPGQYTMFGITAGFLDSFPFLAGI
FT                   SLSTNILGATLLGIDQLTTYR"
FT   CDS_pept        615045..619055
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431226"
FT                   /locus_tag="CAGL0H06259g"
FT                   /product="Similar to uniprot|P31374 Saccharomyces
FT                   cerevisiae YAL017w FUN31"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="signal transducer activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60000.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058503"
FT                   /db_xref="HOGENOM:HBG396821"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6713"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS7"
FT                   /transl_table=1
FT                   /translation="MPYIGASNISQNSFVSLKEKHAIRDKGSPSGSEISLVPDSPIKDV
FT                   APSRLNNVTNASSLSNNSDSAPRSNNGVGTDSSSVPKTRPREQSFNGPLPEHILKDDKN
FT                   FFGLERPPRLARNVSLDSSASTISEVDAKELFMLPNESTHAYSYNPLSPNSLAVRLSIL
FT                   KRSLEIIIGNPEMLREPELDLPEELKGENVSQRRKSLNNLYNPHFESFSMDRSVMRKAN
FT                   QKAMPHTATLNAFVANSTTNFGNLAISEKKKANNQLSKSSFGNINVGNIAGIHRAASMA
FT                   FLPSSFGRSDSRTDRSLADFNRKFGRKPNPQINFREPFKKIPEQGTSSMEECSSTKTLS
FT                   GDNTSKDLDHSISAISEEGDTVVNEMDYFVDEQRANLMSLLDLLNETLEKNTSPKASDL
FT                   HMISLFNLDKLSLNNDECNGKSSSESQKRTVALKKTLLDSLAEPFFEHYGGADEIRHDD
FT                   GELVNELEDISAMADDSVSLGEFRPQQDYGRILRTFTSTKNSAPQAIFTCSQNDPWQFR
FT                   AANDLACLIFGISKNALRALTLLDLIHTDSRNFVVNKLSSTEGQELVFTGEIIGIVQPG
FT                   GDNTNLIWASFWAKRKNDMLVCVFEKVPCDYADIMLSLDDFSVTSVLDRCGLLEAAKKK
FT                   EPENKHPTFHLGLNEEDSEEEDDESSDSKVAEPAKKSVKFADEITNISMISTSLAQTIE
FT                   DVCNGKLHNLDDDLLPLQLRVSNRINFTRYFTLNHLSHSIPCAVSATILENEMKLKIHG
FT                   IPYQAGLFVVDSHNYQMISFNKSIVKNMFGYHFSDMVGKPITDIIPSFSELLKFTSLRY
FT                   PALTVTNHRNRGLVLTEHFFRKLRAEMMGRKDEFYTSIGIDAVHRDGGMIKVDFQVRVM
FT                   SSNVILVWITHSRDVFFNDYTTTPSQLHMLKENDLAVVSSEGSSTCSSSKSSPHISSRP
FT                   LRELTKLSDVDRDNQPERFKSSSVSSKDSTLFDKDTHKDVSMDEVFDDLEIEKDIEDPE
FT                   LKRKLALTKIYHKDKSQFVKEENFKVNQSFIMSKISIQHSSDSLANNRSATTTPINLQE
FT                   GNIAPTTFLTMNPNPIGAKKHTKKLSDFIILQNMGEGAYGKVNLCLHKTERYIVVIKMI
FT                   FKERILVDTWVRDRKLGTIPSEIQIMATISKEPHENILTLLDFFEDDDYYYIETPVHGE
FT                   TGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVDSQGFVK
FT                   IIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGSPYEGKPQDIWAIGILLYTIVFKENPF
FT                   YNIDEILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTIDDIYNDEWLVI"
FT   CDS_pept        620236..622056
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431227"
FT                   /locus_tag="CAGL0H06281g"
FT                   /product="Similar to uniprot|P31383 Saccharomyces
FT                   cerevisiae YAL016w TPD3"
FT                   /function="binding"
FT                   /protein_id="CAG60001.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG021800"
FT                   /db_xref="HOGENOM:HBG526812"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B6714"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS6"
FT                   /transl_table=1
FT                   /translation="MAQADQDLYPLALLMDDLKNDDISNRVEATKKIDQIAIALGPDRT
FT                   RNELIPFLTEVAEDDEDEVFTVLAEKLGSFVPYVGGAEHASTILPVLDILAGAEETIVR
FT                   EKAVDSLNIVAEQMPDDELFKYFVPLLQRLASETWFSSKVSACGLFKSVFLRVKDVQSR
FT                   VDLWNLFMTLVNDETPMVRRAVGKNLPILIDLLTENPEFCTDKDLEFISTTFQTVINDQ
FT                   QDSVKFLAVDCLISIVKFFNKKGYDTHSRDLLNSALSLAGDEAWRVRYVVADKFGELTE
FT                   GFSSNPSYIEELLDPFLKLCEDSEGDVRKAIAKQVSYFSKFVNDSHVVLNKIVPVLQNL
FT                   SMDENEDVRASLASGISDIVLLLPKEQVIEYVFPIFLNMLRDEIPDVRLNIIGKLKVVN
FT                   EVIGIDMLTDSLLPAISELAKDSSWHVRLAIIEYIPILAEQLGVDFFNSQLSDLCLSWL
FT                   WDAVYSIREAAIKNLQKLTNIFGSEWCNNEVVPRLLNLDSHMLENFIYRITLLQTFKAL
FT                   VSVLSPEFVANQILPHVMELANDQVPNIRFNVANTYPIIVEVLSKGGDQYKLLVTDTIY
FT                   PSLKDLCEDPDFDVRYFANKSMKKCKEIIS"
FT   CDS_pept        complement(622232..623638)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431228"
FT                   /locus_tag="CAGL0H06303g"
FT                   /product="Similar to uniprot|P31378 Saccharomyces
FT                   cerevisiae YAL015c NTG1"
FT                   /function="catalytic activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="CAG60002.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG459731"
FT                   /db_xref="HOGENOM:HBG464473"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI00003B6715"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS5"
FT                   /transl_table=1
FT                   /translation="MLRSTSRFRPRSTLGVIQWHTMAVLRKRKSSAKEIAVKNENSEVT
FT                   KSKYFKERVKVKKEREVDISHDRDYVDINWVKSLDSENYFKWIVSRNGNVPNRWSQPFD
FT                   DTIFTDLDEESFKLLPKNFPEIYKKMRWMRSFIRAPVDLIGGSSIPMTVGEICGIKKSE
FT                   ILPRNYRLQVLVGVMLSAQTKDEVTAMGMYNIMKYCIEELKDAQGITLDALLRIDEQVL
FT                   DELIHSVGFHKRKANFIKRTAAILNEKYDQDVPDNVTDILGLPGVGPKMGYLTLQKAWG
FT                   KIEGICVDVHVDRLCKMWKWVDPDKCKTPNDTRKQLQKWLPPRLWTEINGLLVGFGQVI
FT                   GKSRGANFNIFRVNIDESKQRQLTEKTFTTLSNLNESIRSNITSYSKWMGFLMKLDLKK
FT                   LENDMKEELDVSIVEGEQNSIELKKEPHSSIDNKLDVGVKLEESCAINVDTSLKSEILI
FT                   KKEPDTSLFV"
FT   CDS_pept        complement(624076..624903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499457"
FT                   /locus_tag="CAGL0H06325g"
FT                   /product="Similarities with uniprot|P31377 Saccharomyces
FT                   cerevisiae YAL014c FUN34"
FT                   /protein_id="CAG60003.1"
FT                   /db_xref="HOGENOM:HBG058498"
FT                   /db_xref="HOGENOM:HBG397920"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI00003B6716"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS4"
FT                   /transl_table=1
FT                   /translation="MDLKVSYELDKLKDIVEERTRLIDELSMEPSKSDTISLKSQLSTV
FT                   LDLLNSVGGHGTDEIKAYIDEYNKVLAQLGDDTAVDVGLYTFSPKQDIASKPGESRANA
FT                   GDIDEEEIEDDETRKRVRFNDDLETFPNEDTEQDAPASAPMTFQPYHDYEEDTTNSSSS
FT                   TSDKRVNAGHMISNDELFARQQQQLLEQDTHLDSLATTIKNTHGISIDINQELTDQNEH
FT                   ILDDMENLLDTSSRNLERARRRLDSFQRTARENGPCSIIVMLTIILIFLLIIL"
FT   CDS_pept        625360..627138
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431229"
FT                   /locus_tag="CAGL0H06347g"
FT                   /product="Similar to uniprot|P31385 Saccharomyces
FT                   cerevisiae YAL013w DEP1"
FT                   /protein_id="CAG60004.1"
FT                   /db_xref="HOGENOM:HBG058964"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI00003B6717"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS3"
FT                   /transl_table=1
FT                   /translation="MENRELEKEPMEDRIPGNEAIEEDQESVLSNIDFNGQDGEVITMR
FT                   SELNLSEYCVSSDADTEKMDDDDDDGKHPPLKELVVDAETLSRKRSLDDDATEDVFEDK
FT                   KPKLEQVEASEVNNENQGNDNHTETNDSVPVEPISSPLNTMEGVKPPVIPSENTTELRT
FT                   ADQASNEISVPDKETEESTPMGTEERLNEEKDTLEHQSNEKPKSAEPVPQPEEVSNDLA
FT                   DTDTVIGTESKQSEDQLHDVVPEEPTDPNSAPDNVEAPVEAPVKADITKENTDADENGP
FT                   EESEVKEGEKEEEGNDEEAANNIDEDEGAVGDADDDEDEDDDIDEDEEDEEDSQTVDNV
FT                   ETSDSSKKKKRKKSSILPMVLEERRQQALKDITEIEHSFAELRQKLYENKLRRLETELQ
FT                   MCVEGSHPELHEYYEKISKLRDFKLHRTYQRQKYELKCIDIETRATRTMIHQNFLRCVN
FT                   ELRSQLLQDTTTKWYDINKERRDMDIIIPDINYHVPVKTANKTLSCITGYAGPAQPRRY
FT                   LGEPLSEDLECENISYRYNGNPVDKLEVIVDRMRLNNELSDLEGLKKYYHAFPGAPSLS
FT                   TLRDSEIQDDFNYLRQ"
FT   CDS_pept        627708..628883
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042908"
FT                   /locus_tag="CAGL0H06369g"
FT                   /product="Similar to uniprot|P31373 Saccharomyces
FT                   cerevisiae YAL012w CYS3"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG60005.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS2"
FT                   /transl_table=1
FT                   /translation="MGLLESDKFATKAIHAGAHEDIHGSVIEPISLSTTFKQSEPAKPI
FT                   GTYEYSRSQNPNRENLEAAIASLEGGKYGLAFSSGSATTAVILQSLPQGSHAVSIGDVY
FT                   GGTHRYFTKVANAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAE
FT                   NVKKINKDILLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDI
FT                   YERLQFLQNAIGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNENVVAVNY
FT                   PGLQSHPNYDVVKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLL
FT                   EVPAVMTHGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQKATA"
FT   CDS_pept        629481..631460
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431230"
FT                   /gene_name="SWC3"
FT                   /locus_tag="CAGL0H06391g"
FT                   /product="SWR1-complex protein 3 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60006.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058914"
FT                   /db_xref="HOGENOM:HBG203633"
FT                   /db_xref="UniParc:UPI00003B6719"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRS1"
FT                   /transl_table=1
FT                   /translation="MAVALRARNAVKVEDGIDTSNIIEEVDDNTKGTRSRASRRRRRRG
FT                   DEEEKHSEEETYNEFNDDGTLKTEGTLQTGNGSGRPFELVAGLPCSLDVPQYNSALTFP
FT                   LSVRDSGVLYSSLLSSRRTWISGEMFEVYWTRANKVPSLAIKDESIIKELESSKEQDAS
FT                   GKDRMQRMCDCELMAGPHTFSIKLFIVKDDEKEKKWQEEQEYKKKEKEEQKKLESEQRK
FT                   KRAEEKKQMLQLKKQEREKQMQLQKEARARAKKEQAEARQRQKEEERQRKLMNKERVKE
FT                   QKASTSKPKKDQNKKNSDQHMIANLNIMAQRDPELKKLMAKVANGQANMQEIEEFKRVI
FT                   ELAKNLPPPGTPPAKPEVQKAQSKPTDSNETSADSSKSEILQESKTNESDKKATAEQAT
FT                   EPKTHSEENKPESENQSRDNSEKSASSHNQEASIKKEADANSVIKKESSDGDGNKSQQP
FT                   KRKYNKAPKVADELTEKEKEMQLTAFQQKYVTGAELVLEFAENTNFRFLLPKKAIIQYI
FT                   PESNRYKMSWLQIHNQSDITRFYKRQVKELTRRIHNAEEKQRVTDEYNVFRDKKCPSPL
FT                   FSSMTVTFSGIHVKFNSIMMNSFDPKEEVRGYMEDVLAVGTRLSGYNLWYQLDGYDDRE
FT                   LAERLRSELNEYEQSLKPKRQKKQ"
FT   CDS_pept        complement(631794..632432)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431231"
FT                   /locus_tag="CAGL0H06413g"
FT                   /product="Similar to uniprot|O13547 Saccharomyces
FT                   cerevisiae YLR390wa CCW14"
FT                   /protein_id="CAG60007.1"
FT                   /db_xref="HOGENOM:HBG124857"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniParc:UPI00003B671A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRS0"
FT                   /transl_table=1
FT                   /translation="MRAAVVSAVVLGLFSQVLATPPACLLACVAQVSKQSSQCHTLNQV
FT                   GCFCENENTAIKNCLDSICPNGNSDAAYTAFKNSCGDVGKAVASVSSSMSSSMSSSASS
FT                   SMSSSMSSSSSSSSSASSSISSVSSSTSSVVTTGSSSAPKVSESTTSTPSSTASSTFTI
FT                   TSSKPSSVSSTKTSQKPSSSHAISTFSAGANAINAGSGLAVIAAAALLI"
FT   CDS_pept        complement(633080..633391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431232"
FT                   /locus_tag="CAGL0H06435g"
FT                   /product="Similar to uniprot|Q06011 Saccharomyces
FT                   cerevisiae YLR390w ECM19"
FT                   /protein_id="CAG60008.1"
FT                   /db_xref="HOGENOM:HBG049873"
FT                   /db_xref="HOGENOM:HBG059057"
FT                   /db_xref="UniParc:UPI00003B671B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR9"
FT                   /transl_table=1
FT                   /translation="MSRIRGFDLVTIGVVSLVGIYTGARFFEPIVLGQLEKDGHLRKDV
FT                   AVPKYDEDGNLVVPQGTFAGATAPANISTGTGTTTSTSTPNPGNLGNLGNSGTPGDST"
FT   CDS_pept        633721..636747
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042909"
FT                   /locus_tag="CAGL0H06457g"
FT                   /product="Similar to uniprot|Q06010 Saccharomyces
FT                   cerevisiae YLR389c STE23"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60009.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG006464"
FT                   /db_xref="HOGENOM:HBG328356"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00003B671C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR8"
FT                   /transl_table=1
FT                   /translation="MLVAQSTLYRSVLPSGVRIALQFKKLTSYYYKKNYTTVANKSTMP
FT                   YKDLKVQFLKPDLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPG
FT                   LAHFCEHLLFMGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNADHLHGALDR
FT                   FSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGNL
FT                   ETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVKNSD
FT                   RALPVYDAPILKENDLKKIIKVKPVKDLRKLDISFVVPDYEKKWEAKISHIFSHLIGHE
FT                   GSGSLLAHLKSLGWANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDIVVLIFQYLEM
FT                   LKTSLPQEWIFKELQDISNATFKFKQKGSASQTVSGLAKQLEKDYYFPVENILATNLLV
FT                   KYEPELIKHFMKSFTPENSRITFISRSIVADSKEQWYGTEYSVEDYSPEFLKSIENPGL
FT                   NPNLSVPRPNEFIATNFDVEKFDVKEPLNEPLLLKDDDVSKLWYKKDDRFWQPRGYIYV
FT                   TLKLPNTHSSIISSMLTTLYVQMVNDALKDLQYDAACANINLSFVKTNQGLDITISGFN
FT                   EKLLILLKRFVEGVQGFEPKKERFEVFKDKTVHHLKNQMMEVPYSQISGLYNSVVNERT
FT                   WPTKEKLEVAEKLKFEQLDNFVRAIYDGMYYESFVHGNLESKEAREVDSLVSTFLKKDD
FT                   IKNIDVQSNRLRSYIIPKGKSYAYETDLYDENNVNSCIQHVVQLDVYNEKLSALSGLFA
FT                   QMLHEPCFDILRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIDEFYKTFG
FT                   EKLRNMDEEDFNKHKEALCKTLLQKFKNMKEESLRYVAAIYLGDYNYLHRQKKADMVKD
FT                   LTKEDMIAFFENYIESDDATKLVIHLKSKKATEKDESQLDTTKYPSGEKIEDVGQFRSQ
FT                   LYLAPLRQPTKKFEIHEEL"
FT   ncRNA           complement(636877..637093)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR34"
FT                   /db_xref="Rfam:RF01254"
FT   CDS_pept        637775..639010
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194057"
FT                   /locus_tag="CAGL0H06479g"
FT                   /product="Similar to uniprot|Q06709 Saccharomyces
FT                   cerevisiae YLR387c"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60010.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202432"
FT                   /db_xref="HOGENOM:HBG738425"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B671D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR7"
FT                   /transl_table=1
FT                   /translation="MSSTFTCNSCDIQFQTSDSQRYHMKTEWHRYNLKRRVANLPHISA
FT                   SMFAEKVQMSEREKREHMVDEFGFEILKAPDHGRKHKKRGSAAKPTSKEDKSEVPSNNI
FT                   KSSANALHRTISPTESVASEMSALTTGSEYNTTDFGEDTASEYGFTSDSNYDYGSTTDE
FT                   SSDEEDHKLSVKHNHDDFKTTTCIYCGVENKEVERNIRHMFKSHGLYIPERSYLIDLDG
FT                   LLKFLINHILVENKCMCCNYQGSSVESIRAHMDSKRHCKLPYETREERAVVGEFYDFSS
FT                   LYSDEENEESENADDVEEAAGDSNGINSNYTVATIDDSGAELTLPTGVRLGHREGQRYY
FT                   RQNLPLPPNHGESRRTVTAADRRMISGVTEKQYKKGMKKMQLLEQKAASEQIRKEVKRV
FT                   NFQPHFRDPLLQ"
FT   CDS_pept        complement(639130..641736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431233"
FT                   /locus_tag="CAGL0H06501g"
FT                   /product="Similar to uniprot|Q06708 Saccharomyces
FT                   cerevisiae YLR386w"
FT                   /function="binding"
FT                   /protein_id="CAG60011.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG022193"
FT                   /db_xref="HOGENOM:HBG512104"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="UniParc:UPI00003B671E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR6"
FT                   /transl_table=1
FT                   /translation="MDKSIEKGLNDKLYDKRKASALELEKLVKQCVLENDYARVEQIID
FT                   HLCKDYAYALHQPMARNAGLMGLAATAIALGPNQVGTYLPQILPPVLACFGDQNDQVRF
FT                   YACESLYNIAKIAKGEILLYFNEVFDVLSKISADTENSVKGAAELLDRLIKDIVAEKAS
FT                   NYVSLVNNDPNNVPPATRTDSVTGNVYQESYEQDDALAFSLPKFIPLLMERINAINPDT
FT                   RIFLVDWIRVLLDSPDLELISYLPSFLGGLFNFLGDSHKDVRVVTNSLLELLLQEVVRV
FT                   ATIHRKIREYKLAKEKQPSLNKKNDGSLIAEKKKSLLNALGSLSIESVSNNSSITENPE
FT                   SIRTSENEQKFIEDNDGEEYIPGQDIHIDFPELINILLSNLASSEIDIQLIALQWMDKL
FT                   LVLADSDFIPFLPRILSVLIKLLGRSEENIIELAKEVNSKLVTLCTENTTGLDEEGEDA
FT                   INYGSIVNSLSLQFFDSSTTSRIASFDWLMLIYQKAPEKIMEHSEGLFLIILKSLTNKD
FT                   ATLLDKALSLLNNLCLDTNDQYLRKFLKAFIEGLKRDPKQLKVRANYVLKQISIKLATE
FT                   RVYKLISSILEEDFDVVFVRMMIQIMSTNLMTAPELFNLRKKLRNNDDIMFFNIIFKSW
FT                   CCNPVSAISLCLVAENYELAYLVLQSYANHELKINDLIQFDILIQLIESPVFSRLRLQL
FT                   LEQDRYPYLYKCLYGILMILPQSEAFNLLNKRLKSVNVWFAQGSQNKNSFYKQSNRSGL
FT                   SDVSNTSDISQQRSVSNSKLHFIDLLDHFNKSMETDYYSQREGLGLKEAQLNFLDGFHN
FT                   VENENSSFRSEVSTKESISNRDNASEKRDDASSVIIRNNNRSGITRKISGKLKKFT"
FT   CDS_pept        642001..642915
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347324"
FT                   /locus_tag="CAGL0H06523g"
FT                   /product="Similar to uniprot|P40459 Saccharomyces
FT                   cerevisiae YIL145c"
FT                   /function="pantoate-beta-alanine ligase activity "
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60012.1"
FT                   /db_xref="GO:0004592"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="HOGENOM:HBG170145"
FT                   /db_xref="HOGENOM:HBG428839"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B671F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR5"
FT                   /transl_table=1
FT                   /translation="MRVFHTIKEVVNWRRNDVGDRRALSIGFVPTMGALHEGHATLIRE
FT                   SKSQNDYTVVSIFVNPSQFAPDEDLDKYPRTLEKDIELLESLGCDALFAPNAREMYPQG
FT                   IPLDVQQQRGPFVSVLGVSEMLEGKTRPNFFRGVATVVTKLLNIVSPDVAYFGQKDIQQ
FT                   FIVLNTMVTELFMNTRLVRMPIARAPSGLALSSRNKYLCEETLEISSSIYKGLNKAADI
FT                   VKTEKSVERSELVNAIQSIWQPHIDSADFKVDYISIADYTTLHELNKVDLPKKQDQVVI
FT                   SCAVYVTDRASKSVVRLIDNIVL"
FT   CDS_pept        643447..644925
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431234"
FT                   /gene_name="ATG32"
FT                   /locus_tag="CAGL0H06545g"
FT                   /product="Autophagy-related protein 32 "
FT                   /biological_process="autophagy"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG60013.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124859"
FT                   /db_xref="UniParc:UPI00003B6720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRR4"
FT                   /transl_table=1
FT                   /translation="MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQME
FT                   GSEVPSESGVLGESWQQIRESDVGDGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQQL
FT                   LGGQQEYKNFHMTAEEQLQEQAQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGS
FT                   CSSSLDEHELNSIFTSDSMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRF
FT                   HQDIPREYRQYFHISQSSDPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPIC
FT                   QPGQRIRVKNILKSFLKNDAITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSL
FT                   STSDKSLSDETSGYRKNNRRKKHGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTL
FT                   LYGKAESHHANEAKGFSITNGNSGSSSISHSTEYYESTISQKGLLRNTIVFIKRTIHNL
FT                   NGKVGTFFASITQVIKQTPVREDNQFYTLGYMLS"
FT   CDS_pept        645707..649216
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431235"
FT                   /locus_tag="CAGL0H06567g"
FT                   /product="Similar to uniprot|P39928 Saccharomyces
FT                   cerevisiae YIL147c SLN1"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60014.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG059489"
FT                   /db_xref="HOGENOM:HBG398244"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI00003B6721"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR3"
FT                   /transl_table=1
FT                   /translation="MDSTESAPRRRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTT
FT                   GVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNK
FT                   TEENWEESTNVIQKFLSSSNLFFLSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLS
FT                   TDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGL
FT                   RSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNG
FT                   AFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISG
FT                   TVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEGRGLRPAGAGSGSRSGSRTSSMK
FT                   KDINDLNFISRLSLSEKNHRPAYDSASDSNYATDGSLSHDLQTSQASNRPSDNDRSSSR
FT                   SRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLE
FT                   AAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGE
FT                   LLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNV
FT                   IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT
FT                   IADSDAHQQHPVSSSPNGVLVKHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISD
FT                   HSDDLSSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTG
FT                   PGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKF
FT                   TFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDRITNH
FT                   SGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEE
FT                   KVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNID
FT                   LACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAF
FT                   ADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENKDGDKKVEENKP
FT                   KKE"
FT   CDS_pept        649740..651491
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431236"
FT                   /locus_tag="CAGL0H06589g"
FT                   /product="Similar to uniprot|P32354 Saccharomyces
FT                   cerevisiae YIL150c DNA43"
FT                   /protein_id="CAG60015.1"
FT                   /db_xref="HOGENOM:HBG059492"
FT                   /db_xref="HOGENOM:HBG203027"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B6722"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR2"
FT                   /transl_table=1
FT                   /translation="MVHIIDNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQD
FT                   LISRLKENKRKLLSKQLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQA
FT                   ANNKKANPNEEDIVRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGS
FT                   TSLSDNKTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEP
FT                   QYSNWVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVG
FT                   DIIAVLNPEILPWRPSGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKIC
FT                   NSPINTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTN
FT                   PAKHKMFSITGHGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRK
FT                   IKASKMDRNLLKALNGEDASQSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDK
FT                   SRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDS
FT                   DSDLEIV"
FT   CDS_pept        653472..657320
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431237"
FT                   /locus_tag="CAGL0H06611g"
FT                   /product="Similar to uniprot|P36168 Saccharomyces
FT                   cerevisiae YKR096w"
FT                   /protein_id="CAG60016.1"
FT                   /db_xref="HOGENOM:HBG124667"
FT                   /db_xref="HOGENOM:HBG203026"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="UniParc:UPI00003B6723"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRR1"
FT                   /transl_table=1
FT                   /translation="MGSSPIEHSIKGKHVYDRKSKLTDNNFNSNNFINNNNSIPGFTQG
FT                   LHQKRHNSSANNHTRDTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTPGSRPHSV
FT                   TKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDNIANSAN
FT                   RVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYNSNLEN
FT                   GEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALISKLQ
FT                   DIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQ
FT                   TDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSD
FT                   YIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMAT
FT                   VQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDYLK
FT                   HNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHSP
FT                   LFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVS
FT                   GNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVT
FT                   ALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNS
FT                   DSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKT
FT                   AGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNINSLN
FT                   SEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENN
FT                   IILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLK
FT                   PRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDETEDETE
FT                   ETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYS
FT                   GLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHI
FT                   EEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTK
FT                   QRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN"
FT   CDS_pept        659326..660960
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431238"
FT                   /gene_name="PCK1"
FT                   /locus_tag="CAGL0H06633g"
FT                   /product="Phosphoenolpyruvate carboxykinase "
FT                   /EC_number="4.1.1.49"
FT                   /function="ATP binding"
FT                   /function="oxidoreductase activity"
FT                   /function="phosphoenolpyruvate carboxykinase (ATP) activity"
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60017.1"
FT                   /db_xref="GO:0004612"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG006603"
FT                   /db_xref="HOGENOM:HBG293387"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniParc:UPI00003B6724"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRR0"
FT                   /transl_table=1
FT                   /translation="MPSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKE
FT                   KKTVISSAGALIAYSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERA
FT                   ADYLRTRETLYVVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPD
FT                   FTVWNAGQFPANARTQDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVH
FT                   HNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEG
FT                   GCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFI
FT                   PSAKIPCLAPAHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTE
FT                   PEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKY
FT                   TRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSK
FT                   LAGLFVENFKTYQDKATSDVLAAGPQL"
FT   CDS_pept        complement(661713..662987)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431239"
FT                   /gene_name="RRD1"
FT                   /locus_tag="CAGL0H06655g"
FT                   /product="Serine/threonine-protein phosphatase 2A activator
FT                   1"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60018.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG191557"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI00003B6725"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRQ9"
FT                   /transl_table=1
FT                   /translation="MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD
FT                   LELSGVVGGVVKVLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISS
FT                   HFPSELQCVVELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQVLYIF
FT                   DRYYSLVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPV
FT                   LVEQYSRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVL
FT                   NKFPVIQHFWFGTGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESR
FT                   FLSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTSMG
FT                   IVQTRMPSSTTSQAHASRLMNTPRQ"
FT   CDS_pept        663303..664319
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042910"
FT                   /locus_tag="CAGL0H06677g"
FT                   /product="Similar to uniprot|P32351 Saccharomyces
FT                   cerevisiae YIL154c IMP2"
FT                   /protein_id="CAG60019.1"
FT                   /db_xref="HOGENOM:HBG059496"
FT                   /db_xref="HOGENOM:HBG203011"
FT                   /db_xref="UniParc:UPI00003B6726"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ8"
FT                   /transl_table=1
FT                   /translation="MQKGILVPSGSERGPTEIQFDSEIGRGRSRDKRTGGNGAGRLSLS
FT                   RSRSRASSRVREEEFLKWTVLRRDPSMRLTTLKKNKKSGSGTGGDDDDDDDEDDDDEDD
FT                   DDEEESDEERVSDIENDAEIDEEFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLSTLD
FT                   MEKERAGVNFETLEGGYSRALELVRKGKGAEAHPETSKNYILCTDLSSESTYALTYVMG
FT                   SLVSNGDTLYIVHWDGDSTTSTKDSFIDNALRVKKHVRHLMDCVSVIVDDLDVVIISLT
FT                   HPYPKHLLNEMIHGLKPVTLACSLSLILSSLQNFVCSVPTLVIRKKLKRSRKKGISE"
FT   CDS_pept        665295..667247
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431240"
FT                   /locus_tag="CAGL0H06699g"
FT                   /product="Similar to uniprot|P32191 Saccharomyces
FT                   cerevisiae YIL155c GUT2"
FT                   /function="glycerol-3-phosphate dehydrogenase activity "
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="CAG60020.1"
FT                   /db_xref="GO:0004368"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG422884"
FT                   /db_xref="HOGENOM:HBG720894"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI00003B6727"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ7"
FT                   /transl_table=1
FT                   /translation="MFARVAASTRAHSRLLAGTVAAGATLAVANHYNNNNKLISNDVSL
FT                   ISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKND
FT                   FASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPII
FT                   IPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHD
FT                   GSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKDGKVAGAVVEDRETGKTYSVRAK
FT                   VVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPS
FT                   AGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEA
FT                   DIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKADGSTQGLVRSHFIFTSD
FT                   HGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWDPNLPALLAQ
FT                   KYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRYP
FT                   ITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQ
FT                   DEIRYSTEFIKTFGV"
FT   CDS_pept        complement(667816..671061)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042911"
FT                   /locus_tag="CAGL0H06721g"
FT                   /product="Similar to uniprot|P40453 Saccharomyces
FT                   cerevisiae YIL156w UBP7"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG60021.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG124668"
FT                   /db_xref="HOGENOM:HBG203000"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00003B6728"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ6"
FT                   /transl_table=1
FT                   /translation="MDRFTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQC
FT                   MLEDYMGCVDVDTSKAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLN
FT                   MTNVIAMVKEEVAQIQEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYS
FT                   ISSPSGMSTLSLHDELPEHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNI
FT                   NQPRKSLDVTLNANNEIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIW
FT                   TAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHA
FT                   NRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNP
FT                   EERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLF
FT                   NGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMN
FT                   TYVSQYQIELDDYLYRPYAPSNNKGEQNNAQIPDVPTWKPPPVPVMVRKRPPPPVPVSI
FT                   PIPPETPPPLPQKIKLESIEESAPSDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTI
FT                   EKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKES
FT                   AISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHD
FT                   ELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ
FT                   CQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCP
FT                   KCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHE
FT                   GKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVV
FT                   SYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDD
FT                   EVVKAEKTHGNVDKGITKVSSKNVYVLFYERVD"
FT   CDS_pept        join(complement(671637..671645),complement(671272..671481))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431241"
FT                   /locus_tag="CAGL0H06732g"
FT                   /product="Similar to uniprot|Q2V2P4 Saccharomyces
FT                   cerevisiae YIL156wb"
FT                   /protein_id="CAR57989.1"
FT                   /db_xref="HOGENOM:HBG398360"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniParc:UPI00017BD8DA"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN09"
FT                   /transl_table=1
FT                   /translation="MTLIGKAVHLSVDLVLVSTCLAAVKRNTGLVPRTELIPNTTARDY
FT                   FEKYLAFGESTYDYTVATCGTSSYFKR"
FT   CDS_pept        671849..672391
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431242"
FT                   /locus_tag="CAGL0H06743g"
FT                   /product="Similarities with uniprot|P40452 Saccharomyces
FT                   cerevisiae YIL157c"
FT                   /protein_id="CAG60022.1"
FT                   /db_xref="HOGENOM:HBG059498"
FT                   /db_xref="HOGENOM:HBG397017"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI00003B6729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ5"
FT                   /transl_table=1
FT                   /translation="MMSMLPSRMLRQRTALAAVRGLRTGSRVMVELKDKERPMTVNAEL
FT                   PDPMAGRRKRIAAFAAFSLATGSALAVIFNYEKTESAIVSNTMYYMRRSGQTIDALGEN
FT                   IEFAGVIPWVWGELNPVAGKINITFSVKGKKGVTGIVKLVADRENRREEFRIHEWSLTV
FT                   PDKKIDLLAENPHSSFD"
FT   CDS_pept        complement(672619..676503)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042912"
FT                   /locus_tag="CAGL0H06765g"
FT                   /product="Similar to uniprot|P40450 Saccharomyces
FT                   cerevisiae YIL159w BNR1"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="CAG60023.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG253398"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B672A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ4"
FT                   /transl_table=1
FT                   /translation="MPADGEAVDRLFEELIRDGGYYWGEELVDELRRGPCSKRWEFICK
FT                   VHGLETSHQGAGKSSDNVGGTLNGPVDAGGQAEADEEISGILQKLESVKDTVLASESGG
FT                   ETVLRFLYNLEKLLRQSRLREVFVYYDYVTALLEPLVTVILDLEQMHGHNSKFLYIHLR
FT                   CIKTIMNSSEGRLLVLKNDVLVTYLRDIVTTDLEFSINFVKNKCQAMEVLLLLSYLDMD
FT                   RGFQVIYETFEPYMDEWMDSTLCNCDELQHYESSSSLINPTKILVEYCTLFMFMVNSII
FT                   EGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKYRDVKLEIMTRNSCVP
FT                   SILEDVSYSQVLTDLVIQTKNTALESGLGNLFTLVFQVIHTKKLNECIKFLKLIALLVP
FT                   YLNKVLTVEDSLENPDYFFKDAITTLVDNLQSEDLTRRAMVEIKTLEKNITELNSHIAE
FT                   LENEAHMDKRTIIQQLKQAEHMLEEKTIENESSIRLINQLKGQLREKQKKYDQLLVHQR
FT                   MAPKDTRSISGGKIFENVNSGKVNQRSFSTSSAKMIYKSKGFRSLVSVVQSNEDFHNQK
FT                   ENISGYKPGLNMVYNENGKGSSLTTFDTGKGYPQNVFNTGIKSQQGDVKHGQYLLKSAQ
FT                   YSSDISSDIAKQEFNGAASNGKPYILPQNSVMTLNMNTSVDSVVSTEFDQPSIQPEHGN
FT                   VQIAGLPPPPVPPFLKLGGGSKLSVTSSNDDKDGPTIPDSPIMEFPGILTNIDIKKNED
FT                   ASTKIGVTNDNLPPPPPPPPLPPNLTKNKASADTSDEASGDVVVAPPPPPPLPSNFNVP
FT                   SSTPKSTIRLKQIHWEKVDDVGGTLWEDVSGIPLDHLKDEGVFSQIEKYFKILEPVKKT
FT                   KVLAENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGF
FT                   FTKEDLTQIPSGLERKFAPYSTNYLTDDSPEKDPRELERADHIYLELFYNLRSYWSARS
FT                   HCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGSVTGIK
FT                   LNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVELE
FT                   CEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTKR
FT                   SLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ
FT                   RNKKIEEQEHSDDEINAVDDLITKLRDAKKQHPAPLRRRRSTKAVLNEKRAGEPLLERT
FT                   QALLSDIQNI"
FT   CDS_pept        676925..678154
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431243"
FT                   /locus_tag="CAGL0H06787g"
FT                   /product="Similar to uniprot|P27796 Saccharomyces
FT                   cerevisiae YIL160c POT1"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAG60024.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG297252"
FT                   /db_xref="HOGENOM:HBG370930"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI00003B672B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ3"
FT                   /transl_table=1
FT                   /translation="MAERLKNIGSHLLGGSQGPSVKEQHPDDVVIVAANRSAIAKGFKG
FT                   SFKDVNTDYLLTVFLKEFIDTFPPQLRDNLDLIGEVTCGNVLNPGAGATEHRGAMLAAG
FT                   LPYTTPFMALNRQCSSGLTAVNDIANKIKAGQIDVGLAAGVESMTQNYASSNPLGRISD
FT                   ELKSDKNARKCLIPMGITNENIAKGFEITREMQDEFAAASYQKASNAVQSGVFKDEILP
FT                   ITLPDGKVVDVDEGPRANVTAKSLGGLKPAFIKETGTTTAGNASQVSDGVAGVLLARRS
FT                   VANKLKLPILGRYVAFQSVGVPPEIMGVGPAYAIPRVLQDVGITVDDVDVFEINEAFAA
FT                   QALYCINKLGINLKKVNPRGGAIALGHPLGCTGARQIATILRELEKGQVGVVSMCIGTG
FT                   MGAAAVFVKE"
FT   CDS_pept        complement(678341..678784)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001092" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431244"
FT                   /locus_tag="CAGL0H06809g"
FT                   /product="Similarities with uniprot|P36116 Saccharomyces
FT                   cerevisiae YKR020w"
FT                   /protein_id="CAG60025.1"
FT                   /db_xref="HOGENOM:HBG059391"
FT                   /db_xref="HOGENOM:HBG202365"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI00003B672C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ2"
FT                   /transl_table=1
FT                   /translation="MAEQISHKKSLRVGKNKRSLLKEYYHLEDGATKTDEPVTGEVHEQ
FT                   DNNTLQTDTGNEEVVKEVLEDSDSQPNVDRPINEQTLKELVATHNTLLGKETATNSSIK
FT                   NTIYENYYDLVKVNDKLKELSGDKLQQSMDSLKKAVEESLRSA"
FT   CDS_pept        679307..679924
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000089187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431245"
FT                   /locus_tag="CAGL0H06831g"
FT                   /product="Similar to uniprot|Q96VH4 Saccharomyces
FT                   cerevisiae YCL026cb"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG60026.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053494"
FT                   /db_xref="HOGENOM:HBG289260"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniParc:UPI00003B672D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ1"
FT                   /transl_table=1
FT                   /translation="MTKHSPTSHEASASNPVLEAIVARRSIHYLKPELPEGVTFDDIYH
FT                   IVQECVKHTPTSFNSQVNRAFIVRGALHYKIWDQVVNKIKEPEYRARPLRIRDGAYGSI
FT                   FFYVDENVTERNKVEHPEWAPVCEAYADQAMGAASIAAWTVMHNMGIGCNMQHYGKYMH
FT                   DPNVLPEDIPSHWTMKCQLVFGVPDKDPNEKKFIENIVKVYE"
FT   CDS_pept        complement(680184..681266)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431246"
FT                   /locus_tag="CAGL0H06853g"
FT                   /product="Similar to uniprot|Q04894 Saccharomyces
FT                   cerevisiae YMR318c"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60027.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B672E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRQ0"
FT                   /transl_table=1
FT                   /translation="MSSEDKFQGIAVLDHKDWKNPKKVEFPAKPFYDHDIDIKIDACGV
FT                   CGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTGLKVGDRVGVGAQVFSCLECD
FT                   RCKNDNEPYCPKFVTTYSQPYEDGYVSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLC
FT                   GGITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLLFAKAMGAEVYAISRSNAKKEDSLKL
FT                   GADHYIATKEEPNWGEKYFDTFDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDED
FT                   QTLTMKPFGLLGVSIANSALGSIKEIEQLLKLVSEKDIKIWVETLPVGEAGVKEAFERM
FT                   DKGDVKYRFTLVDFDKEFGN"
FT   CDS_pept        complement(682518..684626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431247"
FT                   /locus_tag="CAGL0H06875g"
FT                   /product="Similarities with uniprot|P05085 Saccharomyces
FT                   cerevisiae YML099c ARG81"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60028.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189621"
FT                   /db_xref="HOGENOM:HBG395762"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI00003B672F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP9"
FT                   /transl_table=1
FT                   /translation="MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGY
FT                   KIKLRWSPLLHFDLYGVPMPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHEDMD
FT                   EELSELHAPPEDKIANNKTWIIKKFGVFRAIEREAIIAAKRGKTDKRPVQKKIANELNS
FT                   NNSNNHINNEPLMKKPRLAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPL
FT                   PMELLQPDFIHDHSHLVSLSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPW
FT                   AKIYFPRAIAALGELIAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLA
FT                   VELRTRASHFLNLALEQEEEYEEYRDILEDDDIAEDYNKHFCDMLIAILTMNSIDIVWG
FT                   TMVDCDNYLRICEQLISKNKKRVVVSKKIKSLYTIYAFLKLMQNSTAMETITSEPSLDF
FT                   HNPDIIPYKYLRETYENDIKTIFTDHYGSTKMNTLGADALNALPNSLVLLFYDCVSLTR
FT                   YYFYHKKKSEGIELPTEFFMKTREFEDKLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTM
FT                   SFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGF
FT                   IAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAIQIMFEVWRRRDNNELGDDWLSVSRD
FT                   WEMNIMLT"
FT   CDS_pept        685058..685549
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347325"
FT                   /locus_tag="CAGL0H06897g"
FT                   /product="Similar to uniprot|P11747 Saccharomyces
FT                   cerevisiae YML098w FUN81"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="CAG60029.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="HOGENOM:HBG061001"
FT                   /db_xref="HOGENOM:HBG677126"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B6730"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP8"
FT                   /transl_table=1
FT                   /translation="MSRRRLKKTNLFHKDINSLLYAYGDVAQPLNKTVQCLDELVSSYL
FT                   VDICAEAAHVANSSSRNKIRLEDFKFVLRKDPIKLARAEELISTNALITEAKKQFNENE
FT                   NQNLKRYKEDEDDDDDEDDDEDDDEDSKPKEAPVTVETQESTVPVKEKKKRTKKAKVKS
FT                   "
FT   CDS_pept        complement(685736..687619)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042913"
FT                   /locus_tag="CAGL0H06919g"
FT                   /product="Similar to uniprot|Q03103 Saccharomyces
FT                   cerevisiae YML130c ERO1"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein thiol-disulfide exchange "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAG60030.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006467"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG436396"
FT                   /db_xref="HOGENOM:HBG521237"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="UniParc:UPI00003B6731"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP7"
FT                   /transl_table=1
FT                   /translation="MKLSYLLLAGIVAGEGNSTNNQTNWTTENHFCAMDKDLMISPSCN
FT                   VTFTELNVINKSIRKNLVSLVRTDFFKYFKIDPDKQCTFWDNNDGLCFSRDCMVDVVTD
FT                   WDSLPEIWQPEVLGGLDEAQDASGSDEKEWTFLDDLCAESQQQSKPKPLLDVDDNNYCD
FT                   INDFSGENAVLVDLTKNPERFTGYGGQQSSQIWTSIYGENCSPLGKDLVKSGKASQDEV
FT                   SMARDVFFRFVSGLHASIGTHLSNDHLNTENGKWEPNLDLFMLRVGNFPDRVTNIYFNY
FT                   AVIAKSLWKIKPYLSRIEFCNDYDDPVKSKILSIVSKLDSSIFNEDLLFQNDLSSSLKN
FT                   EFRARFKNVTKIMDCVHCDRCKLWGKVQTTGMATSLKILFDLDEADESSKQKFVDKLTK
FT                   YELIALFNTFDKLSESVEYINNFEKLYKRREGGDSYTNFFQNNFFKILEKMKKGWSTIN
FT                   DSVSNNKEYNNSAQNSESISDPSEESMTSLVKDAVEEVKNTTKSSLSDNDEFLTAKLSE
FT                   NNENIEENKLEDKLNEQEAFADLKMPIRKKKLTKKKSNGTLDIWINAWHTETHNVMEAI
FT                   KFILRSYIDLPRNLWRLTIVTVNKLWNNFVGVANYVSEEPGEEIIYDLDFQ"
FT   CDS_pept        complement(688276..689640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431248"
FT                   /locus_tag="CAGL0H06941g"
FT                   /product="Similar to uniprot|P54787 Saccharomyces
FT                   cerevisiae YML097c VPS9"
FT                   /protein_id="CAG60031.1"
FT                   /db_xref="HOGENOM:HBG058743"
FT                   /db_xref="HOGENOM:HBG203498"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI00003B6732"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP6"
FT                   /transl_table=1
FT                   /translation="MESSHIREPKGQASDRDMNSNKTSQASEELQSNFKPELNEQLESH
FT                   NQVVNALQSPEHEEEDVNETYYNFQLFLDQIQDARCAPLIKYTRSFLRNFVTQRAIWSA
FT                   TEQDKLIKDFKTFIYSKYKDFKPFSDLNKTELRNAEEGMEKLLTGKLYHHLFSPLLAER
FT                   AKAAGIEADKEHLDDIEKDKMFIKKVAEFKFIEPTNLDISFQNVKRVKKFTSFASIELN
FT                   KMNNFKAPRDKMVCILNASKILFGLMKHSEETGADCFVPLLIYTLLSGKIENLVSNINF
FT                   IERFRYSSLFRGEEAYYLSSLQAASNFILKLDKKSLTIENEKDFDTKYEQNIENVKQDQ
FT                   LQKEKLLKETKQEESSNMLDDVSNMVMNKLNEFFIQDEPQKEKKKEVHHKANSKNEDGE
FT                   VASMIKQLEAKEHQETVETLTSMFPDLDVEIIEDVCIAKKHRIGPCVDVLLTLSN"
FT   CDS_pept        689948..691501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042914"
FT                   /locus_tag="CAGL0H06963g"
FT                   /product="Similar to uniprot|Q04489 Saccharomyces
FT                   cerevisiae YML096w"
FT                   /function="asparagine synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="asparagine biosynthetic process "
FT                   /protein_id="CAG60032.1"
FT                   /db_xref="GO:0004066"
FT                   /db_xref="GO:0006529"
FT                   /db_xref="HOGENOM:HBG037399"
FT                   /db_xref="HOGENOM:HBG608903"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B6733"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP5"
FT                   /transl_table=1
FT                   /translation="MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRC
FT                   RGPNYCSMRQIKDVNSIWISSVLSLRQPFTKQSIVIGNKYVLQFNGELYNDEIIESGND
FT                   TQFLSGLLKKCISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSLSYSLNYN
FT                   ISELIVTSVSGSDNGSRIFNDCVAGVIYKYDIDRNILDTTSTLRKPWSITREHDDDMTH
FT                   IDTCTKNLYDLLSGATRKRVESIHPLHIENSPISILFSGGLDCSVITAIVCETLISRNM
FT                   HDHATIELLNVAFENLRTGMMPQDAPDRQLAVKSYSELCEKYPNINIKLIEVDVSYAEY
FT                   MKHRPEVVDLMYPKNTEMDLSIAIAFYFASRGDGFITDENGVRKEYKRKGLVLFSGLGA
FT                   DELYGGYYKLSNKHEDELANELTTQINNIYRRNLNRDDKVIASNGVEVRYPFLAEEVVE
FT                   FSTASIPLNYKRDKMILRNIASSILGLHGLSAEKKRAIQFGAKSAKMTKNGNKNGTDLL
FT                   "
FT   CDS_pept        691854..694490
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431249"
FT                   /locus_tag="CAGL0H06985g"
FT                   /product="Similar to uniprot|Q04500 Saccharomyces
FT                   cerevisiae YML093w YMJ3"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAG60033.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG058728"
FT                   /db_xref="HOGENOM:HBG398243"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniParc:UPI00003B6734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP4"
FT                   /transl_table=1
FT                   /translation="MAKRKGNTRSKSSKRALNALELAEREVGGQDSEEEEEFYDRNKKN
FT                   GTVVNLLKMVNGGDDEDVEDGGDSFEDEELDSDEALGSDDDYDILNSKMSQTIRDKKKR
FT                   GEYNSEEEEENYTSIDEDELMPLSQIWDMDTKGGDDTKGSTTRDESLQLASDVDSSSEG
FT                   SSSSDEESSDDESQESEDPFDEISDDEEDIDLANVTSKLVKETEMHVPKKLSNYGHGEA
FT                   NDFALPSLTSESGIQKLSMEEMMGAIDDKHAVTQASLLKGKSLATAVPLPQRIQQRNER
FT                   KAAYEISKEEMNKWTEVVQQNRRAEHLVLGSNKEKVHNDASAFTRMTEKPTSELQSKVD
FT                   ELLGESNLVDPQKESTFEELATAKMTPEEMKKRTAEMRLMRELMFREERKAKRLKKIKS
FT                   KTYRRIKKKEAMKNRELAGLSDESDTEHDIRRAKERMTLKHKTSSKWAKDMIKHGMAND
FT                   KETREEMEEMLRQGEKLRDKIIDRQSGDSDNNISDIEQDSEQDIDVEKVGKTGVMNMAF
FT                   MKNAEAREKAENKQFIEKLREFEKTGDDDLFESDDEKPVIEGKDTVTSINKGRRTYAPG
FT                   DLEMRHEMKKIKEEVRKEKEIDESRTLVNRLKRRNENNEEEIIDVVEEVVPPKEEKTAP
FT                   KSKTKSESSNPWLDGSDDEDVNVKQSSKVHIIDKDSSKLSKSANKIEKAKAKSKKSNKR
FT                   ENDSDELLLTTDKSNSLKIVDPYGGSDDEGQEFMFKQQDVIAEAFAGDDVVAEFEQEKT
FT                   RVADDEGDKEEDVTLPGWGDWAGSGVNPRKKRKFIKKIKGVVDKDKRKDKYLKNVIINE
FT                   KVNKKNMKYQSSAVPFPFESREQYERSLRMPLGQEWTARSTHQKMIKPRVITKPGQVID
FT                   PLKNPFS"
FT   CDS_pept        complement(694778..695530)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431250"
FT                   /locus_tag="CAGL0H07007g"
FT                   /product="Similar to uniprot|P23639 Saccharomyces
FT                   cerevisiae YML092c PRE8"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAG60034.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00003B6735"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP3"
FT                   /transl_table=1
FT                   /translation="MADRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVI
FT                   ATEKKSSSPLALTETLSKVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEY
FT                   PPTKLLVSEIAKIMQEATQSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATS
FT                   IGKGSTAAKTFLEKRWNNELELEDAIHIALLTLKESVEGEFNGDTIEIAVIGEPNTDLL
FT                   GYKGVEKDKGPRFRTLSTQEINDRLEAL"
FT   CDS_pept        696225..696497
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431251"
FT                   /locus_tag="CAGL0H07023g"
FT                   /product="Similar to uniprot|P81449 Saccharomyces
FT                   cerevisiae YDR322ca ATP21"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="CAR57990.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG328835"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniParc:UPI00017BD8E2"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN10"
FT                   /transl_table=1
FT                   /translation="MSTVNVLRYSALGLGLLVGLKTDFSLRGAAAKKLEEEEFSKRQQL
FT                   IADAKAEWAKLHPPKTKATTKEINFDDPNLDFGELIVNAVNALDA"
FT   CDS_pept        complement(696804..697874)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347326"
FT                   /locus_tag="CAGL0H07029g"
FT                   /product="Similar to uniprot|Q06678 Saccharomyces
FT                   cerevisiae YDR322w MRPL35"
FT                   /protein_id="CAG60035.1"
FT                   /db_xref="HOGENOM:HBG060081"
FT                   /db_xref="HOGENOM:HBG396198"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI00003B6736"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP2"
FT                   /transl_table=1
FT                   /translation="MFRRGFHSSVKAAERTRVWSDFSNRSKSLGINNVLVKKNVLEGSS
FT                   AVKGGPVTIGRKSNRLKYNSPEHIDEAFAVSYKYLEDHASKLYEKAKGQENELEREKLI
FT                   AKAESGNPEVLYNFQYHEKIENDPRIIDYTQPVYRHLGRKHWESYSQMLLMQRLESLQV
FT                   IPDTMPTLVPKAEVNIRFPYSTGVNKWVEPGEFLSSNVTSLPPAVKIQEYDLVDPSKQL
FT                   YSVLIVNPDEPDVENDTFKTTLAFGLVNIKIDYNDNVVDPRRYTDENVLAEYVPPVPEK
FT                   NVPAQRYSVWVFRQTEPIAKGDVVRDNFNIRDFASKNNMEAIGAHVWRSEWDLNVSKVR
FT                   EMYNMPTGRVFSRVRR"
FT   CDS_pept        complement(698202..699338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000044165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431252"
FT                   /locus_tag="CAGL0H07051g"
FT                   /product="Similar to uniprot|P38986 Saccharomyces
FT                   cerevisiae YDR321w ASP1"
FT                   /function="asparaginase activity"
FT                   /biological_process="asparagine metabolic process "
FT                   /protein_id="CAG60036.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="GO:0006528"
FT                   /db_xref="HOGENOM:HBG348837"
FT                   /db_xref="HOGENOM:HBG497495"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="UniParc:UPI00003B6737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRP1"
FT                   /transl_table=1
FT                   /translation="MVNDSVEITTICPDVENSQFLLSSSVQDLRKVSQTPLGTVHRSLP
FT                   RIKILGTGGTIASKGSDSSQTAGYHVDLTIQDMLSAIPDISGICELEYEQLCNVDSKDI
FT                   DEALLFKIYKGISDSLQSFDGIVITHGTDTLAETAFFIESTIDAGDVPIVLVGSMRPST
FT                   SVSADGPMNLYQAICIASDKKSRGRSVLVSLNDQISAGYYITKTNANSLDTFNVRQGYL
FT                   GNFFNNEIHYYYPPVKPMGCHKFKLKFDDVEEKYTGFNFPKVAILYAHQAFEPELFDLV
FT                   SDKYDGIVIATMGAGSLPDNVNQKALTLKVPIVYSKRSMDGMIPVANLPKAADGTHNYV
FT                   IASGYLNPEKSRILLQLCLAGKYSLHEIRHVFAGVYGG"
FT   CDS_pept        699630..699851
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042915"
FT                   /gene_name="DAD4"
FT                   /locus_tag="CAGL0H07073g"
FT                   /product="DASH complex subunit DAD4 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="CAG60037.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060079"
FT                   /db_xref="HOGENOM:HBG398730"
FT                   /db_xref="InterPro:IPR013959"
FT                   /db_xref="UniParc:UPI00003B6738"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRP0"
FT                   /transl_table=1
FT                   /translation="MVENPYEEVQVNVLSRIIANVEKLNQSVRTLNQELENVNKRNKNL
FT                   EVMGQICENYHRSVQFNLEATGNKKPPL"
FT   CDS_pept        700262..702247
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431253"
FT                   /locus_tag="CAGL0H07095g"
FT                   /product="Similar to uniprot|Q06677 Saccharomyces
FT                   cerevisiae YDR320c SWA2"
FT                   /function="heat shock protein binding"
FT                   /protein_id="CAG60038.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG060077"
FT                   /db_xref="HOGENOM:HBG203253"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015228"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN9"
FT                   /transl_table=1
FT                   /translation="MSDPFGHLLASLKEGNVPSSKPGSKENSVTPGALTPQKKKLTPLH
FT                   TESIVHGNGNVVSNTNIHDDLDDLFGSIPKKEDVVQDNHTSIDGLDLFQSSSHVVSKTE
FT                   PDNQEINPFDNPFETEHKSESPTEEVIDEVRDMELAKLMSLGLNIDKASSYYERGITFE
FT                   DVLRKRKQKASNGYQQRSNIDRKQGGGEIRNIFDTRGSGSESLFSGILNKGKELVNQLS
FT                   TYTEEENERMNKFKGYEEYSMSETYLEKENSMDPGVFSRSSQEKIPQRAARPSHEKSNS
FT                   SRSKINKRMTTEAPHKPFNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHASSPVVN
FT                   TSNQNTVSITQIPISHIEISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLR
FT                   IIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKII
FT                   LRQAESYEAIEKYKLALDAYQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSA
FT                   TPAPAPRRAPTVNRQTEVVNKKSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKN
FT                   GKQDDIRYLLSNLQAVITWTQWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLE
FT                   QQMIAESVFSTLSDSWENFKKSNDIN"
FT   CDS_pept        702520..703302
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499458"
FT                   /locus_tag="CAGL0H07117g"
FT                   /product="Similar to uniprot|Q06676 Saccharomyces
FT                   cerevisiae YDR319c"
FT                   /protein_id="CAG60039.1"
FT                   /db_xref="HOGENOM:HBG060076"
FT                   /db_xref="HOGENOM:HBG203252"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI00003B673A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN8"
FT                   /transl_table=1
FT                   /translation="MFVPTRKQVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSK
FT                   NVFNQILAYKGNWVWLFLFMGVAAVQYNLRTKSQSLLPTDTRALVVSNKTKLQIIKEYF
FT                   CKYFLKLFILDVIFLVIDGVFIMTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCF
FT                   LVNISMILWMELIAIAEHVCGYDTVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHT
FT                   IAEKLIGCVFGYICPFVMYGLIPNSHDLNKLFYATMSD"
FT   CDS_pept        complement(703350..704426)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431254"
FT                   /locus_tag="CAGL0H07139g"
FT                   /product="Similarities with uniprot|Q06675 Saccharomyces
FT                   cerevisiae YDR318w MCM21"
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60040.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124862"
FT                   /db_xref="HOGENOM:HBG203251"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniParc:UPI00003B673B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN7"
FT                   /transl_table=1
FT                   /translation="MDTVTVEELLQDVEALTSEINGLQEKSKKLREQLKHPEQFIKFDK
FT                   AFGDFNDIFEKNPGLRDLLLGYEIDKSATDVDDTNIIPVTPQKKSRSSVVNEKLHSLPE
FT                   HEWVLKTQPLVEHRLFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVSKEPIQYEN
FT                   IYRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKS
FT                   AKSDDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFL
FT                   QLEKDGIIDDLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTIKSKIMSDDEKERLAM
FT                   MLQGSLHDLKYKLISLRN"
FT   CDS_pept        complement(704823..706097)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347327"
FT                   /locus_tag="CAGL0H07161g"
FT                   /product="Similar to uniprot|Q06674 Saccharomyces
FT                   cerevisiae YDR317w"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG60041.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124863"
FT                   /db_xref="InterPro:IPR014843"
FT                   /db_xref="UniParc:UPI00003B673C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN6"
FT                   /transl_table=1
FT                   /translation="MITTNLENTSGSLSREKTFEKNILLFGSTGLTGSLVFEYLLDPCF
FT                   YLNSAVELRELLLEAIEEGLENVTIKTCLYCFNRKIGEPLDKYLKSPSANSFGPFCFNG
FT                   SQYHYNKGTCVPLDIDQDIETSNDATFDGFLYYKDKGKNVTGKNPISGEYYGKEYMYYL
FT                   EYMSAEGNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVEAISFREKMPLKRYFPLL
FT                   SDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIIS
FT                   TVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVGRHSDIYPTNDSILKNSSLFERA
FT                   LLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRIPGSKLLGYCIPAQKVAYAISI
FT                   AAVDKYLHEEPLTRVVTSEEMDNMK"
FT   CDS_pept        complement(706436..707932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347328"
FT                   /locus_tag="CAGL0H07183g"
FT                   /product="Similar to uniprot|P38793 Saccharomyces
FT                   cerevisiae YHR070w"
FT                   /protein_id="CAG60042.1"
FT                   /db_xref="HOGENOM:HBG026728"
FT                   /db_xref="HOGENOM:HBG592917"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniParc:UPI00003B673D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN5"
FT                   /transl_table=1
FT                   /translation="MHRFFSWFPKYRLVRNWSTMSTQHNMYKYSPPVNRSMKELDRSFF
FT                   TKKIPLVVVKFKDPRNISEFAKNYKESILRIPRIPHVIKLEYKDGHAPSKTVACDNELV
FT                   TKGVLLTDKITNVQDVSKVLSQGAVDYLNEKQAELLPYEYTLDYNFWKAEEILRSVLPE
FT                   EFLDEVPTGFTITGHVAHLNLRNEFKPYDSLIGQVILDKNNKIECVVDKVSSIATQFRT
FT                   FPMKVIAGDSTNLVVEQKESDCTFRFDFSKVYWNSRLHTEHQRLVTDYFKDGEIVCDVF
FT                   AGVGPFAVPAGKKPSFVLANDLNPESFKYLQENITLNKVSDFVKPFNHDGAEFIKQSAN
FT                   ILDNFREESNGVVRHAIKLRGKKRRKGNENEPQPKQLEQQYKEYIIPKNISHYVMNLPD
FT                   SALTFLGNFNGVYNNIDPEIYKEMPYVHVHCFEKYENGEEVSMEELHKRVFNRILKEMD
FT                   CSADILPFEAVAFHLVRKVSPTKPMFCCSFKLPKEVAFKQ"
FT   CDS_pept        708198..709307
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431255"
FT                   /locus_tag="CAGL0H07205g"
FT                   /product="Similar to uniprot|P38792 Saccharomyces
FT                   cerevisiae YHR069c RRP4"
FT                   /protein_id="CAG60043.1"
FT                   /db_xref="HOGENOM:HBG351773"
FT                   /db_xref="HOGENOM:HBG735314"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B673E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN4"
FT                   /transl_table=1
FT                   /translation="MSSVISVVKRTGGFQSNSIESDFESDEDMSYGSDVEEGQDADGDM
FT                   EMKEEKGKGNSDIVTPGELITDDPVWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPL
FT                   RGRYAPETGDHIIGRIAEVGNKRWKVDIGSKQHAVLMLGSVNLPGGILRRKSESDELQM
FT                   RSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRDGIFCQVPSSLIIRSKNHTHNLP
FT                   GNVTVLLGVNGFVWLRKTSKMDLTRDAPPGGSTGAGRESSVGPTGATHVNTNTNISITR
FT                   LEEESSWQIYSDENDPTIKNSERKTISRYANVIKALAFCEIGITQERIISAYEASMAFP
FT                   NIGSLIEKETMESIGRDVITVERMRGTEQ"
FT   CDS_pept        complement(709402..710760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431256"
FT                   /locus_tag="CAGL0H07227g"
FT                   /product="Similar to uniprot|Q06668 Saccharomyces
FT                   cerevisiae YDR316w"
FT                   /protein_id="CAG60044.1"
FT                   /db_xref="HOGENOM:HBG057957"
FT                   /db_xref="HOGENOM:HBG397038"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI00003B673F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN3"
FT                   /transl_table=1
FT                   /translation="MLLMRCVAQTRNRFPVVRPILQVHYSARYKSDANSNTKTYIPQPT
FT                   AKVRRPKTKEEIAKEKHEKALQSPYRLVRWAAIASSEKFNKSMTKYMVGIYAIFLIYGV
FT                   YFSKKLFQKEKELEKLEGKAKTSGINEYESLRIKELRGKLRRRDELKLEQYQQMIDKGI
FT                   TDFDGITLENNDQNRLNESIVPAHDTTEFYDHKAEEYDKAINSEERAILMGRKRKWLMK
FT                   HCEGDVLEVACGTGRNIKYLDIERVNSLIFLDSSENMLEIANKKFRDRFPTYKKVAFVK
FT                   GRAEDLLDLAGDDPDKKEQKKFDTIIEAFGLCSHEDPVKALKNFQELLKPGGRIVLLEH
FT                   GRGSVGLINKILDKRAKRRLETWGCRWNLDIGEILDDSGLDVVEEYTSHLGTTWCVVAK
FT                   KKSDVRKKKEISFIEKYFRSGLREKIQHMNEENNRTTSNVNSNNAEIPSNTSK"
FT   CDS_pept        complement(711240..712397)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431257"
FT                   /gene_name="DYS1"
FT                   /locus_tag="CAGL0H07249g"
FT                   /product="Deoxyhypusine synthase "
FT                   /EC_number="2.5.1.46"
FT                   /function="deoxyhypusine synthase activity"
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="spermidine catabolic process to
FT                   deoxyhypusine, using deoxyhypusine synthase"
FT                   /protein_id="CAG60045.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0034038"
FT                   /db_xref="GO:0050983"
FT                   /db_xref="HOGENOM:HBG042306"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI00003B6740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRN2"
FT                   /transl_table=1
FT                   /translation="MSAANDKLPDILQDAVLKASVPVPDDFVQVKGIDYSAATATDMRA
FT                   SDLVNSMKTMGFQASSLGKACDIIDEMRSWRGKHIDELDEHDRKGQFDDAGYQKTTVFM
FT                   GYTSNLISSGLRETLRYLVQHKMVDALVATAGGIEEDIIKCLAPTYLGEFSLEGKSLRD
FT                   QGMNRIGNLLVPNDNYCKFEEWIVPIFDKMLEEQEEYVAKHGKDCLDANTDVDSPIWTP
FT                   SKLIDRLGKEINDESSVLYWAHKNKIPIFCPAITDGSIGDMLFFHTFKASPKQIRLDIV
FT                   ADIRKINSMSMEASKAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGA
FT                   RPDEAVSWGKIKAEAKSVKIYADVTIVFPLIVAATFANGKPLPKN"
FT   CDS_pept        712654..713490
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001053" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431258"
FT                   /gene_name="IPK1"
FT                   /locus_tag="CAGL0H07271g"
FT                   /product="Inositol-pentakisphosphate 2-kinase "
FT                   /EC_number="2.7.1.158"
FT                   /function="ATP binding"
FT                   /function="inositol pentakisphosphate 2-kinase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60046.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0035299"
FT                   /db_xref="HOGENOM:HBG057956"
FT                   /db_xref="HOGENOM:HBG203249"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniParc:UPI00003B6741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRN1"
FT                   /transl_table=1
FT                   /translation="MLVAEGGANILLELDHRGVLYRCNVRDKSLKVNNEYTYKNYRYIN
FT                   QVVRPLLGDCIPEMELVDIPYDRISGIIGDFVGDPDSDHVSALTIKNLRPTNVYGEKIR
FT                   YDDHFTKVYHDDTMEHILVEIKPKWLHHAKFCRNCTHNNLKNRKIPYCYALMVVDPSHV
FT                   SDMLLHTGIAFPRKFLIKFVDYFSKSDNILAKLHDIQKNLDSNVSMNDIKSIDDVSDAF
FT                   LLNMTLKDVSCFIEWTREPDSLEVNVVDVDMKLVSKLDHWVNTHIQLSNSSNLVHH"
FT   CDS_pept        713669..715675
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431259"
FT                   /locus_tag="CAGL0H07293g"
FT                   /product="Similar to uniprot|Q06665 Saccharomyces
FT                   cerevisiae YDR314c"
FT                   /function="damaged DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60047.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG124865"
FT                   /db_xref="HOGENOM:HBG203248"
FT                   /db_xref="InterPro:IPR004583"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="InterPro:IPR018326"
FT                   /db_xref="InterPro:IPR018327"
FT                   /db_xref="InterPro:IPR018328"
FT                   /db_xref="UniParc:UPI00003B6742"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRN0"
FT                   /transl_table=1
FT                   /translation="MNNKRDREDELADLSAKRQSLNTGEETELFYDESSSSEESDIEDI
FT                   DWEDIDLAGDITVKLKAPLHQNATNKRRRKDNFYHRLRYGLHIIAIPILVATLIKRTNW
FT                   TQDERLRRRLKRSVPKQITKKVKNWSKSSQDIRISSIRTLLLGLVMWFRANYQINSNGF
FT                   RQNFYRLHYIFRLDDGNVMKPYREACLRDQHKYYGERPDIAGNIEDIRTFVRNKKANRD
FT                   YLTLFFITILREILPADQIKSLRLCFSLPLHNFQISPRNITKLASRDAGKVPNRFDTDL
FT                   LQPYFWIELHTIDEPDKLYVIDPVVHIEEGNIVKKYNIDEPVDIFEPIKDLNLNVNQWF
FT                   QYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHFFMRVLKSTSRY
FT                   RNDNTVLMKTIAAKNYKLPKSISELKRSPNFKGLRILKQSETVSSKAKPVGKVQYGGKK
FT                   DKIYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAISSAQELNFARELFS
FT                   YEQTDLTPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIPTGFRLMRTFDKDY
FT                   KFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQATPIKTHILVNYMDYRKILSL
FT                   QKDYIELLRLESWSNFITRLKIKCELEDKYGKL"
FT   CDS_pept        715930..716766
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065938" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431260"
FT                   /locus_tag="CAGL0H07315g"
FT                   /product="Similar to uniprot|Q06651 Saccharomyces
FT                   cerevisiae YDR313c PIB1"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60048.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057954"
FT                   /db_xref="HOGENOM:HBG398814"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00017BD8E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM9"
FT                   /transl_table=1
FT                   /translation="MTRRCSVVNAGAIWKPDDDSKVCDKCGVRFTFLYRRHHCRCCGNI
FT                   YCHNCTHNFILYDTTRVRVVKNPESYWEYPPYRTCDTCFETLRSQNLISSKYHYEEIPD
FT                   ADSNEPDDTSTDIADSTAGTTTTDTTDTTNTDSSMNHDSHAYEMNHCPLCNQDLRTFPT
FT                   EEDAQQHVERCITSAEQTQQHQEQESEEPPRCPTLQNRMLVYKIPTTTAPENEPQGYQE
FT                   CPICFEEMVPGEKVGRLECLCVYHYSCIKSWFRKKRKEMSVATARNFCPIHDAITL"
FT   CDS_pept        718141..718590
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431261"
FT                   /locus_tag="CAGL0H07337g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60049.1"
FT                   /db_xref="HOGENOM:HBG124866"
FT                   /db_xref="UniParc:UPI00003B6744"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM8"
FT                   /transl_table=1
FT                   /translation="MTRVDPVSAMRLAEEIAKRQEVLIYTRYQNNIEYYRELQRQADEM
FT                   SVSDEVQSQISGVDDYLATTAKLYELSGNCKENKTHTNTNYDSNTQDKIARSPMPNVNC
FT                   IDGGCAIDKPHSDSKSTFTPSTYVSCPFPLQDPRFKVIDVFLNEN"
FT   CDS_pept        complement(718943..720580)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000099116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431262"
FT                   /locus_tag="CAGL0H07359g"
FT                   /product="Similar to uniprot|P11491 Saccharomyces
FT                   cerevisiae YDR481c PHO8"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAG60050.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG237270"
FT                   /db_xref="HOGENOM:HBG617166"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniParc:UPI00003B6745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM7"
FT                   /transl_table=1
FT                   /translation="MIRNTERESLLTSQNKRHKKYFKYGLKYILTTVLVFFTFLHIWYP
FT                   DVISESLHWNSHAKKKNVIFFVTDGMGPASLSLTRSYRQYVQGLDIDDILELDRHLIGS
FT                   SRTRSYNSLVTDSSAGATAFSCGMKTYNSGTGVGPDKTPCGTLLEAAKLKGYLTGLVVT
FT                   TRLTDATPAAFSSHVDYRFQEDQIAEQQLGNYPLGRMVDLMMGGGRTHFYPSGTNDPRY
FT                   GRRGLRQDDRNLIEEAIENGWQYAGNRNDFDDLKMGKNVTLPLLGLFADFDIPFEIDRS
FT                   DKEYPSLEEQTITALTALNDASKHSDKGFFIMIEGSRIDHAGHQNDPAAQVREVMAFDK
FT                   AFKAALEFAKESDTETVIISTSDHETGGLVTARQVTVSYPEYVWYPEVLFNSKHSGEYL
FT                   KHKIANYKGNDKKRFIEKEVFEKIMNIGDYSDSDVEDLSNMTNVEDIQYKLNDMISFRA
FT                   QIGWSTHGHSAVDVNIYAYSNRPKSWQYLLSKLQGNHENIEIGHFMRDYLELDLEEVTK
FT                   RIKDTDHSPRKQGNIYIDEYHPASTVGI"
FT   CDS_pept        complement(721553..721984)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431263"
FT                   /gene_name="CWC21"
FT                   /locus_tag="CAGL0H07381g"
FT                   /product="Pre-mRNA-splicing factor CWC21 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG60051.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059744"
FT                   /db_xref="HOGENOM:HBG203319"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniParc:UPI00003B6746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRM6"
FT                   /transl_table=1
FT                   /translation="MGRGVGLQSAKGSSTSGYVQRSLAHDNRDDKTGIVRLKNKNYELR
FT                   KITKRSQKVDKPANESKDNGLKKVLVEHDKRREIEVQVSELRDSLEDKQDRNPDEWPDK
FT                   RIDEECEKLRSTLLADLQEKEKYQKAYTPRSKRSSESSK"
FT   CDS_pept        723340..724731
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431264"
FT                   /locus_tag="CAGL0H07403g"
FT                   /product="Similar to uniprot|P27809 Saccharomyces
FT                   cerevisiae YDR483w KRE2"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60052.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B6747"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM5"
FT                   /transl_table=1
FT                   /translation="MAIFLSKRLIRLCAMVTVLLLLLATLNTHQSSSQYVSGYLPSQLR
FT                   LPDSSNFGFPSGGASDVTVGQTTELEDPTKELEAARAKADKDTDAGNISNPDEKAPGDS
FT                   GKALEQAANAEAAVKDMTKKDIEEYLAPSFANKGKRPKAAFVTLIRNRELNDILEPMNM
FT                   VEKRFNKNYHYPWVFLNNEPFTEEFKETVKKHASGEVIFDLIPKEHWGYPDYVDQDKAA
FT                   IERKKMADKNIIYGDSESYRHMCRFQSGFFWREKALEDFDWYWRVEPSTKIYCDIPYDP
FT                   FQYMQDNKKAYGFTITIHEYRSTIESLWKTVKNFIKDFPQYLAKDNLEKFVSEDNLEEY
FT                   NLCHFWSNFEIANLNVWRSPAYRDFFDYLDKTGNFFYERWGDAPVHSIFVSLFLPKSYL
FT                   HYFNDFGYYHPPYNHCPIDNEIFRDRNCDCTQKDDFTFKGYSCGIQYHNAQGIKKPSNW
FT                   EDYSD"
FT   CDS_pept        725307..726449
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347329"
FT                   /locus_tag="CAGL0H07425g"
FT                   /product="Similar to uniprot|P33313 Saccharomyces
FT                   cerevisiae YBR155w CNS1"
FT                   /function="binding"
FT                   /protein_id="CAG60053.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059740"
FT                   /db_xref="HOGENOM:HBG395515"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI00003B6748"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM4"
FT                   /transl_table=1
FT                   /translation="MSSTKKEYKKPQKYVPGINDPILPPQLAEFQDKSTDEVLTELNRM
FT                   PFFMTKLDNSDGDGGENVELEALKALAYEGEPHEIAENFKKQGNDLYKVKRFRDARELY
FT                   SKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAF
FT                   TALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEIEARRLKLENEKKERENYQF
FT                   ILNSAIELRNITNIKTSKPAELLREASIKLENPLELESQLIIPAVVLFPLSDEFDFIAE
FT                   VGELSTVQDVIDILMERPPEWFERPEHKGYSSKSLLAFMETEGGGLVKAGKKLTFHDIL
FT                   RKEKPNVPLFDSALKVFLVPKDQSDDWLSKWDKEKALARR"
FT   CDS_pept        complement(726654..728834)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431265"
FT                   /locus_tag="CAGL0H07447g"
FT                   /product="Similar to uniprot|P38283 Saccharomyces
FT                   cerevisiae YBR156c SLI15"
FT                   /protein_id="CAG60054.1"
FT                   /db_xref="HOGENOM:HBG124867"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniParc:UPI00003B6749"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM3"
FT                   /transl_table=1
FT                   /translation="MDWAINAAKKKTKAIPGGSRSIIESLNKLNNISCDGQDAINEILS
FT                   DIDFSLLGISILPADKNRSLIIKTKNIEHLDTKPDSKDDNSTRNELKSIEVNPLSEDNS
FT                   TVFNVKATLSSAAPKKNKDLVNTPIKRESGIPSITPKSMSIEKKDENGLTSNDVTIANS
FT                   SSLKEKDSKSGSPTKSEWSPFKSNKSFSNLSSNINETLKHQNHNIIDTHNQTTTKEGED
FT                   TSILSNNDKNKAESETKISSKSFTNKERVLRKRSNMFIPLPTKETYVIKSSPDKQSNNQ
FT                   EVSKLGSMSKSNKLHNLKSEMPLTIKDVRLDSSKQNLNESSEKNRKISASDNVFERLAK
FT                   VPTKSFEKKITKTYKPYSDSKSMYSPTRKRNSLAGKGIIKTTSGQVDTSMNETLKGIFE
FT                   LNSPKTLLSNDSKAQIVSSSTSIATNKGMRKSLQPRIDVKSLSTVTSRLIPNGRSELND
FT                   GNNKVNLHSNKSSHGIYLNKMKPTERLTPIRIKSGNTITSPTESSLLKLSNRGSPKRVA
FT                   KLHHKLDSKDPAKHKNDRLTNFQLLPSLESKKNELKKKLNKRLSEVMRSQQDHHRRRTE
FT                   LQKRKSQIYEDLKKRTKPASEIKDSNKKNVDTSLDGSNFIRYRDKTHNDTNSEMKGILD
FT                   TINTVDHRIIIGESTRNQEENVGDATLPEIYSDSEADDTLVLATWAETANLKKALVDQA
FT                   GLDPNDIFGPAYPLKPEEIFSPTRMAKLKSKH"
FT   CDS_pept        complement(729381..730061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431266"
FT                   /locus_tag="CAGL0H07469g"
FT                   /product="Similar to uniprot|P34756 Saccharomyces
FT                   cerevisiae YFR019w FAB1"
FT                   /protein_id="CAG60055.1"
FT                   /db_xref="HOGENOM:HBG124868"
FT                   /db_xref="UniParc:UPI00003B674A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRM2"
FT                   /transl_table=1
FT                   /translation="MKSYLPQFSFESKEKSPSESKRRNRGIVDRLKKFNFPQVQSNDKS
FT                   QNLGNSHPPDDRVTIRTISNDSADDHRVFSNYTYSTRDSFPSSHSENYELPKTPPPITP
FT                   SGSPRRYKHRKSNAISVSTPEELYLPKTPDHNSDIYREDEGVFYLSSPTSDIISYKHQL
FT                   SPETTIRDTKEQLRRNTVVGVANSLTEFAEKNRLDISGKVFADINDTPPPLIDLGKITE
FT                   NLNE"
FT   CDS_pept        732854..734389
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000033921" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347330"
FT                   /gene_name="AMN1"
FT                   /locus_tag="CAGL0H07491g"
FT                   /product="Antagonist of mitotic exit network protein 1 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60056.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124869"
FT                   /db_xref="HOGENOM:HBG204181"
FT                   /db_xref="UniParc:UPI00003B674B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRM1"
FT                   /transl_table=1
FT                   /translation="MVLPDSNIMKNGSIKRLRDSQIENSPYSRPIKKITPNSSHEDLSA
FT                   TISNEGSLNFTPRTSRQESLYNMKKIFQKTYSQTKLGLFSSKKQVNTLETAIPTTPKQQ
FT                   LPTPTTSPEKNNILWSTPNSLTSLRTISNDLDDCRNRNLITDFSELSIINSSSSSIYST
FT                   QQSHPIFEIPEIVDNIVKQLYLIENEQDLLNGHHKKDVNRENTSTVVSCLAVSKTWNKV
FT                   SKGYLMRDLKFTKSTSLTNFLSQCSTKKTTPQSLILHKMSDINNNNSRGLEIIIDPKQL
FT                   RHLEYYVCPNILPPVNWFQSLTKLEKLILPGNKLINDSYLIQICRYLPNLKVLDLRACD
FT                   NITDAGIVAVGTHCKQLVSCNIGRHRNGSSITGLSVVALAKNTMIRTLGLAGCDITDAS
FT                   MWELAQKCGKNIERLSLNNCNKLTNFSLPMLFAFNYFPNLNVLEIQNIAKITDVRHMVR
FT                   YKIWKRSQRIPILIKGCDRITKLIHEEERQIKAQSLKTARKDMTLWVNQLENE"
FT   CDS_pept        734835..735893
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347331"
FT                   /locus_tag="CAGL0H07513g"
FT                   /product="3-ketoacyl-CoA reductase "
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60057.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG713750"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00003B674C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRM0"
FT                   /transl_table=1
FT                   /translation="MTFVRELEVASQNSRAFNVTLWFIFIFGLLKLVPFALRFLSMVFD
FT                   LFVLPPVNYAKYGCKAGDYAVVTGASDGIGKEFASQLASKGFNLVLISRTESKLVALKD
FT                   ELEGKFNIKAKILAIDISADSKDNYNKIYSLCDDLPISILVNNVGQSHSIPVPFLATEE
FT                   EEMRNIITINNTATLMITQIIAPIIIRTVKKHRESGDKKLKSQRGLILTMGSFGGLIPT
FT                   PLLATYSGSKAFLQNWSSSLAGELAADNVDVELVLSYLVTSAMSKVRRTSMMIPNPRTF
FT                   VKSTLRNIGRRCGAQDRYGTITPFWSHAIYHFVIEELFGVYARVVNEINYKFHKSIRIR
FT                   AVRKAVREAKQN"
FT   CDS_pept        736241..737137
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194058"
FT                   /locus_tag="CAGL0H07535g"
FT                   /product="Similar to uniprot|P00546 Saccharomyces
FT                   cerevisiae YBR160w CDC28"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60058.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B674D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL9"
FT                   /transl_table=1
FT                   /translation="MSSELANYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLE
FT                   SEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPK
FT                   DQPLGVNIIKKFMVQLCKGIAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGV
FT                   PLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIF
FT                   KIFRILGTPSEAVWPDIVYLPDFKPSFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPI
FT                   NRISARRAANHPYFHEQ"
FT   CDS_pept        738086..739516
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347332"
FT                   /locus_tag="CAGL0H07557g"
FT                   /product="Similarities with uniprot|P32805 Saccharomyces
FT                   cerevisiae YGL254w FZF1"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60059.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124870"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B674E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL8"
FT                   /transl_table=1
FT                   /translation="MSYNQGKEFITELGKTPMKYIIEPTVGLANNLTPHGDTVVDEAKK
FT                   AKKGRTKSGRKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHL
FT                   RVHKWTHAQVKPLKCSYCERRFITNQQLKRHTNTHERRIAASKKKETEAAMRMMVGLPP
FT                   KNNKPKKSPTTTLLNEANETNGTVNGAANGTTNGVINGTDGVANGTANDTANGVTNGVT
FT                   NGVTNGVANGVANSITNGNDIVNGNNYNTDKFDDNGLNGLATGIHTINLQDLGFSDING
FT                   YRLNNTSLLSDPVIDVDGNGLRFRIKCPYFDCDAILGPNEDIMNHLLEMHLVSRLEKDP
FT                   TVDGELFYSPNSVVNNSLSLSDTATSPSSDGKSDTSYLLDGRIQDKTDDKCFSETIPND
FT                   ISYYRNNETVLNISDHEEASSWNDLRCREAHCKDLPKFNNVFVLIEHYDQDHAFIPESL
FT                   VKFGYLHLYAPDVQDGVL"
FT   CDS_pept        740607..742067
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499459"
FT                   /locus_tag="CAGL0H07579g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="hexokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG60060.1"
FT                   /db_xref="GO:0004396"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG130961"
FT                   /db_xref="HOGENOM:HBG522186"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI00003B674F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL7"
FT                   /transl_table=1
FT                   /translation="MVHLGPKKPPARKGSMVDMPKDLLDEIKKFEDMFSVDAATLQKVT
FT                   KHFISELSKGLSKEGGNIPMIPAWVMENPTGKEKGDFLAIDLGGTNLRVVLVKLGGDRT
FT                   FDTTQSKYKLPGPMRTTKDPEEIWSFIADSLETFIKEQFPEGCNETLPLGFTFSFPASQ
FT                   DKINQGVLQRWTKGFDIPNIEGHDVIPMLQKQIEKRNLPIDIVALINDTTGTLVASLYT
FT                   DGETKMGVIFGTGVNGAYYDVVSDIPKLEGKLADDIPSSSLMAINCEYGSFDNEHVVLP
FT                   RNKYDIAIDEESPRPGQQTFEKMSSGYYLGELLRLALLDLYNQGLIFKGQDVQKLKEAY
FT                   IMDTSYPSRIEDDPFENLEDTDELFQADLGIQTTVQERKLIRRLCELIGTRSARLSVCG
FT                   IAAICQKRGYETAHIAADGSVFNKYPGFQQRAAEGLRDIYGWKEDKPQNYPIVIVAAED
FT                   GSGAGAAIIAALAQKRIAEGKSLGVIGA"
FT   CDS_pept        complement(742499..745768)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347333"
FT                   /locus_tag="CAGL0H07601g"
FT                   /product="Similar to uniprot|P51979 Saccharomyces
FT                   cerevisiae YGL251c HFM1"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG60061.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG124871"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6750"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL6"
FT                   /transl_table=1
FT                   /translation="MEYTLLANCFYNRLKNSKRDVYLKYKTENSIREKFKFSTYNPILD
FT                   DSDNDQDLGDDYNMNSLFGQSNLSVGTEDTFTTSNDRLNTNDITALKPIKRGRVTVRRS
FT                   VNGKSGNPPGQIPEKWREYFDFDEFNKIQSICANKLYEKNNSFVINTPSNSGKTVLLEI
FT                   SILKALETYEQQNNTGLKVIYISPMKSICLEKYNRWKAKFTNLKVQLITSDMNHFEKNT
FT                   IGNANIIVATPEKIDLICKKWGDYLTFLKFVNLLLIDDIHFLKEERGAVLEVVITRITQ
FT                   NASNLRVIALCTNTGNIDDICCWLNSTHLINKANSLDFSASHGHIRERTKVIGIRSYTP
FT                   WKETNNSKFNKALFDIIKAQCESKPTIIFCPTKSSAARTAISLCGMSVTTIKKSSTNIS
FT                   FRNTDLQNCYKNSILFYHAGLHIDDRKEVEKNFANGDIQILCCTSKLDIGNNLPVYLVV
FT                   INGTSTWKDDRLSEYSSFEILQMIGRTEGFKYDGIGGKAIILTDDSRIKFYQNLIDKNI
FT                   TVESSLHNKIIDFILAEVSLGNIKSVNDIGEWINATFMVQRYCKNVDHYMPALQRQGLI
FT                   SLGNISSPIFYEKIIQSLQTLSLIFVNKGNISSTLIGSAMSRHCIDFKTMKSLITAAPK
FT                   NTVKAILKIVSKVEVFSIYRVRLNEKATLKELNNSQIWFRLLTEGGKPQIIDQPWQKIF
FT                   LLIQYNLSKPKSQLLVRLTPKLIYELCSIERHFIRVLKCLIDIFIAKNDGISLKNALFV
FT                   LRSLNVGCWESTPYILKQVKGMSINAVEKLSKMGINSLQQLTSMNREQLELYLGLKPGA
FT                   GTKLLDEIRRLPILSFHYQAFIDDKNSLNISPYISAKVAKPIGKSNEISVNFLALDKNG
FT                   HLIDFRRFPMILLNKEQSFTIMVDLTRVNEYIELILNVEEIPGIGLSRILKLESITENI
FT                   SGTKQQIITNSNKIIANSNDELEMDSNLSDLEILELVPSDPNNEDLSLPEEQHQKESNN
FT                   QQVNNFDGIASKNFKQHPYHNKSKQFYKQTHWDAPYEGKSFSTADMNTIKNDVSNHKRH
FT                   RIFPSSQSNDFDSDMEDKNFVELSRDIQTELAFLGSDIDLQ"
FT   CDS_pept        746280..747146
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194059"
FT                   /locus_tag="CAGL0H07623g"
FT                   /product="Similarities with uniprot|P53060 Saccharomyces
FT                   cerevisiae YGL250w"
FT                   /protein_id="CAG60062.1"
FT                   /db_xref="HOGENOM:HBG124872"
FT                   /db_xref="HOGENOM:HBG204290"
FT                   /db_xref="InterPro:IPR018822"
FT                   /db_xref="UniParc:UPI00003B6751"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL5"
FT                   /transl_table=1
FT                   /translation="MSIEEMNGQRMIVELEESKSPSEQGQQEEAGSLNVELGGDSDGVD
FT                   VRDSVLVEDADDDLLSSSGSDDRRLFVQDPRDDDYLRTIAEGLVQRKENPYVEVRYERD
FT                   VYPLFDDHSSLEHDVAIENYRQCVCKDPAMLQRSFSEFMAHLRSFLESRHGRLKFASQE
FT                   ILLSIVPLDLVVCEDNVYNSQISLADVVNIFEILQTRSREAEEREIPKHLDMEVSTRPR
FT                   FVSRYNTLVELTEGKATLSNVRPFSNDESHPLVLDDDQPVKVINSKQNTSTVDNNDSDE
FT                   LLEILSE"
FT   CDS_pept        747508..749538
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499460"
FT                   /gene_name="ZIP2"
FT                   /locus_tag="CAGL0H07645g"
FT                   /product="Protein ZIP2"
FT                   /function="DNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="meiosis"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60063.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="HOGENOM:HBG124873"
FT                   /db_xref="UniParc:UPI00003B6752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRL4"
FT                   /transl_table=1
FT                   /translation="MCIPENMWTPPTLPLPLQSFPKENIPIDKRTQKCLLQIKKLCSTQ
FT                   FSLNKEYKSTFNLIDYKLQRIIQPHNLSVNPINSFWPHTVERLVVPPIYYEMLSNQQIY
FT                   TLDYLQINPQYHIPIKSVQKSKQKAFQLNLLPLPRQKFRQIQLESYMPSKLESKMTSIC
FT                   EESLPKTVIFDYHGYFDLKQKLLTSNTLLTARLNPISTSAGCRQKLKFTTHWPSWTIEI
FT                   NTDISNISRLHKVLFDENFNKIELFKLASCNLKVERSTRIKKNHIATWKLDKLQLKELD
FT                   WDPLKKLKAYSVQKKINCDEVHAQATFIITPLKLVLMPINSSEIHILQNNYGNIVISAK
FT                   SFGNLQPKNTIESSQVSNNNTKLLKEARTTGSSMSDRSTSITSYKCSSLVPEKRSLLDS
FT                   NLISIVQLKKLRTSYPQSTESHSGEMSLLRLLHSNSCKTEIQQIDTWYDTAKLNTTPKT
FT                   TSFKLEGQDIKKKVSIIANEYDISTTYQITRLLRERQYSNIEEYRIKLPCHFILSFSSC
FT                   LLLVEISKVFQCITAGELFLERTLSILIKHFRVVHVFIEYEPNTELYDKDIFWKAKLIL
FT                   NNPQVRTIFIPKFSNNLTTWMLRVTTIQGQKFQEMVKDNTLSHFNINPYQEYLIQEKLR
FT                   ESSPSRLIETLVFGDHVLDGILTPIHINSLKIFARENWHLT"
FT   CDS_pept        750319..751419
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042916"
FT                   /locus_tag="CAGL0H07667g"
FT                   /product="Similar to uniprot|P22434 Saccharomyces
FT                   cerevisiae YGL248w PDE1"
FT                   /function="3',5'-cyclic-AMP phosphodiesterase activity "
FT                   /biological_process="cAMP catabolic process"
FT                   /protein_id="CAG60064.1"
FT                   /db_xref="GO:0004115"
FT                   /db_xref="GO:0006198"
FT                   /db_xref="HOGENOM:HBG059472"
FT                   /db_xref="HOGENOM:HBG397320"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="UniParc:UPI00003B6753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL3"
FT                   /transl_table=1
FT                   /translation="MTFTFEVTILGGSGGPIENDCQSFLIRPYGSDVVDSICVDAGTGL
FT                   GSLYNLVAQIGTSDEAKVNDYYNQNVTTRKVFNDVNVAYTNGFSSSLKKVLSEKYQNLN
FT                   HWETTILLYNGIRDYYITHPHLDHIAGLIINSPLAYEISFGTSKNVYGLTSTKEALTDH
FT                   IFNDTIWPSLNKLKYPKINLNALKQCRTHDIANFPWTTTPFKVNHGCGACNGEPNHSTI
FT                   YCIRHNRTSEAIVVCGDLENKASIDTLDSYLQTFTNWLTNNILAENFKGILIECSSQTV
FT                   PDGTPLFGHLSPPHLISLLKLLLKKYNDIDQTISELNVIVTHVKYTCGNEDPRLTVLSE
FT                   LRNLAKFNNLHNLNFSYASQGTTYYL"
FT   CDS_pept        751810..752349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194060"
FT                   /locus_tag="CAGL0H07689g"
FT                   /product="Similar to uniprot|P53062 Saccharomyces
FT                   cerevisiae YGL247w"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60065.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG124874"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniParc:UPI00003B6754"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL2"
FT                   /transl_table=1
FT                   /translation="MPLAELDKSCDSKGTPLHGSTKKNGNARRGILNKPVYLIACMVVA
FT                   IGSICLIIAFMKEIRKDVDVKLEIEMLQHLRKIDQCKYNYRINECDPGVRVRALDKLCE
FT                   EWYECMTVGDALSKNSKFTKKRAALWAETLGEILNAFMNSIKIKTWGLLMISITMSILA
FT                   INVSAAVIKNLTNSEQ"
FT   CDS_pept        752900..754600
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431267"
FT                   /locus_tag="CAGL0H07711g"
FT                   /product="Similar to uniprot|P53064 Saccharomyces
FT                   cerevisiae YGL244w RTF1"
FT                   /function="DNA binding"
FT                   /biological_process="histone modification"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60066.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016570"
FT                   /db_xref="HOGENOM:HBG059477"
FT                   /db_xref="HOGENOM:HBG397816"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniParc:UPI00003B6755"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL1"
FT                   /transl_table=1
FT                   /translation="MSDLDEDLLALAGADEEDEEEVLTTTNKRTKGSSNSQVKKRRIEV
FT                   DSEDEEDDYNPDDGYEPVDVSDKEEEEEEENPFPLEGKYKDTADRDHLESLPEMERETI
FT                   LFERSQVMRKYQERKLFRERGRNLKQQKIQAGEDSQKTRSSNRSTRATGHSDIKASKLS
FT                   QLKKQRERKSKGRRSSDYEESDEDNYGDEDEFKDDFIEEDSDYKENDDDEEGYDPYARK
FT                   SKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGR
FT                   VNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGP
FT                   FVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKK
FT                   LSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKK
FT                   LEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTKVYYQEIQKEENEKA
FT                   KEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKIIGSINVDIKLDI"
FT   CDS_pept        754933..756090
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21042917"
FT                   /locus_tag="CAGL0H07733g"
FT                   /product="Similar to uniprot|P53065 Saccharomyces
FT                   cerevisiae YGL243w TAD1"
FT                   /function="RNA binding"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAG60067.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG059480"
FT                   /db_xref="HOGENOM:HBG397682"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniParc:UPI00003B6756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRL0"
FT                   /transl_table=1
FT                   /translation="MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVI
FT                   ASDTRTDKHSILTITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSM
FT                   EGIESNLIHNTPNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQ
FT                   QYITPEIKTILRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSY
FT                   MMPTPLYISNYVIPNINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETP
FT                   PSSMSALKILFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHR
FT                   EFKDLTYLEFKRRYCAERAELIRSIKSSLSSDGWLSTAEDDCQLP"
FT   CDS_pept        complement(756294..756812)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210161" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17431268"
FT                   /locus_tag="CAGL0H07755g"
FT                   /product="Similar to uniprot|P53066 Saccharomyces
FT                   cerevisiae YGL242c"
FT                   /protein_id="CAG60068.1"
FT                   /db_xref="HOGENOM:HBG051678"
FT                   /db_xref="HOGENOM:HBG397688"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B6757"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK9"
FT                   /transl_table=1
FT                   /translation="MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTS
FT                   KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL
FT                   FIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPEL
FT                   IDDDDGEED"
FT   CDS_pept        757134..760199
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499461"
FT                   /locus_tag="CAGL0H07777g"
FT                   /product="Similar to uniprot|P53067 Saccharomyces
FT                   cerevisiae YGL241w KAP114"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG60069.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG059481"
FT                   /db_xref="HOGENOM:HBG323803"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6758"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK8"
FT                   /transl_table=1
FT                   /translation="MVSPEFQLLIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIE
FT                   LGENNQTPLASRLFSLLSLRKFITMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDD
FT                   QQSNKVRNSSSYCVVQISAVDFPDEWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISE
FT                   EMFFEGGIGYETLQIIFTLLTNAQVRLASKTSALKLFGACISQMSVLDNNSSQKRKLLV
FT                   SECLGQALQTIKLLLEQCEIIQSDLTSINETLEFKDNLYDDINSIKENFPRKFFPEDVN
FT                   LYVTNIAVRDLDQLAGLYQESFKDNFDEQSMSIFENCVIHLLDFLANPISPLNNELISN
FT                   ILTASITLCEQSALTKDSWESDFNEFASKETGLSASFTIRDEVAELVNAFEIPQLETSF
FT                   ELIVGYLSNNSSHLSADKIESALYLLQCLMNVEDDFSNTSLVPSLIEFIKSMLSQQNNL
FT                   DQMSQIRLLLLIPKTLAKFMDILPNVKQLTAETLNEILSMATNSNSHLIIISALISFTY
FT                   FASYAEILSVLGNDQTLLVQNKTLHLIQEISEESTEDTNGLLMEVLNCVIDCNDKNVAN
FT                   MELFKFEFKLILVISGKDPANIQVSIESQECLEKLLLNVNTNDYLSFVDICIPSFINII
FT                   KSSEVTNYSYSPLLSLVLEFITVFMKNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELL
FT                   QIATEAFSYMIHNSSKDVITPKLETIVNILDRLLSSNISDSAAMNVGTLILALITEYSE
FT                   PMNPLLPSIISAAVRKLVVSNNITTQQNLVTLLCFLVCHDPKQTVDFLCELTIKNDKGE
FT                   QVALPVIIQKWLDTFAVVRGENRIKENIVALSQLFLLGDDRVNEVKVNGEIIPYDGDLI
FT                   ITRSMAKSMPDRYTTVSAPEKIVKMFLGELGFQGRNKNPEELLTTDDMKGMGLKPNQQS
FT                   NNDEGDDDWEDVDDVVDYEKLQEYIDDEDDLDDNSVGELETITGQQHIPQSIPELLKDF
FT                   FNTAAQKNVAGFQEIYNNLSEEERKCISELIL"
FT   CDS_pept        760514..761302
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499725"
FT                   /locus_tag="CAGL0H07799g"
FT                   /product="Similarities with uniprot|P53068 Saccharomyces
FT                   cerevisiae YGL240w DOC1"
FT                   /biological_process="regulation of mitotic
FT                   metaphase/anaphase transition"
FT                   /cellular_component="anaphase-promoting complex "
FT                   /protein_id="CAG60070.1"
FT                   /db_xref="GO:0005680"
FT                   /db_xref="GO:0030071"
FT                   /db_xref="HOGENOM:HBG124875"
FT                   /db_xref="HOGENOM:HBG204333"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniParc:UPI00003B6759"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK7"
FT                   /transl_table=1
FT                   /translation="MISEYNRREEQSKNSNNSKWKDFLQRLGPDSAIKPVKLPHQQKKL
FT                   VLDEALFNQNPNVYVNGILNETNQEGEQHADTIADRYRVGLQLLNNNDYTNVTSLAYWK
FT                   ASSCKTGNPITNAIDDSFENYWQSDGIQPHTVDAYFSKRMDIVLIGIFFTITADESYTP
FT                   RVIHIFAGNSPSDAVFYKTLIVNNMNGWAALTFEDNLPVEKLLKCQYLRFKFPVNHENG
FT                   KDTHLRGIRVYTASNNQCKPQLETIKLQPVLPELDSFGLR"
FT   CDS_pept        761870..764755
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194328"
FT                   /locus_tag="CAGL0H07821g"
FT                   /product="Similar to uniprot|P33307 Saccharomyces
FT                   cerevisiae YGL238w CSE1"
FT                   /function="importin-alpha export receptor activity "
FT                   /biological_process="cell proliferation"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60071.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008262"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG022680"
FT                   /db_xref="HOGENOM:HBG327833"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B675A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK6"
FT                   /transl_table=1
FT                   /translation="MSDLETVSKYLAESVVASTSKIAEKNLKQLENEDGFGLTLLHIVA
FT                   SSNLPIATRLAGAVFFKNFIKRKWIDENGVHLLSPSNVELIKNEIVPLMIALPGNLQVQ
FT                   IGESISVIADSDFPERWPTLLDDLVSKLSTDDMVTNKGVLTVAHSIFKRWRPLFRTNEL
FT                   FLEIKLVLDKFTEPFLNLMKSVDEQITHKKDDKASLELLFDVLLLLVKLYYDFNCQDIP
FT                   EFFEDHIREGMGMWHRYLSYENPLLEDNFDTETASTLIKVKTSIQELVQLYTTRYEEFF
FT                   EPMINEFIQITWSLLVSTPNQPKYDILVSKSLSFLTAVARIPKYFEVFNTDSAMHSITE
FT                   QIILPNYTLREEDVELFEDDPMEYIRRDMEGSDSDTRRRATADFLGELKEKNENLVTSI
FT                   ILEHVKKFHDQYSTNPQEFWKYKDLYINLFTSLAVKGNITNSGVSSTNPLVNVIDFFTI
FT                   QILPDLMAGSLPHPILRVDAIKFVYNFRNQLNKQQLIEILPILANFLLNGEYLVFTYAA
FT                   ITIERILAIRETPSSPVFIFNKNDLSGSADVLINNLLTLIKKQGSTPEQLAHNEYLIRA
FT                   VYKVIQTAEETISPMYPELINQFISIVDIVAKNPSNPRFSHYLFESIAVILNYNPNSTL
FT                   PQIIDHIMPSFMHILSEDIQEFIPYIFQIIAYAVESMPQISESITALSQPILAPAVWEL
FT                   KGNVPAVTRLLKAFIKKNYKIFPDLIPVLGIFQRLIASKAYEIYGFDLLECIFLSIDLE
FT                   VLKPFMKQIAILLLQRLQSSKTERYVKKLTVFIGLILYKFGPDFLILFIDEVQDGLFGQ
FT                   IWGNFIITTLPNIGNLLDRKISLLGMNSIIGTQSNFQSKYSSLITPTLASVVKTITSDS
FT                   AANAGNNFVDLDNIEEVSTFGSHFSKLGSISEKTFDPAPEIDNNDGVKVFVLQTLKKFN
FT                   DSSNNLVINSISTELSEETQNKFNQLWSQSQ"
FT   CDS_pept        complement(765236..766126)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432279"
FT                   /locus_tag="CAGL0H07843g"
FT                   /product="Similarities with uniprot|P06774 Saccharomyces
FT                   cerevisiae YGL237c HAP2"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="CCAAT-binding factor complex "
FT                   /protein_id="CAG60072.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016602"
FT                   /db_xref="HOGENOM:HBG124876"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="InterPro:IPR018362"
FT                   /db_xref="UniParc:UPI00003B675B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK5"
FT                   /transl_table=1
FT                   /translation="MSRREVIYSETMNLQNVHPPSSIVGGTSNASPAGTDLYTSNPDDN
FT                   ESQAPTNEELYLYNELKRVSENVDSDNLEGKQQEDTGVPQNIITKQYVQTIPRTALDNE
FT                   SNNGNIKMESEPPINSTTRVPDNKNTHINGKEKNYKFDGPQRSSTNDNVRKSVPKNYEN
FT                   PSNKFSTEIPESNLPKEESTSEQPYYVNAKQYYRILKRRYARAKLEESLRICRERKPYL
FT                   HESRHKHALRRPRGEGGRFLTAAEIKELKEKGELKDTEKTKSQSDAEKSIDTNADIVNS
FT                   QKSGASTGDLDTKKD"
FT   CDS_pept        complement(766917..768908)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499726"
FT                   /locus_tag="CAGL0H07865g"
FT                   /product="Similar to uniprot|P53070 Saccharomyces
FT                   cerevisiae YGL236c MTO1"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60073.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG001394"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI00003B675C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK4"
FT                   /transl_table=1
FT                   /translation="MLRCLGNRSAHRTVIVARRRLMVDSQIREYLRTLEEHDVVVIGGG
FT                   HAGCEAATAAARSGARTVLVTPFLDKIGTCSCNPSIGGVGKGTLIKEVDALDGVAGRVT
FT                   DKAGIHFKMLNQSKGAAVWGPRAQIDRNLYLKEMQSILSNYPNLQLQEAKVKDLLLDKE
FT                   HGDKTVVHGVVLEDSTIMRTRKVVITTGTFLSAEIHIGMKCIPAGRIGEEPTYGLSKTL
FT                   KEIGFKLGRLKTGTPARLDGKTIDFSNLEKQYPDEVPHPMSFLNNNVAVETQLLCYGTT
FT                   TTPELHEYLRQNLDKSLHIRETIKGPRYCPSIEAKILRFADKQSHKIWLESEGLDTDVI
FT                   YPNGISNSMPEDVQLKMMRMVPGLENVRIIHPAYGVEYDYIEPTQLNHNLETKLVNGLY
FT                   LAGQINGTTGYEEACAQGVIAGANAGLSSKNRDQIILSRSDAYIGVLIDDLVTNGVVEP
FT                   YRMFTSRSEFRITTRAENADFRLTPIGRKYGIVDDTRWSRFNNDKHIFEKFKTKLKNFD
FT                   LSASKWNQKLGIRIADSAKNRTAWEVFRYNDITLRYLAVKIPELDIDINAIPNHVSLKL
FT                   DVEGKYEPYIVKQNQFVRAFQADEQMLLPKKFDYSNIPTLSSECKMLLNSIQPNTIGQA
FT                   RRIQGVTAAALFELYKLVRPRQAELKNQ"
FT   CDS_pept        769859..772234
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000030315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432280"
FT                   /locus_tag="CAGL0H07887g"
FT                   /product="Similar to uniprot|P07244 Saccharomyces
FT                   cerevisiae YGL234w ADE5"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylamine-glycine ligase activity "
FT                   /function="phosphoribosylformylglycinamidine cyclo-ligase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /biological_process="purine base biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60074.1"
FT                   /db_xref="GO:0004637"
FT                   /db_xref="GO:0004641"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="HOGENOM:HBG019024"
FT                   /db_xref="HOGENOM:HBG328156"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniParc:UPI00003B675D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK3"
FT                   /transl_table=1
FT                   /translation="MLNILVLGAGGREHALVWKLVQSPSVEHIYVAPGNGGIAKIGPKV
FT                   VCVDIDCDAKNFEKLREFAVSKDINLVVPGPEVPLIDGVTDLFAKVGIPVFGPSAKAAQ
FT                   LEGSKGFSKDFMQRHNIPTARHKTFESYEEAKRHLEEVNYRVVLKADGVAAGKGVLIPE
FT                   NKEEALKALDVIMVEKQFGDAGNTVVIEEFLEGDEISILTISDGYSYFNLPPAQDHKRI
FT                   GENDTGLNTGGMGTYAPAPVATPKILQEVDSTIIKPSIDGFRKERIPLVGCLFTGIILT
FT                   KEGPRVLEYNVRFGDPETQSVLPLLTEDTDLAEVFLAAAEHRLDSVEIKTKSDCFATTV
FT                   VLSAGGYPESYKKGDIITIDEKKLPFDSYVFHAGTALDAQGNLITNGGRVIAASAVSDT
FT                   LKGAVDKAYEAVEGIQFEGRYFRKDIAHRAFRDTENKSQGITYADAGVSVDNGNLFVEK
FT                   IKNMVKSTRRPGADSDIGGFGGIFDLKQAGYNTDDTLLIGATDGVGTKLIIAQETNIHD
FT                   TVGIDLVAMNVNDLVVQGAEPLFFLDYFATGALDIKIAADFVSGVAEGCIQSGCALVGG
FT                   ETSEMPGMYPPGHYDTNGTAVGAVQKDSVLPMTNLMKEGDVLLGLASDGVHSNGFSLVR
FT                   KVISHVGISWSEQCPWEPSKTLGEAILTPTRIYVKQLLPSIREKLILGLAHITGGGLVE
FT                   NIPRALPKHLQAQVDMSNWSVPEVFKWFGKAGNIPVDDILKTFNMGIGMVIIVDKANVA
FT                   RVKELLEQANETVYEIGSLVNRLEGQPGCVVNNASNLY"
FT   CDS_pept        772741..775389
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432281"
FT                   /locus_tag="CAGL0H07909g"
FT                   /product="Similar to uniprot|P22224 Saccharomyces
FT                   cerevisiae YGL233w SEC15"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAG60075.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG059468"
FT                   /db_xref="HOGENOM:HBG204361"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="UniParc:UPI00003B675E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK2"
FT                   /transl_table=1
FT                   /translation="MDQETKKVISKDFQDVLLDTSTVVVSSVFDQENKIVGGENAKGVD
FT                   IIDSTLDIDQRAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLND
FT                   KLETSMDEIAEIQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAI
FT                   ILINKVLRLLELSNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIP
FT                   YLKSVTKDECINLIKNSLNSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKF
FT                   NSPIEISMRDEENLRKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKT
FT                   IQPLPWKTSGNTVSVNSTAHDEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVN
FT                   NNYNATNEFWEMLMMRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPL
FT                   YSVMLALFEKYCKTTLELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQII
FT                   DDMDDENFSVTLPFSPLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGIL
FT                   DGVVNKQIRAKLETTSREEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLAST
FT                   KNFAESRKYAESKLIDLIDTKIKDILETVSFDWLDTDRRIDPDISIVDLAQFLEMMFAT
FT                   TLVNLPYSVQILLIFREFDSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKI
FT                   FPRTDENENGRLGSQTPKTPTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSED
FT                   PNEYLDPQMRSRKYSRIKPDDANILIGKIRPITAPAPTNEAENSSVFNLDWNGSDSNNG
FT                   NNRLAKFFNRR"
FT   CDS_pept        775729..776526
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499727"
FT                   /locus_tag="CAGL0H07931g"
FT                   /product="Similar to uniprot|P53072 Saccharomyces
FT                   cerevisiae YGL232w"
FT                   /protein_id="CAG60076.1"
FT                   /db_xref="HOGENOM:HBG059467"
FT                   /db_xref="HOGENOM:HBG397782"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniParc:UPI00003B675F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK1"
FT                   /transl_table=1
FT                   /translation="MGTKRGNDGSSQNRKIKKFKIATGFLDPGTSGIYATCTRRKEKAA
FT                   ISEMGILLEEKIEELYGESEVADSDVDEAGSIEDEVAKELAQLKKNKDDQDKKQLLKAI
FT                   DLQCECVVFFKTRKPVNPTTLVKAIIDDFSNPESKVKRTRYIQKLTPITYSCNATKEQF
FT                   QKLIDQVVEPAFKSDQSYKFAVEVTRRNFNTMERMDIINTVVSTVMKHGHHKVDLKNYD
FT                   KVIMVECFKNNIGMSVLDNDYSKKHKKYNLQQIYEAKFKDEEK"
FT   CDS_pept        complement(776742..777293)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347587"
FT                   /locus_tag="CAGL0H07953g"
FT                   /product="Similar to uniprot|P53073 Saccharomyces
FT                   cerevisiae YGL231c"
FT                   /protein_id="CAG60077.1"
FT                   /db_xref="HOGENOM:HBG340717"
FT                   /db_xref="HOGENOM:HBG609692"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniParc:UPI00003B6760"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRK0"
FT                   /transl_table=1
FT                   /translation="MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLSGSVRDK
FT                   KNTSNKQVNKPDIANLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLS
FT                   GPVKSIFTIRETFKPVLGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTS
FT                   DWMAWEKITDYNKGIRVFSF"
FT   CDS_pept        778377..779204
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001021" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432282"
FT                   /locus_tag="CAGL0H07975g"
FT                   /product="Similar to uniprot|P33399 Saccharomyces
FT                   cerevisiae YDL051w YLA1"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG60078.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG203099"
FT                   /db_xref="HOGENOM:HBG393749"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002344"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6761"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRJ9"
FT                   /transl_table=1
FT                   /translation="MAENQARRNSYGNIDFTEEVSKQCLKQVEFYFSESNFPYDKFLRT
FT                   TAEKNDGWVPITTIATFNRMKKFRPVDKVVEVLRTSEILEVSENGENVKRRVPLVWNRN
FT                   DEKFKEAKLEQNKRTLVVMNFPHDEEAGQAQEKKEGEEEKEDKDLQVEIEEFFRKLAQV
FT                   NQVRLRRDHKKNFRGTVFVEFKNYDECKKFEDEYSAGSKDDKEGGEILSFKGKRLNILT
FT                   KKQYDMQREATRSKNFSGSGQRSRSFTGHRKNMPKPSKKKDQDSENSSAIAEE"
FT   CDS_pept        complement(779848..780645)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432283"
FT                   /gene_name="KNH1"
FT                   /locus_tag="CAGL0H07997g"
FT                   /product="Cell wall synthesis protein KNH1 "
FT                   /biological_process="cell wall biogenesis"
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="cell wall"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAG60079.1"
FT                   /db_xref="EMBL:AAC64009.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0042546"
FT                   /db_xref="HOGENOM:HBG058969"
FT                   /db_xref="HOGENOM:HBG396695"
FT                   /db_xref="InterPro:IPR008659"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI000012DF1D"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74684"
FT                   /transl_table=1
FT                   /translation="MLSIILLLMQLVAADIAVVGPSLDQSFDASGGTAKIPIQWLFTPN
FT                   TPSQDDFTSLTFSLCSGPNYKIEAFKVIGKLSDIGTTDFEAEVSQSVGANGYYYVQIYA
FT                   ATTDGYTIHYSPRFKLTGMTGSKLPDTLLITAPPTPETRVTTGDLGATIDSKSFDIPYG
FT                   EQNGKAKFAPMQTQPGTKITATTWSRRYATSAVSFFTSLTATPVQHTTLTPGWSYYISS
FT                   DYNYAPPAPFPSDNGGWYDPKKRQSFTTRKLNMDKLRKRRQTS"
FT   mat_peptide     complement(779851..780603)
FT                   /gene_name="KNH1"
FT                   /locus_tag="CAGL0H07997g"
FT                   /product="Cell wall synthesis protein KNH1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:O74684 "
FT   sig_peptide     complement(780604..780645)
FT                   /gene_name="KNH1"
FT                   /locus_tag="CAGL0H07997g"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74684 "
FT   CDS_pept        781773..783050
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194329"
FT                   /locus_tag="CAGL0H08019g"
FT                   /product="Similar to uniprot|P40160 Saccharomyces
FT                   cerevisiae YNL207w"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60080.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG461643"
FT                   /db_xref="HOGENOM:HBG746084"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="UniParc:UPI00003B6762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRJ7"
FT                   /transl_table=1
FT                   /translation="MKLDTSHMRYLTADDFKVLQAVEQGSRNHEIVPTQLIHQISKMRS
FT                   ISGTNRSISDLAKLKLISKVRNAKYDGYRLTYNGIDYLALRTLLNQEVVYSVGNTIGVG
FT                   KESDIYQVSDRNGTAKVMKIHRLGRTSFHTVKNNRDYLRNSRQGTNWMHLSKLAASKEF
FT                   EFMSMLYAKGFIVPQAYGCSRHVVVMDLIDGYPMRRLREHKNIPKLYSDLMTFIVKLAN
FT                   SGLIHCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRF
FT                   FKKKLKYDPQPEAGMLDTDGFGEGYKYAYPDFNRDVKRTDNLDELMQASGYSKKHPGDR
FT                   YLEEAVESMRNAEYNSDDDIDVAEDRSEEESDSDYDYYYTEEDEESGEDSDGDSEEEEN
FT                   ERIIEALSSGVGNLKMDKLGNYILED"
FT   CDS_pept        complement(783229..784590)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347588"
FT                   /gene_name="RTT106"
FT                   /locus_tag="CAGL0H08041g"
FT                   /product="Histone chaperone RTT106 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /biological_process="transposition"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60081.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0032196"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG189714"
FT                   /db_xref="HOGENOM:HBG202644"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="UniParc:UPI00003B6763"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRJ6"
FT                   /transl_table=1
FT                   /translation="MSSFDFLNELPKELQNKIRNITRALPSSLEVFQELYNYGLSHSDN
FT                   IEKKRKVTSNGVIDEQNIIFSLKNVSVLSPIRKKLDLVLHLSSIDHKPQLSLVKNGVSE
FT                   FSISNLKDNVKMGTFLPVPEKPNLLYLFVQLKKVNDKDQDPILLTMNKENVLTEFKSMG
FT                   LIGQEVDDFNKCTEYIRKQAILTGFKIANPFNPSVEQPVPSFHVECHRGTKEGTLYFLP
FT                   EIIIFGFKKPILVFESSNIESISYSSITRLTFNVTLIKKVDDGYGTKFEFSMIDQTEYS
FT                   KIDDYVKLKQVKDESMSEELKAKTANKNKQQNNTSDQPSALQEATKQMETEGNINEIPF
FT                   DSEDDEEADGNFEDNSDLSDGSEVEEEDNEEENEEDEEADGGDYAEEDFEEDEIIQEQA
FT                   NPAVNQLISKTTPINKNSSNAGLFDFPIETPSFDIPIELEDNEDDEEGSGVEYD"
FT   CDS_pept        785331..786203
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19347589"
FT                   /locus_tag="CAGL0H08063g"
FT                   /product="Similar to uniprot|P32573 Saccharomyces
FT                   cerevisiae YNL202w SPS19"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60082.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6764"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRJ5"
FT                   /transl_table=1
FT                   /translation="MVNTLDKTFLEKSSWKPDLFKGKVGFVTGGAGTICRVQVEALVLL
FT                   GCKVAIIGRDHEKTERVAKEISSLVDNPDAVLPISKVDVREVKQLESAVKRTVDRYGRI
FT                   DYVIAGAAGNFICDFNHLSANAFKSVVSIDLLGSFNTAKATMPELIKSRGSILFVSATF
FT                   HYYGVPFQSHVGAAKAGIDALSNALAVEMGPFGVRSNCIAPGAIQGTEGFDRLIGDASK
FT                   KKTTSKIPLQRLGTTEDIAQATVYLFSPAASYVSGTIQIVDGAMWHIGTHFAHELYPDL
FT                   LFKDPKAKL"
FT   CDS_pept        786770..788794
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112416" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432284"
FT                   /locus_tag="CAGL0H08085g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAG60083.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG059225"
FT                   /db_xref="HOGENOM:HBG203232"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI00003B6765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRJ4"
FT                   /transl_table=1
FT                   /translation="MGIQGLLPQLKPIQNPVSLRRYEGQTLGIDGYAWLHRASCSCAYE
FT                   LAMGLPTEKYLKFFIKRFNMLKSFGVTPYLVFDGDSINVKQETNKKRREKRQENREIAM
FT                   RLWQSGNKRNAMDYFQKCVDVTPEMVKCVIDYCKNNGIKYIVAPFEADPQMVYLEKKGL
FT                   IQGIIAEDSDLLVFGCRRLVTKLNDFGECIEICRDSFGQLTSKFPIGQLSNEEIRMMVC
FT                   LSGCDYTNGIPRIGLIKAIKLVMTHRNMDRILMSLQTEGKFSVPENFYDEYRYADYSFQ
FT                   FQRVFCPLSKQIVSLTEIPMGLQSDKILHSCIGKAICRLDGTKRYCLNDEIDHEIHGYL
FT                   ARGDLNPYDFTKRLVNREHKLQLQSKSDMSITYDPSNEQKSRKVLSIDTFFSSVPEIKG
FT                   QGTSSNKQPVYEDFVEKKYTQLISNRKLGRKSDCNNKVTSKFFTSNQESNSRTAGLNGC
FT                   NLNSIEQATEKIIISDNESETDLPESELPTQVEAQNTPTEFSLSIASSQSKSTSDGFNS
FT                   FEVTSQRDEIGNTSEEHEDISELIDLSDNNDVDNSTNLVSGLRNIKTENSIPSLKLENV
FT                   RRANPHKFDLSISSYEIKKPKTEILKPSRVLKPRNVNQKPSSGIIPNIIGDKHSRDRLK
FT                   RDVGKQRVLASKAKALQTETSTRKTGNKLLQQYVYNPSK"
FT   CDS_pept        792971..793987
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043220"
FT                   /locus_tag="CAGL0H08107g"
FT                   /product="Similar to uniprot|Q12398 Saccharomyces
FT                   cerevisiae YOR032c HMS1"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60084.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124877"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B6766"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRJ3"
FT                   /transl_table=1
FT                   /translation="MKFHKQIKSILSTQENFDNIQLFSSQEAVNQMNMVIPLFPDQSDE
FT                   LRSGNGDSEQNWRNQGDVHIDHSVPCSLNEDWIDCKSDGESQQSVSSFGNTCTTGSEPK
FT                   HFESATSSMQTSSQFMNEKHSFIDEQPFPSFTEPADIESRMEKAFDSLISENVLTITDE
FT                   KRGKNTSTQCVSTKESVIDKNQHIPFCVSRTMGKNKNGLMGANMHVLDVRNDKYCKKNT
FT                   KTQTPKGSKRALHSIVEKKYRTNINERLAELKNTVPTIRYTYKKLCNIPLTEADHRQLN
FT                   GMEPARKLNKASILHKATEYIKFLENENSDLKAENARLQNIINLSFNLQQRITPLNM"
FT   CDS_pept        complement(794516..796216)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043221"
FT                   /locus_tag="CAGL0H08129g"
FT                   /product="Similar to uniprot|Q99234 Saccharomyces
FT                   cerevisiae YOR030w DFG16"
FT                   /protein_id="CAG60085.1"
FT                   /db_xref="HOGENOM:HBG124878"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI00003B6767"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRJ2"
FT                   /transl_table=1
FT                   /translation="MPNFNDSSYGYLKSNNYGKDLNNNLWKLSGILNSTIFETINSTNQ
FT                   LLHDKAYSCVANLFSGGIVSSADNDLNSGALNYTAKSPLVFIHCSNNTNDKNSVILENI
FT                   MQNAVRNISDLMTYEGLGSGTVLAKTDKFYLGMLLICFGQISICIAYWMLFTVVVLLPA
FT                   DDHNRQNKLVLIFVLFSAITEAIILNRTVINVIQPQYYNNYQRSEEYESIIINSNLVKS
FT                   CDLIYSVFTHFNWLLIIIYMYPTVSLKWVEHVKKLPNGVRHFKHYHICLAIILMLIDDI
FT                   LFCLLLWTNTKPSIHVAFKSFEIIIYTIFCLLLVYFVWSNFAFVLRPKVQKGGCDIDTS
FT                   ETSSKFTTTNETCDNCEKASYSFANKSQNIFVVVMKKGLRLVFYLFNGFFNYFKWSYYH
FT                   LKVLWKDYQDILPLLAYNIVLFGLSYWATIFFTMGEYYHRRWAYNIVYFLRALITVNVW
FT                   ALIGVLEKKKIIASRKTVLGRQIRTNSFNENRDITTLGDHFISREDNNINSGGLISDFY
FT                   IDKASPRVSPQRNSGEIYESSSANKITPHLNTAKYLLRAYPGARRKKKL"
FT   CDS_pept        complement(804418..806169)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499728"
FT                   /locus_tag="CAGL0H08195g"
FT                   /product="Similar to uniprot|P15705 Saccharomyces
FT                   cerevisiae YOR027w STI1"
FT                   /function="binding"
FT                   /protein_id="CAG60088.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG038558"
FT                   /db_xref="HOGENOM:HBG384096"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B676A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI9"
FT                   /transl_table=1
FT                   /translation="MTTADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNR
FT                   SACYASLKKFPEALNDAEECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG
FT                   SNQAAKDGLDQVKRTQESRQGMPDLGLSKIFADPNLIENLKKNPKTSEMMKDPELVAKL
FT                   IKYKTNPQAMSQDLFTEPRLMTIMATLMGVDLNMPDLSSSNSMPKEPTETPEQSKETPA
FT                   EQKSEPQAEATKAEPEPMEVDSAGNEETSKKEEAEKEKALGNKAYKARQFDEAIAHYDA
FT                   AWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREMRTDYKLIAKSFARMGNVH
FT                   HKTNNLKKAIEFYQKSLTEHRTPEILTKLRNTEKELKKQEAEEYINPEKAEEARLEGKD
FT                   YFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFI
FT                   RAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKASQQRFQPASS
FT                   NETPEQVYERAMKDPEVIAIMQDPVMQSILQQAQQNPAALQEHMKNPDVFKKIQTLIAA
FT                   GIIRTGP"
FT   CDS_pept        complement(806660..807637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432285"
FT                   /locus_tag="CAGL0H08217g"
FT                   /product="Similar to uniprot|P26449 Saccharomyces
FT                   cerevisiae YOR026w BUB3"
FT                   /protein_id="CAG60089.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG202806"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B676B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI8"
FT                   /transl_table=1
FT                   /translation="MRVEIKDVPREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELKQ
FT                   VNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGIS
FT                   CIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCK
FT                   IAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFA
FT                   FRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENS
FT                   VVQLACNENILCVATSDDSFKTNAVIDSNLELEPSRIYVEILTN"
FT   CDS_pept        complement(808082..809386)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432286"
FT                   /locus_tag="CAGL0H08239g"
FT                   /product="Similar to uniprot|P53687 Saccharomyces
FT                   cerevisiae YOR025w HST3"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="CAG60090.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG252407"
FT                   /db_xref="HOGENOM:HBG397265"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI00003B676C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI7"
FT                   /transl_table=1
FT                   /translation="MDEKLQTDKIVVFDDTHLLAEEQDDVLLSINRQLNKSRKIILLTG
FT                   AGISCNAGIPDFRSATGLYNLIKRQYPDISIGSGKEMFDISLFRDEMKISVFATFMEKL
FT                   YASVKLAQPTTTHKFIAHLKNRNKLLRCYTQNIDGLEENLGLAISNSSFQPSTGKTTET
FT                   DNSPNKNNIDVIQLHGDLNTLACTRCYHEFQWSRYLARYFRRGELPTCPECERINNERV
FT                   QMGKRLINNIGYLRPNIVLYGENHPSGEIITQGLNTDINRGKPDLFIIMGTSLKVDGVQ
FT                   RVVKQISKQVHERKGLVILVNKTKLSESRWNGIIDYQICCDCDTWVKYLQGQIPDFFKS
FT                   QEEVLALRQLRREASELRKLKKSEKSSIKTPPTTPTGKRNTVPTREPILNGVKRKLLTP
FT                   ENSFDERSPKKFSKTTSSNKKNDTLKKKPLGIVNL"
FT   CDS_pept        810168..812372
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432287"
FT                   /locus_tag="CAGL0H08261g"
FT                   /product="Similar to uniprot|Q99248 Saccharomyces
FT                   cerevisiae YOR019w"
FT                   /protein_id="CAG60091.1"
FT                   /db_xref="HOGENOM:HBG429321"
FT                   /db_xref="UniParc:UPI00003B676D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI6"
FT                   /transl_table=1
FT                   /translation="MEMAEDADRALRDTYKRIKVYYDPAELPYLVRDIRPSVSYDTVPK
FT                   YIGYSAIEDMDGGFPGVEVTKHTVPVKTDLSRKGATLGSQVFLNPRFLLHNHVSGDDDY
FT                   EIERMKKRIFDASPLANNPLSLTRSKKSVFNYTADGKIIRSDYPTKPVFVNKIIIRSRT
FT                   NVHWDERWAQRKSKIEYNMEHKDEKFMYPDILFPEVKEKPLIMGDDFVPITKEQRRRNK
FT                   ILTIKQAHPTLPRTVVCYISGRRHTWAGLDWAVRSLAENDHLVIVATIPKMTSHRDQEP
FT                   EVDGTWVSGYTFDEIDTIISDLFEYIKVIKPVHKALKVTIEISIERTKGALIDAINVYS
FT                   PDFLILGTLKWQRYENLVSYRGNNMVDKLCTTFPIPTFIVPARRLFMLEKEIEEETLTK
FT                   LISDNTKKAVTPENEEIEYPRSPKLVSTDSFGFWSKNEQKLLDESYSISTKDKLEKRQE
FT                   SFTSLTTHESEDSLAIEDDDDRDSNLLESTESIVSKLKSIAITNRKNMMADLEEFDNEH
FT                   SNINTKENQLAKVSLIIKHSLNSSNTIKNLTQNLDEENRGFAVLQKVITGTGTVESRPK
FT                   FSMVDAVRVNGKIPGESSAKKRRSQIKFASNVKPTDGTAGLGTPRIVGPTGESQYSGGT
FT                   SPLRTVDSNESALTFASNGSKISKHGRSSSFGTHSVNNGFLSVKRNSMSDQVSFRSADH
FT                   APKLLTKKTSKSNDKSKDKKDSKKSSTKKKLGKLFSFGNL"
FT   CDS_pept        complement(812738..813058)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432288"
FT                   /locus_tag="CAGL0H08283g"
FT                   /product="Similar to uniprot|P38910 Saccharomyces
FT                   cerevisiae YOR020c HSP10"
FT                   /function="ATP binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60092.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG279789"
FT                   /db_xref="HOGENOM:HBG703377"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniParc:UPI00003B676E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI5"
FT                   /transl_table=1
FT                   /translation="MSTLLKSAKSIVPLMDRVLVQRIKAEAKTASGLFLPEKNVEKLNQ
FT                   AKVVAVGPGFTDANGNKVTPQVSVGDQVLIPQFGGSTLKLANDEEVILFRDSEILAKIK
FT                   DN"
FT   CDS_pept        814034..814993
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432289"
FT                   /locus_tag="CAGL0H08305g"
FT                   /product="Similar to uniprot|Q99288 Saccharomyces
FT                   cerevisiae YDR051c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG60093.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG124494"
FT                   /db_xref="HOGENOM:HBG649033"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B676F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI4"
FT                   /transl_table=1
FT                   /translation="MVDSYNRPRLIVLIRHGESESNKDKKINEVTPNHLIPLTPYGKKQ
FT                   AHNAGLKLLRLLNMADASVIEKLGEEYALPATSTNTLELRGYKPNGKHMDDNIIFYTSP
FT                   YKRTRETLKGVLEVIDRYNELKSGINMCAEQTYNPYGKQKHAIWPHDLENSGIYENDES
FT                   THCGPEREGTYIRYRIIDEPRLREQDFGNYQEVSSMQDVMEKRKTYGHFFFRFPEGESA
FT                   ADVYDRVASFQDTLYRHFQFRQHTKGRDVVVLVTHGIYSRVFLMKWFRWTFEEFESFTN
FT                   VPNGSLMVMELDEKLNKYVLRTVLPKWSDLEAEKDLIT"
FT   CDS_pept        815939..816685
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226413" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432290"
FT                   /gene_name="TPI1"
FT                   /locus_tag="CAGL0H08327g"
FT                   /product="Triosephosphate isomerase "
FT                   /EC_number="5.3.1.1"
FT                   /function="triose-phosphate isomerase activity "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="glycolysis"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="CAG60094.1"
FT                   /db_xref="GO:0004807"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="HOGENOM:HBG000074"
FT                   /db_xref="HOGENOM:HBG708281"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniParc:UPI00003B6770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRI3"
FT                   /transl_table=1
FT                   /translation="MARTFFVGGNFKLNGTKKSIKEIVDRLNTASLPENVEVVICPPAT
FT                   YLDYTVSLVSKKQVTVGGQNTYTKASGAYTGENSVDQLKDVGAKWVILGHSERRTYFHE
FT                   DDKIVAEKTKFALDQGLGVILCIGETLEEKKAGVTLKVVERQLDAVIAEVKDWTNVVIA
FT                   YEPVWAIGTGLAATAEDAQDIHHSIRSYLAEKLGKDTAEKTRILYGGSANGANAGTFKD
FT                   KADVDGFLVGGASLKPEFVDIINSRN"
FT   CDS_pept        complement(816990..818942)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432291"
FT                   /locus_tag="CAGL0H08349g"
FT                   /product="Similar to uniprot|Q04311 Saccharomyces
FT                   cerevisiae YDR049w"
FT                   /protein_id="CAG60095.1"
FT                   /db_xref="HOGENOM:HBG055252"
FT                   /db_xref="HOGENOM:HBG396510"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B6771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI2"
FT                   /transl_table=1
FT                   /translation="MSDTSIKKHDLYIYDLPEALLNSLDLLQFDSYRNEVKPKPVERAP
FT                   VSIEEVKNKQVPTVLKCKVCADSTEAIGREHYQTDLHVANIRRNLNGLPPLNQAQFEEL
FT                   ISKNTAKKDQKIVEGDSDGDISNDSGNDSDSNYSSEDELEKIDEIGGELSRKVNEINII
FT                   DKPITPLLTDTEDSQANLFHLNTGLPQILVRSPLLSNGQTYGIYKALFDKDNIQEPLDT
FT                   ILKWNMDDTRMTSISALFLVGGGHFAGAIVCHQRGNIKSVVRSKRVDETPQEQCVQFLE
FT                   HKTFHRYTTRRKQGGSQSAMDNAKGKANSAGSTLRRYNEAALKTDIQNLMEKWRPYLNK
FT                   CESIYIRARNVQDKKIFLDGGILNKDDKRIKSFPFTTNRPTVTELKRIWCELTYMKPVE
FT                   KPQPIPNEEASRKAISKPDAESKKKDVPKLELSEAEVHTEQIVTLLKKSRVPLLLSYLK
FT                   KNKLDGNFILLPRNKYVHTPTMLHYASQQGLRQMVSILLTTVKCDPTIPNDVGKTAWDI
FT                   SKNDTVRYCFQKARHALGEEYTNWEEAHVGVPLSKEEVERLESEKEKQDEAETKKLIQK
FT                   ELELTKERQKQERSARADEIELKHGQGRRLDSGSPGLMNLSSHKIDSLNEDQRRRLMRE
FT                   QRARAAEARMQKLNK"
FT   CDS_pept        complement(819301..820383)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499729"
FT                   /locus_tag="CAGL0H08371g"
FT                   /product="Similar to uniprot|P32347 Saccharomyces
FT                   cerevisiae YDR047w HEM12"
FT                   /function="uroporphyrinogen decarboxylase activity "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60096.1"
FT                   /db_xref="GO:0004853"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG090899"
FT                   /db_xref="HOGENOM:HBG628392"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniParc:UPI00003B6772"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI1"
FT                   /transl_table=1
FT                   /translation="MFPELKNDLILRAARGEAVERPPCWLMRQAGRYLPEYHEVKGNRD
FT                   FFEVCRDAEVASEITIQPVRRYAGLLDAAIIFSDILVIPQAMGMKVEMVEGKGPHFPEP
FT                   LRTSEDLQKVLDYKVDIKKELNWAFEAITLTRKKLDGQVPLFGFCGAPWTLLVYMTEGG
FT                   GSRLFRFAKQWINEKPEESHKLLQAITDVAVEFLAQQVVAGAQILQVFESWGGELSAGD
FT                   FDEFSLPYLRQIATKVPKRLKELGVEEHIPMIVFAKGSWYALDKLCDSGYNVVSLDWCW
FT                   DPKEAVKINNNRVVLQGNLDPGVMYGSDEIISKKTKTMIEGFGGGKKNYIVNFGHGTHP
FT                   FMDTEKIRHFLEECHRIGSA"
FT   CDS_pept        821998..823836
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194330"
FT                   /locus_tag="CAGL0H08393g"
FT                   /product="Similar to uniprot|P41815 Saccharomyces
FT                   cerevisiae YDR046c PAP1"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60097.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6773"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRI0"
FT                   /transl_table=1
FT                   /translation="MNSNDLLSEVKVSSSEDSQILSKSNDYVHEQNHIIEGDYDDDDKS
FT                   SSSHNLRSRFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIM
FT                   MSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSF
FT                   NAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFL
FT                   MFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFA
FT                   SSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLL
FT                   TMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVAN
FT                   SSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFT
FT                   WLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV
FT                   FAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLD
FT                   NHRKVYDPEFLRQEDLENKERLRNSSFLVKIYEFWC"
FT   CDS_pept        824631..824933
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432292"
FT                   /locus_tag="CAGL0H08415g"
FT                   /product="Similar to uniprot|Q04307 Saccharomyces
FT                   cerevisiae YDR045c RPC11"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60098.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniParc:UPI00003B6774"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH9"
FT                   /transl_table=1
FT                   /translation="MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVL
FT                   GGGWDNVDQTKVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN"
FT   CDS_pept        complement(825191..829423)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432293"
FT                   /locus_tag="CAGL0H08437g"
FT                   /product="Similar to uniprot|P22219 Saccharomyces
FT                   cerevisiae YBR097w VPS15"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60099.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058910"
FT                   /db_xref="HOGENOM:HBG204155"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015747"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B6775"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH8"
FT                   /transl_table=1
FT                   /translation="MGGQLSLLAQTAPSIGIFSYIDILDETHYVSQLNNSRFLKTCKAL
FT                   DPNGEIVVKVFIKPKEDSSLEKIIQRLKREAVLLSALPNVLNYSKIFESTRCGYLVRQH
FT                   LKTNLYDRLSTRPYFTEIETKFVVFQLLQALKDIHDLDVIHGDIKTENLLLTSWDWVVL
FT                   SDFCSNIKPAYIPDDNPGEFSFYFDTSKRRACYLAPEKFDSAKASGDGVHQATKEMDIF
FT                   SLGCCIAELYLDGAALFNLSQLFKYKSGDYTLNDILPQTISKSSPVLKDILQDMLQVDP
FT                   KKRLSAHELLEKYRTIYFPDTFYDFLYDYCKTLVTLGTSVPCADQIEVNTTLQDHLGSI
FT                   DEILIKIYCDFGRICKSLKLPVLDQEDMNYNTKDSFLRVSDKLLRLENYETDKITASIQ
FT                   NEVSLIILVFLCKEFRNLQFPENKVKALQLILAFSLFVLDDTKLDRTLPYLVAALEDDS
FT                   TRVKVMAMNCVTTLIKEVKHPNQLNENIFVDYLLPRVQALLQNGQEESLVRVAIASNLS
FT                   DLALKANLFQEYCHTMQSSTIPNIVHDFESIEVIRKYSRKLQQLFEDLTVSILTDPEIS
FT                   VKVALLKNILPLCKYFGREKTNDVILSHLITYLNDRDPALRMYLVECISGIAILLGPIT
FT                   MEQYILPLIIQTITDEEELVVVSVLKNLKDLLKTRFVNKKYFYDITKFLSPLILHPNSW
FT                   IRNFVLTTLVECINQMSKAEVYCVLYPVLRPFFDFDVDFTGDMLISCAKLPVSRNTYNL
FT                   LRSWNNRSKKTFFWQRVTTNYVDAFGNSTINFVDKRYVKENYGLKTMKVESNIHLHTNE
FT                   NENIPLTLEDKFWIDKFKNSGLTDNELWKIVALREYVVRSSRSSSKKPETVTSIVSKLS
FT                   LTPSNFSIENVMPNTVFFDIEFLHPETLTFNDLDVTNTNSIKESESNTFTDNHSKVIEM
FT                   KGSLIFKTPRIPTTLSNLKNIYVQLEPTNNHSEGHAHLSARNQPANFIVKSSYEGQDKI
FT                   IEKYLKQLNILPSLKEYKEFGFVSENTTAEADVINLHGKFVRSYPQIFDGTLLQSEVLL
FT                   GTKSFMIYGSDQGALTVWDIDRLANEKSITRPLYYECSAEITCIKGLSGYDSFCVGLKS
FT                   SEILIFRISLSKNGKAKNLQELICIRSLNLIGENSSEYPIQIECCPNNDQFQLVVLSNY
FT                   SNVYLFDIRTMKVIEKLELNADYGCTISMVLDDKNNLLFFGTVSGIIEMWDARYFVQIR
FT                   AWTFGESLPINKLAIMEQENKSLLVVCGGVDSAFFTLWNIEKLSCKHVFVRSNEQPSLD
FT                   SFNVIDADKLDKLAFEKNNSNIKPIVQIFNNKVLYMDDIGRLLHILDTRNPEKSSTFAG
FT                   SKVELHSFSVLQVTASLTMSLQKHNYQKEVNNSNYTSSRVMTVNVFQLKNKPYMLLTDE
FT                   EGYINIYT"
FT   CDS_pept        complement(829775..830455)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432294"
FT                   /locus_tag="CAGL0H08459g"
FT                   /product="Similar to uniprot|P38256 Saccharomyces
FT                   cerevisiae YBR096w"
FT                   /protein_id="CAG60100.1"
FT                   /db_xref="HOGENOM:HBG058911"
FT                   /db_xref="HOGENOM:HBG396171"
FT                   /db_xref="UniParc:UPI00003B6776"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH7"
FT                   /transl_table=1
FT                   /translation="MGILAILFIIYLVSSFKSLPGAYFFRFYYYTFGNIISPYFFGKDT
FT                   AIIKKLQSNKYGCFAYAELDTYASPFECDFYFHKSNSTYFEELDISRGDLMTKIFQKLF
FT                   INAKKWPYVPVANVFTNFLKEIKPFQKYAVKSSILCWDNKWIYVMSKFTTNNGKNLCSL
FT                   SLTKYVLKDGRKTIPPSEALEFCGLYNEEVEKISARNLEILTKQSGFHETSPIEQLDHE
FT                   YFRI"
FT   CDS_pept        831136..832401
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499730"
FT                   /locus_tag="CAGL0H08481g"
FT                   /product="Similar to uniprot|P38255 Saccharomyces
FT                   cerevisiae YBR095c"
FT                   /protein_id="CAG60101.1"
FT                   /db_xref="HOGENOM:HBG058912"
FT                   /db_xref="HOGENOM:HBG204154"
FT                   /db_xref="InterPro:IPR013904"
FT                   /db_xref="UniParc:UPI00003B6777"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH6"
FT                   /transl_table=1
FT                   /translation="MPPKEVKDTVKKSGRGRKSKEDAASLQFEQDCINAFTRRVLKEKA
FT                   GNYRPLKRGIDGKFIYPHASGVTTNRGNKLLQGSELISRNRLDTSRPLEEEKVFYNGSE
FT                   HRLLQSTRKRMKFPTIPQSESVLQTLPTDDPLEEDFDEINNLSKLVNVRELLTPISSLA
FT                   DICKRDSIKRTFNRTILKDLALNCILMIEKEQNSVTTYSQLLDVFLGDYPTPIYEKTLR
FT                   LPKYDHSLTLKEEDLEDGSQLELINSDTRNANDKDKQARVTMFTRKIPTHTYYDLLEES
FT                   KTQQDDKTDDEIAEEDSDPFFAVPNLALPESYQKLLPETASPRVLEEVENARQLVQIAL
FT                   QRNQEFIRNLQKIRGCIVKCNRIRERITSWSREYASIPEEGVTVPNALRAAKRGIISAT
FT                   TNRSMSVDEGVRDGQGDKEDEE"
FT   CDS_pept        complement(832642..834819)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347590"
FT                   /locus_tag="CAGL0H08503g"
FT                   /product="Similar to uniprot|P38254 Saccharomyces
FT                   cerevisiae YBR094w"
FT                   /function="ATP binding"
FT                   /function="hydrolase activity"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAG60102.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053941"
FT                   /db_xref="HOGENOM:HBG324223"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI00003B6778"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH5"
FT                   /transl_table=1
FT                   /translation="MKVLITNDDGPLNTQYSPYIRPFVQYILQNRPDWQITVCVPHVQK
FT                   SWIGKAHIAGKHLSLQFLYSKRDSTDDSYWGPYIEPQLRDSIELFPEQKVNEDIPADAI
FT                   EWILLDGTPASCVNIGLHHFEDKYDLVISGPNVGRNTSAAYITSSGTVGAAMEAVICDD
FT                   TRAIALSWAFFDGRKDVPNELMERASARSVDVIEHLVGNWSTQADLYSVNVPLIDSIGP
FT                   ETEAYYAPIWENRWTTIYNGPKINRPVNNDIEDGNESKMISFEWMPDFKGHRPSKHCDP
FT                   DVKYDMDIIEERRICVTPLRAAFHTVPDLVGKLDLGSSTTRSNDESVAVLTIPRNSYIY
FT                   EPLQQSIARHLHIPILDTLDAAPSGKGKVFQYGDYEDFDLDRVMDSQNYLVNSYIYRKA
FT                   IIRKHYLSHTIQRYVSKHPGSILKKAYMESYTIDLDYAEFLDDALDENWELRQELEKND
FT                   RWWIVKPSMSDKAQGIRVFKTIEDLQNVFDSFDEEDTDEEIDEETVDDNKIIISQLRHF
FT                   IIQEYMADPLLLPSMGNRKFHIRCYITCKGDLEVYVYDRMLALFAPKPFSALDSEEYSP
FT                   TDLDKLGCHLTNTCLQSDADKDLAVMEFGNLTDISREDKSKIIEQIHMIAKDIFLAALN
FT                   VDRMNFQPLRNAFETFGFDFLVDSSFNVKILEINAYPDFKQTGNDLKGLIYELFDDVVK
FT                   TCVAPFFQEAEEPQNISNFTKVLDTTSNVWE"
FT   CDS_pept        835080..835385
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043222"
FT                   /locus_tag="CAGL0H08525g"
FT                   /product="Similar to uniprot|P32830 Saccharomyces
FT                   cerevisiae YBR091c MRS5"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAG60103.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00003B6779"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH4"
FT                   /transl_table=1
FT                   /translation="MSMWLDPLAGQEVSAERMKLAEVQFEAMQTTFNNIMETCRKKCIP
FT                   RDEGFSESDLTKGEMTCVDRCVAKMHYSNRVIGAYVQTQRFSPERQLPHYEKFYPK"
FT   CDS_pept        836421..836702
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432295"
FT                   /locus_tag="CAGL0H08541g"
FT                   /product="Similar to uniprot|P11632 Saccharomyces
FT                   cerevisiae YPR052c NHPA"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAR57991.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG738370"
FT                   /db_xref="InterPro:IPR000135"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI00017BD8F1"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN11"
FT                   /transl_table=1
FT                   /translation="MSETRAPRRKTTRRKKDPNAPKRALSAYMFFANENRDIVRSENPD
FT                   VTFGQIGRLLGERWKALTAEDKQPYEAKAEADKKRYESEKELYNATRA"
FT   CDS_pept        complement(836841..837386)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432296"
FT                   /locus_tag="CAGL0H08547g"
FT                   /product="Similar to uniprot|Q03503 Saccharomyces
FT                   cerevisiae YPR051w MAK3"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAG60104.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B677A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH3"
FT                   /transl_table=1
FT                   /translation="MKIVYRPLDIGNLAHFEQLKRLIDADLSEPYSIYVYRYFLNQWPD
FT                   LTFLAFDADAVGQDGNGEDGIAGAVPIGCIVCKSEMHRSSRLRGYIGMLAVASAYRGHG
FT                   IAKRLVQITLEKMAEMQCDEVMLETEVSNVAALNLYEGMGFIRMKRMFRYYLNEGDAYK
FT                   LILPLTERSCIRTTFLNQ"
FT   CDS_pept        837576..840908
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043223"
FT                   /gene_name="ATG11"
FT                   /locus_tag="CAGL0H08558g"
FT                   /product="Autophagy-related protein 11 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG60105.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058913"
FT                   /db_xref="HOGENOM:HBG203964"
FT                   /db_xref="InterPro:IPR019460"
FT                   /db_xref="UniParc:UPI00003B677B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRH2"
FT                   /transl_table=1
FT                   /translation="MEYRCLDCTTGDTIAVDLKVFLDLKEFKSYLSNKWGVPRAQILLL
FT                   YPFGIKLKDSNFRHASDLESPEIYVYDRRLFSLTNEPHTGADAHADSDADADADTADVE
FT                   QQAAQLLDSLLEQRRHPQLQDDLIRPIPSPLEDLKIADGISHRTAVSMLTTNLGWLSAL
FT                   EIDVNYYSSISDKCKEDTQSLARCLGTCEQYLGLYCYDVERLYNSNVVFLDQLHENSLQ
FT                   SRWKECYKNTLTKLAGLNGYLSQYVDEAKQIEKEVTLKSLDGKVNSKLKQIKKELDSYA
FT                   DQRKSIQNEIENLKNIKDMKNDDNELHEMQKSFDSIADTVRKASRDILDKDDALFTDEY
FT                   ITQEVVPVMIDIQKKVKTLLTVSQALYENMHELLTHKRNFQIQIIVKLGQIAWIQLQIS
FT                   ELKQYLLNDCNADLTLYKDLEVEFAQIEDYPLIYGLYLVEKYRRQVWKCGMAKNMISIS
FT                   NDIKERSAAELTTRKNWYKNFGELSKPFNEDLTKYNDLDEISKLMNSDSQFLKEKFIQD
FT                   LRNEQRKLEDVIKSFIKNMHDLGLSKETTQVLEQSFKEASNSNICSQIDVTYDHRRINN
FT                   ENDLIKRYKIRIRKLESLLHEQGYSSISKWPSGVLNHTDRPNYFADNVSPAGRSLLVSS
FT                   SALLGLEPSASLKTDAEMFDLKKEIGDLSEKVTALEKDNKLKTDQLKITHSKLIDIEVE
FT                   KAAFRETLNHLNKELARLTVNEEDQTNLLKEERLRFKKEMTSVTVVNQNLMNNLDALQK
FT                   TFEDVELENAHLKSKLKELQQRQDQLIEDSANEKLEIKSKYEKLIKEKDENMGQAFAVT
FT                   NKAISGEQNKTESDIIHSSPYPEAILHLRTELFDIFSTNIYILENIGLLLTETSAGKFE
FT                   IKRVKGLKKGLSQSLLDESAQISPIDGVINSVVYKNIRAQYEQLPNDNNISNCELFISS
FT                   VKKIYENKLFESAVINRFKDIETLAKRLTKENKSKRILIDLYQNERLAVKDFRVNDLAL
FT                   FLPTKEALSETKSLSSSMASSFSSVDLSTPISGANNNITASRKSLHKPNVKHPWAAFTA
FT                   FNESSRYFLKDENMVTDNKEWFIGKITDIQRQVVENISTNNPFKLPKDTVWYLISAEMI
FT                   SID"
FT   CDS_pept        complement(841038..842903)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000173033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432297"
FT                   /gene_name="TAH18"
FT                   /locus_tag="CAGL0H08580g"
FT                   /product="Probable NADPH reductase TAH18 "
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60106.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269581"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI00003B677C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRH1"
FT                   /transl_table=1
FT                   /translation="MSSSKIAVLYGSETGNAQDFAAILSHKLNRLHFKHTFSSLADYKR
FT                   EDILRCRYLFIVCSTTGQGELPRNVYETVTGDQKNTLWTFLKKKKLPADFLNHIKTAFL
FT                   GLGDSSYPKFNYALRIIHNRMVNQLGAKEIFDRMEADEQSMAGSNKGTGLGIESVYFEF
FT                   EKRIITYLMDRFPTRKVGNEIIQREEIDKELYLEPITYLRIDDPHDQQSFSGGPTTFVG
FT                   DKLIKTGTITLNKRITAKDHFQDVRQFTFESCDDIKYKPGDTVALYSYNTDQSVERMLE
FT                   CQPQWIPLADKPLSFTNGIPTHLLDGGVVQPLTLRNLLKYHCDFMSIPRSSFFLKIWTF
FT                   ATDVTRMERGEEQMKDQRQKLYEFATDEDMQELYDYCNRPRRSILEVMEDFLSIRLPLE
FT                   YLLDFFPPIKPRLYSISSTANCNNIELTVAIVKYKTILRKIRTGVCTDFISKLKVGDKI
FT                   RYKIQQNDLIKEEYRSNPFVMVGPGVGLAPLLSAVRSKVSPEMSLYFGCRFKDKDYLHG
FT                   KELEDMANQGLIKFYPVFSRDRENSPDTKYVQDVLWKFGEEVTNLLVERKGIFFLCGAS
FT                   GKMPIQIRLTLLEMLKKWGGFKDDASAKEYLRSMEKEYRYIQETW"
FT   CDS_pept        complement(843298..844737)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043224"
FT                   /locus_tag="CAGL0H08602g"
FT                   /product="Similar to uniprot|P08425 Saccharomyces
FT                   cerevisiae YPR047w MSF1"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60107.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG023813"
FT                   /db_xref="HOGENOM:HBG747088"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI00003B677D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRH0"
FT                   /transl_table=1
FT                   /translation="MGSNIVVRLTPLRVVRNAIHKHIRLYSSIRQTVEINGKTYDTDEE
FT                   MTNITPSIIDLTDRSLHLKPNHPIGILRKLIEGKLNDGKKAYTAYDEFKPVVSVFENFD
FT                   SLGFPKDHPGRSKSDTYYINKDTLLRTHTSAHELECFKNIPKYNNDGFLITADVYRRDE
FT                   IDKTHYPAFHQMEGARVWNRSIKSDGTYDISESAPHIKKLKTDIRELEDILRNEKTNMI
FT                   VEDNTAREVNPKQEYMTDLEVDLVSQHLKRSIEIVVSEVFHKKIESMKALKGANDPSIP
FT                   KELKVRWITAYFPWTAPSWEIEVWWEGDWLELCGCGLVQQQVLINSGNKPDSTIAWAFG
FT                   LGLDRIAMLLFEIPDIRLLWTKDERFHNQFKEGKITTFTSYSKYPGSYRDIAFWLPEKL
FT                   KNEVQLQENDLMEIVRNIAGDLVESVKLIDDFTHPKSKKRSLCYRINYQSMDRNLTNAE
FT                   VNKLQSKVEEELIRLFQVELR"
FT   CDS_pept        complement(845036..845593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432298"
FT                   /locus_tag="CAGL0H08624g"
FT                   /product="Similar to uniprot|Q12262 Saccharomyces
FT                   cerevisiae YPR046w MCM16"
FT                   /protein_id="CAG60108.1"
FT                   /db_xref="HOGENOM:HBG253058"
FT                   /db_xref="UniParc:UPI00003B677E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG9"
FT                   /transl_table=1
FT                   /translation="MEDKWERVCALEREHVDLYTQLLRVLDELHLERSNSNHKVIIKDE
FT                   QENLMKVRRQMQCGLEESAAILRTLQRVNQLDKDGERSLEDLVAERLNSLMERHYSTET
FT                   ECMQIINARLDVSTKIFDEQKKFMKLREELQELDKLYGDQGLDAPAKPAKTAEQEQLER
FT                   ENETLRELLVALQVYSGSGVVL"
FT   tRNA            join(complement(845865..845903),complement(845795..845839))
FT                   /gene_name="tRNA-Leu (TAG)"
FT   CDS_pept        846457..847779
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066031" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043225"
FT                   /locus_tag="CAGL0H08690g"
FT                   /product="Similar to uniprot|Q12049 Saccharomyces
FT                   cerevisiae YPR045c"
FT                   /protein_id="CAG60109.1"
FT                   /db_xref="HOGENOM:HBG124881"
FT                   /db_xref="HOGENOM:HBG203962"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI00003B677F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG8"
FT                   /transl_table=1
FT                   /translation="MSYNQVTPIALGQRSKRKIVPKAEPKDDKKIEVQANKGKNVLKKP
FT                   PVANTNSVVNPAVSVFPQPNKVRPSRIAQKGPTKQNNTNGSNRTNKKLKSNEGKVRHPN
FT                   NNRTNSSGGLSETERRRKRAERFSKANNTISKNELEHEDNFSDLNSIGTKSHIFNKDQR
FT                   IVGRCQKLEKSYLRLTSEPNPEMIRPPEVLEKALEMLMEKYKNKEVNYTYLCDQFKSIR
FT                   QDLRVQMIEDSFTMTVYQEHARIALENDDLGEFNQCQSRLMVLYDNTTIKRTHREEFTV
FT                   YLILYYVLMQDYSAIDALKLELIRERGRSIKNAGIALAFEIAETRLVGNYHKFMKLCAS
FT                   LKGLGQKLIKAFMDQEILKTLVTICRSYNQVNLVFLTKELEFETADETIQYLKRKNLGN
FT                   YIVTKNLNMPNEFKYLDTKACRIEVIQAYAKLKKVDIKGQK"
FT   CDS_pept        complement(848229..849446)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499731"
FT                   /locus_tag="CAGL0H08712g"
FT                   /product="Similar to uniprot|P29366 Saccharomyces
FT                   cerevisiae YBR200w BEM1"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAG60110.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG124882"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI00003B6780"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG7"
FT                   /transl_table=1
FT                   /translation="MAIFVLQKEDTSPTLTKKRSIRDRQRQLNISPPMKHDNSVASWNT
FT                   LHRSASLNYKFYNVKQTYNPTETSSDITHLDPNELRDSNGTPLIDHYLHVTKGSLVQKI
FT                   SDMGDGMWYVKPINELVCGLVPASYLEEEKQLNCTLSAKPHAAKWNTSLIDLTPPTSPS
FT                   TIVSKTFSKASYSRKTSLSIESPRSKQDSFLAVKLITKCEVESIELKDNRLEYTVRIQD
FT                   SEGNTKVKHIYYSAFYKLHTKLMAGLKENMSLPNIPAPSSNYAQEKVDESTKLDRLQMF
FT                   NTYLTYLIDVIYDIKSPLHLQDTFTNWVNDIEPSSANQQIKIKILFQGDYYALKCTKSE
FT                   IDNLDKLHALLRSKIRALKDRTSLKMTAKLEGWYIVELTDEIMYRMILAKLNDIRRLAI
FT                   DVSLVD"
FT   CDS_pept        join(complement(852251..852252),complement(851585..851861))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043226"
FT                   /gene_name="RPL43"
FT                   /locus_tag="CAGL0H08734g"
FT                   /product="60S ribosomal protein L43 "
FT                   /function="metal ion binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60111.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG128467"
FT                   /db_xref="HOGENOM:HBG610728"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI00003B6781"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRG6"
FT                   /transl_table=1
FT                   /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKK
FT                   TVRRGAAGIWSCHSCKKTVAGGAYTVSTAAAATVRSTIRRLRDMVEA"
FT   CDS_pept        complement(853720..853968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432299"
FT                   /locus_tag="CAGL0H08756g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60112.1"
FT                   /db_xref="HOGENOM:HBG124884"
FT                   /db_xref="UniParc:UPI00003B6782"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG5"
FT                   /transl_table=1
FT                   /translation="MRGKAISEDQRVCTGVSERMYALNKSRGPLLPTSHKHKHKHKYKY
FT                   KHNSCENLRRGTDFGSTLRAAFRLWGLRRAISAESSD"
FT   CDS_pept        854147..857344
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432300"
FT                   /locus_tag="CAGL0H08778g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG60113.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG060044"
FT                   /db_xref="HOGENOM:HBG203961"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG4"
FT                   /transl_table=1
FT                   /translation="MDGNDIHNPRNDSRNDRIDRNERNERSESGDDLDESKRISYRSKK
FT                   ERFASTLNSILPSISAKFHSRKNVNTSSDAPTDVTESTGVDYDKSKDRYFMSDGTSVSD
FT                   YRTAFSSGYQQGSLYQGNNYDTMSNSSKDLNYTPITYASMETSPNYLNSQQIQHPGSSG
FT                   MPLISPQLQGHVNSMSLPQNSNSLNLKIGNMSAMTNNNLPIPAQPNNVWQSMNSNSTPI
FT                   SLPQSVPDPFEHSNPPVSGLNNTASLVNSGFDRERAHSFGSFQNGSSHYGSDMSLHYSL
FT                   NNNTASGYPALNAATQNIPAVTTSTNVTTSVPQMQQQEQLTPVVADDVDPALISWVSTN
FT                   INIPASNQTGFLLPTNTLCISNVFPLQTPGEYGNNNLSHPINLTSTLLASLCSQYGKVL
FT                   SSRTLRHLNIALVEFETVDSAITALESLQGKELSLLGFPCSAAFAKILSVSDGVGLGEH
FT                   TLSVKENSTRKPLLHEVFLNTALYQGSNSTFTLQSNLQPPVVISQPSKENISTKNASNV
FT                   HLSSADNDPCPFKLPPAILADKLDDFQDIIKKFNIKYDVDIVNHMLNNSLQKGPNACDV
FT                   NNFGPIPQQSVHRQFDAPKLRELRKAFDSNSLSQVEMEQLAIAMLDELPELCLDYSGNT
FT                   IIQKLYDNCSPIIVDLMLRESHKYLTSMGIHKNGTWVSQKIIKVVKTPRQMDFITKGIQ
FT                   DYCTALFNDQYGNYVIQGVLTFGFPWNSFIFENIMSNFWVIVDNKFGVRAVRACLEANG
FT                   HMSKEQELLLCSMIILYSEYLSTSNTGTLLVTWYLDSCTFEEKYAMIISSLIPHIVELC
FT                   SHRLGSLTVLKLLNLRIDQCVKDSILTAIFGDLNDNKPSENLIEILKDNHNGGSFLYKI
FT                   ISSRFLESERKSHLVEKIKIVLLNSNLAHQNKRLIEEVGLTSTGNGNGMSQPIRHRKTI
FT                   SYSHSHESARQSRDHTMPNRVSYPKSIVSAGSYLSPNGITGIGHNENISPDMALYLANS
FT                   SPNLLYGSRNSQTYQQVPELQDLSLQLEGMKIHNDQNYFGQIQSHTYDTTGMPGHDLLA
FT                   NRLDHDESGYNMSYNYR"
FT   CDS_pept        857901..858347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347591"
FT                   /locus_tag="CAGL0H08800g"
FT                   /product="Similar to uniprot|Q08971 Saccharomyces
FT                   cerevisiae YPL225w"
FT                   /protein_id="CAG60114.1"
FT                   /db_xref="HOGENOM:HBG022846"
FT                   /db_xref="HOGENOM:HBG314532"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniParc:UPI00003B6784"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG3"
FT                   /transl_table=1
FT                   /translation="MSLNTFDPNTAENSEDIEKQFAVVAVEQAETYWKLITSIPGSKLR
FT                   LTKLDDEIYELFMERFPEYKDIERLRKFDEEELKNKVAKERWRQFANYFEKKVEDFNFG
FT                   TLLRTDANAEYGQFTTCFVVRIQFYAFEIARNRHGLNDWAVGHQ"
FT   CDS_pept        complement(858891..860435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194331"
FT                   /locus_tag="CAGL0H08822g"
FT                   /product="Similar to uniprot|Q03218 Saccharomyces
FT                   cerevisiae YMR177w MMT1"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60115.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG395980"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00003B6785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG2"
FT                   /transl_table=1
FT                   /translation="MLRLSIPTLSNRALQSSHIIISNKRVVFSRIKLGYALQRYNFTTS
FT                   SIRNASNKADEDKIEEHGHGHHHNHDHGHIHTHNSVHDSEDSDHRHVHMKQSETEQNDT
FT                   YSIRSILKHSHTHSPKATYLGTPKAAKAPATHIHSHMHHHGHGHTHSHSGGNPLLVLSA
FT                   EEIRKNAGVRITWIGLGLNVAIAIGKFIGGIVFHSQALFADAIHALSDMVADFLTLFSV
FT                   DLASNKPSQKYPYGYGKVETVGSLAVSTILAMAGLSIGWTSICALVGPYVPHAIIESLH
FT                   QIGLANASHHHHHTVEEITKEVTDINAAWIAAASIAAKEWVFRATRKVAIETNSNVLMA
FT                   NAWHHRVDSLTSFVALITITAGHLFSIQSLDTIGGLIVSILILKAGVHGMTMSLRELVD
FT                   EAVPSSDPRYIEVETIIDETLAKLVTNNNSKIPYKIKELTVLPSGPNLRAHLTLTVPLQ
FT                   RWNNVLDLGEFELISAHLRKILSEELPSLIKIDIEYVEEVDEKDLIDEKNELEQKN"
FT   CDS_pept        complement(860942..862918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432301"
FT                   /locus_tag="CAGL0H08844g"
FT                   /product="Similar to uniprot|P18899 Saccharomyces
FT                   cerevisiae YMR173w DDR48"
FT                   /protein_id="CAG60116.1"
FT                   /db_xref="HOGENOM:HBG124885"
FT                   /db_xref="HOGENOM:HBG203464"
FT                   /db_xref="UniParc:UPI00003B6786"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRG1"
FT                   /transl_table=1
FT                   /translation="MGLFDKVKKAFDDNKGGDDANNNDNDYIKKAEGYLGEERVNQFKS
FT                   KIGEDNFDKLENTVRNQFSKTSIDDSDKKNNTSYSNDNYGDDSYGSSNKNQSSYGDDSY
FT                   GSSNKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNSYGDDSYGSSNKNKSSYGDDSYGSS
FT                   NKNKSSYGDDSYGSSNKNSYGDDSYGSSNKNKNSYGDDSYGSSNKNKSSYGDDSYGSSN
FT                   KNKSSYGDDSYGSSNKNSYGDDSYGSSNKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNS
FT                   YGDDSYGSSNKNSYGDDSYGSSNKNRSSYGDDSYGSSNKNKSSYGDDSYESSNKNKSSY
FT                   GDDSYGSSNKNKSSYGDDSYGSSNKNSYGDDTYGSSNKNSYGDDSYGSSNKNKSSYGDD
FT                   SYGSSNKNSYGDDSYGSSNKNKSSYGDDSYESSNKNKSSYGDDSYGSSNKNRSSYGDDS
FT                   YGSSNKNNSSYGDDSYGSSNKNSYGDDSYGSSNKNSYGDDSYGSSNKNKSSYGDDSYGS
FT                   SNKNSYGDDSYGSSNKNKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNSYGDDSYGSSNK
FT                   NKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNKSSYGDDSYGSSNKNKSSYGDNSYGDNS
FT                   YGSNRNSYGNDNYGSNQDSNNRY"
FT   CDS_pept        complement(864317..866293)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432302"
FT                   /gene_name="HOT1"
FT                   /locus_tag="CAGL0H08866g"
FT                   /product="High-osmolarity-induced transcription protein 1 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60117.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124886"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI00003B6787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRG0"
FT                   /transl_table=1
FT                   /translation="MSDAGDSKLAKEQSDASTGTCNGNGTGNGTGSGTATANATTTPTP
FT                   TPTSIPTAAGSVTDVTATSSMVLAKLDDISSRLTMLESNFNNVFSKINDQNSMILDLKQ
FT                   NNSHAFLRLSSKVNKLETHVAALASNNPQSAFVTDLLNSITNVSSSYLRKMKHNGAENL
FT                   NVQLSTHENGFVHPTPNDSPNMMGPIYYNQIETSKARGQLKSLNRKKTFTLNPNGIKKR
FT                   RLGHHHGNSGSRSNNLNVTFDITGQVGQPGYDTSLNSATPNNHAMTPSNVISSSNSYSE
FT                   LQSLNGLQSNTTASDGRTLSPVNTVQALKTPYLTATNQHSLNHGSLNNYNLNFPQFLDN
FT                   TNSVTLSRLGSSSPVEKRDGIVMSHSAPQLDNGSITYPDNRLHIRNQASQDILGGASQG
FT                   QPQKINNIDEDGYQEDDEEEESELNKHKNKVGNLKYNTTLTDSHSINDDRKPTVNVYAS
FT                   TGHPVNNTKSEYLEDDESNDSDNSHETDEESEDEVEEYDEEDDMVNEEDRQPYSRKPKE
FT                   PASERKRKKLRKINKYRNNVIEPRKKDDKEKDAQNSDLNYMLLKAPSSVKTIWEEYVNG
FT                   IDGNPSIRGLEEKYGNKWRIKRNKKTFSRRKRLYKFILNGIDKGKTADEMIDMLEKQRL
FT                   YRDENGEIKRRTIGWLQQSLIGI"
FT   CDS_pept        867213..869633
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499732"
FT                   /locus_tag="CAGL0H08888g"
FT                   /product="Similar to uniprot|Q08967 Saccharomyces
FT                   cerevisiae YPL221w BOP1"
FT                   /protein_id="CAG60118.1"
FT                   /db_xref="HOGENOM:HBG058898"
FT                   /db_xref="HOGENOM:HBG396900"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI00003B6788"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF9"
FT                   /transl_table=1
FT                   /translation="MLWCWLFMLLFGEALAKRSLYATSLVTCMENSQLQANSFDVKFNP
FT                   DDRSLFYNLDMTTSINSYVYALIDVYAYGFKIITKEVDLCNINWKQFCPVHPGNIQIES
FT                   IQYISEEYVNEIPGIAYHVPDIDAFAKVRIYSPENQYLACVQVFFSNGKTVSQTAIKWV
FT                   SAVIAGIGLLLSATLSTFGNSRAASHISANTMLLFLYFQSVVVVCMQHVHRVPPIAAAW
FT                   TENLVWSMGLIRVTFMQKIFRWYVQSTGGTPDLYLTSKTQSVLTQRAIDYIRSSTVYKR
FT                   AEEVLYGNQNTMIFRGIKRLGYQMKIEPTSIVPTGFTFFVLCGYLLAGVIIAAKYAIEL
FT                   CIRAGWMDKRRFFEFRQNWRLILKGAILRYIYIGFVQLTILSFWEFTQRDSAAVIVIAC
FT                   LFVVLSCGLMLWSIFRTYHYGQKSIRLYNNPAALLYGDEYVLHKYGFFYTMFSAKFYWW
FT                   NGVLLSYLFLKSLFVGFAQASGKTQALAIFIFDFFYTIAIIRYKPYLDKPTNVMNILIC
FT                   VVTSINSFLFMFFSDLFKQGYQVSAVMGWVFFILNAAFSLILLLMILTFTLLMVFSKNP
FT                   DLRFKPAKDDRASFQKTGLSNPFEDSPYSGDNMGSPSTFSSESPYNEKKKNRKYTAADE
FT                   LLALGNVAEDHDNWEDQIHNEKPEAQNGLMSPFMDVSEAGFMDNSSNSNTSASENEKKD
FT                   MPQRKVSFPGKIMRALSLRGYKDNYNEPKSSINKKAVLPDRNVEGTLDPSSNHDGFYDG
FT                   DNDFEREHTNPFDSDPENAFSTPDANLGRFDTDVETESFTFSLNRNSNNNNMQ"
FT   CDS_pept        complement(870096..871136)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499733"
FT                   /locus_tag="CAGL0H08910g"
FT                   /product="Similar to uniprot|P53122 Saccharomyces
FT                   cerevisiae YGL138c"
FT                   /protein_id="CAG60119.1"
FT                   /db_xref="HOGENOM:HBG124887"
FT                   /db_xref="UniParc:UPI00003B6789"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF8"
FT                   /transl_table=1
FT                   /translation="MMLHLVTLFILVVNKFSCGFIVPQMNHEQPSDIASLVCATRIEDE
FT                   RFPNIKKFLSQYFQAWQPGSNSGGYTGFKIYKHFLFQFLPPLVDNSIKVTFCRDGVSQW
FT                   TVTQNMQEDIDWNEFICIYDGKSNITSSLRTAAINDINNYHCFKLARRKKYVKRNYSFF
FT                   LPGSFIGGLYYCNLSKNQKIQILDSSTSNLVVLHSNPVPLCNENNTIPLLPLVSDDLRG
FT                   YWSYWYSKKSHNKVKEILNANVHKVVPYIHTYNFPSFEYNKTGSIPMFSVRELLFNLIT
FT                   ANELGLNGLKNGIRSWFYEVSVTEDYSNFDTKPIIVDVIINTVINVLGQAASTPHRALY
FT                   KIFKEK"
FT   CDS_pept        join(871668..871685,872089..874779)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432303"
FT                   /locus_tag="CAGL0H08932g"
FT                   /product="Similar to uniprot|P41811 Saccharomyces
FT                   cerevisiae YGL137w SEC27"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAG60120.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG029581"
FT                   /db_xref="HOGENOM:HBG330931"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B678A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF7"
FT                   /transl_table=1
FT                   /translation="MKLDVKKTFSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIWNYETQ
FT                   QEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIA
FT                   VHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDH
FT                   KVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVA
FT                   TLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLNLGLERSWCIATHPV
FT                   GRKNCIASGFDNGFTVLSLGNDMPTLSLDPVGKIVWAGGKNASVSDIFTAVIRGNEDVE
FT                   QDEPLPLQTKELGSVDVFPQILKHSPNGRFVTVVGDGEFIIYTALAWRNKAFGKCQDFV
FT                   WGPDSNSYALIDETGQVKYFKNFKEVTSWSIPVSYGVDKLFSGALLGAKYDGFTYFFDW
FT                   ETGSLVRRIDVDSKDVIWSDNGELLMILNKDSEQNEGSSGYSLIFNKDIYYEVSQQGEV
FT                   DETEGVDEAFDVLHELNETVTSGKWVGDVFIYTTSSNRLNYFVGGKVHNLAHYTKEMYI
FT                   LGYLPRDNKIYLVDKEIHVYGHQLSIEVLEFQTLTLRGELQEAMESILPNITEKDALNK
FT                   IARFLEGQEYYDEALQIATDKDQKFDLALKVGQLDYAHSVLTEDASELKWRSLGDAALQ
FT                   KFHFKYAIEAYEKSHDLDSLFLLYSSFNLKDKLSELAVQAEEQQKYNLAFDAYWTLGDI
FT                   KSIKNLLIKSDRLSEAAIVSYTYGLNDDEVLDVIKQWREKLVLDKGNDKLAARIGDLDN
FT                   NLPPRNINSAPLLDLDEKENTEKPQEPKKTKKNKNKKANKAENTKETPFDDKLETKPSE
FT                   AATKVEMKEEKPIDTVTAEVVEEETDEKEDA"
FT   CDS_pept        complement(875104..875949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194332"
FT                   /locus_tag="CAGL0H08954g"
FT                   /product="Similar to uniprot|P53123 Saccharomyces
FT                   cerevisiae YGL136c"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60121.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG266638"
FT                   /db_xref="HOGENOM:HBG398270"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI00003B678B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF6"
FT                   /transl_table=1
FT                   /translation="MIRMNLTLAIRAAHRTQNRCYSRASSKRWLDRQKQDFYTRESKLD
FT                   NLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRTHPDSIVLGVDILP
FT                   CDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVESMARNDSDTEQQPQFPVNII
FT                   LSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNSIDLCDAALITAVDLLEPAG
FT                   SFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEIYFIGKKKKKNVDKLNVFC
FT                   "
FT   CDS_pept        876668..877321
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207014" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432304"
FT                   /gene_name="RPL10A"
FT                   /locus_tag="CAGL0H08976g"
FT                   /product="60S ribosomal protein L10a "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60122.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316566"
FT                   /db_xref="HOGENOM:HBG529802"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI00003B678C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRF5"
FT                   /transl_table=1
FT                   /translation="MSKITTSHVRENVKELLKYSAETKKRNFLETVELQVGLKNYDPQR
FT                   DKRFSGTLKLPVCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLS
FT                   KKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVL
FT                   CLAVAVGNVEMDEDTLVNQILMSVNFLVSLLKKNWQNVGSLVIKSTMGPAFRLY"
FT   CDS_pept        877952..879595
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194333"
FT                   /locus_tag="CAGL0H08998g"
FT                   /product="Similar to uniprot|Q08966 Saccharomyces
FT                   cerevisiae YPL219w PCL8"
FT                   /protein_id="CAG60123.1"
FT                   /db_xref="HOGENOM:HBG124888"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI00003B678D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF4"
FT                   /transl_table=1
FT                   /translation="MMNDTDDESDFMELPLRHNGSRLLDSANDNFSELNEDLDGNLLHS
FT                   GEKDQSSSSLTKKVRFESNEGNDFNEQATITEHQGLAAMDGGPHQEEESNEFILHAPGH
FT                   IRLSDRNGIDSDLMLADRSQTSSTVSNKMDVEDLIRAASEVNEYMSQNLDKINSFRSEL
FT                   LSSTDFTRDNKLKDPSNHLNVENTSILANPAHNISGSLSNFELSDNEDSERDSDELRNY
FT                   VMNREILLSSSTSLGSTSDFGRKSYNSSTSLSKLLNNNNFEGSQLNLNSVQQELLKTQQ
FT                   FNDSIDIDVDQAITEIKQRKHSDHSARHEHEEVMDSSTVLLLKYIDDDINFEDVTIEKA
FT                   LEIYQQNLSQIMELSKSAVSKSDLTANEQNPEDHNDNEAEKRDEADNDESSTKKGDDIR
FT                   VEGPYEIESPAALNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDN
FT                   PDSNIRVRLKLRENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVSL
FT                   IMCIKNERLMITKQKLTASQKILDELQSAL"
FT   CDS_pept        880434..884210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347592"
FT                   /locus_tag="CAGL0H09020g"
FT                   /product="Similar to uniprot|P53125 Saccharomyces
FT                   cerevisiae YGL133w ITC1"
FT                   /protein_id="CAG60124.1"
FT                   /db_xref="HOGENOM:HBG059283"
FT                   /db_xref="HOGENOM:HBG204277"
FT                   /db_xref="InterPro:IPR004022"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="UniParc:UPI00003B678E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF3"
FT                   /transl_table=1
FT                   /translation="MVLYKRKPIELPRPKPLPSDLNVQIWHIDETGEWFPTYEEYLERL
FT                   DFYTRHQFTCEITGASCLTFFEALDSEESRFKYVEEKFPLKLREPVARFLHFHEIRRLD
FT                   VLVEKVYARFKNDYFPGELVYLRKPNSTASNANSTVPSETSTPAPPPPEDPKKSGESSA
FT                   TYFYPIRKYDQLTPPAHPYIIKEKVQFNANSDTNPDGKTGPQTKYMLIDEKDPHDSVIA
FT                   DETQIYRDRSTFTKHLIKCFFKITFQKASYKMGAPWCVKPEYLAMYGLTMDWPPEMLKY
FT                   KAEPGHVQTDDDGEESDRDRKRSHSGRHDSSDEGEGRKESKKKKKNTLKKEEPTEQKET
FT                   TENISTASDIEQSAQVQETPLLASAATTITSIVDDMVLPFQPLAQQVFDKLHQYNINLE
FT                   SLDVKETENDTAFPAFDKILQINQFLNTFGNKLYISNFTLEQFITSLKCSDPYELKGEV
FT                   VYVNLKKDQSEIDDDDLSDWKRNSKMRKMINSKNDEYVEYRIIKDDPADDEMIDNINSN
FT                   GSSLFVECFVALLRLIINENGDWTCLVVEEWVEDKDIMELPIKNEENSNNVEEIKEEDA
FT                   KSEDVDMIKQENSNEGATVKSEVSDVPNGTSNDNEKNYAVENGNSEISTNDQESLQEAE
FT                   EEKDQEREEEDDSESIEDILYKCLNYRNVNWAERLSKRQFNNNNWLLILLGVFEDCKHI
FT                   PMYTDIIQNMFQKILPKGVAQTQIPKQLWRNFCRNLTLKEKVDALWILVDLVSNYCSEV
FT                   RSFVDDAMELCGIIRSERFRVSKEIKNVSNSLYQSTIQLRELETIAQMGGQATTFTNIE
FT                   NLQIQPANGDTNEIKPAENGEENSSSQLPVTERIEKLKQELEELEQKLATLQNDKTILD
FT                   KQLMLNDGQRLRSLGMDRYGNKYFWFELFGQVLDTVPKSDDHNDWEGLSYQNGRVWLQG
FT                   PHKDAAKFFLDLSEEQITNWRRIAKQDGRVAATKEVFGVYTEGNKTLYNQPDGTLIVLV
FT                   DEEGNVNQDITLTPILRKIIDETPAALLLSEEQWYAVETYEDFDFMLNSFNQWGRKEHD
FT                   LIKQVRPVQEYIQDVYMIRNHNLKLSDLNETEQSLINELKEYEFNDTEHELMKGSDNPN
FT                   NTEGQLEKIEKSLDTIVQRVMELDDQGETDENKAELKTLEEERDRLLAEQDKLASNGDN
FT                   GGRLMARSEKKKMLVRIQTKVEKQMEILTDLINNRHFKAMEDVIAWKNDISLKVWGSEL
FT                   RRNASGAKKNTITETVAERFDEIVDLTSRIASQ"
FT   CDS_pept        884592..885755
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432305"
FT                   /locus_tag="CAGL0H09042g"
FT                   /product="Similar to uniprot|P38696 Saccharomyces
FT                   cerevisiae YHR129c ACT5"
FT                   /protein_id="CAG60125.1"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI00003B678F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF2"
FT                   /transl_table=1
FT                   /translation="MTDFSPDLLNQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLA
FT                   ERSMVTVSNKETYIGNSAYERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQL
FT                   QEHPVVLTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGH
FT                   RGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKER
FT                   CCVLSKDFYNEIRAYELITSKTSNNKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEI
FT                   PLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERLTKEIRKEIDGNQKIMLNA
FT                   PHERRFLPWIGGSVLSGLSTMKLLWKSKSAYREDKHFDFNTLYNNRM"
FT   CDS_pept        complement(886051..886701)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043227"
FT                   /gene_name="FUR1"
FT                   /locus_tag="CAGL0H09064g"
FT                   /product="Similar to uniprot|P18562 Saccharomyces
FT                   cerevisiae YHR128w FUR1"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAG60126.1"
FT                   /db_xref="EMBL:ABG43017.1"
FT                   /db_xref="EMBL:ABG43018.1"
FT                   /db_xref="EMBL:ABG43019.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG020849"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="UniParc:UPI00003B6790"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF1"
FT                   /transl_table=1
FT                   /translation="MSSEPFKNVYLLPQTNQLLGLYTIIRDKNTTRPDFIFYSDRIIRL
FT                   LVEEGLNHLPVENKDVDTHTSEVFNGVGFMGKICGVSIVRAGESMEQGLRDCCRSVRIG
FT                   KILIQRDEETALPKLFYEKLPEDIADRYVFLLDPMLATGGSAMMATDVLIKRGVKPERI
FT                   YFLNLICSKDGIDRYHAQFPDVKIVTGAIDKGLNEQKYLVPGLGDFGDRYYCI"
FT   CDS_pept        complement(887366..888061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194334"
FT                   /locus_tag="CAGL0H09086g"
FT                   /product="Similarities with uniprot|P38833 Saccharomyces
FT                   cerevisiae YHR127w HSN1"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG60127.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG124889"
FT                   /db_xref="HOGENOM:HBG203783"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6791"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRF0"
FT                   /transl_table=1
FT                   /translation="MARKDSGKYAGKSLIDRIGKVNGAGVNRKRAIPGPTPTGPKKAGS
FT                   AGFTVVNGKLVKADDIGVLLRAAGNSPRDVVKGKREVKKSIRSAKANSVKVPTKPKQST
FT                   SKAQKKMKSKPNVITPTNIPTFPVGTGNTLVISTNTDASDKSLVLYNLTLGVNQRNLQK
FT                   ILENLANVSIKRVKVRDLPSGSATAHVWLKKATIEELERVRKLFHGALVDGRTIQVMIS
FT                   SETSNNLTY"
FT   CDS_pept        889038..890636
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432306"
FT                   /locus_tag="CAGL0H09108g"
FT                   /product="Similar to uniprot|Q08977 Saccharomyces
FT                   cerevisiae YPL260w"
FT                   /protein_id="CAG60128.1"
FT                   /db_xref="HOGENOM:HBG174756"
FT                   /db_xref="HOGENOM:HBG395722"
FT                   /db_xref="InterPro:IPR018810"
FT                   /db_xref="UniParc:UPI00003B6792"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE9"
FT                   /transl_table=1
FT                   /translation="MSGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQY
FT                   LNSKDVLNTYQEVLTRVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQ
FT                   LLSLCFLTVGLKNSAPATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEK
FT                   SVESRPEDEVAEFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDI
FT                   MERLFKVRRGLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKM
FT                   EAMRDENGQFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYE
FT                   KLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILY
FT                   LLRRCYAIIYKLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL
FT                   ASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELKVEAEEREDEEDEDEEEDE
FT                   DDNVSHDRNHDEEYL"
FT   CDS_pept        complement(891140..894187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432307"
FT                   /locus_tag="CAGL0H09130g"
FT                   /product="Similarities with uniprot|P36044 Saccharomyces
FT                   cerevisiae YKL201c MNN4"
FT                   /protein_id="CAG60129.1"
FT                   /db_xref="HOGENOM:HBG059565"
FT                   /db_xref="HOGENOM:HBG202357"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniParc:UPI00003B6793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE8"
FT                   /transl_table=1
FT                   /translation="MLTNTVAAKVVVGLMVIVCLGYYNYHHAYSNLYNYRSDTSTALPA
FT                   DSVLSKADVSHDTTAYTKFPNNVVEDFHSTKADTVRSNSGKLLDLARRIYYKYKFDTSP
FT                   KWMDKYTLKKNLLRYSAGPKKGEPIPAISNLGFYDFDPRMTWSVYLHHFLSTATDDYED
FT                   DGEQVQFSWYDWTDFHEVNNMLAASVSSLPCNFVLESAFDREYIEMIEEENGEPLFSYD
FT                   RKKYSQASWYKMERKKADFHRRNKISDYCEPFNIGKHFGVNSSTLAGVDLTQDVFSRMQ
FT                   PPFYIKKPWDNLRPEVFQLQARIYMWSTLQPPLSITILDGMNNSFQIPINQTSRLNLAQ
FT                   NGMLQNFVNNRTEEKIEQMKKAKWQQDPNDIDVEFDHIELFEKFVNDDRIQKYKVKIPG
FT                   TNKHALQHDEFIELKEEDFDFDVKSKISELEELEREGMATKQDSMYLDSLKFSLNTPAV
FT                   LQPKYFAEARGVLQYNGLGHHRDRRFFYGDNLIHDTHEYALRLNSMIRTFQKFAIANGL
FT                   VSWLSHGTLYGYMYNGMTFPWDNDFDLQMPIRHLHLLAQYFNQSLVLEDPREGNGRYMI
FT                   DVGSSLVTRSHGNGHGNIDARVIDIDTGMYIDLTGLSVSYSRISDKLKLQIGHMISDQN
FT                   IIVEPKEEPVTDLESLKQIPLGLMTPLQLYNYSTAFKEQFSKAELRTLKENAEREIKDS
FT                   KGNGWAPRKLNPAQRLEFNKLMKAYNCKNEHFSLLSELSPLRNTLFHSVPALIPNRYVD
FT                   LLRHEYRVPAQYEFTVFQQNAFIPEFRSWLTYNAIRKYANIHHWYANLKSIIKSLPPNI
FT                   VKQFLGLSLSDVKTMYANMVKSHDDDLLALQFASFDLTSYRVKELGILYSKLTPILKTK
FT                   LLRELRRNVAPHISSPGKDAFMFNYERKLWKNVTESMDPTEVRIIEEWVMLDIYDNIVT
FT                   RTDDLMNEKYYLFNISEPVKNIDRSIFAAINPQNTTSTVLDFNKIGTNFFTSKDKSWSL
FT                   RSDNMLFRTDVNLVPGLFLVGATSQS"
FT   CDS_pept        complement(895722..898055)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347593"
FT                   /gene_name="PTK2"
FT                   /locus_tag="CAGL0H09152g"
FT                   /product="Serine/threonine-protein kinase PTK2 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60130.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124890"
FT                   /db_xref="HOGENOM:HBG202364"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B6794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRE7"
FT                   /transl_table=1
FT                   /translation="MTVATEKTPHKSSSMFKLFSNKLRGNNDSTPAAAPAPVPTKKLTK
FT                   AHTSAHISRSASTNTPHPLRNGVTGIPSASPAPRQMTRRSTGVTPTMVKSSKQLSTLTA
FT                   HNSNPFRNKNGTISSASHTHNGPTNSQHMVYNPYGINNRPTETQSSVRGSSYSRHGSGS
FT                   HISSGSASSTNNNTDLSFYMHDGDNKIRMLPLPIADPNEFLPDDIKQVSIHLSDNFSFD
FT                   KDNKTIGSGGSSEVRIVRSNYRSKDVYALKKLNMIYDETPEKFYKRCSKEFIIAKQLSN
FT                   NIHITSTFYLVKVPTTIYTTRGWGFIMELGSKDLFQLMEKSGWKNVPLHEKFCLFKQVA
FT                   QGVKFCHDNGIAHRDLKPENVLLSKDGVCKLTDFGISDWYHKENEDGTIEVKQNAGMIG
FT                   SPPYAPPEVMYWDAKKKYPTSMQKPYDPLKLDCYSLGIIFITLINNIIPFFESCNMDPK
FT                   FREYENSYNNFIRYQNKNFRQKGTYKPGPGSEYMLARRFKNADASRVAWRLADPDPETR
FT                   YTMEDLFNDPWFQSVETCVDVNDVNLVRHPQIKKTSSEGINLVNAADAHPIPSPMVGTD
FT                   TNGGLHSDSENPAGTHTTEESVETPKPASIRELHKPRSMVDIAESPMKKAATTPLFTLD
FT                   EEAKEERDHEQETNTTAEADNEKAQTVPTSAVDTNEFASKENATTTDNDNVNTKATTAD
FT                   PTTQQGAEITETGSIAGSISASISASITASMSGSVSGAATAPIPRRDPSNRSIHSNATS
FT                   TGTAGRKKKVVHHHMEVPGSAFQI"
FT   CDS_pept        complement(898883..901978)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347594"
FT                   /locus_tag="CAGL0H09174g"
FT                   /product="Similarities with uniprot|P24004 Saccharomyces
FT                   cerevisiae YKL197c PAS1"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAG60131.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG176616"
FT                   /db_xref="HOGENOM:HBG202371"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015342"
FT                   /db_xref="UniParc:UPI00003B6795"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE6"
FT                   /transl_table=1
FT                   /translation="MEAETKVVYSHDVKGNFVRLPIELVDAVEAANIQVQDVKVKLHGS
FT                   ELLTLGWDGFETTTNGTVEINASLAKLYSLKPGQIITTSIAKFTDEDVAIEVHLEPNSS
FT                   YDWDIIEGNSRLIQDSILFQTRAVTLQKPFICYLDSMIATFKVTRIVPENVKTVKLTDG
FT                   TLVVVAPKLNTKSKQKLKNSVPEKCKRLVKSRLCEQQENLEGLTVIIRGEPEKESEYGC
FT                   ISVKRKLHVKNKDPYLRQIPVRVCYSDLVAQEHVLIAPLVWQCLALTAANNELFELWIN
FT                   TINVQVASSPEDITLIFRPFGSNQHHHTSESKKKSEISQLLDQLKGSLIATDLVLTKQQ
FT                   CVLEIKSNNGEKVPVVDLKDLSHPLEKFLYLNSEPKDISLPPDVLHFSQLHDFGDINVE
FT                   PIQSVLEVLEEQLLAPLNPAPAFLVEGESGMGKTMLFKYLQRRLATQNQLNVMYIDCND
FT                   LLKYSSFEKLRRFWGGIISSCYWTQPAVILMDNADSVFPTTKSDDAQQQAQMQSPHSLG
FT                   NVARQTLVYLVETLTHMNTKSRGCVRVVLGAAKKYSLDAMFFDTHFVCETYSLKAPNRD
FT                   QRAMYLQGFCGTHGEGNTSAYGLCLDSRLDWADIAAETEGFSVRDLKMFSEMLYYRTVM
FT                   AQRLSQDGSGLVDQVVLDSCVKDFTPSSLRGVQLTKGTGVRWDSIGALQEAKQILLETL
FT                   EWPTRYAPVFAKCPLRLRSGLLLYGYPGCGKTLLAGAVAHQCGLNFISVKGPEILDKYI
FT                   GASEQNVRELFERAQSVRPCVLFFDEFDAIAPKRGHDSTGVTDRVVNQLLTQMDGAEGL
FT                   EGVYVLAATSRPDLIDAALLRPGRLDRSVLCDMPDESARLDILRAITREQPGGATQLRV
FT                   AADVDLAEIARGTRGFSGADLQSLCYNAYLKAVQRQLAHVSTTPTAEQKATDHMEYVVL
FT                   PGNDTTITADQIRKIVAGRKGYEAVSDYPNGTSGSSENSAQNPDIQAADLQEALQETKP
FT                   SVSATELARLRTVYANFASDRTGEMPAPHTDPADIGTKLSLM"
FT   CDS_pept        902895..903869
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194335"
FT                   /gene_name="VRG4"
FT                   /locus_tag="CAGL0H09196g"
FT                   /product="GDP-mannose transporter "
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60132.1"
FT                   /db_xref="EMBL:AAK51897.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG328976"
FT                   /db_xref="HOGENOM:HBG429711"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI00003B6796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRE5"
FT                   /transl_table=1
FT                   /translation="MSELKSRIGNSGSIANSGPVSILCYCASSILMTVTNKFVVNTDGF
FT                   NMFFVMLFAQSLVCTMCLMVLKMFGYAKYRPLNLIDVKNWLPISFLLVFMIFTSAKALK
FT                   YMPVPIYTIFKNLTIILIAYGEVLFFGGSVTPMELSSFILMVLSSVVASLGDQQAAKIA
FT                   QPLANNSILSPEYYWMFLNCICSASFVLIMRKRIKLTNFKDYDTMFYNNALALPILLGF
FT                   SFLSEDWSSENLAQNFSGESLSAMIISGMTSVGISYCSGWCVRATSSTTYSMVGALNKL
FT                   PIALAGLIFFDAPRNFLSIMSIFIGFASGLSYAVAKQKKVQKN"
FT   CDS_pept        complement(904209..905048)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499734"
FT                   /locus_tag="CAGL0H09218g"
FT                   /product="Similar to uniprot|P53078 Saccharomyces
FT                   cerevisiae YGL224c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG60133.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG338931"
FT                   /db_xref="HOGENOM:HBG502486"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE4"
FT                   /transl_table=1
FT                   /translation="MTIATDACNEHRLKVYREIKANEEHLNSLDHDGSKVTFVVDQEIP
FT                   EPDENLRVFYFDIDNCLYPSSTRIHDLMQIAIVNYFEKQLGLDKVHAEELNRTYYKQYG
FT                   LAIRGLTLHNGIDPMDYNTLVDDALPLQHILKPNLKLRETLIRLRECGKIDKLWLFTNA
FT                   YKNHALRCVRLLGIADLFDGITYCDYNHAESLICKPDPAAFEKAKRESGLGDFKNAYYV
FT                   DDSGSNIKTGLSLGIPKCAHLVEDKVLDVLGKTPEGSIVIKDITDLDKAFPELFQIN"
FT   CDS_pept        complement(905670..907598)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432308"
FT                   /locus_tag="CAGL0H09240g"
FT                   /product="Similarities with uniprot|P40549 Saccharomyces
FT                   cerevisiae YIL014w MNT3"
FT                   /protein_id="CAG60134.1"
FT                   /db_xref="HOGENOM:HBG124338"
FT                   /db_xref="HOGENOM:HBG202997"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI00003B6798"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE3"
FT                   /transl_table=1
FT                   /translation="MKPMNYRARKQFGRRAVLTVVVIFVLLYLSSSSSSPKAGNHVSDK
FT                   DAVDDPFRMHYEFGLYPASTFSPFSYINTRIMKLKEEKDDPKKAGKKTRTESEEDKILL
FT                   NWNKGSRFDQCRLLVKGFYTDEKWNNMNLVYAWSSKDYMEKTAQFAGECMRIYNYCFFE
FT                   GDVNPRELFKKLDLQATDAYDFQKRMFFFLKNVTQEDSDYLYPTIKNVRTGEVVSKPKT
FT                   KQSPQEFNSNFFANWRKIASGRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQVVHKGG
FT                   ELTRDNEISLKQFAEETDQNIYIVDAGPVLDKNFADEHITKFHNKWVGVLFNTFEEYIM
FT                   VDADTVPFISAEDFFESENFKKSGMRMWRDRTLTNRHIREHCPDLALKLEPSLEEHRIL
FT                   GTTLRFKLLDPDLKQEKTSEERAFNQMRTNLALHHVDSGLVVINKKEKLHSLLLSEFFQ
FT                   NHALFRRCSYGDKELFWYAAFSANTDYVIEPEDAATIGKLEYSEKDRRYSICAIQMAHT
FT                   DSNDQLLWTNTGLRNCKIPEVAKKDFDENPKMMTEKYGSLEVMKISYHAPLQIDGYLIP
FT                   DPEEHEWQQTHVCADYTYCGFVDELNIGYSKAKVHEFSDEEKKRLNKISKIWNNADVNK
FT                   ERNRIGV"
FT   CDS_pept        complement(908258..910135)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194336"
FT                   /locus_tag="CAGL0H09262g"
FT                   /product="Similar to uniprot|P40549 Saccharomyces
FT                   cerevisiae YIL014w MNT3"
FT                   /protein_id="CAG60135.1"
FT                   /db_xref="HOGENOM:HBG124338"
FT                   /db_xref="HOGENOM:HBG202997"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI00003B6799"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE2"
FT                   /transl_table=1
FT                   /translation="MKTLLRARNPGFKRCSLLAVIAICFLFIFMRADSASQRRSTRYEE
FT                   DLLFSSGNSTYAYFQRKVKELHDNKPFFSLENMLPSWMLSTHTAREKRVLLNWDKSSGF
FT                   DQCAMLIKGLYNDPNWDNMAITIDHDNATINDEVFQMSAERVRLYNHCFLQNSYDINEM
FT                   FEKYRMYYTSPHDYQRRMFPFLRKVTAMDGYYIYPTITNLRTGEVQTGPIADMSYQEFN
FT                   SNFIAHWKNEAKGRGIVVTASVNDCRFLRSQFFVWKELGNTYPIQVVTKGKEMPPELIA
FT                   KIKEYATEADQEVYIVDLQNVLDPNYAEKYIENFHNKWYAAMFNTFEEAILVDADVVSY
FT                   VHPDEYFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLGTTLKYRL
FT                   EEESLKDAGTSEADGLHKFFFEKSGSIVDSGLVVFNKKKKLHSLIISEFFHTDAKFKPC
FT                   TYGDKEIFMLGAYSAGVDYSLDPEAAVIIGPIRESTNKKFNSICSAQMGHTNGRGKLLW
FT                   SNGGLQVCKNPNFAKDDFEKDVKFMSNNYGTLEDTEKYYKSNLSIDGFISPNVPNLKFQ
FT                   QQPACHHYMYCVHMPVDGEDMGELVRFDQEQRERVNKISNVWNSVKINL"
FT   tRNA            complement(910652..910724)
FT                   /gene_name="tRNA Thr (AGT)"
FT   CDS_pept        911146..911433
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499735"
FT                   /gene_name="TIM13"
FT                   /locus_tag="CAGL0H09306g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM13"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAG60136.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00003B679A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRE1"
FT                   /transl_table=1
FT                   /translation="MALFGGSSSQAPASATDNKVQAFKQQIAQEIAVANATDLVNKVSE
FT                   NCFEKCLQSPYKDGNEGCVDQCLAKYMRSWNVISKTYINRIQDASTTGEI"
FT   CDS_pept        complement(911758..911967)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194337"
FT                   /locus_tag="CAGL0H09328g"
FT                   /product="Similar to uniprot|P22289 Saccharomyces
FT                   cerevisiae YGR183c QCR9"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="CAG60137.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG142113"
FT                   /db_xref="HOGENOM:HBG318018"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="UniParc:UPI00003B679B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRE0"
FT                   /transl_table=1
FT                   /translation="MSFSSLYKVLFKRNSIFVGTILASAFVFQGAFDTAVTSWYENHNK
FT                   GKLWKDVKAQIGAAGGDEEDDDDE"
FT   CDS_pept        complement(912452..918349)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347595"
FT                   /locus_tag="CAGL0H09350g"
FT                   /product="Similar to uniprot|P19812 Saccharomyces
FT                   cerevisiae YGR184c UBR1"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /protein_id="CAG60138.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG058077"
FT                   /db_xref="HOGENOM:HBG204417"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013993"
FT                   /db_xref="UniParc:UPI00003B679C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD9"
FT                   /transl_table=1
FT                   /translation="MDLQAVRMEVRETLNSIHEMNYFKGTRGPTERVKMSFTLKEFLYR
FT                   YLYYLICDEGKNLPQLFDTAPVGLFPKDLKEIKDIDLVWATKSNSFFTIDKEKVTKVHR
FT                   HSGRNCGRKFKIGEPLYRCHECGCDETCVLCIFCFNPEDHVGHHVYTDICSDVTSGICD
FT                   CGDEEAWNVPLNCKAELEEKNQESTGESNASNENTFMKPETTQLIEVILEEVIDHFIDV
FT                   FNQNLEPLPTFQHAISLKLKSHTQFGKIKERSEFLNDFKYKNFYNSAANYGETNENSSS
FT                   NENIPEENMDKDSDEVADDVASTGGVLQADKTSEDCPTEPKHYTVMIYNDEFHNYSQAT
FT                   TALRQGVPDNVHTDLLTSRIDSEGRAMLKCSMDLSSVMGGFFAVQTNGLTATLTSWDEY
FT                   IHQEACKHLIFWITHCLAIPDPDFQNTFRDALGKVLCSQYDSTKTVDMNPFINKHFEHL
FT                   FEEEGNHDCLNMSVLAPGNKIPLGKHKALSNDSIDKISTGINELIEIKDKNYTNSRVQY
FT                   LLYFDNRYWKRLRKEVQNMIIPTLSSSFTYKPYFCRQVVEIFNHMTRSVAYMDREPQLT
FT                   ALRECIVQLFTCPTNAAMIFNDGSFIDIVWSVFDIFAEFCKYDGPLLLWQRVQKSNPTK
FT                   SYSISFKQGLYTVETLLSKVADPNIPLRAPEFVSIVTLCKIFNGAWKLKRKEGEHILHE
FT                   DQYFIPYLEYTTSIYSIIQTIEKIMEQFKEQIDTNLLRNAIKLVNTFLAHRSLTYREVA
FT                   GTHEIIKFEVSREPVAYMNPVQTLFSFLIEKTSLTEAKEIVLRDCNDFLKISDFSLRAV
FT                   VLCAQIDVGFWVRNGVSVLHQASYYRNNPELNSYSRDIHLNQLALLWEVDDIPRILYNI
FT                   LDRWELLSWFTGETEYNNTVYEDKIGLVIQQFITFLYHLLTERRFFKNYASAKEKRFSQ
FT                   IKTSIMYSLYTKPLSYSKLLKNVPDYLSEDGTEFDKALSEVSTFMEPKGLADNGVFVLK
FT                   DNLYSKIDPLRLDNLENEFESSASIIKSHLATSKEDVNKTILVPQLIHPKHLDPLTMRL
FT                   GAFTRTGVFAKLMYKLLQVCLDTENGLFLNELLHLIHCVFKDDEQVNGKSSIPQNFISK
FT                   SICNLFLSIANAKSDIFSESITSKADYLLEVMIRKNPEDVFDSLITGFGLEYVDEYKTK
FT                   KLNQGVILEETEKEKKKRLAKKHQAKLMAKFNSQQSKFMKENSAVFDDKENELDMLGNK
FT                   ITASEDFTCSLCQDDTSDDFFVVPVYHDFSPAFREADVYSAEDYSGKVHGFFNDEEKAS
FT                   ATDATVLEDLRLNSEMGSRKVFVSCNHHIHHNCFRRYIQKKRFSSNAFICPLCQTFSNA
FT                   VIPICQTDKSEEALNLNSFGMPMPILDIVSRLFKNFTVSRYKSIHSIFNLILPQINSFD
FT                   KIIRKSSEFNDTDTSLIMAAHWANTISMLEISSRLDPPDTNSYIKGREQKFKTLGNILI
FT                   SMSLFYYIMGKPTNKLEIYDSSSESGNCYNQVLQYIVKSTLFENTPVKEAVSRVMFVLI
FT                   KQTVQSYFKCMWMNDSREDYQFSDMFKDGYEAPELVVSAIRQFENEYFKTNISKTREVH
FT                   EKDQAYYNIIYSFLLNQIVPSYKRVFIMLKVFHNLVKESEDQPLIIDDVNIESDISIED
FT                   YVSFANSATPLLTEFTDFDDMFVQALLDSKFTEGNDTYLKDIPHEYPGVVKLINLKKYL
FT                   NTYVTDSKQFKLLEEALTNVINPKNRLDFRICLTCGMKVHLRTDRREMSRHLTNCFSSF
FT                   GLFLMPNTSEVCLFLSQPPSNIFISAPYLNSHGEVGRNAMRRGDLTTLNLKRYEHLNKL
FT                   WINNEVTGYISRVMGDEFRVNILSNGFLFEITRGQRFPTRPTEIDEDNDFYDDEEIRDV
FT                   DMDDEDLARGANGIVGGPAAAAAAATTLFGFPNAAGAQGDVRDFFQIFEDFRDAVQNGD
FT                   NDEQDFRMDLEDTDGNTWQNQDQEDTDDEPEW"
FT   CDS_pept        complement(918777..919955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432309"
FT                   /locus_tag="CAGL0H09372g"
FT                   /product="Similar to uniprot|P36421 Saccharomyces
FT                   cerevisiae YGR185c TYS1"
FT                   /function="ATP binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60139.1"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG035376"
FT                   /db_xref="HOGENOM:HBG330667"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015624"
FT                   /db_xref="UniParc:UPI00003B679D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD8"
FT                   /transl_table=1
FT                   /translation="MDAEEQYEWITKNLQEVLNPQIIKDVLKEGRPLKLYWGTAPTGRP
FT                   HCGYFVAMTKLAHFLKAGVEVTVLLADLHAFLDNMKAPLEVVNYRTKYYEYTVKAILKS
FT                   INVPIEKLKFVVGSSYQLGGDYTLDLFKLSNMVSQNDAKRAGADVVKQVANPLLSGLIY
FT                   PLMQALDEQFLDVDVQFGGVDQRKIFVLAEENLPRIGYKKRAHLMNPMVPGLTQGGKMS
FT                   ASDPNSKIDLLEEPKKVGKKINSAYCSPGDIENNGLLSFVEYVIEPIQELKKGTGKFEF
FT                   FINRPEKFGGPVTYTSFKDLQTAFKEQQLMPVDLKIGVTDAINELLAPIREEFANSKEY
FT                   QEAEAKGYPQVVPEKTKKVKKPKNKGTRYPGATKTEEPKVEAVTEELKEASI"
FT   CDS_pept        complement(920468..921373)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432310"
FT                   /locus_tag="CAGL0H09394g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60140.1"
FT                   /db_xref="HOGENOM:HBG124891"
FT                   /db_xref="UniParc:UPI00003B679E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD7"
FT                   /transl_table=1
FT                   /translation="MSSESRIVGEFSEYLKEVEQRVRREIEAELAEKYERRLKELEAAA
FT                   EGHTRADSHVRADGNGVEVTEVQERGIEGGFSDKRRPSDEKDRHLKRIRGIKEWPEVVM
FT                   RLHKRPPSNATMLMWEELECLLIYLHTGVNITEQIKDNVCRVEAVRMAQLVCFTEITSL
FT                   EAKIQLVQEGYGKIRSKHVDSMLFSLVARFCPHIVLDANEELVGTYTKAITETDLLTQD
FT                   RDLFKDDYLANYTADLLSVQELLKQEQVQYNDWTVFLDACIPEKISDGVLRNSNNNLLP
FT                   WDCAVLEIFKRWGSSRMEAE"
FT   CDS_pept        921571..923823
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499736"
FT                   /locus_tag="CAGL0H09416g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60141.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI00003B679F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD6"
FT                   /transl_table=1
FT                   /translation="MLRLLTRLNVPVRAMRPMPLAPLARALPVTRPLALPLRFYSDMNS
FT                   RKQETGSGGSSDGGPAGDEGSGGKGQGQGKGPGKDPREEMMKAFWQYVKSKEFQNTMYL
FT                   TIGLSFIYTLMSANEDTSGRDPLTFQDFKAKYLEKGLVKKIYVINKYLVEAELVPLAND
FT                   SNGQYGANGMVPRVISFTIGSADVFEEQLDELQDRLQIPPSERIPVQYVERASAFQYLY
FT                   PFIPTVLLIGGLYFIAKKLNPNANMNGGGGSSGMFGVGKSKAKLFNKETDIKISFKDVA
FT                   GCDEAKQEIMEFVHFLKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAGEAGVPFL
FT                   SVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALGGANDER
FT                   EATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMSGRKAI
FT                   YNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQDKYV
FT                   ELLHFEQAIERVIAGLEKKSKVLSPEEKKTVAYHEAGHAICGWFLQYADPLLKVSIIPR
FT                   GHGALGYAQYLPSDQYLITEEQFRHRMIMALGGRVSEELHFPSVTSGAHDDFKKVTNMA
FT                   HAMVTSLGMSKEIGYLSYDQKGSGFQINKPFSEKTGRKIDLEVKRIVDEAHEACRKLLT
FT                   ENLEDVDKVAKLLLQKEAISREDMIKLVGPRPFPEKNEAFEKYLDNGLNGPAPATD"
FT   CDS_pept        complement(924130..925104)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194338"
FT                   /locus_tag="CAGL0H09438g"
FT                   /product="Similar to uniprot|P40013 Saccharomyces
FT                   cerevisiae YER016w BIM1"
FT                   /function="microtubule binding"
FT                   /protein_id="CAG60142.1"
FT                   /db_xref="GO:0008017"
FT                   /db_xref="HOGENOM:HBG023549"
FT                   /db_xref="HOGENOM:HBG622485"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR004953"
FT                   /db_xref="UniParc:UPI00003B67A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD5"
FT                   /transl_table=1
FT                   /translation="MSGIGESRTELLNWLNDLLKLNYKKIEECGTGAAYCQIMDSIYGD
FT                   VPMHRVRFNSTADYENQINYKVLQSNFTKHNIEKTVYVDKLIRCRFQDNLEFLQWLKKY
FT                   WVNNKDGTPYDAEARRNYRPISSTNSGTPGTPSGLSSASNSSSTLNISKRRNMSDSTSL
FT                   SRTQSLSTRYASGTSGNNINRRVTSEQIIALQTELSQSHNKIQEMEQEMGTFKEALTAM
FT                   EAENNFYFSKLRDIEILVQTTQDFIKEGLYKGDVEELDKFTNKVQHILYATIESASNEE
FT                   TKDTNESNRITTNNTSSGNIASQTLEGESLRSSNNLIIDEETF"
FT   CDS_pept        complement(925461..927686)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499737"
FT                   /locus_tag="CAGL0H09460g"
FT                   /product="Similar to uniprot|P39518 Saccharomyces
FT                   cerevisiae YER015w FAA2"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG60143.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG266050"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003B67A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD4"
FT                   /transl_table=1
FT                   /translation="MSFSVTELVETSPRYAELKKRLSGYKPGSDEYLRALMDTFPLSNH
FT                   PDYRKFLQAQAVPVPGSQAKGFSPVYRSILSTERLVTCMDKNLATYYDYFLFSARNWPD
FT                   NDCLGRRPYNDEKQDWEQYYEFDSYQRTLERSQALGSGIMTLVNTKRRRKLTDNKDLIV
FT                   AILSHNRPEWILTDLACQAYSLPNTALYETLGPETSEYIMNLTESPILIFAKSNMYNVL
FT                   KILPQLKHLNTLVCIEDLSDEELHMLNTSSLPNATNANGEKISVHTLSQVEKLGALNKI
FT                   PIIKPKPDDLYTISFTSGTTGLPKGVEMSHTNIASGLAFAFSTFRKNPDKAHRQLYDLC
FT                   FLPLAHIFERMICAYDLAIGAGLGFLHIPDPSALVEDLKILKPDNLALVPRILTRFEAG
FT                   IKNSFDKSAVSRAISGTIVNAKINRYSTKAGPDDSLVNSLIYKKVLINKVREQLGLSRT
FT                   DFMVTGSAPIAKETLLFLKSCLDVGVRQGYGLTESFAGICISEQDEKDVGSCGPIGISA
FT                   ECRLKSVPDMGYDAERDLKGELQLRGPQIFDRYFKNPDETNKAIDKDGWFSTGDVSYID
FT                   KKGRLHIIDRVKNFFKLAHGEYIGPEKIENTYLSSSPYITQAFVYGNSLQNFLVGILGL
FT                   DLESLRPQLMHSHPEIKSWTDEKLLDQINSDKKLRLVLLQLINRSCVGLQGFEKLHNIY
FT                   VGLEPLKVEDDVVTPTLKIKRQKASKFFKDILDDLYKEGSVIKAQKL"
FT   CDS_pept        complement(928384..928788)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432311"
FT                   /locus_tag="CAGL0H09482g"
FT                   /product="Similar to uniprot|P85052 Saccharomyces
FT                   cerevisiae YER014C-A BUD25"
FT                   /protein_id="CAG60144.1"
FT                   /db_xref="HOGENOM:HBG124892"
FT                   /db_xref="UniParc:UPI00003B67A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD3"
FT                   /transl_table=1
FT                   /translation="MKLTNLLSLVVPISVAMCIDSNNKEELHGYVQGYINELVEKHQGA
FT                   VLASIQAATDPENEQTIEFHNLQQGIDLDKNKEWTIGESHLKQVDDNILGVMIQKLYSM
FT                   AKTNLWKRFNLKETGLYYYSFTSTNIFEDL"
FT   CDS_pept        complement(929241..930857)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194339"
FT                   /locus_tag="CAGL0H09504g"
FT                   /product="Similar to uniprot|P40012 Saccharomyces
FT                   cerevisiae YER014w HEM14"
FT                   /function="binding"
FT                   /function="oxygen-dependent protoporphyrinogen oxidase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="CAG60145.1"
FT                   /db_xref="GO:0004729"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG193530"
FT                   /db_xref="HOGENOM:HBG395774"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B67A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD2"
FT                   /transl_table=1
FT                   /translation="MLSPLTALPKNAKVAVGGSGIAGLSFAYFLAKMRPDVSVTLYEKA
FT                   ARNSGWINSWQTKDKNGQPVMIERGPRTLRGVSDGTVMMIDAMKDLKSLDIVHFIEHNS
FT                   DADKKFLLDPNDKLVKVPDSFLSGIKFIMSDLGKGIIPAMLGEFWRKASANPGKDETVA
FT                   SMLDKRMGNEHLGKNVFSAIYRGIYADDINTLSAKKVMHKMVANELKFGSNTKALIHSM
FT                   KTKKDRKKNADSLTLILDKYTKVMGKEESKILELSKKLKHYPMLGFKGGLESFCQTLLK
FT                   GLESMPNVSVLNNSAITKLISDAKSDNNNITVEINHGKSTEKFDHVRLTGIPHRLGPLL
FT                   REIDGHIADSLETIKANTVVLVNFYLPDKDVIPKKNRGFGYLVPESNPNKEKLLGVIFD
FT                   SVIEQNLKNIENAQEMVSSDKKSYTKLTAMVGGYMYNDPATGEPVVPKDEQIIDAVRNT
FT                   LERHLGVSPNDLDRGLWQVTPANKCLPKYNVGYMDWQTDMEKKILKLFNNKVSIGGMGF
FT                   AIGPGIPDVFADGFQDALKLR"
FT   CDS_pept        complement(931276..934683)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432312"
FT                   /locus_tag="CAGL0H09526g"
FT                   /product="Similarities with uniprot|P24384 Saccharomyces
FT                   cerevisiae YER013w PRP22"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /protein_id="CAG60146.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B67A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD1"
FT                   /transl_table=1
FT                   /translation="MNKNDDDIESILGTKDPVVVEFVLRIAQESQDLNEFEKKFEALGV
FT                   VLETDKIQRLYATLTSTVKDDPISSISKVLDSELGISDNVVAEFILQIVKDSPNISTLL
FT                   KKLTEMNTGVPPIVAKKLFDSYNASQGQLTVKTKVRIKNEVDGLELPNETIKWEDIYDS
FT                   KDLLSMNFITEDEQPVLGKIYKGIIKKIMPFGCFVQILHLKKECGEGLVHISELCKNKV
FT                   RHPSDVVKQGQTVYVKISKIMTNGKISLSMINIDQVSGKEKESTDVDVESLKVRGRPGE
FT                   KQSNPIRKRKLTSPERWELRQLIASGMASIKDYPELLKYDQKEVVDHEGNNDKTEDQSD
FT                   NINEIEEIDIERNPNDRPKFLRKEGKKVSKKYELPKLSNNPMGSLNRAGSQGSKLMLQH
FT                   REEKLQKKKDIEEQIKQKRKIEDPTKDPLQIKKEIDDLRQQLTVTSWEKKKSREKVSYG
FT                   KKSAKPISAQRKSLPVYSMREKLMSEIKNNQFLVIVGETGSGKTTQITQYLDDEGFSKN
FT                   GIIGCTQPRRVAAESVARRVAEEVGCKIGREVGYTIRFENVTSDVTRIKYMTDGMLQQE
FT                   ALLDPILSKYSVIMLDEAHERTIATDVLFALLKKAAMKRDDLKVIVTSATLDSNKFAEY
FT                   FNNCPIINIPGKTFPVEVLYSKTPTMDYIASSLDCVMDIHTSEGPGDILVFLTGQEEID
FT                   TCCEVLFERAKEMGDKIDPLIILPVYSALPSEIQSKIFEPTPRGSRKVIFATNIAETSI
FT                   TIDGIFYVVDPGFSKVNTYSPRAGMEQLVVAPISQAQANQRKGRAGRTGPGKCYRLYTE
FT                   SSYQNEMLPNAIPEIQRQNLLHTILMLKAMGINDLLHFDFMDPPPKSLMVHALEELYHL
FT                   QALDADGHLTKLGQRMSLFPMEPTLARALLSSVSNNCSDEMITIIAMLSVQNVFYRPKN
FT                   KQQEADGKKARFHHPYGDHLTLLNVYNRWERSNCSEDFCNTNFLHFRHLRRAKDVKRQI
FT                   SMIFERLNLPITSCNENPEIIRKTLVSGFFLNAAKRETKSGYKTINGGTEVGIHPSSAL
FT                   YGREYEYVIYHSLILTTREFMSQISGIEPQWLLEVAPHFYKVADENSQSRKKTKIEPLF
FT                   NRHSKDQNSWRLSSKKQNREKALGMKKK"
FT   CDS_pept        complement(935231..935815)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188743" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347596"
FT                   /locus_tag="CAGL0H09548g"
FT                   /product="Similar to uniprot|P22141 Saccharomyces
FT                   cerevisiae YER012w PRE1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAG60147.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG020946"
FT                   /db_xref="HOGENOM:HBG317631"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI00003B67A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRD0"
FT                   /transl_table=1
FT                   /translation="MDIILGIRVQDSVILATSKAVTRGISVLKDSDDKSRLLSPHTLMT
FT                   FTGEAGDTVQFAEYIQANMQLYSIRENYELSPSAVSSYVRQELAKSIRSRKPYQVNVLI
FT                   GGYDTKKEKPELYQIDYLGTKVDLPYAAHGYSGFYTFSLLDHHYRPDMTTTEGLELLKL
FT                   CIAELQKRMPIDFKGVIVKIVDKDGVREVEQ"
FT   tRNA            complement(936248..936319)
FT                   /gene_name="tRNA Glu (TTC)"
FT   CDS_pept        937859..938569
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194340"
FT                   /locus_tag="CAGL0H09592g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG60148.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG049900"
FT                   /db_xref="HOGENOM:HBG429408"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniParc:UPI00003B67A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC9"
FT                   /transl_table=1
FT                   /translation="MAYSKTAILIAAAAALVSAQTPQQLDELNVILDDVKSNLSSYMSL
FT                   VQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDFDGIVPFLSKLPWYSERLA
FT                   GKLAKDLGEASSSAAPSSSAAPSSSAAPTTSSSAAPTTSSSAAPSSSKASSSAAPSSSK
FT                   ASSSAAPSSSKAASSSAKASSSAKASTTVVTSATKAAISQIGDGQIQAQTANGAGKVAA
FT                   GMGAGVIAAAALLL"
FT   CDS_pept        complement(939286..939996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499738"
FT                   /locus_tag="CAGL0H09614g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG60149.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG049900"
FT                   /db_xref="HOGENOM:HBG429408"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniParc:UPI00003B67A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC8"
FT                   /transl_table=1
FT                   /translation="MAYSKTAILIAAAAALVSAQTPQQLDELNVILDDVKSNLSSYMSL
FT                   VQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDFDGIVPFLSKLPWYSERLA
FT                   GKLAKDLGEASSSAAPSSSAAPSSSAAPTTSSSAAPTTSSSAAPSSSKASSSAAPSSSK
FT                   ASSSAAPSSSKAASSSAKASSSAKASTTVVTSATKAAISQIGDGQIQAQTANGAGKVAA
FT                   GMGAGVFAAAALLL"
FT   CDS_pept        942183..942890
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432313"
FT                   /locus_tag="CAGL0H09636g"
FT                   /product="Similar to uniprot|P40011 Saccharomyces
FT                   cerevisiae YER010c"
FT                   /protein_id="CAG60150.1"
FT                   /db_xref="HOGENOM:HBG178104"
FT                   /db_xref="HOGENOM:HBG324715"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniParc:UPI00003B67A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC7"
FT                   /transl_table=1
FT                   /translation="MTLEGYVVKLKDYGACDVSDGLLHYCKIDDGGFFPDLIQRSGPHK
FT                   TIVGPAYTVLFASVDDPRPEVNYIDNIPAGAFMIIALEKSLQEKPEQITQALYGGLMAN
FT                   RAQYQNSAGTIVFGRVRDLGEHKECGQPLFSLGVGTCAPKKAVKPVATNVSLPILLPNG
FT                   CTSAISPGDVLVADENGVVRIPKDTLLESGDKLINYIEQQIAADTLVMEDIRNGIPAKQ
FT                   SQKDRRAALKQLL"
FT   CDS_pept        complement(943088..943465)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432314"
FT                   /gene_name="NTF2"
FT                   /locus_tag="CAGL0H09658g"
FT                   /product="Nuclear transport factor 2 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60151.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG061558"
FT                   /db_xref="HOGENOM:HBG319937"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI00003B67A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRC6"
FT                   /transl_table=1
FT                   /translation="MSMDFNALAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETSQLQ
FT                   GAKSIVEKLVSLPFQKVAHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFH
FT                   LIPDGNSYYVFNDIFRLNYSA"
FT   CDS_pept        943940..947986
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043228"
FT                   /locus_tag="CAGL0H09680g"
FT                   /product="Similar to uniprot|P33332 Saccharomyces
FT                   cerevisiae YER008c SEC3"
FT                   /protein_id="CAG60152.1"
FT                   /db_xref="HOGENOM:HBG124893"
FT                   /db_xref="HOGENOM:HBG203741"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="UniParc:UPI00003B67AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC5"
FT                   /transl_table=1
FT                   /translation="MKSARSPFKKFGHSRENSTDETKNGGHKRTASGHSGHKSHSRQPS
FT                   GSNIPPVAGNNNTNGHKHNSSRASNSSQNSNFLADQYERDRKAIIKYCFSKPDPKTGVP
FT                   PNNYITHVRIIEDSKSPNMRPPPDSKLENKKKRVLIVSSKANNTKEVQLHKARENSDKS
FT                   FQIGRTWTLKELVKIEADSVVPEGFTFTMGKVYYWETNTAKERTVFLKSVVSLYIQTFE
FT                   GKVPELINLDLSLFYLDEKSYSRAVITRSPSSSLPSSPLRATPNLGASHGNSGIQQLQQ
FT                   AAVTAPAAIPPMNKDRVLKGSNVTPINTSISNVMTMDPPMRSPNRQTSRLSNDTGGLSK
FT                   SPYANNTTINDVHRNYGAPAHSIKSDRQDSLVDNSSGKFSNSELGSDKVIANSLSKNST
FT                   NDKEGNEMVSQHSRESKGFKLPSEKRWSSNLPDDDSRPDFDDSEYNKPPQNRPPDLTNP
FT                   GMPEYLDKQNNSLRDRPKDNLLEDLNAVLASDDFKAPKTAMYANEDLNSSVISEDGVAP
FT                   LNLAEVIPLQTKSVEALAEPIDLNESPRMTDDYPIREDVTEDMTESYLDDTKEDTTEMS
FT                   FEKNDEVRYSHGYEPQIEHVYHEVSTIQEEPDLAKVPARNTDRLKKVDEVPPINVNIND
FT                   EALMEILTDIHWDVENDDADTLLEKVNTNLSKTEYMFNTSLLTLSKLSNNLQPYETNVN
FT                   KACDNINPTFSLFLMEMSNCSEDIDYVESQNNGLQIESANKKQLWSTLDNLLKIVSLDE
FT                   ETLNKLLNCPIREKNLPWIEEQLDAMCKAYNAIEGAKNNDESNLRDLEALRQRREFYER
FT                   VTKLLIDRMVDELGRRFSNLHNSSTSSEQVMNILNNLLVFSPLILFCKIMSPESYEKLL
FT                   ELWNANSQAIHKTIWDKEFAKLDKNEIMELKANHAILMEKGTEQLLKQWKHFKTTRKTT
FT                   TDEPIYGDILVSVLEMLESLQKQCIYYQNFIDLYFHISSTQNFTEAIKAKYSPEYNHSL
FT                   LASIHCIESDREAAVKKMDIVSKAFQSVVTSISVKISDILKEENSVAPALMLYLEQKIK
FT                   ELESTNQDYLSSAYNRLLAQINQSWSEFLEESLVQMERSFHGASLSDALTVINNTAVYM
FT                   KNIQDLFEYIQSQMKIENTNTFDTVSIVETGCTTLTLRVSKILDRKNDGGSIISGIQGN
FT                   NSQEDIENTIALIINSNSMVEFLMVLNNYMGGILESSLQESKNIFDCEKEIYAAYILRE
FT                   TMPKLTSFVNGATNMLNTQSAMNNARFAAYSKHNLQNILAGYSSKDIGVIIEKFHQRII
FT                   EQFNPNGELNPMEIVLCDKLWSCLQGNTVSLYLKLQTLIEKVYPGVSAKFTKNDIISAF
FT                   EKYRK"
FT   CDS_pept        complement(948066..949553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499739"
FT                   /locus_tag="CAGL0H09702g"
FT                   /product="Similar to uniprot|P39937 Saccharomyces
FT                   cerevisiae YER007w PAC2"
FT                   /protein_id="CAG60153.1"
FT                   /db_xref="HOGENOM:HBG190992"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="UniParc:UPI00003B67AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC4"
FT                   /transl_table=1
FT                   /translation="MVMCAKFKVGDRISYSDYNCTILYVGEISVWPGEIAYGVEWDDDT
FT                   RGKHNGKLGGIQYFNTIRPKSGSFLKVSKVDVSADPRRSFYDGICEKYGNTASDQFNVN
FT                   IGTKMVEQLGFDKLNLINKRWNSLGIIDLSSAKIFCAGDNPSTEPITTKDLDLSRNLIT
FT                   DFKEIAKILNNFKSVACLDLSENRFLRFLFDKTIKFCTVKTLKIRSCYLSMNNLQDILA
FT                   VFPNVQNLDISGNRLYGNDLANIHLILPNLKSLTVSNNCITNIDLSKLIYLTELDISST
FT                   DIKIQLSDIKSNSITFLNMTHIRLDSWTLVDKINIMFPSLCEIRCSLNWLPPIDAQFPD
FT                   SKLFILIAILRHINIINGTIIDRRMRKDADYYLECKLKEGALKLEGFTLRMKELVKKFY
FT                   NTIETVENHSWLNTNIITISLIIYFDELMHSKMKIYDKYSIRYLKGLISDEFNMKYYQI
FT                   DIKYESTPGVLIPMSREFSPLSDYGVANGGKIHVNLM"
FT   CDS_pept        complement(949913..951472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499740"
FT                   /locus_tag="CAGL0H09724g"
FT                   /product="Similar to uniprot|P40010 Saccharomyces
FT                   cerevisiae YER006w"
FT                   /function="GTP binding"
FT                   /function="ferrous iron transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60154.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0015093"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG285492"
FT                   /db_xref="HOGENOM:HBG397932"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR014813"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00003B67AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC3"
FT                   /transl_table=1
FT                   /translation="MRVRKKTSKRTSTRMREGIKKKATAQRRKEKKMAKKDITWKSRSK
FT                   KDPGIPASFPYKAQILEEIEAKKMREMEERELAKQQRLEAKRAAMEAGVTEEMMDDDED
FT                   DSNGLSALVESAQAAAEEYDGHPYSEELQSQPVDVIDYDIDFYTDADNDNDSELEKSRK
FT                   AYDKIFKTVVDASDVILYVLDARDPEGSRSRRVEQAVLQSQGKRLLLILNKIDLVPPHV
FT                   LEQWMNVLKSSFPTIPLRAAPGATNKSTFNKKLTQSATANALMDALKTYANNSKLKRSI
FT                   VVGVIGYPNVGKSSVINSLLSHRGGTSKACPVGNQAGVTTSLREVKVDNKLKILDSPGI
FT                   CFPGENRSMSKVEQEAELALLNALPPKYEIDPYPAILKLVKRIAGSDEMTENFKKFYEL
FT                   PPIPSGDPETFTKHFLIHVARKRGRLGKGGVPNLSSAGISVLNDWRDGKILGWVLPKAS
FT                   KNNTIEPSVQESTISSGAQPAPAKSEQTTIVSDWSKEFDLDGLFSTLDNAIQDSKDQAM
FT                   QD"
FT   CDS_pept        complement(951805..953709)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194341"
FT                   /locus_tag="CAGL0H09746g"
FT                   /product="Similar to uniprot|P40009 Saccharomyces
FT                   cerevisiae YER005w YND1"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG60155.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG190991"
FT                   /db_xref="HOGENOM:HBG397253"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniParc:UPI00003B67AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC2"
FT                   /transl_table=1
FT                   /translation="MASKQYGIVIDAGSSGSRVHVYEWDDPNVLRESENSTPALLRSVP
FT                   EIRQDPSWTKKISPGLSSFEHKPGKAFKKHIKSLLEFAEDIIPENKRKETPVFIQGTAG
FT                   LRLIPEDKRTKILHEICNGITKHTDFLLEDCDYQVQVIDGETEGLYGWLSLNYLLGKFN
FT                   EYEVNANSHFTFGFMDMGGASTQIAFVPSSADDIAKHKEDIATVYLKNVNGDVQEWNVF
FT                   VSTWLGFGANQARNRYFAQLVNALPENTNKYDDDDFTTRKLTDPCTPKGAKIKFEFKDK
FT                   EFQILGSGNYEQCSKSIYPLLLKNIPCSDEPCLFNGIHAPHIDFKKDRFIGTSEYWYTA
FT                   NDVFKLGGEYNFQEFNEQVIKFCNSDWQTLKNKSDNGAFNGMPQNLLKDACFKANWVLN
FT                   ILHEGFELPRLGFEKELSQEIEEETPIFQSLERINERELSWTLGRILLYATSTITAGSK
FT                   SITAGVLPSSLEMEKLGKTFSPGGLIGNSSFYHSKSSHFLRSIFLFLMVIVLLYAFVFK
FT                   NKLRRLINSSKILEYNSEFISSVKSLFRGAPAFEDKLSQLEEGLPNGRAFREQFEMNPS
FT                   PSYSRTGSSSRRLEREIYKTGKSPSSSHLSSPSVPGTATRTAFSISDFGKFKDERFTE"
FT   CDS_pept        complement(954112..954813)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000258441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432315"
FT                   /gene_name="FMP52"
FT                   /locus_tag="CAGL0H09768g"
FT                   /product="Protein FMP52, mitochondrial "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG60156.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="HOGENOM:HBG199800"
FT                   /db_xref="HOGENOM:HBG564164"
FT                   /db_xref="HSSP:2FMU"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B67AE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRC1"
FT                   /transl_table=1
FT                   /translation="MSKQTAVVLGATGLCGEHLLKSAVASQAFEKVYSISRRSLPYVAD
FT                   CEQIVDKDSSSWASLLPKENFKFLFTSLATTRAAAGGFDKQYQIDHDLNLELAKASKAN
FT                   GCETIVLVSSTGANKNSWMPYLRMKGEIEEDIIALNFKHTIILRPSALLGDRRDHHKGF
FT                   GNDLFVKIGNCFYRSRLQSIMGYPVQGEEVGIAGVQAALQEAEKNTESPTVRYVGSSEI
FT                   LELVDNFKNNS"
FT   CDS_pept        complement(955495..958446)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194342"
FT                   /locus_tag="CAGL0H09812g"
FT                   /product="Similarities with uniprot|P40317 Saccharomyces
FT                   cerevisiae YDR006c SOK1"
FT                   /protein_id="CAG60157.1"
FT                   /db_xref="HOGENOM:HBG059039"
FT                   /db_xref="HOGENOM:HBG203119"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniParc:UPI00003B67AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRC0"
FT                   /transl_table=1
FT                   /translation="MDNPRTHTRTRHSSSTATPKSTVPPPVSLTSTSSSLLNTSSNSAG
FT                   SVTSGDSDKGVDAGIELKEEPSSIITAGTRDSDIDRQQFEMAMRTHEDMYGSEDIGNHD
FT                   HSNSSTDLPDTEMSCGDEDINMLDKPQQRQGITKKFKSNQDNETENTDGLGFPNSVSNQ
FT                   DRNNLNEDVDMKDYMSTAVPSQQLNSVTPLSKLVDQEVQQSQEQHNNKNIFKPFDMKTG
FT                   QFLRVDSNSNEQESTTSANNRSNESHQGSITKENNISPDDLSHTERTDTTDKHNKNSAL
FT                   QLNEDNVNSKPTNDTPVVLTDFMNHHNSHKVRSHSVPTILHSSLRRMTTTNIPVVNKDI
FT                   YPFKTNAAYHQPSTKATNFSKGGIIISKDSAGEGVYQKNMDERGLKADNMTSSSMVALR
FT                   KAMILSQQFHNETSKRNITENEMLLPTTSLDERIEYLKRTRDVIPLPPINLQGLKEIDL
FT                   HEIMKNPQLRHDIIFDPLLQFRPNLDGERGVKKRQLAAKYWSDVENEIIVYKERPELFE
FT                   YGKTRLVPLFDTLKEVLLTIVPQKEATTINNVLDTELNMQELLKGSLVMTNLSEWLAEL
FT                   FKRHCAPMRDAWVDKMSATFKEAETENSLSKLIDGLRIVFQILETMKLDIANHQIRILR
FT                   PALLSNAVEFEKQYFNTLMNSKRIDLVGSLKWFSQKFDSYVKNNEFNENNIQIPDVYRI
FT                   CIKSIISLLSCRKMVREYPTSLSFDHARLILLRADIRQIVCLQVCRLLFQQLVANDNSI
FT                   DKMAKSYIINKYSNKLLVNDIVSIITDDHGNCRWTKNTLSIAVHLCKVISDLKLEYTNN
FT                   AKGQGSIANTRSAASTKLDTNKINFAKSWLGKQTQPLSDVYGVLENRIFKLLEDGIYRR
FT                   SSCTLEGRVKQDFVYLYNANPSQNTEGDTSAMENSGQTLNIDSKVKGIKNSSLFAYPLT
FT                   DEMRRNMATYAVTEMEEFGNVFRHLYTVVNLHWSVFGMHYADCLGDKIAKKGI"
FT   CDS_pept        complement(961286..961597)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499741"
FT                   /gene_name="HHF2"
FT                   /locus_tag="CAGL0H09834g"
FT                   /product="Histone H4"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60158.1"
FT                   /db_xref="EMBL:AAM74210.1"
FT                   /db_xref="EMBL:AAM74216.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG210755"
FT                   /db_xref="HOGENOM:HBG385452"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="UniParc:UPI000006A8C4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIG3"
FT                   /transl_table=1
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   mat_peptide     complement(961289..961594)
FT                   /gene_name="HHF2"
FT                   /locus_tag="CAGL0H09834g"
FT                   /product="Histone H4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIG3 "
FT   CDS_pept        962788..963198
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499742"
FT                   /gene_name="HHT2"
FT                   /locus_tag="CAGL0H09856g"
FT                   /product="Histone H3"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60159.1"
FT                   /db_xref="EMBL:AAM74211.1"
FT                   /db_xref="EMBL:AAM74217.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00000009B9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61833"
FT                   /transl_table=1
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   mat_peptide     962791..963195
FT                   /gene_name="HHT2"
FT                   /locus_tag="CAGL0H09856g"
FT                   /product="Histone H3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61833 "
FT   CDS_pept        complement(963767..964630)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432316"
FT                   /gene_name="IPP1"
FT                   /locus_tag="CAGL0H09878g"
FT                   /product="Inorganic pyrophosphatase "
FT                   /EC_number="3.6.1.1"
FT                   /function="inorganic diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="phosphate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60160.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006796"
FT                   /db_xref="HOGENOM:HBG355416"
FT                   /db_xref="HOGENOM:HBG434750"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniParc:UPI00003B67B0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FRB7"
FT                   /transl_table=1
FT                   /translation="MVYTTRQIGAKNTLDYKVFIEEDGKPVSPFHDIPLYADKEENIFN
FT                   MVVEIPRWTNAKLEITKEETLNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWEDP
FT                   NQTHPETKAVGDNDPVDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKVIAIDIND
FT                   PLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALDIIKE
FT                   TNESWKQLIAGKSTDSKDIALENTKVTDSPYYSASAASAIPAAAPQADAPIDKSVDKWF
FT                   FISGSA"
FT   tRNA            complement(965445..965518)
FT                   /gene_name="tRNA Val (TAC)"
FT   CDS_pept        complement(967366..970713)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499743"
FT                   /locus_tag="CAGL0H09922g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /protein_id="CAG60161.1"
FT                   /db_xref="HOGENOM:HBG124894"
FT                   /db_xref="UniParc:UPI00003B67B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB6"
FT                   /transl_table=1
FT                   /translation="MFSFSSKSKIDRFTEQPVSFKEKFLSKKARFKEFVKTKVFNRTPS
FT                   PPLIEFSEEYLFDCYAPFDLEAQIKRDPALTILSRKVKNKCYSIRDYKRKVFNGSARTF
FT                   FKDKASLWAGWSTDSEIPVSNKYTAAYPSPVNSSDDTLPVLAPIDAFSILAATKTAETD
FT                   YQYLANDCYVHSNRGVENAAAISVNAKCSEVDLRNFTDSQDERFVPMQEAFEKSVSMEE
FT                   QFFADISTDNIGLKPAETINATDIGSFFKDASNIDTWKSTVLKPITNVVNNNNNNNNNV
FT                   IKNVTFKDSNHDLTFKSDDHIVVATHEDSLGAISIDVIAATNSIDPGVVVNHTYSDDDS
FT                   IDYLTSLRRTHEENHDTTDNNSEFVIEGFQESKTKIHEIDETPADATAEEASYDRRTNN
FT                   ELVGNSGSLRKFGNLHTDADDTTSFLDSTISDIAADEDVFSFEEVEDQEEESTKSDSNG
FT                   VRTHMLNSLPAISEDDAEGLKASSDTSEVTETCPTTQFNCNILNNKDPQNRSTDLSHSI
FT                   IIANDSQYLSPCRSQNSLVIDILEEDSCAEETSFKYSDKGQETGDNCSANSCIRVNDNI
FT                   LNLEESENSILIIQEECQFTHVTKASQSISSHNVENSLKRQGSDIEKSDSTDGETNIKN
FT                   PLLKRQRVSSEETVLDEGYYSVQAPNSNEIFSKKISEEVTIVDNLENSKFNLEKKKTGG
FT                   SSYRKTNENHLNEDVCNYSEDLLGEQVVETSCEEFKNLKSRFSDVDNNESCSGVKDHCS
FT                   QGSVDVGSKSVLQCGATIEESIISTNALKNESVRDLPSNFEVKNVSDLSNLDSNTNSLE
FT                   NSFKDQCKFGIDIVKSFIKSSKVNESNTEIDESVESLLDIEEQSDYEYFLVPTFRGELK
FT                   NKISLSSFISSEKENSIRVNSKIFNKTFQCVKRPISFRNKTFYENELEAGPDYDELPEF
FT                   SDFGSDIESGSISMPSKGSIRFDNKSYVCVFDKNKAVDSSNSKNEVSTISSSTGTSDCS
FT                   LSLNNCSGRLFNPEKRSILKKKISDKIFQEANRMVSCDNIGIDSFLKMLDKGEDERASD
FT                   MDSISTKKHMQLRNYFDNFVNKNEDMNSSIYEQFERCIEATADNIGRPIYDYDCLNGKE
FT                   RELIDEMI"
FT   CDS_pept        complement(971519..972520)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043229"
FT                   /locus_tag="CAGL0H09944g"
FT                   /product="Similar to uniprot|P38230 Saccharomyces
FT                   cerevisiae YBR046c ZTA1"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60162.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B67B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB5"
FT                   /transl_table=1
FT                   /translation="MFIPTTQKVVLIDGKSDDYDVIKYQDFAVPSIGSTDVLVKNKYAG
FT                   VNFIEAYFRKGYYPCELPYVLGREASGEVVQVGSEVKDFKIGDKVAYLGGSTFAQYTKK
FT                   STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSI
FT                   LCQLISQRKAHVIAVASSAEKLAMAKENGAEFLINYAEDDILEKVMQYTNGKGVHAAFD
FT                   SIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVYGYLGTRSE
FT                   WDHYCSIFKHFVQSKSLKVDISGIYPLSEYAEVAKLLERRQTTGKVTLEIPQ"
FT   CDS_pept        973025..973576
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194343"
FT                   /locus_tag="CAGL0H09966g"
FT                   /product="Similarities with uniprot|P38231 Saccharomyces
FT                   cerevisiae YBR047w"
FT                   /protein_id="CAG60163.1"
FT                   /db_xref="HOGENOM:HBG124895"
FT                   /db_xref="HOGENOM:HBG204131"
FT                   /db_xref="UniParc:UPI00003B67B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB4"
FT                   /transl_table=1
FT                   /translation="MYWPLMRRALAKISYRPLVIARPSCRPYSKEVSSKIIIPPAGHFG
FT                   EELNYAGAVVTKKSNIPMHEYRQLPDDSNYIEKYYAELDVFLQYLQTQLHKSYVDFEND
FT                   PDELVFQLEKYIELQVRSNYDANKAGEKLVIDRFVAFCEGVKLTLWLNGGHCFIFDVLL
FT                   QTKGEFDKLETTKKKQEIHA"
FT   CDS_pept        complement(973850..975811)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432317"
FT                   /locus_tag="CAGL0H09988g"
FT                   /product="Similarities with uniprot|Q12457 Saccharomyces
FT                   cerevisiae YDR026c"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60164.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124896"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00003B67B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB3"
FT                   /transl_table=1
FT                   /translation="MSEHKEDDQSVEEAVMKYVGSLSGGARGDDGDAVPETDGGALLES
FT                   HTGNGGKSKKSKKRRGSKVSKRERKRSLEGGHSKKLKLSEDISNNVPDITSADDEGFIV
FT                   DPDLADLEDPSVMMDQPDPIVQKALLASRDVDKTTDLSQYNSDGQSSSDEAKAMKDLES
FT                   YVEGQQHDLAVDGGADTEQPQDKLNYEPNDQTLDIGLGDGSRSYDDELSNPLSKPLEGK
FT                   NYQEVLPKVINTKQRNDTTFGNKITLGGTEYDVDVPESVRVRQLLKEAVINASKLVDKE
FT                   TADSVRAASKKGAGGSVQPDGRIISSKAFSKEEDEALEKFVNEYQIIEGVTRRQVCERI
FT                   WNSDRPRDNFWHSIYQVLPYRTSASIYKHMRRKYHIFEQRGKWNKEEDEILEKLCKDKE
FT                   GQWVEIGKVLGRMPEDCRDRWRNYVKCGGNRSANRWTAEEEEMLKRVVNEMMEEANGQY
FT                   RGMDESGNNIGELGSGDQTDLGIDDSNSMISDKKENNLSFKDVINWTIVSERMQGKRSR
FT                   IQCRYKWNKMLKREASDRLDSRDEEDMKWLFKRIIQLEITDEKSLDWQELAESNPSSEM
FT                   TPLEAEVCYDKLKRLVKEIKNKNPTEVATKVLAHFEYQASDDIETNKQLHTHTAKFIRV
FT                   HPSTTLTSHAVEVLQNRR"
FT   CDS_pept        complement(976466..977299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194344"
FT                   /locus_tag="CAGL0H10010g"
FT                   /product="Similar to uniprot|P38835 Saccharomyces
FT                   cerevisiae YHR131c"
FT                   /protein_id="CAG60165.1"
FT                   /db_xref="HOGENOM:HBG124897"
FT                   /db_xref="UniParc:UPI00003B67B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB2"
FT                   /transl_table=1
FT                   /translation="MEMLLRDRNGRKRRSSAGAGSGGSGGSGVGGVGGGSGSGAENRVR
FT                   KVRFSETVQCMAVDGAGVVRALSDVVLSDCVSVEYTLSGRRSGVRRRYEYNRVVTYGDI
FT                   EDFLPGEAVDQGLLQPPLGAVHVEAIHLGSVPKTAVVVGENEVVDVPRDAMAGIDILLS
FT                   ADSSAETLSLRRTPRSSSIRLTGAAAGLKRSASLSPRSLYNSTFIFNSDDDIDADGTDS
FT                   DTGIDTEAETERNADTDTDIDDPTAKNPYPATQASLQPLAHDRNATAGPPPDVLN"
FT   CDS_pept        complement(978463..979059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000030539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194345"
FT                   /locus_tag="CAGL0H10032g"
FT                   /product="Similar to uniprot|Q12335 Saccharomyces
FT                   cerevisiae YDR032c PST2"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="negative regulation of transcription "
FT                   /protein_id="CAG60166.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016481"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG341443"
FT                   /db_xref="HOGENOM:HBG686708"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="UniParc:UPI00003B67B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB1"
FT                   /transl_table=1
FT                   /translation="MARVAIIIYSMYGHTAALAEAEKRGVESAGGKADIYQVAETLTAE
FT                   QLEQFGAPAKATYPIATRDTLEEYDAFLFGVPTRFGNFPQQWKAFWDATGGLWAKGALQ
FT                   GKAAGFFVSTGTGGGNESTVINAISTLAHHGIVYVPLGYKNVFAQITNLQEVHGGSAWG
FT                   AGTIAGPDGSRQPSELELKTHELQGKYFSETVKKL"
FT   CDS_pept        complement(979535..980596)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141784" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20194346"
FT                   /locus_tag="CAGL0H10054g"
FT                   /product="Similar to uniprot|P38235 Saccharomyces
FT                   cerevisiae YBR053c"
FT                   /protein_id="CAG60167.1"
FT                   /db_xref="HOGENOM:HBG058111"
FT                   /db_xref="HOGENOM:HBG204134"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniParc:UPI00003B67B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRB0"
FT                   /transl_table=1
FT                   /translation="MGKTKYQELQPFYHVADARLSEGLTYIKETDTLLWVDIYRGEIHR
FT                   LDSVSASGTANHKVFNVSQSTYSSGAAIKYPKTPTPLRESVGCIFPVITDGQVDTVLFG
FT                   SKFGVGRCQFSSGEWEYLTLYSHCPELASGDRWLDLRSNDGNVSPDGKSLYVGVMCDFH
FT                   VPMQDIGAIVRVDLVGSAALPLPVHLVIDRVKIPNAIHWNSAGTKMYWTDSLHFCLWEQ
FT                   DGDDSSTKKKLIDVQRHNPEFESPEPDGSATDLVNNVVYVCVWSTHKVQKYSLEDGTLL
FT                   HEYVLPQSTPRISSCCFVGRDLCITTANLDIEQGSSASGDSVGGCIYKLTDVLDSSTDV
FT                   GSAKRQPDISQLP"
FT   CDS_pept        982652..983629
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248243" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432318"
FT                   /locus_tag="CAGL0H10076g"
FT                   /product="Similar to uniprot|P38079 Saccharomyces
FT                   cerevisiae YBR054w YRO2"
FT                   /function="ion channel activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60168.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123791"
FT                   /db_xref="HOGENOM:HBG395442"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="UniParc:UPI00003B67B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA9"
FT                   /transl_table=1
FT                   /translation="MSTFVDLYKRGGNEAVKINPPTGADFHITSRGSDWLWAAFCVFLL
FT                   LAIVFVLLMFRKPVNNRFVYLTAIAPNVFMAIAYFSIASNLGWIPVRAKYNHVRTSTQQ
FT                   QHPGVRQIFYARYVGWFMALPWPLIQASILGKTPVWHVAFNCTMGCVFSVCFLIAACVH
FT                   STYKWGYFTIGCGAGIVSIISLMTTTYTLIKKCGDKEIKRCFLIYVCPIIVLYLVAWPV
FT                   CFGITDGGNVLQPDSEAIFYGIIDLLLLGIFPALYVPMASHVGYENITYGIFDSAIGGA
FT                   APGGMAHSASMDIEKSPMSATSSPTPVSPTPKAGIKKPKLKLKK"
FT   CDS_pept        complement(984334..986919)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246836" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499744"
FT                   /locus_tag="CAGL0H10098g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="binding"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60169.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058109"
FT                   /db_xref="HOGENOM:HBG204135"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR010491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B67B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA8"
FT                   /transl_table=1
FT                   /translation="MSGYRPAFLDQKPPPGYIAGVGRGAFGFATRGQKNETPRVPKRYT
FT                   KESNDDDDEDVFASIEEKRARKRAPKPEERSKADFIPLKRKLANVTEDQWLNLPEATDM
FT                   TRRNRRIRLEEQMNRKTYAAPDSLLDSNSVDLVKLTEEREKLLARQLDTDFFAKNEPND
FT                   QEMKTLKYIADIDKDSVNIVRRGDDEEVQKQRLVLKSYRRAEPKDPTSWIASAKLEENC
FT                   GNYELARELIQQGCLQCPLDEIIWLENLRLNVSNNEKKKIIVANAIRFQPKSVALWLEG
FT                   IKYEEQPANKFRVIQKALREIPAEEEIWKLAVKYNPNDYDSLRICKKALEFIPTSFYFW
FT                   AILMKEPYEDVMNTLEKVITQNPKQIDLKVYKLMNEEIHKKIDSVSQCKSVIIKELGIN
FT                   MKDMDKSVVTKWLDKVEIWNKSIAVDITTASLCEVIFDSIGEKIVKEYGLNYLDNISNV
FT                   KIQIIFLKSYLKFEPTKISVWQKLKNICVKSYNIDKFFQVFEELLFDRDTQNSYEMVKI
FT                   HPNLVLLYVKELWKHDGNPDKALEILSKTLNEIPNFIEGWLAKIKILLQTGRLDCVASI
FT                   FDKLLNSLETANYDDHNKERLLYRHVSFLRFMDENEKAVSYIENKYLLLFPQSVKLKLQ
FT                   LVQIYEDMGMNSICSRLYDDYTKRLPSHAVFWIEYANFIQRTSGNTSRARSILDKGIVH
FT                   NPSNVSLIVAKVKLEETVGNFAQEELLISQGLQTFAKDAELWACRMRLSKSKKSSLKKT
FT                   LFQDALKATNNSYLILFEVGRSFYNDNQYKVAMKWFDRAVTKQPRFGDGWAYIYNCKQK
FT                   LNDDLDKLLEKVAELDPAYGEEWIKVSKNVKMQYLSSPVILKKVAERCK"
FT   CDS_pept        987346..988833
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432319"
FT                   /locus_tag="CAGL0H10120g"
FT                   /product="Similar to uniprot|P38081 Saccharomyces
FT                   cerevisiae YBR056w"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG60170.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG058108"
FT                   /db_xref="HOGENOM:HBG395743"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B67BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA7"
FT                   /transl_table=1
FT                   /translation="MFDKLKQKFEKLSVGGSSGEPIPTEEVVFGEELPEEVVYKYRYNH
FT                   GVNLGSLFVLEEWIFNSVFEHGGGNEFDAVNNYLKNGKSEDEVAKKLQDHYHDYSCRID
FT                   WDWLKNEVGITAVRVPIGYWHVRDGDLLSGLPFEPLKKVYHLAKPTNYLKDIIESARNR
FT                   GIGVLIDIHGLPGGANGDGHSGFPNRGADFFRNSGYIDRICNDIIPAIIEDICKPNKNV
FT                   IGLQVVNESVFDNNAHGQKNYYKRAIQTIASNQPGLPVIISDGWWPQQWSDWLKQEKLD
FT                   LVTVVDTHVYRCFSDEDKKKSADQIINDLEGSTSFPKNDADFVVGEFSGVLDEETWKKS
FT                   PGDRNEYAKQFLNKELEVFSKSSSWGWFFWTLQFKYGDGGEWGLKPMYERGGIKKRSTQ
FT                   NNLNIDDNRVRQIIDEHINYWKDKGGDKFEHWRFEDGINSAISDIKEFARFDNSRLGRW
FT                   HAWKAQRRNDYMKKKGDSEYMWEWDQGYDRGIAEFNF"
FT   CDS_pept        989652..990770
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499745"
FT                   /locus_tag="CAGL0H10142g"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="CAG60171.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG000409"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B67BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA6"
FT                   /transl_table=1
FT                   /translation="MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANI
FT                   LKARDSVCDILNGKDDRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYL
FT                   EKPRTTVGWKGLINDPDIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSD
FT                   CFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTK
FT                   PGVTAIVGTEGNSDTFIILRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDC
FT                   SHGNSNKDYRNQPKVAQEIYNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGC
FT                   SITDACIGWDTTESVLELLAEGVRNRRKHLSK"
FT   CDS_pept        complement(991125..992579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432320"
FT                   /locus_tag="CAGL0H10164g"
FT                   /product="Similar to uniprot|P38236 Saccharomyces
FT                   cerevisiae YBR057c MUM2 meiotic protein "
FT                   /protein_id="CAG60172.1"
FT                   /db_xref="HOGENOM:HBG124898"
FT                   /db_xref="UniParc:UPI00003B67BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA5"
FT                   /transl_table=1
FT                   /translation="MSYFYNFNQGDGFANNTSMGTQDQSAFQNQNQNQVQNQSQGKAHT
FT                   QFGSGQTYIASSMLNGMSGSSYSGNYEKNVNSPQDASAYANYFQPLQNAFNSSPGFQTV
FT                   TQNNLATDYSYSHANSNGNNQIASSGSTDTTTTDTTAYNVSTNNDRFPKMTSDLTHMTS
FT                   QQSRYPNTTSDKGVDDQLFTSRYNSMGTLTSTSTISSIPAKQDNASYLGQVNYNGIPSN
FT                   RNYTASSTTHSAMLGNSFTSDAVTGYYYPTNRETNKQGLINSTKLPSRYSGSDNGQVYN
FT                   NATTFDATQSSQPSNCSATVNPKEPKESSGEIDTLKYDIQVKDAQLQSLQRELTRLKSA
FT                   ISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDIIFRKLSSALQKREKELDETKTNLE
FT                   SVLAAMALNPSNSSTKFGRYDPENLAHKTVVRLETLTKENQEMARMLSFGRAKEKHIAL
FT                   ELLKKENKDLKTQIIQLKEKLGKDKV"
FT   CDS_pept        complement(993354..995690)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162311" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18499746"
FT                   /locus_tag="CAGL0H10186g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG60173.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG371766"
FT                   /db_xref="HOGENOM:HBG746888"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016652"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00003B67BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA4"
FT                   /transl_table=1
FT                   /translation="MSDQILQGLEVPAIIAKEECIYCFETPYNPEKPGSKEQQLTDSTK
FT                   AAHTLNICLVCFQAVCPRHTPFHIEVGKHNDAQHFDYLNVAKVRKYEDMLDGEEDEDTN
FT                   SSKKIKLQVIEKSRDEDYNDVWSLLHFESSQSSPHIVLKSNEANAAQTEKVDHVLNAKS
FT                   QDLADQANVWELDIKPCKHVDSFSFANVQEKPLETHCSSCELTQNLWICLYCGNLGCGR
FT                   EQVGIEGHSHALEHFKSKNDHCLAIKLGSLSSSSFDLYCYACDDEVKFNDLQVLKTTLA
FT                   KYGIDMDKKSADEKTLVELQVEQNMNWDFKMVDEKGQQLKQLNASQELGCGLINLGNSC
FT                   YLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGI
FT                   RPKSFKKCIGGSHEEFSSGRQQDALEFFTYFVDELDKKLFKNSDYNPNDLMKFMMEDRL
FT                   QCQECHGVKYSTETSNVIQLPLQESNDAQDLEERINAYFSGEVIEFKCPNCKKMVNAVK
FT                   KPAMRTFPDTLVINPIRIKIENWTPVKTSNLLTIPGLETPTEVLELTQYKGNGLQKDTE
FT                   TQLNDDNDEIQFEVNETFVNQLMEMGFTENACVRALYHTGNKDPELAMNWLFGHIEDAD
FT                   VNAEFIPPKKAKNDVNPEHISMMVGMGLDPKLCRKALILNNHDVTRSVDWVFNNMDDDG
FT                   EIEELKEQSDTSKTYGHHDAKPYELSAIICHKGNSVHSGHYVAFIRKMVDGKPTWVLYN
FT                   DEKIVVSNNFEEMMKNSYMLFYSRT"
FT   CDS_pept        complement(996157..996411)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432321"
FT                   /locus_tag="CAGL0H10202g"
FT                   /product="Similar to uniprot|Q3E790 Saccharomyces
FT                   cerevisiae YBR058C-A TSC3"
FT                   /protein_id="CAR57992.1"
FT                   /db_xref="HOGENOM:HBG398816"
FT                   /db_xref="UniParc:UPI00017BD8BE"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN12"
FT                   /transl_table=1
FT                   /translation="MSTGNDKKSTMRYVLTLKERRELEGKGITMMHRVEDFMDRIYWMY
FT                   YIHMPYYLMTSFDAFCLHTFFLMIFSLSLFGIVKYCFFL"
FT   CDS_pept        complement(996853..999936)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21043230"
FT                   /locus_tag="CAGL0H10208g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60174.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059887"
FT                   /db_xref="HOGENOM:HBG204137"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B67BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA3"
FT                   /transl_table=1
FT                   /translation="MERPNSRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFA
FT                   QIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSP
FT                   NIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVS
FT                   IGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNI
FT                   YVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYD
FT                   FPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLY
FT                   TKFQSKVQTIQNQINYLQNKVVSSKSKLSKEDGLVLDELYIKTFEMIPKIPNPRLSEKQ
FT                   PTLEIGLNSPSIQDQHLDVNNKRRSMHESINSRQASDNISQKSVRTSSNTIEKTFSQTS
FT                   NKEFSKETDPESHDESGEPYFPSVNELNTYLDKEFKQQKAQDNVVKNQIINNSGGNMNS
FT                   SNPERQKSISSFSSSGKSMKSSSHVPSAGFVGADATEGPKMVGYLKSQNHKSNNPFPFM
FT                   AGDRQRSTESLNNKHNNYDANNTTAPVKGNYGGIQANNIPSQPKNFEYNNPVNDTNRIQ
FT                   DTGIGQSAGRPQNVSQFSNTKMNFVPGTNMSVNFDVTNPINQHNIPISQGVVNNSGVPS
FT                   NQGFHNKVPLPNAGSNYIPFPPRPQMMQQSYEAPQKQMQKYDQVYHEQPSQQNAYINTT
FT                   PQEVQNEQLLIDISPPRDIKRTSSPQKELSNVKTHAPQVLDLQLNEMDISEASIADSSN
FT                   GNDVDSSLLSSESVDLDVTNRLKMHYPFGNQRQTKLAQKPIQSKVKDTDKQQKNGRRSL
FT                   DLSVQEVHFNSEAGKNNLLHNKNTHRPGIKGSMSEESVEDTIKSLPPSNTLPRSQSSKV
FT                   ISQSTNARTSLDRQRQRHIEPRDSKSRSRSHGLEEYTSSNGSNSSINISTSNKFEMKRS
FT                   FAKARQSLDLERARRDAMSRSNSGHETGKRKSLFSMFK"
FT   CDS_pept        complement(1000574..1002118)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432322"
FT                   /locus_tag="CAGL0H10230g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="CAG60175.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG124899"
FT                   /db_xref="HOGENOM:HBG204138"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniParc:UPI00003B67BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA2"
FT                   /transl_table=1
FT                   /translation="MSPPETPKKESLKENEDLAIKENGTSPREIGDKIKVESAGEYETP
FT                   ELTSDEENLVQLQTPRKRRKVNLSKEHDFTSPLKKVIMNNLNEYKKSDLADKLKLSRDF
FT                   VNTQVPRPADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFG
FT                   LISNIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYL
FT                   SPKLALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSE
FT                   SKFWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVA
FT                   IVASADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGA
FT                   KYVLQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLC
FT                   AADFIASNEMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMKRLQEILYEE"
FT   CDS_pept        complement(1002563..1003492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432323"
FT                   /locus_tag="CAGL0H10252g"
FT                   /product="Similar to uniprot|P38238 Saccharomyces
FT                   cerevisiae YBR061c"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60176.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG266638"
FT                   /db_xref="HOGENOM:HBG398270"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI00003B67C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA1"
FT                   /transl_table=1
FT                   /translation="MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELK
FT                   RVVDLCAAPGSWSQVLSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADIT
FT                   HPRTLERIYELFGNQKADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGT
FT                   FVAKIFRGRDIDMLYSQLGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDV
FT                   NSSVTEFFATCDLGKLSIDDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVA
FT                   LDPVQAPTNPPYKRALELKRDGKLTRNI"
FT   CDS_pept        join(complement(1004468..1004483),
FT                   complement(1003801..1004312))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17432324"
FT                   /locus_tag="CAGL0H10274g"
FT                   /product="Similar to uniprot|P38239 Saccharomyces
FT                   cerevisiae YBR062c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60177.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059894"
FT                   /db_xref="HOGENOM:HBG398490"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00017BD8BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FRA0"
FT                   /transl_table=1
FT                   /translation="MSTYEEEHNINNNESSDEGRQEVRDHFRTLFQQFYGPGTHRDGTE
FT                   RGGEATTTLLQLLSQLMPEDLQEQLMQSMDSASKQGCSDTFIDSLPRIPQKKLKSDDTC
FT                   PICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELPELDTS
FT                   KVELEEDWGMYG"
FT   CDS_pept        complement(1004900..1006021)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347597"
FT                   /locus_tag="CAGL0H10296g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG60178.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058544"
FT                   /db_xref="HOGENOM:HBG397468"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B67C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FR99"
FT                   /transl_table=1
FT                   /translation="MSFVSQFLKKKPDVLGTLEVSKKFMEHFPKKKTINKLLFDLNSRL
FT                   TYKKLYPIYVGLYHGVPVPQQQKLLDGVKGSDLIVMRNVLEKVRNRTRYARPDMLKLED
FT                   KLLELAAELGNNDAIAILSFRSIRENMGTNSAAEANNEEVTIAKKLFKDLYNINHLLAI
FT                   KLLGDLALEANNWEEALTFYNKYINIAVKDNGHLLTGNDDLTGEVYGKLGEIEFTYLAN
FT                   MTKAEEYWQKCLELTSVEDSVRWYFLAAQIYMSSEPLKSRILLEKAASQGFKESLTSLG
FT                   FLEMNYFRDYGRAKEWFKLGMEVFELQSYIGFFDCCVKNEDWIAALKCLKSIEKIGTME
FT                   SFGSDNTNKATVSNFMNSRAEFIDKVRLKSALV"
FT   CDS_pept        complement(1006299..1007222)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19347598"
FT                   /locus_tag="CAGL0H10318g"
FT                   /product="Strain CBS138 chromosome H complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60179.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B67C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FR98"
FT                   /transl_table=1
FT                   /translation="MERAEYTKEKKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKDG
FT                   LDMSAIREVKYLQEMQHVNVIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTPAD
FT                   IKSWMLMSVRGVHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVLTSN
FT                   VVTRWYRAPELLFGAKHYTSAIDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFRALGT
FT                   PTDKDWPEVSSFNSYNKLQM