(data stored in ACNUC8465 zone)

HOGENOMDNA: CANAW_4

ID   CANAW_4; SV 1; linear; genomic DNA; CON; FUN; 1768732 BP.
XX
AC   CM000310; AAFO01000000; CH672348;
XX
PR   Project:16373;
XX
DT   15-APR-2006 (Rel. 87, Created)
DT   12-JUN-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Candida albicans WO-1 chromosome 3, whole genome shotgun sequence.
XX
KW   .
XX
OS   Candida albicans WO-1
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina;
OC   Saccharomycetes; Saccharomycetales; mitosporic Saccharomycetales; Candida.
XX
RN   [1]
RP   1-1768732
RX   DOI; 10.1038/nature08064.
RX   PUBMED; 19465905.
RA   Butler G., Rasmussen M.D., Lin M.F., Santos M.A., Sakthikumar S.,
RA   Munro C.A., Rheinbay E., Grabherr M., Forche A., Reedy J.L., Agrafioti I.,
RA   Arnaud M.B., Bates S., Brown A.J., Brunke S., Costanzo M.C.,
RA   Fitzpatrick D.A., de Groot P.W., Harris D., Hoyer L.L., Hube B., Klis F.M.,
RA   Kodira C., Lennard N., Logue M.E., Martin R., Neiman A.M., Nikolaou E.,
RA   Quail M.A., Quinn J., Santos M.C., Schmitzberger F.F., Sherlock G.,
RA   Shah P., Silverstein K.A., Skrzypek M.S., Soll D., Staggs R.,
RA   Stansfield I., Stumpf M.P., Sudbery P.E., Srikantha T., Zeng Q., Berman J.,
RA   Berriman M., Heitman J., Gow N.A., Lorenz M.C., Birren B.W., Kellis M.,
RA   Cuomo C.A.;
RT   "Evolution of pathogenicity and sexual reproduction in eight Candida
RT   genomes";
RL   Nature 459(7247):657-662(2009).
XX
RN   [2]
RP   1-1768732
RG   The Broad Institute Genome Sequencing Platform
RA   Birren B., Lander E., Galagan J., Nusbaum C., Devon K., Cuomo C., Jaffe D.,
RA   Butler J., Alvarez P., Gnerre S., Grabherr M., Kleber M., Mauceli E.,
RA   Brockman W., MacCallum I.A., Rounsley S., Young S., LaButti K.,
RA   Pushparaj V., DeCaprio D., Crawford M., Koehrsen M., Engels R.,
RA   Montgomery P., Pearson M., Howarth C., Larson L., Luoma S., White J.,
RA   Kodira C., Oleary S., Yandava C., Zeng Q., Alvarado L.;
RT   ;
RL   Submitted (20-MAR-2006) to the EMBL/GenBank/DDBJ databases.
RL   Broad Institute of MIT and Harvard, 320 Charles Street, Cambridge, MA
RL   02141, USA
XX
RN   [3]
RP   1-1768732
RA   Soll D.R., Srikantha T.;
RT   ;
RL   Submitted (20-MAR-2006) to the EMBL/GenBank/DDBJ databases.
RL   Department of Biological Sciences, University of Iowa, Iowa City, IA 52242,
RL   USA
XX
CC   On Apr 14, 2006 this sequence version replaced gi:90659822.
CC   Annotation was added to the scaffolds in June 2009.
XX
CO   join(AAFO01000022.1:1..203945,gap(unk100),AAFO01000023.1:1..629106,
CO   gap(unk100),AAFO01000024.1:1..68422,gap(unk100),AAFO01000025.1:1..44877,
CO   gap(unk100),AAFO01000026.1:1..437922,gap(1144),AAFO01000027.1:1..22002,
CO   gap(unk100),AAFO01000028.1:1..67397,gap(unk100),AAFO01000029.1:1..48422,
CO   gap(1195),AAFO01000030.1:1..10190,gap(712),AAFO01000031.1:1..8471,gap(227),
CO   AAFO01000032.1:1..2627,gap(2058),AAFO01000033.1:1..21235,gap(2806),
CO   AAFO01000034.1:1..8949,gap(unk100),AAFO01000035.1:1..5643,gap(819),
CO   AAFO01000036.1:1..15601,gap(1482),AAFO01000037.1:1..3760,gap(162),
CO   AAFO01000038.1:1..5116,gap(unk100),AAFO01000039.1:1..7214,gap(166),
CO   AAFO01000040.1:1..44593,gap(unk100),AAFO01000041.1:1..20861,gap(unk100),
CO   AAFO01000042.1:1..24436,gap(4887),AAFO01000043.1:1..5625,gap(unk100),
CO   AAFO01000044.1:1..45560)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1768732
FT                   /organism="Candida albicans WO-1"
FT                   /chromosome="3"
FT                   /strain="WO-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:294748"
FT   gene            complement(<38..>640)
FT                   /locus_tag="CAWG_02347"
FT   mRNA            complement(<38..>640)
FT                   /locus_tag="CAWG_02347"
FT                   /product="predicted protein"
FT   CDS_pept        complement(38..640)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02347"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPE9"
FT                   /protein_id="EEQ44088.1"
FT                   /translation="MSDSTLSKISELIKLEDDLAKIGSIRQQFLKEKSSVDVKLSSTTQ
FT                   VQIDSIMKNLANLHNTMERLDSIKGSIGEVQQVHDSTIGEVREYDTIKKMTMVNQFLHQ
FT                   VGSLYEDISGFKRFVGALNEEIQRELQGLQNDLKYPLPNFVRIHHAYTQARNFVDYLEV
FT                   YSTRLSDDLQSIVYKVVSPIKTTIKLFDELLNEGIQS"
FT   gene            <711..>1309
FT                   /locus_tag="CAWG_02348"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            complement(<944..>2284)
FT                   /locus_tag="CAWG_02349"
FT   mRNA            complement(<944..>2284)
FT                   /locus_tag="CAWG_02349"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(944..2284)
FT                   /codon_start=1
FT                   /gene_family="HOG000093792" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPF0"
FT                   /protein_id="EEQ44090.1"
FT                   /translation="MKGQSKNGHRRSNSRFANDDKRLVYLTSKAMGKKCIATITDGSRY
FT                   QGLLVGSDLSPLSVVLLKPQLVGSSLLNEKNNLDKLPENLIIQAKDLIDLEVDVDLSEP
FT                   VKPPHEFKTDADISGKMQIKERELERWVPDDEVELTLEDDGSEWDQFKVNQEKFGVESS
FT                   YDEHLYTTRIDTSAPDYHERVAKAERIAKEIEQQATTDRHILEERGVVVDDSGVDEEDK
FT                   YSGVDRRGDELMAALRNASISKPAQQGTTTHHHHDPAIVSSSKQAKPESIPPKPPVPNE
FT                   SFRLNAQSEINSLREFSANFKIPHKMPQDLLPILAKDKMKQDEILKKQQDHTKKEPKTY
FT                   KLNPKAAVFTPSSKHATISSPKKSPRPYSNGNVKKHYQISAADFFGVNKVPTKDGQTTK
FT                   IKEFKCGFNMFVTTRRKHKEYEKSFQTPPTWECTVDDAHDKLLRRGQ"
FT   gene            <1212..>1748
FT                   /locus_tag="CAWG_02350"
FT   mRNA            <1212..>1748
FT                   /locus_tag="CAWG_02350"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1212..1748
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7K5"
FT                   /protein_id="EEQ44089.1"
FT                   /translation="MVACFDDGVNTAAFGFNLYVFGSFLVWSCCFFKISSCFILSLAKI
FT                   GNKSCGILCGILKLALNSRNELISLCAFNLNDSFGTGGFGGIDSGFACFELDTIAGSWW
FT                   WCVVVPCCAGFEISAFLNAAINSSPLLSTPEYLSSSSTPLSSTTTPLSSKMCRSVVACC
FT                   SISLAILSALATRSW"
FT   gene            complement(<2359..>3792)
FT                   /locus_tag="CAWG_02351"
FT   mRNA            complement(<2359..>3792)
FT                   /locus_tag="CAWG_02351"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(2359..3792)
FT                   /codon_start=1
FT                   /gene_family="HOG000093793" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPF2"
FT                   /protein_id="EEQ44091.1"
FT                   /translation="MSSNIIALFIAEFDVRSGYKLVHQEAKIAGFDFDGLEYKVLPSGI
FT                   QEFGTSTVLFSHWFQGKVYYGLSKYYQYIIGDDSRDRNNVKMFAMGVLCEPKPSVWKPN
FT                   EFIDNGWEYADAIHQKLVSFVHSGEYVGLKGIPKVVPNVDNHLLTNLPEMFRSLGPLVF
FT                   VLYKQSLLRKRILIFNQHHKSYDDQDILPSGVDNLYNISSFCYLISLLSVVPHEIDFVE
FT                   APTYSQPVYQIGLTDMGGELLKCRGYIGSTNDDILKDNAVYDIGVIIDEHAKVFDYAQQ
FT                   PLRATNKDYQKFGLIYSELPRTRDGFTNSSGISADDLSSIRSDVSKDFSGGVVGDTPSW
FT                   WKTDATEPVSWTESIWSAFSWFATAGQYGDVPQPPHVPDKVDLVDLVNIVGYFHKLTKK
FT                   WFYMINEAVLEVWDDQASTDDQPLTRRICLELTYQDVVEMELDPYSNADLEFLKQFVLL
FT                   YWEVVDSVEIGMGLNSICC"
FT   gene            complement(<3851..>4198)
FT                   /locus_tag="CAWG_02352"
FT   mRNA            complement(<3851..>4198)
FT                   /locus_tag="CAWG_02352"
FT                   /product="vacuolar transporter chaperone 1"
FT   CDS_pept        complement(3851..4198)
FT                   /codon_start=1
FT                   /gene_family="HOG000208407" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02352"
FT                   /product="vacuolar transporter chaperone 1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7L0"
FT                   /protein_id="EEQ44092.1"
FT                   /translation="MSSTNKRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLN
FT                   FGDYVGRISAGLFTFIAMLTMVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCIFLLVA
FT                   VVVNFILRIRA"
FT   gene            complement(<4317..>6077)
FT                   /locus_tag="CAWG_02353"
FT   mRNA            complement(<4317..>6077)
FT                   /locus_tag="CAWG_02353"
FT                   /product="allantoinase"
FT   CDS_pept        complement(4317..6077)
FT                   /codon_start=1
FT                   /gene_family="HOG000219146" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02353"
FT                   /product="allantoinase"
FT                   /db_xref="GOA:C4YPF4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPF4"
FT                   /protein_id="EEQ44094.1"
FT                   /translation="MSRALSSTRVLVNDTLLPATIIFSVESGTILEIVDRVLPPNDPIL
FT                   ARYNVFPIDYRNVTPAVIMPGLVDAHVHLNEPGRTEWEGFETGTKAAASGGVTTVIDMP
FT                   LNAIPPTTTVANFNLKINAAKGQTWVDVGFWGGLIPDNLYDLKPLIRMGVRGFKAFLIE
FT                   SGVDEFPAITPAHILAAMKEVKDEKTMLMFHAEMQPREKEEFSDSADTLTAEIDDFDLG
FT                   MSASFIDRAPTPVVRLLSNDPGDHHHEHENCRLPHNHAGSINPSVLSDKQAKALAHTPI
FT                   LAGAEPTFGKNARKVNTHHSRSYSYTEEDTKVNTPLLLAQQENAELANIDPTAYATFLA
FT                   SRPDNFETTAIAEIINCSTLLPTVPLHIVHLATHEAVPLLRAAKAKGLPVTAETCFHYL
FT                   SLCAERIGSCSTHFKCCPPIRTDDNRKLLWKALRNDVITTVVSDHSPCTPDLKGMEKGD
FT                   FFEAWGGISSVGFGLPILYTEGLKLDPPIRLAEINKWCSWNTAKQVGLSHCKGTIRVGY
FT                   DADLLIFDTDAKYVVENKETYFKNKLTAYDGMEFRGRVLETLVRGNTVFAMGRGFSGPK
FT                   GKLILEPRFE"
FT   gene            <5536..>5916
FT                   /locus_tag="CAWG_02354"
FT   mRNA            <5536..>5916
FT                   /locus_tag="CAWG_02354"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        5536..5916
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7L4"
FT                   /protein_id="EEQ44093.1"
FT                   /translation="MAAKIWAGVIAGNSSTPDSIKNALNPRTPIRINGFKSYKLSGINP
FT                   PQNPTSTHVWPLAALIFKLKLATVVVGGMAFNGISITVVTPPDAAALVPVSNPSHSVLP
FT                   GSFKWTCASTSPGIITAGVTFL"
FT   gene            complement(<6215..>7309)
FT                   /locus_tag="CAWG_02355"
FT   mRNA            complement(<6215..>7309)
FT                   /locus_tag="CAWG_02355"
FT                   /product="enoyl-[acyl-carrier protein] reductase 2,
FT                   mitochondrial precursor"
FT   CDS_pept        complement(6215..7309)
FT                   /codon_start=1
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02355"
FT                   /product="enoyl-[acyl-carrier protein] reductase 2,
FT                   mitochondrial precursor"
FT                   /db_xref="GOA:C4YPF6"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPF6"
FT                   /protein_id="EEQ44095.1"
FT                   /translation="MITAQAVLYSQHGEPKDVLFTQKFEIDDENLTPNQVVVKTLASPV
FT                   NPSDINQIQGVYPSKPEKTTAFGTSEPAAPCGNEGLFEVLKVGDNVKGLEAGDWVIPAN
FT                   VNFGTWRTHALGEEQDFIQLPNPTQSKANGKPQGLSLNQGATISVNPMTAYLMLTHYVK
FT                   LNPGKDWFIQNGGNSAVGKYASQIGKLLNFNSISVIRDRPNLEEVVEELKELGATQVIT
FT                   EEQNNSKEFGPTIKGWIKESGGEAKLALNCVGGKSSTGIARKLNNNGLMLTYGGMSFQP
FT                   VTIPTSLHIFKNFTSAGFWVTELLKHNRELKLKTLNQIIEWYESGELKDAKSTETRFDG
FT                   SKELHELYKDGVANSKSGKQLITY"
FT   gene            complement(<7447..>8079)
FT                   /locus_tag="CAWG_02356"
FT   mRNA            complement(<7447..>8079)
FT                   /locus_tag="CAWG_02356"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(7447..8079)
FT                   /codon_start=1
FT                   /gene_family="HOG000093794" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPF7"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPF7"
FT                   /protein_id="EEQ44096.1"
FT                   /translation="MSSLNAQYLAYLIKYPLLTKSITSGVFSGLNETVASVLTNEFQET
FT                   KVAGIKIKHVFTQKLLTMIIYGSCIATPISHYMYFIINNKIFKGPLTKSGKILQILTSL
FT                   STVTPTLAACFVSWIALINNYKLPKGSISPIAELNKIVAIVRAGLKKGYFGVLKSSLVT
FT                   SSVALVIAQKFVPPELWVVFFNVVYFFLGTYQNTKLKRLQKQQRLAK"
FT   gene            <9551..>11443
FT                   /locus_tag="CAWG_02357"
FT   mRNA            <9551..>11443
FT                   /locus_tag="CAWG_02357"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        9551..11443
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5A7L9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7L9"
FT                   /protein_id="EEQ44097.1"
FT                   /translation="MSTNPEKPTRNEDLFENSSSSSSVPHNKEASELESVNSTAEREGG
FT                   EHGNILAQYTEEQVMQMGRNYAHKYDLDPDLFGRAAALARAPSAFNSMPFLTDEEKQGL
FT                   YLEATKKWHIPRKLIEVIAVGAIAAATQGMDESTISGATLFYPKAFGVTEMKNADLIEG
FT                   LVNSAPYLCCSVIACWTSDYWNRHLGRKWTIFWTCLISAVTCIWQGFVNNWWHLFIARF
FT                   FLGFGIGVKSATVPAYAAECTPKHVRGALVMLWQFFTAVGIMFGFVSALAFYYVPHKSF
FT                   GTGLNWRLMLGSACIPPIIVLFQIPFVPESPRWLMGKERHKEAFESLKALRFEEIAAAR
FT                   DCFYQYVLLKEEGTYDIPTWKRLIQMFTIRRNRNGAIGSWIVMFMQQFCGINVIAYYAS
FT                   SIFIKARYSEISALLASWGFGMINFVFAIPAFLTIDKFGRRNLLLFSFPLMGVFLLIAG
FT                   FGFLIHDRQGQLAMVTTGIYIFSAIYSSSEGPVPFTYSAEAFPLYIRDLGMSWATATCW
FT                   FFNFILAFTWPRLQNAFTPTGAFGWYAAWNVIGFFLVLWFLPETKGLTLEELDDVFAVP
FT                   MYEHAVYRTKELLNGFQRVILRRNIPPMPPLYHHQRMAVTNPEWNDKTEVDHIE"
FT   gene            complement(<10981..>11478)
FT                   /locus_tag="CAWG_02358"
FT   mRNA            complement(<10981..>11478)
FT                   /locus_tag="CAWG_02358"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(10981..11478)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPF9"
FT                   /protein_id="EEQ44098.1"
FT                   /translation="MYILINTIKELNYSIWSTSVLSFHSGLVTAILWWWYNGGIGGMLR
FT                   RKITLWNPFKSSLVRYTACSYIGTANTSSNSSNVNPLVSGKNHNTKKNPMTFHAAYQPK
FT                   APVGVNAFCNRGHVNANIKLKNQQVAVAQLIPKSRMYNGNASAEYVNGTGPSELEYIAE
FT                   KM"
FT   gene            complement(<11493..>12848)
FT                   /locus_tag="CAWG_02359"
FT   mRNA            complement(<11493..>12848)
FT                   /locus_tag="CAWG_02359"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(11493..12848)
FT                   /codon_start=1
FT                   /gene_family="HOG000162970" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPG0"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG0"
FT                   /protein_id="EEQ44099.1"
FT                   /translation="MSDTIATKEEASKIFDRLKKDPANQVCFDCSNKNPTWTSIPFGIF
FT                   LCLQCSAVHRNLGVHISFVKSSNLDSWQRIQLRNFKFGGNQQAKDFFLKNGGSQFVNNK
FT                   NGVDATAKYTSPCANKYKEKLKQKAAQDAAKHPDIVTLDDVTDVMSLSDSPSESTDDFF
FT                   SNWNKPVNNSNTASPLSSRAATPNASTDDLTKKKPVVRTTTTSARLKNNNTAAKKSILS
FT                   GKGNGPRTSRLAAKRINKTEDDIDFDEIEKKAKQEAEEAKKLGYKPTETVEPTVKKQPT
FT                   STSLSLKKENEEVKLTPAPIQETTQQFQKLGFGMTQGDNIVSSSTKKYKEVKYTGEVSN
FT                   KYGTQKGISSDEFFGRGPRFDEQAKTEARTKLQAFNGAQSISSSSYFGEEEGGARGGRS
FT                   NSGAGGLGDLEASAREFASKFSGNANQDLEVLKDALEDGATKLGSYLRDFLR"
FT   gene            complement(<12991..>14265)
FT                   /locus_tag="CAWG_02360"
FT   mRNA            complement(<12991..>14265)
FT                   /locus_tag="CAWG_02360"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(12991..14265)
FT                   /codon_start=1
FT                   /gene_family="HOG000208172" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02360"
FT                   /product="hypothetical protein"
FT                   /note="similar to mitochondrial protein Import 1 protein"
FT                   /db_xref="GOA:C4YPG1"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG1"
FT                   /protein_id="EEQ44100.1"
FT                   /translation="MLRSGIIKTQPATAIIRPLSRCFHYTNINFNDKPPSSDSPLKVFF
FT                   DTFKTEVKKSNELKENIKALQDESGRMAESEAFKRAKEAYAKAQLGSTAAGKVLKKGAE
FT                   TVGDAAYKAWESPVGKGVRTGVKVTADVADKAFEPVRKTQVYKDMSEVIDDGSSTAYGG
FT                   FLTKEQREALRKKELERKKKQGFQGPVRENDEAGGALVATEHKPTGPTMGEKWENFKLK
FT                   SPIGRGVVYLQERWEESENGLIALIRTIVEKVTGFFSETEQAKVVKQLKLMDPSFRLTD
FT                   FQRTLTNYIVPEVVDAYIKNDAKVLKEWLSEAPYNVWEANNKQFIQQGLFSDSRVLDIR
FT                   GVEIVTCKSLQPNDVPVIVVSCRAQEIHLYRKAKTGEIAAGTEDHIQLSTYAMVLTRIP
FT                   EEFDNKVTDGWKIVEFARGGSRPFH"
FT   gene            complement(<14367..>15737)
FT                   /locus_tag="CAWG_02361"
FT   mRNA            complement(<14367..>15737)
FT                   /locus_tag="CAWG_02361"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(14367..15737)
FT                   /codon_start=1
FT                   /gene_family="HOG000251788" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02361"
FT                   /product="hypothetical protein"
FT                   /note="similar to A-460 protein"
FT                   /db_xref="GOA:C4YPG2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG2"
FT                   /protein_id="EEQ44101.1"
FT                   /translation="MSEEESQKTIGIVGAGLVGCLAALAFVKKGYDVTLFEYRPDPRTV
FT                   DSSKRNLRSINLAVSSRGIRALQYVDPAMADRILEHVIPMKGRMIHDITGTKQESQVYG
FT                   LNGESINSIDRSFLNNCLLDELDKSNVKILFKHKLVKLDTSNACRMTFIDGHNDAKTST
FT                   FDFVVGCDGAHSQFRYHLQKTMRMDYSQKYIDMQYLELYIPPSEDANNKFSIDANHLHI
FT                   WPRHNFMLIALANKDGSFTSTFFSPWSVIEGISSSQEFVEFFRHNFPDAVGLIGEDALS
FT                   SAFKSNPRGSLMQVSCYSYSNGKGIILGDAAHSMVPFYGQGMNCGFEDVRILMELIDTN
FT                   NGDIEEAFKQYSAARKNDLDAICKLALDNYYEMSSKVVDIGYLIKKKLDYTLGKIFKNK
FT                   WLPLYTMISFRDDIPYAMAIEIEKRQNRIMNNVGLGVLGTAAVYGLVKLGQYWNRRQ"
FT   gene            complement(<15831..>17327)
FT                   /locus_tag="CAWG_02362"
FT   mRNA            complement(<15831..>17327)
FT                   /locus_tag="CAWG_02362"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(15831..17327)
FT                   /codon_start=1
FT                   /gene_family="HOG000093795" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG3"
FT                   /protein_id="EEQ44102.1"
FT                   /translation="MSEDSSPPPPLPARKSLDSILIETEISKKLPDLPSAANANQRISF
FT                   DLNDSVSQISAVRQWEIYTSLQLNETSDIFVNNAIGQNTIRTKLNELKDDHTKFWIDMN
FT                   DYSSSILLPKRINKLEEEILTGIPSNIRYLVYLKTLLVRQKLNSRETFSSLLTKSRQLR
FT                   DEYIESLAVDSRVREILIVFNYYVNEITNSKFEIESDENSELMQLPISRFIINVCILLG
FT                   TFPEASQEDVLYLLLKFNKLYTCLNKDEFFYKVSRSLEEGLADIFKHISVQGINLNSLF
FT                   RSILVQLFSSELLDEEVCLRVLDFVVFEGFDFVLRSILYLFRKNLEKIQELDGDALLQF
FT                   LNSPEFCQVEFDFKEVLAEEPSLIQYENEFYLINANSMSNNSNELTNLKEVNDELVVKI
FT                   NDLKRKIDSLQATHSEISDQSEQYTKDLSEAEIENQKLLKRQAELQEKYQNLTMAENLS
FT                   NTIKANQEFSQRNFELESQIKNLQNSIEEKNAKLAKVQQS"
FT   gene            complement(<17458..>19923)
FT                   /locus_tag="CAWG_02363"
FT   mRNA            complement(<17458..>19923)
FT                   /locus_tag="CAWG_02363"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(17458..19923)
FT                   /codon_start=1
FT                   /gene_family="HOG000093796" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPG4"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG4"
FT                   /protein_id="EEQ44103.1"
FT                   /translation="MSSLKDKEYPSLKRKGLSIGSGSYKPVNTLGAAPRNELPNSNNVS
FT                   EETFLSNITMKESYAPGNDPSFSLERAKERRHRLNGLSQSLKTNHSPVDVTEFQITDCF
FT                   GSSVNVSAKDLRDEPAVSINLKSFHKVGGAYYRSMSRRQHLLNISKNGDYICIFESDYP
FT                   KSNFLINIDTQLKSLSFAPEALVMELNEGHETIIASHYGRDNEVREYFQNNPTAKVDPS
FT                   KTLSGTALHRLEKTVQLDNDNDNDLDTTERSVSRTRPIRVRTRQASKAFWSSVAEENKE
FT                   DPLDIVKVTDDSPIESVFVEDDYIPYEKPAPFEPDLQYTFPDNKIFRITAKDFATLYNN
FT                   DWINDAVMDFCIRYDIEEAINQGVVNREDVYAFNSFFYTKLTSGKTEDYYNKVKRWVHK
FT                   IDLMSFSHIIMPINEKHHWYCCIIRGLPTLLEMIKSQKEKSNDADSPDSEEMFKRWGVE
FT                   IFVFDSLGLRRDNVKKPLKAFLIDYCKDKYNYDVNTDQIRVTAAKVPRQNNYNDCGLHV
FT                   IYNVKKWLLNIEACESFWRKWQRGAARTIFLADERNKMRRYWIETLLKLHSEQAPAIKR
FT                   SSHANEEEDDDDIVEIVDTKTIVPPPTDQPKLSPPSNQKSNAVFDNSFLNQEFGNEHIP
FT                   RFVVETLNKIFPKRSLHIPDEMKKLVSAFIKDSQSNVSSEQELKEVFIRNHEVIKKEIE
FT                   NQNRPKNKTIRITDAVSNLRIDPGTFFCPTHKEISSGLRKDQLLEEIDARPIIKAIRTP
FT                   QESDQNSNEKDAEDHATSDSEHVQVEEVNLEEDRNSRQRFTRSRQRAKQNIMDLAIFDN
FT                   IDRKRRKCE"
FT   gene            <20466..>21791
FT                   /locus_tag="CAWG_02364"
FT   mRNA            <20466..>21791
FT                   /locus_tag="CAWG_02364"
FT                   /product="26S protease regulatory subunit 4"
FT   CDS_pept        20466..21791
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02364"
FT                   /product="26S protease regulatory subunit 4"
FT                   /db_xref="GOA:C4YPG5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG5"
FT                   /protein_id="EEQ44104.1"
FT                   /translation="MGQGPSGMPGGDNINKKKDDRKKEKPKYEPPVESKFGKKKRRGPD
FT                   TAVKLPSVYPNTRCKLKLLKLERIKDHLLLEEEFVTNQEAFQPTEARQAEEREKVDELR
FT                   GYPMAIGTLEEIIDDDHAIVSSTASSEYYVSIMSFVDKGLLEPGCSVLLHHKTVAVVGV
FT                   LQDDADPMVSVMKLDKSPTESYADIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKG
FT                   VILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFQIAADHAPS
FT                   IVFIDEIDAIGTKRYESTSGGEREIQRTMLELLNQLDGFDDRGDIKVIMATNKIESLDP
FT                   ALIRPGRIDRKILFENPDANTKKKILTIHTSKMSLADDVNLDEIVTGKDDLSGADIKAI
FT                   CTEAGLLALRERRMQVKAEGFKSAKERVLKNKVEENLEGLYL"
FT   gene            <21879..>24215
FT                   /locus_tag="CAWG_02365"
FT   mRNA            <21879..>24215
FT                   /locus_tag="CAWG_02365"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        21879..24215
FT                   /codon_start=1
FT                   /gene_family="HOG000093797" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG6"
FT                   /protein_id="EEQ44105.1"
FT                   /translation="MFFRLHPVKRRNGLRQLWQHSNVALETLPAIARRTNEYLCKLENH
FT                   PLKSFASLGRVIKFQNATKRRIDVSRNLDLEIQSAFNQVIKLRHWFSNKKVLESTVDLI
FT                   NRDWGQILIMKVQLDQVFTSDHVPTATEQEEIDKLIHNVVKKIFDCNLDFGMKLDKLYP
FT                   PVIKYYQTDDSTNYVQATLKLQTSQLTKPNCNVQTISKKFQNLHKLASSRTTSRLASYG
FT                   CLNKTSSGVSQQIILSKVLQARICNRIKQTITNRGKVKILGGKPMASATILQVGEESRV
FT                   SIKTNVFLEKYTSKHPSIYYKRDLSEMSNYAVRSIFEGLKGTGIELDEIYTLHAIVAEN
FT                   SPVTITSKLRIAFAEDYLTPNDSALIFPEVNEAVLHKRRKLDQDSKQRDHKGFRFVNFD
FT                   KLQGIGAASYKDAEPKQPSSTMILTDWNSEGRGYRPVLGLSPLTVTSVAGKNFKNPTNR
FT                   EAIELIGYSILRELSFKWAMTNLKIKPIDIVKGFLASVRSTKLMEQSTAGYTKLDLIHA
FT                   VQAYVGLKYLEENTIDGIAKWYKTRLETRDLNFYFDKDTWITKQKPELESLCRSHIAGP
FT                   LDLTLFSQVNQPTLLRYLPHKLPPIPRLTNDFLYSFIRLSFSYPFHNNKYPKVNYFKKS
FT                   LDGLGDAILKRISCEYFMNVSKTDPTFKWNMDDIHFINTNILFGRLAIAYRLHEGIQNE
FT                   EYSAFIKNRLLGSLDSANVFLGNHFETLVSVLYLDSPETCTKWMFKVYDAVRNNLTASN
FT                   GKETFLDKEKYIRLYEHQLKTHTLY"
FT   gene            complement(<24224..>24613)
FT                   /locus_tag="CAWG_02366"
FT   mRNA            complement(<24224..>24613)
FT                   /locus_tag="CAWG_02366"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(24224..24613)
FT                   /codon_start=1
FT                   /gene_family="HOG000093798" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPG7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG7"
FT                   /protein_id="EEQ44106.1"
FT                   /translation="MSTPNVTNISSDDEDDEIEVLEFRKLTQDLIDNPTQPEERKITKK
FT                   LSDVECPICFDEVRRAITTSCGHVFCLECIERSISSSHARGQVRSSQRGRGLCPLCRKQ
FT                   VVFKETIPLKMKKAEKIDKPDLPPK"
FT   gene            <26393..>27157
FT                   /locus_tag="CAWG_02367"
FT   mRNA            <26393..>27157
FT                   /locus_tag="CAWG_02367"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        26393..27157
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5A7M9"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7M9"
FT                   /protein_id="EEQ44107.1"
FT                   /translation="MTKTQQPAVFYVHAALFDCDGTLVNSTGAISEFWRDFGKTRPHVD
FT                   PEEIIRTSHGCRTFDVIAKWSPEDAIEEQVTAWEGAIPDTFGHHAKPIPGSVELVKSFD
FT                   KLSKEATENGKQRWAVVTSGTLPLATKWLKLLSIERPDCFITAEKVTKGKPHPQGYQAA
FT                   RDTLGYHDAHYKVVVFEDAPAGITAGKGAGAMVVGICSTYDPEKVRKSGANIVVKDLSS
FT                   FRIDSYNKETDEFKVVVDDYFYADEQFLQESA"
FT   gene            <27439..>29529
FT                   /locus_tag="CAWG_02368"
FT   mRNA            <27439..>29529
FT                   /locus_tag="CAWG_02368"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        27439..29529
FT                   /codon_start=1
FT                   /gene_family="HOG000074523" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018843"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPG9"
FT                   /protein_id="EEQ44108.1"
FT                   /translation="MSKPELYDQYMITTLPRTPDLELSDKVVVSTIKSIDTSIIDIGVS
FT                   KSTISSHITKPTPKLLWSYSLNPTTIVECMDVLAKEDKKYYVCGLSDRKKFRLLLVETT
FT                   RSITEDGNANYTTTNELELKLDRKPVGIKFMSPEIITVLYVNGSVEEVGFSENILQFSG
FT                   VKYTDTKSNDTVVYSAFVNDLEDNLLLTVSTNSKSTIYRLIAINSKNSILEVNSHSVPG
FT                   VSNTKFCYSSGSLYQYANKTIESLSITNFKITNTVSVDGIINDEEITSIVAPAPDRVLV
FT                   GNSNMIYLINVKFASLLSSFKSSSSSSHPIPDKVFLNQVVPVKGNSTNSYISMAVYLNL
FT                   KNKDNNVYLNVIDINVGMNKLSECLGKSLNKQKPGFHEIPELFNIQDALPSSDEIQEVY
FT                   SYLKDAKEAQDLNKWESILIPYLKNKKTWAEIKSLSRASKKDKVYEFKEFDVDNDRVID
FT                   IGFIDSVLQLIFTEDPLAFANEQFVPEYTLMYLLTNPLFPIRFTSGLIELFSVTGNTTL
FT                   LRQAINTCPNIPCRDLLDQLVNEENKETLLDLINRIIGEFSRKEITNTFKQLIQGNAVD
FT                   VVELISKLIGLPGNNNWYLVEILVDVNGLFNWDMGDIKALDEIISQKVEALTVNSYNLT
FT                   LSHQVLLHNKRLSKKAKEKGSTSHLDNLLTLTSHSTSAKFDDTPEEANLKVPVYSVERV
FT                   NF"
FT   gene            <29700..>29951
FT                   /locus_tag="CAWG_02369"
FT   mRNA            <29700..>29951
FT                   /locus_tag="CAWG_02369"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        29700..29951
FT                   /codon_start=1
FT                   /gene_family="HOG000171075" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH0"
FT                   /protein_id="EEQ44109.1"
FT                   /translation="MSSVLSAYRNALRATKVAFRQDLPILQAARVQLKQGIRDNSNLQA
FT                   QPEIEEAVQKLNEVAKFLIQNIVQGEKQTDGKYFLNFP"
FT   gene            <30190..>30813
FT                   /locus_tag="CAWG_02370"
FT   mRNA            <30190..>30813
FT                   /locus_tag="CAWG_02370"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        30190..30813
FT                   /codon_start=1
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPH1"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH1"
FT                   /protein_id="EEQ44110.1"
FT                   /translation="MPPPDKARRDVLISKALSYLLRHGAEKEKLSIDDQGYVKISDVLS
FT                   HQRLKSLKTTRDDINRIVQENDKKRFTIKDDMICANQGHSLKAVKNDNLTPMTVDELSQ
FT                   LRIYHGTYRTKLPLIKSSGGLSKMNRNHIHFTCDQYSTCSGIRYNANVLIYINASKCIE
FT                   HGIVFYKSLNNVILTSGDKDGKLSWEFIDRIVDLDGNEINKEQV"
FT   gene            <32982..>33689
FT                   /locus_tag="CAWG_02371"
FT   mRNA            <32982..>33689
FT                   /locus_tag="CAWG_02371"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        32982..33689
FT                   /codon_start=1
FT                   /gene_family="HOG000093799" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH2"
FT                   /protein_id="EEQ44111.1"
FT                   /translation="MFMDNQQQTLLTPRAHTYYPKMHTTPKQHTRSASSSQRTNLAPPA
FT                   SNRSYSQNHLLPNQPTTREPQENSMLTSDNKICQWYCCSCGQSYGSVLYKDDYREVRPN
FT                   GQPPQKRARSLDSSNYILDSLKYYSQVVYRDHKHVISNASFSAGSSVNSNADTNYFDCK
FT                   TATTDTEESHSPTITPNTPMLSPLHLNLNHNSFIDYREKVILNIPTRFTCHRCDHMMCP
FT                   YCLKLRLKDLDTS"
FT   gene            complement(<33957..>34621)
FT                   /locus_tag="CAWG_02372"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            complement(<34745..>36772)
FT                   /locus_tag="CAWG_02373"
FT   mRNA            complement(<34745..>36772)
FT                   /locus_tag="CAWG_02373"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(34745..36772)
FT                   /codon_start=1
FT                   /gene_family="HOG000093801" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPH3"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH3"
FT                   /protein_id="EEQ44112.1"
FT                   /translation="MEDTSLVDDKINLAILYFKSQNYEKALSTYNVLINQLKNLPRSTI
FT                   KQIRKSYNLLETPLVGPAIHPKLGSLLDQRAATYEKLNQLASALKDGRELIKLEPIGCK
FT                   GYLRTGKILYSLDKKVEAYKCYQEGLYIIEKSIKDYNITVPEKLFTSLKTQYKALNIEL
FT                   KRKRTMAETKETTKLVKKTRIRTTDPFAYFPVDILELIFQNIPMNQILKCHTVSKLWYY
FT                   TLTSIPRLYDFKCRANIALNEFVSGVRLFKKICSYSSSKSVQHVRINHACNKQHLAKML
FT                   DILIRQQGILPRNLSIMDKNFNLQLLFHLFAKSGWKLLNFQNLESLKIGINCSIKYGHA
FT                   LLNMFKKLKALEIVILVSEKSSLDLIPIQDKLFRRFKDQELEEYGLERLLLVNHPKLLS
FT                   DNPNPISPQTYSPYPILLNRVFPGLTELTLVSFDFSTTLPQFGEFLMQTPKLEKLYLEN
FT                   NQAINMLIFFQMLVNYKPTFKLQEFTFRESSVVSAISLTEFRLTDLPQLKNLYKLDLYK
FT                   NCLSVTGFLKMLKIGGKSIRHLNIGHSIYISFVLHSTKMIYLYDILDKCPHLSHLYLND
FT                   MDIDQQAMVQINKDLERISCHLQMLDLSFNKIDGVSLIRMFEKCLIVNPIEQMVLHGMD
FT                   ISTDTIQYLIRKKYVNSVSTDTARLKWQAFGVNSWVQERS"
FT   gene            <36931..>37743
FT                   /locus_tag="CAWG_02374"
FT   mRNA            <36931..>37743
FT                   /locus_tag="CAWG_02374"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        36931..37743
FT                   /codon_start=1
FT                   /gene_family="HOG000164405" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5A7N9"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7N9"
FT                   /protein_id="EEQ44113.1"
FT                   /translation="MTLVLIALPLVMFVATFVAGILPLKLTVAQHHLKYLSFLSMGILI
FT                   GTAMMIILPEGIETISHETTDVASYVGFPILLGFLTMYILDCMFSTNVKAQESSVVESV
FT                   VGSPITLGLIFHGIIDGISLGSSLASGEVMTLIIFAAIIIHKIPTSFSLSTILLQEGTS
FT                   DSKLYWHILLFALSSPSACWFTFVLIKLVNAKSNLVIGVLFLYSAGTFLFVVNHVMHEF
FT                   SSNDFYTLPTSVESDTTTVESHSKISRNELILSLIGILIPTLLSFAKE"
FT   gene            complement(<37774..>40621)
FT                   /locus_tag="CAWG_02375"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            complement(<40979..>41524)
FT                   /locus_tag="CAWG_02376"
FT   mRNA            complement(<40979..>41524)
FT                   /locus_tag="CAWG_02376"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(40979..41524)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH5"
FT                   /protein_id="EEQ44115.1"
FT                   /translation="MIGDITTSSSAIVGFVSASKMCNLIPIRKTNCLHVARMYDSILSQ
FT                   PITVSPFLVASLTVKKNPGNPPMSDQERIDPVRKIPCNLENLTSDPNVLTTLWVPSGTF
FT                   PKRYSNPFLVVKHIRGLVVSSVKCVIVVTLNISVPFETGLFGVLGLLSWVLQVCRWYFP
FT                   ECIKLVENKERLEKGKVF"
FT   gene            <41118..>43691
FT                   /locus_tag="CAWG_02377"
FT   mRNA            <41118..>43691
FT                   /locus_tag="CAWG_02377"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        41118..43691
FT                   /codon_start=1
FT                   /gene_family="HOG000093802" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH6"
FT                   /protein_id="EEQ44114.1"
FT                   /translation="MFKVTTITHLTDDTTRPLICLTTRKGFRYLFGKVPEGTQRVVNTF
FT                   GSEVKFSKLQGIFLTGSILSWSDIGGLPGFFLTVSDATKNGLTVMGCERILSYILATWR
FT                   QFVFRMGIKLHILDAETNPTIADEEVVISPIMIDPANQTSPPENSSKLVRQIKKLASLM
FT                   FPLDTSQVNSRDPESYKSDPTQNDIHTHVHLPSASEIATTQQSISYCISFVPVLGKFDP
FT                   KKAKELGLTPGPQYRDLTNGLSVVNKNGDTITPDQVIAPNRVFRKILVIDVPSNDYYEN
FT                   TINSDRWFEHDHPKNAGEVGLVYHMLGQDLDLDLSDYKERFLSKFPSDTYHVISHPSMT
FT                   NNVIMNDRFISNTLKIKSILNENFNLVNSENFKPLSNSQVDRLHALQSYHLNDNGVVPD
FT                   SSSAIKTTNKSLFEEEVESLDIPNAANFETMEKTKIELDCNKHTNLKDRVQVFMLGTGS
FT                   ALPAICRNVLGNLIRLPYQDDSGAISYRSIVLDGGENTIGSLLRLFGHENGKEFVQIFQ
FT                   ELSLIHLSHLHADHHLGIVSLINEWFNINQDESKLLYLVVPWQFITFLKDWYSLESQYN
FT                   KVFDMNRLVCISCEDFMMDNRTPEFIKIDMDKFEEFYDEGGLHKPIPRDRLLSVDHKKI
FT                   KNMYETVGLNSVTTVRALHCAWAYSTTFDFKLNENGETFKISFSGDTRPNPRFSECGYG
FT                   SDLLIHEASMDGNWIEEAIAKKHSTMIEAVAVSKLMNCPKLILTHFSSRYGISNNCVPK
FT                   NELQSCADNLDTYLNKSHCELNIFQSQSPSDLSLEEIDLWFAYDLMGVCYGDMHKQEYV
FT                   WPILSELFLPSAEVDHEKINEKKEVKRLERLAMMKTKKKRKMSPK"
FT   gene            <43794..>44426
FT                   /locus_tag="CAWG_02378"
FT   mRNA            <43794..>44426
FT                   /locus_tag="CAWG_02378"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        43794..44426
FT                   /codon_start=1
FT                   /gene_family="HOG000093803" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPH7"
FT                   /db_xref="InterPro:IPR019437"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH7"
FT                   /protein_id="EEQ44116.1"
FT                   /translation="MFRSVSLSSLIPFLIIVSIAMQRPENDVPMIMQSSWLINEVIKSI
FT                   NSNGQYINALIKKDFQPTVLPVSFILRILKFTATTDSKDITAVLADSTHKIFAIFLFSP
FT                   AIVDFENKYHHRMTYNTRSCLIRIHKANLKFMDKSTVKKCYGRKSDGGLAIAVLEVLEF
FT                   DIFFKDQYSFINSIENRLKYVYDDAEYNQLCGEKKHKPEYEDLMCDI"
FT   gene            <44560..>45189
FT                   /locus_tag="CAWG_02379"
FT   mRNA            <44560..>45189
FT                   /locus_tag="CAWG_02379"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        44560..45189
FT                   /codon_start=1
FT                   /gene_family="HOG000093804" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7P4"
FT                   /protein_id="EEQ44117.1"
FT                   /translation="MAETNPNDNSPKSLPLRRHSDVLVNTGTTYSATTPNSLNEGNSIS
FT                   SHRELIIPSSAGGRQQSPVLDLVHPISSGNLTTTSQETRTRNCISWCSGLFNFRNSSQQ
FT                   TAENSSLLPVYHVRSNTSPTDSAGMTSNLSDFIRRLLPGLARDRYPNTFSWLLATLLTI
FT                   VLIAATLGLYFSGNLSGLLVLFRALVCSVFRQFQPSDVALPLFCRS"
FT   gene            complement(<45266..>46372)
FT                   /locus_tag="CAWG_02380"
FT   mRNA            complement(<45266..>46372)
FT                   /locus_tag="CAWG_02380"
FT                   /product="60S ribosomal protein RML2, mitochondrial
FT                   precursor"
FT   CDS_pept        complement(45266..46372)
FT                   /codon_start=1
FT                   /gene_family="HOG000232982" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02380"
FT                   /product="60S ribosomal protein RML2, mitochondrial
FT                   precursor"
FT                   /db_xref="GOA:C4YPH9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPH9"
FT                   /protein_id="EEQ44118.1"
FT                   /translation="MLPITRRWLGNTASPAVSLLKYSRAFVRFNSTSELTELELQDIKY
FT                   RKQRELSLKLTKMKNYGDAFPAHSHPGSTHYKKPVHDHLHKGRPIKELTVARSHRSSGR
FT                   NNEGKITVRGRGGGHKKRARLIDFHRWNAGRQEVVRIEYDPNRSGHIALLKHLETGDLS
FT                   YILAPQGLRSGDIVESFRQGIPKDFMEEMERTNNGEIDDALLSARILQRGNCLPLRMLP
FT                   VGSIIHNIGLRPGDRAQLVRSAGTFGKILSKHPEKNRAVIKLSSGEQRYVILDCHATLG
FT                   VVSNKEHQLISWGKAGRSRYRGLRPKVRGVAMNACDHPHGGGRGKSKSNKVSQSMWGLK
FT                   KFQKTRLRPNPDQIRNRKGHLINHDKFK"
FT   gene            <46715..>47332
FT                   /locus_tag="CAWG_02381"
FT   mRNA            <46715..>47332
FT                   /locus_tag="CAWG_02381"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        46715..47332
FT                   /codon_start=1
FT                   /gene_family="HOG000075825" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPI0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI0"
FT                   /protein_id="EEQ44119.1"
FT                   /translation="MISRVFSRSLSSAAKSTKPPIQLFGIDGTYANALYSATIQQSDMA
FT                   QTYKSLEKIENVIKGDPQLKNALTNPSLTKDDRVAIAKSVANDLSLDKTTANFLTVLAE
FT                   NNRLGNFSSVFQKFGLLNDAYNGVVEAKVTSAKPLESKILKRLQTSIGKSSFVGEGKTL
FT                   KLTNQVNPEILGGLVVEVGDRTVDVSIANKVARLNQTLRDNL"
FT   gene            <47732..>49144
FT                   /locus_tag="CAWG_02382"
FT   mRNA            <47732..>49144
FT                   /locus_tag="CAWG_02382"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        47732..49144
FT                   /codon_start=1
FT                   /gene_family="HOG000093805" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPI1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI1"
FT                   /protein_id="EEQ44120.1"
FT                   /translation="MAISPKIKALVDLATVIAILLNFFVYFYPDIVNPTEKCNWYNAPE
FT                   QKSKYTFLNNNLPTDWVNKLVLNFPSLKEQEEVVSNDIHMLLFGDPQINGNWPSTKYIK
FT                   RLDNYGNDYYLGHIYNTMKRRLNPSHVTVMGDLFSSQWILDSEFYNRTYRYVERLFPQP
FT                   LEYKQNALEVHARHENYNWQQWLEDEKAMDPIHRFQSRVYNDVYDWVYRNRSTPNYDQP
FT                   LFINLTGNHDIGYSGDATWQHMARFHLLFGQNNYVINYKKGTPDEWRIVVLDSLTLEGP
FT                   ALQEEFVNYTWSFLENLRDRENPNFKGSTILLTHVPMYKKAGLCRDGPEHKYYINNEKE
FT                   PYKNGKLRSHNHLAYETTQKVMDIVFPNKGKSGIILTGHDHEGCDDWYNYINGEWIASK
FT                   EKQSAERESVREVVVRAMMGEFDGQTGILTGHFDDARDTWDFHFSYCLFVIQHCGGSKV
FT                   LTVVSLHLVKLL"
FT   gene            complement(<49291..>50082)
FT                   /locus_tag="CAWG_02383"
FT   mRNA            complement(<49291..>50082)
FT                   /locus_tag="CAWG_02383"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(49291..50082)
FT                   /codon_start=1
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5A7P9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7P9"
FT                   /protein_id="EEQ44121.1"
FT                   /translation="MPELRRSARVAARPAKEPEAVTEQPPTKKVKTAPTNTAKPDAGLG
FT                   IGEKIPDVTLLNQDGEEISLTEVAKGSKYVVIFAFPRASTSGCARQVSGFRKLDKDYKD
FT                   VSIFGVSSDSVKAQKNFQTKQNAEYDLLSDPEKKLIGALGAKKHPSGIIRSHWIFVDGV
FT                   LKVKQIQVSPEVSFTSAEEEIKKFINENENGKEATENDVTKEEVKEESQQDDKEDNTEQ
FT                   TDEKATEQTQDEVKKVSDETKVEDETEEKPTEEQKTEAPVV"
FT   gene            <51312..>52937
FT                   /locus_tag="CAWG_02384"
FT   mRNA            <51312..>52937
FT                   /locus_tag="CAWG_02384"
FT                   /product="histone acetyltransferase ESA1"
FT   CDS_pept        51312..52937
FT                   /codon_start=1
FT                   /gene_family="HOG000182457" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02384"
FT                   /product="histone acetyltransferase ESA1"
FT                   /db_xref="GOA:C4YPI3"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI3"
FT                   /protein_id="EEQ44122.1"
FT                   /translation="MAVAEIKKEKGSSLSPEPSSPIQILSTEPDANTDIKQEKFTPKDI
FT                   LPGCKVHVSKDGEFRLAEILQEHIKKGRKVFYVHYQDFNKRLDEWIELDRIDFTRSLIL
FT                   PEIKADTKENKSKKKSKFKGQTKLSKNNTTANSTTGTPQPSDGQPIMGDDEMDLENLNV
FT                   QGLKRPGEEFSREDEIKKLRTSGSMTQNHSEVARVRNLSTIILGEHIIEPWYFSPYPIE
FT                   LTEEDEIYICDFTLSYFGSKKQFERFRSKCSMKHPPGNEIYRDSKVSFWEIDGRKQRTW
FT                   CRNLCLLSKLFLDHKTLYYDVDPFLFYIMTIKSDQGHHVVGYFSKEKESADGYNVACIL
FT                   TLPCYQKRGFGKLLIQFSYMLTKVERKVGSPEKPLSDLGLLSYRAYWTDTLVKLLVERN
FT                   SPALFRKNNPQLEYDEAENGKDSSATPTPGPGSNASQSAVLASAAASRSGLNSSPIFSN
FT                   EITIEDISSITCMTTTDILHTLTTLQMLRYYKGQHIIVLTDQIMELYEKLVKKVKEKKK
FT                   HELNPKLLNWTPPSFTANQLRFGW"
FT   gene            complement(<52958..>54127)
FT                   /locus_tag="CAWG_02385"
FT   mRNA            complement(<52958..>54127)
FT                   /locus_tag="CAWG_02385"
FT                   /product="pre-mRNA splicing factor PRP46"
FT   CDS_pept        complement(52958..54127)
FT                   /codon_start=1
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02385"
FT                   /product="pre-mRNA splicing factor PRP46"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI4"
FT                   /protein_id="EEQ44123.1"
FT                   /translation="MSVTATSHDILKSIDDSILPPEDTLSEAMYNNVKLDHYFNKLPKS
FT                   SEENNINDQTNQLIVSAAPESEDSPAAEWKLLRTLAGAHQGWIRAISLDEITNKWYVTG
FT                   SADSTIKIWDFENNSLKAVLTGHVLGIRSLCISKRHPYLFSGGEDKSLRCWDLERSNSD
FT                   AGCQIRSYHGHLGGVYSIGLHPELDVLFSGGKDCVVRVWDIRSRVEAMTLLGHTNDITS
FT                   IQTDYNDPQVITSSMDGTIRLWDLRKSKTELLITNHSKSIRSMKSHPKEATFVSGDSNG
FT                   EIKQWLLPKGELLNEFGTSQLSPNQRDNSRIINTLAINPVTNTLFSGYDDGKLEFYNYT
FT                   TGNLQQSGQSPSLAGPEQSAIYASTFDMSGLRLLTCHGDKSIRIWGTSY"
FT   gene            <54266..>55351
FT                   /locus_tag="CAWG_02386"
FT   mRNA            <54266..>55351
FT                   /locus_tag="CAWG_02386"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        54266..55351
FT                   /codon_start=1
FT                   /gene_family="HOG000093806" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI5"
FT                   /protein_id="EEQ44124.1"
FT                   /translation="MEVRAVTQDNDQLSIIRELYEAITSSCRSQKIIQIVQIPQNENRI
FT                   ATYDDKANDTLEIGISKPTYLAMFKQSHDYWYRYMESSQCTLDKLEITILRELYLMTLG
FT                   YLITANDHHSIMNLHESIVQILGNFETDIEIISCFLTSRLKRINKSSLLWHWMKKMTIL
FT                   VIFNKLEEKQGSQHLSDSQFYNKIVSRAFRSCELHYMNYYANNFIHWIIQFNMIVLGIE
FT                   DGDYLFHQLQKHCRQALSDSSLWMNMKNYIKCIQGSVQHDNQIIEEYNRINLSYGVPLR
FT                   IHSKKQLISPNKSDEDIIVGEFQWLVKVQCKNVAPFSNLIELAQTKTVLKRLNELIQLH
FT                   GFKHNAAKIESLIELRSRMIG"
FT   gene            <55526..>56110
FT                   /locus_tag="CAWG_02387"
FT   mRNA            <55526..>56110
FT                   /locus_tag="CAWG_02387"
FT                   /product="NEDD8-conjugating enzyme UBC12"
FT   CDS_pept        55526..56110
FT                   /codon_start=1
FT                   /gene_family="HOG000233456" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02387"
FT                   /product="NEDD8-conjugating enzyme UBC12"
FT                   /db_xref="GOA:Q5A7Q5"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015580"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7Q5"
FT                   /protein_id="EEQ44125.1"
FT                   /translation="MLKIRQLQKKKQEEAERLAKSQSTTPTPGDSTSTSNQRVSPAQIR
FT                   VQKDISELDLPSSIRVTFPNPNDLFNFNLQLIPQAGYYKNGKFEFKIEINSNFPIDPPK
FT                   IKCLQKIYHPNIDLQGNICLNILREDWSPVLSLTGVFMGLNFLFLDPNATDPLNKDAAN
FT                   VLVKNRKQFEINVFNSMRGGYLDSVYYDRVI"
FT   gene            complement(<56209..>57669)
FT                   /locus_tag="CAWG_02388"
FT   mRNA            complement(<56209..>57669)
FT                   /locus_tag="CAWG_02388"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(56209..57669)
FT                   /codon_start=1
FT                   /gene_family="HOG000000796" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017252"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI7"
FT                   /protein_id="EEQ44126.1"
FT                   /translation="MEKLQILTERQQTELNHAIIQYLQPLCQQDNHVLLDQLSKLLNID
FT                   QSTQESNNVEKVDNYLEKRWSTVLRLQKKIIDLENEISNLNNIINSTNSDNNGIILSKD
FT                   KINWIPKGAVKQSYQCENIVTTVKLHPNLPLVLNGCNDGNLYIWNISNDDNTIPEKMIK
FT                   AHTRAINKICFTYKKPYYLATCSSDLTIKIWDEKFNHIRTLNGHEHTVSSIQFSPVDNS
FT                   ILYSVSRDKNIRVWDIFQGISLKSFVGHSEWCRDLDIISSDTYGDFVLTCSNDQSARLS
FT                   HANSGAGVAMIVGHSHVVETVKFLPSLQANKILDEYITKNTEQFPTIPLELLKDKTYNQ
FT                   LGFKYCITASRDNTIKLWLIPPPTIAPHRPPLPSKYNNSQSWLIAELKGHSSWVKSLCV
FT                   HPNGKFIISGSDDKTIKFWDLSGLLETGYVNVVKTIIGHDGFINDIDFARLKEASDVSE
FT                   EDLLKQVEKRMRCLFISGSADNSIKLWN"
FT   gene            complement(<58371..>59132)
FT                   /locus_tag="CAWG_02389"
FT   mRNA            complement(<58371..>59132)
FT                   /locus_tag="CAWG_02389"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(58371..59132)
FT                   /codon_start=1
FT                   /gene_family="HOG000205346" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005061"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI8"
FT                   /protein_id="EEQ44127.1"
FT                   /translation="MARPGSAPPHLNPLRLKTALKMAISKLRFIQEKKTAITKQQRRQL
FT                   SELLSQGKESSSKIRVENIIRDDIYIELLEILELYCELLLARLPILLERTTVEKNLQEA
FT                   VNSIIYSANHTELKELVTIKDILIYKFGGPEFAQPILDNKNGEEVPEKVVKRCDIEPPS
FT                   ETLVDLYLCEIARAYNVPYSGLKEEEATNASGDNSDDDNDDGGQKEFGLAEPLGGVAVK
FT                   PVFKNHDPKQQEESDFDALKARFAALKGTSP"
FT   gene            complement(<59420..>61510)
FT                   /locus_tag="CAWG_02390"
FT   mRNA            complement(<59420..>61510)
FT                   /locus_tag="CAWG_02390"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(59420..61510)
FT                   /codon_start=1
FT                   /gene_family="HOG000093807" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPI9"
FT                   /protein_id="EEQ44128.1"
FT                   /translation="MPDKHKLKLFGKHKHDKDDELSLSTSNHSHGSTRKFLGFHIGRHE
FT                   SGDSLTSPVMSNSSESHHHSHHPHQANSSANHRNPSPVHSNTGTATTIPSIQSPQPQAS
FT                   GLHREDSDKKSSGSVVDLKKFFKTKKTSNPRKEGHSILGQYSNQLHSPPPMAQVHSPGA
FT                   GSGNGSALQSREQSSTSLATLINQTSSQLLYNASHSVNSNRDPFTDDNSPLVKKYGKIG
FT                   KELGSGAGGSVKLITRPSDSKTFAVKEFRAKRSTESLKDYTRKCTAEYCIGSTLRHPNI
FT                   IKTIDIIHENNRYFEIMEYAPIDFFAVVMSGEMSRTEINCCLKQIIEGVAYLHKLGLAH
FT                   RDLKLDNCVIMNEGILKIIDFGSAVIFKYPYEQFGNNNSIQPCHGIVGSDPYLAPEVLK
FT                   SPNSYNPQPVDLWSIAIIYCCMTLKRFPWKIPSQEKDNSFRLYCMYDDNFHDYYLSNEC
FT                   HKLLLQQRKLKNTIVRSNKRKKQLEEEKGDKPEEDEEMKDADSAPQQHHHSHDVESGKT
FT                   GGSTVGKDKSNEAVTVLTDEQAEEIMAQLNDIDRKLQEFEDKKNELKEKYEALRDADPR
FT                   YQKQLAQIHEEEEKQRLKDAEHGADEKKKSHHKQIHGPYRLMRLLPHAARPVISRLLEV
FT                   DPKKRATMEEILEDEWIKEIQCCTVKPVSKSTDATLDFIEDEDEVLVKGVPPHEHTIVK
FT                   EG"
FT   gene            complement(<62959..>64269)
FT                   /locus_tag="CAWG_02391"
FT   mRNA            complement(<62959..>64269)
FT                   /locus_tag="CAWG_02391"
FT                   /product="protein SOF1"
FT   CDS_pept        complement(62959..64269)
FT                   /codon_start=1
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02391"
FT                   /product="protein SOF1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7Q9"
FT                   /protein_id="EEQ44129.1"
FT                   /translation="MKVKTISRSSDTYIPVKNTQESALPRNLNPALHPFERAREYTRAL
FT                   QATKLERMFAQPFIGQLGDGHRDGVYFIAKNYQATNQIASGSGDGIIKYWNLTDRLETA
FT                   SFKAHYGMVSGICIYANKMYSCGDDKTIKIWSVNSDDFDIKVNDDVDGIYRNQLGGAGG
FT                   GDGKTSGGLLKTFIGEHSFKGIDHHRDDDLFVTGGATIQLWDVNRSKHISDLSWGADNV
FT                   GTVKFNQTETNIIASSGSDNSIVLYDIRTNTPVHKVVTSLRNNCITWNPMEAFNFATGN
FT                   EDHNGYLYDMRNLQKTLKVYKGHVGAIMDVDFAPTGQELVTGSYDKTIRLWKTLDGRSK
FT                   DVYHTKRMQKVFSVKYSTDSKYIISGSDDTNLRVWRSDASSRSNIKSSRQRAKLEYQDK
FT                   LKERYKYMPEINRIARHRHLPKPVKKAQDMKRLYSKK"
FT   gene            complement(<64948..>66270)
FT                   /locus_tag="CAWG_02392"
FT   mRNA            complement(<64948..>66270)
FT                   /locus_tag="CAWG_02392"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(64948..66270)
FT                   /codon_start=1
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02392"
FT                   /product="hypothetical protein"
FT                   /note="similar to small CTD phosphatase 1 splice variant"
FT                   /db_xref="GOA:C4YPJ1"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ1"
FT                   /protein_id="EEQ44130.1"
FT                   /translation="MGLLSSLLCCSIESKDDNDDKVHRPSTSNGIATTTSNKSNAAVTS
FT                   ASSKGNSSRNNQQDKAKKINTTTTKTTKANTTIKPTTNTSKSQSKNTPTRHGKDANSNE
FT                   NNSDLTKDNDIDVMGDEDEDEEDEVDALKPSKKDLLDDDQSINEIETIANTNDESNNNT
FT                   PKSSNDTTKTDTNNTKINTSDIITQVPENGGAYTTTNSSNNYQKESRNSVQKNETRNGE
FT                   DDDEEEEDEDDDEDDESLEDLTKLQDGQAFNPETGYLLGKKDKNFGNKKCLILDLDETL
FT                   VHSSFKYLRNADFVIPVEIDNQIHHVYVVKRPGVDEFLQKMGKLYEVVVFTASVSKYGD
FT                   PLLDKLDIYNSVHHRLFRDSCYNYQGNFIKNLSQIGRPLEDTIIIDNSPASYIFHPDHS
FT                   IPISSWFSDSHDNELLDLIPFLEDLAKPIVDDVGLVLDISL"
FT   gene            <70148..>71836
FT                   /locus_tag="CAWG_02393"
FT   mRNA            <70148..>71836
FT                   /locus_tag="CAWG_02393"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        70148..>71836
FT                   /codon_start=1
FT                   /gene_family="HOG000248681" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ2"
FT                   /protein_id="EEQ44131.1"
FT                   /translation="MLFKNFLLLFIATATTVFASYDVSSSLIHYHDFNFNVGDIAIRNG
FT                   ASFSLVNTFDCLFKGDLTIEEKSKLYITSTGRALILHIAGLFNKVKNDGLLVVNTLESH
FT                   AAAICKILGASFVNTGDAIFAFQGRFLPPIIALTARQWQNFGRMHFLQKFPSKSLAMLG
FT                   HFGGTIENHGTLCFTNQIFKQLTTIDGRGCIALEKSSSFFIENSLFPIDRRQVIYMGEG
FT                   NPSIQAVVTTFPQTFKVANFGGNGAHKIGLNLPLMYFPHHDEHDWFYDEETGILTLRAT
FT                   EFLSQNFDIGLGYDPSKFEVCSDESVGFLWVFNGAIKYNGPAPNPGRPSICQACPGIHS
FT                   APGAEPSTTTKSIITTKTDGAVCTEVDTVIVSSDKSGSWYTTTSGASINCGTTSEAPIP
FT                   NPRVTITTTWTEITTATVTETGTKTDTVIVQVPTTPNPQITVTKTWTESFITASTVTGD
FT                   KTDTVIVDIPETTTSCLTTTNTWTGDYITTITTSGWIIVEVPTQNVVTIVYTDSQSTSG
FT                   KTTTTPVVTAETSATTGNDNTASTTDATGKTLTTVTSSNDNTTSTG"
FT   gene            <72186..>72752
FT                   /locus_tag="CAWG_02394"
FT   mRNA            <72186..>72752
FT                   /locus_tag="CAWG_02394"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        72186..72752
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ3"
FT                   /protein_id="EEQ44132.1"
FT                   /translation="MLSVRTALPQSIMVTMNPQSLLSVMTISLPLGITISLLQQLKSVI
FT                   MTRLQSLTIALNPQSLLSVMTISPPSVTMISLLQSMLSVMILQQPQSVTIALNPHSLLS
FT                   VMTISLPSVTMTQLQSFPSEMIIVLLKRVPPTPKTILPVSGMMTSPLLSLSMLQRSVIL
FT                   SALQKPSTQNQRKQRLTRLRHLKSN"
FT   gene            <76743..>78278
FT                   /locus_tag="CAWG_02395"
FT   mRNA            <76743..>78278
FT                   /locus_tag="CAWG_02395"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        76743..78278
FT                   /codon_start=1
FT                   /gene_family="HOG000248681" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ4"
FT                   /protein_id="EEQ44133.1"
FT                   /translation="MLLSNLVIPLLATRATVSATFDVTSSLTKYAAFDFGVGDISIQKS
FT                   ASFSLINTFDCAFQGDINIEKDCEFLIASTAKALKLTFNNIFHKIENKGKWIVHTLESA
FT                   AASTCNIIVKSFVNTGEIILAFKGHVLAPIINITASHWVNHGCLHLFQEIKSISVAILG
FT                   VVGGTIENHGTICLTNQLCKQVTKIIGSGCIALEKSSSFFISNSFLSIDAQHTFYLGEG
FT                   NPTIQAQAVSLPQTFKVANFGANGSHKIGLNLPLLSITIAGKKGWSYDTKTGILTLTAN
FT                   GFISQKFDIGLGYDPSKFEVCTDNSVGIVSVIKGSIKYNGPCPHAGRPSVCQICPDVPT
FT                   PPVITSSATAITSTQSKTTSSSSTSSIATTSTTSSKPKPTTVSTSSIASTTTPDGSYST
FT                   SFVTVTAETTKVVTITSCSNNACHPTTAPTGLTVVTLTTSDVKTVVTTYCPLTQTVTLG
FT                   VTGTKTVDLGCPTGYFGYNGYIGKGVSIGHGGAAASASAGFQIGFDIFKNHHF"
FT   gene            <77578..>78096
FT                   /locus_tag="CAWG_02396"
FT   mRNA            <77578..>78096
FT                   /locus_tag="CAWG_02396"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        77578..78096
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ5"
FT                   /protein_id="EEQ44134.1"
FT                   /translation="MLMDSFRKSLTLVLVTILLSLKFVSTIQLVLFPLSKVLSNTMVHV
FT                   HTSEDHQCVKFVQTFQLLQLLHQVPPLSQAPNQKLLVPHPLQVLLLLVLPVVNLSLLSF
FT                   LLALLLLQLLQMDLTLPHSSSLSSKPLRLLLSLLVLTMLVIQQSLQSVLSSSHLLLSMS
FT                   KSLSLLTVH"
FT   gene            <78735..>79463
FT                   /locus_tag="CAWG_02397"
FT   mRNA            <78735..>79463
FT                   /locus_tag="CAWG_02397"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        78735..79463
FT                   /codon_start=1
FT                   /gene_family="HOG000074503" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ6"
FT                   /protein_id="EEQ44135.1"
FT                   /translation="MTNTDESLSMYFDDDFNPSSYIDKLVNSITNSNPASSTTPVSAYS
FT                   KQSLTKLSNDISHLITHLDYYTNMLTNDSLQKKLDALDKSNEIINNNEESGTTRLQYNV
FT                   HVFNNAVLSLQTELNEINRQLDESTINNEAISKLIQLKQVKANLTKVLHIFELVYNSIS
FT                   QDDELSFTVDKFQNALDELFASIKNQLDTSDKNVKLLAQIDKLLEMNGLFTHLSRFNTV
FT                   FKKFLTKLSNEKEVYLNSKR"
FT   gene            complement(<79561..>79976)
FT                   /locus_tag="CAWG_02398"
FT   mRNA            complement(join(<79561..79903,79966..>79976))
FT                   /locus_tag="CAWG_02398"
FT                   /product="protein PET191, mitochondrial precursor"
FT   CDS_pept        complement(join(79561..79903,79966..79976))
FT                   /codon_start=1
FT                   /gene_family="HOG000173745" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02398"
FT                   /product="protein PET191, mitochondrial precursor"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ7"
FT                   /protein_id="EEQ44136.1"
FT                   /translation="MGASCKDQRKALAICLQRSPCVLLDRHTPKECLSDPDLKKDLPEL
FT                   CKAQFRAFMECKNGMFDMRKRMRGNAPLSTGKYDETFDNLSTGNFDPREEMRKLDVLNR
FT                   NLSRQQQAQEKKD"
FT   gene            <80421..>84128
FT                   /locus_tag="CAWG_02399"
FT   mRNA            <80421..>84128
FT                   /locus_tag="CAWG_02399"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        80421..84128
FT                   /codon_start=1
FT                   /gene_family="HOG000093808" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPJ8"
FT                   /protein_id="EEQ44137.1"
FT                   /translation="MTITFIPGEVNKSNYSVAHSNWKNHHIIAYGSGNNLIITGGTVQP
FT                   TNKNPNPFNVDKSLQTIYLDRDPSAIDINPENGYILVSIESKILVYKPMNEYMKIPKWQ
FT                   SSIEIDVNESTINCIKWASEENEIVVGTDSGLYLFYLYEEYGELKYRKRWQANQVNPVT
FT                   EILVTPNSKMIMTKSGSFDRLIKVWTRISYGDENTLFEVTYLPHPQGTFVIDYHLKKQI
FT                   TEEDKKNEIDASMANIKNIRDYINNATDEGEVIYSFCSDYKFRVWASCEHSGHNQINNW
FT                   ATLDLKEVFSKISTVIVIENYHLRETLIPALKNSDCALFNGLDINDLDLLFVVSDTAEV
FT                   KIYAITNISQCPPTKILFTPISGNYHFGKNEYPLINTQVKTEKISSSYIESEEFITTVL
FT                   KPLLVKEICILNERVPFLTFLLHDRVKNTLRFNIMNIEKLARGSKLESVLINKYQGHTK
FT                   SIRKLVKSNSSFSQNNVLLSISNFPQHNYIWEPMLLQTNTMSVTKRFQINVESGIVNAV
FT                   IINDVEPPVDWKRRHIVVTAGRNNEISVWDCNGSTNDDQPADLITKVKTGVEKEPLVFV
FT                   LTEYPDNTQAERKYCVVALYAHDQIKSWKLFLHYKQNKITDILFDEESVASLPQEEEIY
FT                   QATAVDAFVSEANKSLIAVISKNGLLKSYSLNFDESIRWKKVSELETNVSAASKIHGST
FT                   VINKFAVVDSTGYKLSIWDVMQGVLEYEETFPESNGPVTDLDWTFLSASKMKSTSNALL
FT                   SVGFSRFVLLYTQLRYDYTNKIPAYATLKKIDISDYTSHEIGDSIWLDGGYLIIGAGNQ
FT                   FFIDDRWVKLGSSAIDSTIRQLMSGYTDDDEEMVFDISYLVRVLNGPLPIFHPQFVIQA
FT                   LFIMQFTAVKKILVQLFQVIRRGDVITWDLNTDVENLFRNDEIYQPKRRMSLTLDTFTE
FT                   FNDEVADLLIERLMKISLPLLTRHQQSTLISTIVIVKDFTKDMLVELDPNGIRYLISLK
FT                   LSSTATATSTSSATTKKRLAQIQWAMMCKTPDILLEHVTKHYGGKIKWKEMKDSGMPFW
FT                   VEKNSFTKLFEKMAALEFKDAPLGRICLYYLSLKKKDILIRLIKHKDDKEKNKIIGFMQ
FT                   KDFTQASNRSSALKNAYVLLGLHRYLDAAYFFLLADAPKDCCRILADKVDSDLAVAVAK
FT                   VYGAEDIAENQLSISNMDYLHDPILLLNSENFYKSELLETLIRICMIYTRMGCDYIALE
FT                   LLKNWKFSDK"
FT   gene            <84913..>86397
FT                   /locus_tag="CAWG_02400"
FT   mRNA            <84913..>86397
FT                   /locus_tag="CAWG_02400"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        84913..86397
FT                   /codon_start=1
FT                   /gene_family="HOG000005382" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5A7S3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7S3"
FT                   /protein_id="EEQ44138.1"
FT                   /translation="MTIESNLESNRSEELDNLLTQLKPRLLAYIDEADPKSSNYKPESL
FT                   GTFHEPKFLKQQFIDPDNDLDKPCSEEELFETIDKVLKFSVNTWNPGFLDKLYASNNPI
FT                   GVISDILLSILNTNSHVYTVSPVLSVLENYIGKKYAQLFFHNETCGGLTFSGGSWSNIT
FT                   SLQIARSLKYPDTKVKGNGNYKFALYTSKHCHYSVEKGAILLGLGSENVFKVDVDENGV
FT                   MDVDSLKQVIEKTKKEGYTPLYINATAGTTVFGSYDPFLEISKVAKEHNIHFHIDGSWG
FT                   GNVIFSPKYRDRLAGSEYADSITVNPHKMLGIPNTCSFLLLPQVANFQTAMSLKAPYLF
FT                   HGRESGSDENYDLADGTMGCGRRSDAFKFYLGWLYYGEQGFAKRVEHAYSIMEYFVQSI
FT                   RSNPNFEIVGPQSPQCLQVCFYYHPATVNKSNTEITRYVSRKLHKLGKYLVDFSPNPVD
FT                   DTQGEFFRVVFNSPILSDKIVDELIASIISVGKELE"
FT   gene            <88453..>89982
FT                   /locus_tag="CAWG_02401"
FT   mRNA            <88453..>89982
FT                   /locus_tag="CAWG_02401"
FT                   /product="hypothetical protein"
FT   CDS_pept        88453..89982
FT                   /codon_start=1
FT                   /gene_family="HOG000157110" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02401"
FT                   /product="hypothetical protein"
FT                   /note="similar to DUF895 domain membrane protein"
FT                   /db_xref="GOA:Q5A7S4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7S4"
FT                   /protein_id="EEQ44139.1"
FT                   /translation="MEKDQTKMDINSNTSSSNKDLEVQPEHLELKHHTNAEIEASGSWI
FT                   DKQINILGAKFRFSSAMCQIVLLAFVVFLTPGMFNALSGIGAAISDKKTADLANTALYV
FT                   TFSTVGFFAGTICNVIGVKMSLVFGGFGYAIYAGSLLSFNHNENKGFVIFAGAFLGFCA
FT                   SLLWAAQGTIIMSYPTEQTKGRAIMVFWVIFNLGAVIGSIIPLAENMHNQGSSASDGTF
FT                   IAFIILMICGSVLANFMLPISKVWKSDGTRVMTKTHPYWKDELIGLGRTLIKEPKILLM
FT                   FPMFFASNWFYTYQFNNVNYGRFNLRTRSLNSLLYWLAQMFGAIVLGYILDFKKFKRST
FT                   RAKIGWAILFVTSLAIWGGGLKFQMSFTREEVESKPPKISQLDFKDGAYIGPMFLYIFY
FT                   GVFDAIFQTYTIWVLGAMSNNPKKTALYAGFYKGIQSAGAAIAWRLDSLEVKYMSLFAS
FT                   SWGLVQGSLVLAIPLIFFMIKDHTALEDDNMGEVVDDAELDVVKSTTVHIE"
FT   gene            <90183..>93689
FT                   /locus_tag="CAWG_02402"
FT   mRNA            <90183..>93689
FT                   /locus_tag="CAWG_02402"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        90183..93689
FT                   /codon_start=1
FT                   /gene_family="HOG000216677" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPK1"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK1"
FT                   /protein_id="EEQ44140.1"
FT                   /translation="MEISRDQKKKKFTTKCRPFSFYKNRHIIMLINDESIYLYNLTLKP
FT                   PSYYISSIVGQFYKQDNSTKNAQQLVLVSSTTLQLFEINEETGKLELQSSQNLLGIINS
FT                   IEKICLSEVDGVVITSDSGNLSILQYDNKTKKFISKIQEPMTKNGWGRNYVGENLAIDP
FT                   ENRCILVAAMEKNKLFYKIESNSSGSKELSSPLEAHSKQVLCLKIVALNTDHNNPLFGA
FT                   LELTPEKKCIINYYELDQGLNHVVKKKPNSSNSDPLPNDVNYLIPLPGHIGGMVVCGTN
FT                   WCFYDKLDGPRIYLPLPRRNGQTQDSIIVNHVTHVLKKKKFFILLQNALGDLFKLTVDY
FT                   DFDKEIIKNISITYFDTIPPALSLNIFKNGFLFANVLNNDKLLYQFEKLGDDLTEGELV
FT                   INSSDYESLNSVRESVTSFKLKGLDNLALIDVLETLSPITDSKIIDSKLVTLSSHSYVK
FT                   SITHGVPTTTLVESPLPITPTDIFTTKLSLESANDEYLVISSSLSSKTLVLSIGEVVED
FT                   VEDSEFVLDQPTIAVQQVGIASVVQIYSNGIKHVRMVNGNKKTTDWFPPAGITITHATT
FT                   NNQQVLIALSNLSVVYFEIDATDDQLIEYQDRLEIATTITAMAIQENISEKSPFAIIGC
FT                   SDETIQVVSLQEHNCLEIKSLQALSANSSSLKMLKSSGKETHVHIGMENGVYARIKIDT
FT                   INGNLSNSRVKYIGSKPVSLSVIKFSSEIEGILAISSAPWISYLYRDSFKITPLLEIDI
FT                   TNGSSFISEDIGGEGIVGIKDNNLIIFSVGKEDSVFDPSQDLTIVTTKLRYTPRKMITY
FT                   GNRLFISESEYNVQGPFKCNINGDVKENVDEDYYGAFGYEWKQNSWASCIQVVDSKSNQ
FT                   VIQSLQLDGNESIVSMSAVSFNKTSTPSVPASHLVVGVCTNQTILPNSYDKSYLYTFKI
FT                   GKKHLQLVHKTELDHIPQVLENFQDKLLVASGNHIRLYDIGQKQLLKKSTTIIDFSTNI
FT                   NKIIPQTNRIIICDSHKSSIVFAKFDESQNQFVPFADDVMKRQITSIMNLDIDTLIGGD
FT                   KFGNIFVTRIDEDISKQADDDWTILKTQDGILNSCPYKLQNLIEFHIGDIITSFNLGCL
FT                   NLAGTESVIYTGLQGTIGLLIPLVSKSEVELLFNLQLYMQQSQNNLVGKDHLKLRSYYN
FT                   PN"
FT   gene            complement(<94247..>94693)
FT                   /locus_tag="CAWG_02403"
FT   mRNA            complement(<94247..>94693)
FT                   /locus_tag="CAWG_02403"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(94247..94693)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK2"
FT                   /protein_id="EEQ44141.1"
FT                   /translation="MSNFNSSANDSTSTAPTASTTTNGDIGLNFASPKKITALEAYTPE
FT                   RGSKGNPSGTNNNNNNTNNTNTNTTNNNNGKNTAGGPNTNQSSPAFWNFVQFSTPNGQS
FT                   PVRKSSEEVGNNSPTLNRKIKRERENDETNSPFKKKQRTEMIDS"
FT   gene            complement(<94809..>96392)
FT                   /locus_tag="CAWG_02404"
FT   mRNA            complement(<94809..>96392)
FT                   /locus_tag="CAWG_02404"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(94809..96392)
FT                   /codon_start=1
FT                   /gene_family="HOG000093809" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPK3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK3"
FT                   /protein_id="EEQ44142.1"
FT                   /translation="MSAQFITPKKRPHSPLDSNELLPSFEDPQDMINAVVSTLSAPEEK
FT                   TNVSIAYANEKNQATEIQAYAKIAGKDWTFYVKSLAVSIGRNIELSAPSNTNITTPLID
FT                   IDLGPAKVVSRSHAAITYNLDLRCWELKVLGRNGARIDGQKVNVDSPNVNALHSGAILD
FT                   IGGTQMMFILPDAPAVVAPKMLEKCLLRYKEQQQQQNKRISSGPGIGGSTSFQMFDKAH
FT                   LTHSPSSISANSLQSNLDQDLSKEEAKDIKPPYSYATMITQAILSNPQGVMSLSEIYNW
FT                   IADHYAYYKYSKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWQISESYKEEFLNKI
FT                   SDGTISKTRRGSSVSRQLSLHLATHNQLPESHKYTMDQQIHNGTAASIPQQQKQQQQQQ
FT                   QKRPPQQQNSQPHLSQPHYTIPSNPMQTNSMGYIPQSNIYNMSNSDRRYTPYQQSQNPL
FT                   MYQHQQQHIGQTYNQLGRPQGQLGQPMMQPQQQSYTSSNIKTEPSSPKRNTSISNNTPK
FT                   MAKGTGMYFK"
FT   gene            complement(<98043..>99386)
FT                   /locus_tag="CAWG_02405"
FT   mRNA            complement(<98043..>99386)
FT                   /locus_tag="CAWG_02405"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(98043..99386)
FT                   /codon_start=1
FT                   /gene_family="HOG000204856" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK4"
FT                   /protein_id="EEQ44143.1"
FT                   /translation="MNLSLQDPFSVAKEFPETLTNTLNYGHSVAIQFNHKGDYLASGLS
FT                   DGSIVIYEMVSSGVIAHLNQYCHIRPITSITWSKCGRYLLTSSQDWWVKLWDLSKVNIT
FT                   DAKDIDESPVIREVKFDGPIWSACMHPTNPFVFTASLFEDSPVYVDFTAKDQPPQITRL
FT                   TTTPLEMNEPTEGDNEEEIARKRRKKMEKHMTLVSIFTHEGNYIFTGTSKGWLNIFDTT
FT                   SSNLNLVRSIKIANPNIKNLMISQNGRKLAVNSSDRIIRQIDLPDLINVEDSNDWDFEI
FT                   DHKYQDVVNRLQWNSVSFNHNAEFLVASTHGQSSHDLYLWETSMASLVKILEGSNEELV
FT                   DVKWNYSRCTIGSIGLDSGIIYLWSVQFPQKWSALAPDFVEIEENIEYLEKEDEFDIID
FT                   EDELHKKRLEEEDYVADVLKMDTTDARGFDITQDSFIIPINYEKNFYE"
FT   gene            <99629..>103669
FT                   /locus_tag="CAWG_02406"
FT   mRNA            <99629..>103669
FT                   /locus_tag="CAWG_02406"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        99629..103669
FT                   /codon_start=1
FT                   /gene_family="HOG000074502" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPK5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK5"
FT                   /protein_id="EEQ44144.1"
FT                   /translation="MVATDSVFNELSAKSLLSSSPSIISNSTSSISETSLRKTKFDDRA
FT                   TTKTSLALKSYRNNGNQTSRISTLNEPQPNGGGGSGEDDEILLKDIFQWNELKTISDTI
FT                   NSPEFINSHGSRLFVKSNAVYIAIITNRGNIVIFNYRQEIDYILVPTQSTDENCSISCI
FT                   AFSSDCSYLAAGLQDGSIRLWNLKKATKGNHIPNLPFYTIYPISLKSRFAQNVQGHVIN
FT                   TKITYILFVGESNCQLITADDCGLVFFHNGIKKFMNLIYVTTKLLGKNDANLDDSKFKI
FT                   RRMEMLPLGSAHQITDKMGIVAIMTDDLLVIVSAISLNDDTVSYVKQHFKIGKPKHIIH
FT                   EQDFPSYCLSWMPSIQTKTGVTNIRLAYCWNNILTILELDNKSVSGRILDFINNAKDKN
FT                   KVISKLPFKKIARLTDERIIRDIKWLQSDILCVFLDNEMITIYSNGTMLVPAASQTIGN
FT                   ISDINLSKHRVIYTDESKLFIGKSLGWADILLNKLSQGLYAEALSIADNYYNSNSVGKL
FT                   TVVGLPQNQKQRGDLIEPYLVKIMREAMPHLIQSDHESYITLCLNIIAYLAVPNDLLEA
FT                   LYEIVQDNSIFFQALEPFILSGLILSLPPVVLKALIQYYVKAENQQSTNMDDDGELLTE
FT                   IICTLDIKSLDIDLTIQLCKQYNLRECLVYVWNFVLNDYQTPLVDFFVDIKKNPSSPDN
FT                   FKVYTYLSYILTGRQYPIDKFINNDMVAKKTICDILFSSSTISSVPTENGNTIFPYLYT
FT                   LLKFDSLEMLSCLNEFFEDSFLNEDPKLNRQYLIEALIDIFEANDEQFTDFDKCQLSIF
FT                   IARNYPKYSQFLRLSDSILSDVFNRLCENKSESIFSDCELALQSLLPYFEPEDEYYVEK
FT                   LEMAKYYNVLINMYKSEGMFSQALKMWLKREHENASEDTLDNETPEMDIDGGSDDHDHD
FT                   HVDQLYLLLESSFASSKNPSDRLNLVKIVKDNFGKFLKLNYVSDYNISRFVNLIEQFSP
FT                   NLHLEVLKLTSSSDKTDVDNEIVLSYLREVFLISKSIDLTQFINRYVELLLLYKKDKEV
FT                   ISFVKQWKDKVDYDVVMSLFKNHNAIEPQVILLIDHKKSSVALELILKYVEDNVNDTSL
FT                   QEEFTNLLDLAIAICENPKNHVTSEVRADELKLNEKLWVELITRLVVLVNSSNIVAGSQ
FT                   IYQFFNQFIQDCFKRISDHKLNNDSKSLFLNVFNKFLHQFPEDDPTKFATLANIKDVLQ
FT                   QVFISYSYESEILKITMRMFNRDMYKNMMLLQDIKLAKWDITTKNCANCGKPMWGKHID
FT                   TEDLNQHWLAWENCQKQKLWGNGKDDTFADLKLIFFSCGHGYHYNCLERLGVNDYCVIC
FT                   GKK"
FT   gene            <104578..>107898
FT                   /locus_tag="CAWG_02407"
FT   mRNA            <104578..>107898
FT                   /locus_tag="CAWG_02407"
FT                   /product="chitin synthase 2"
FT   CDS_pept        104578..107898
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02407"
FT                   /product="chitin synthase 2"
FT                   /db_xref="GOA:C4YPK6"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK6"
FT                   /protein_id="EEQ44145.1"
FT                   /translation="MGNSNFNNKNSHNPFDNVSDDDDDLFDDIEPVQQGLPSQPQHHHH
FT                   IATNANNSYQFDNSPYRRSSSYDVYNNNPFVGNTSYTNTTTPPPMLQQQQQPALSPLQP
FT                   PLFNNNGNNNTLYQQQQYKKYRTPTSSNSNSSYSTMVDNDEFQLSRKKTVAFTEPEYPP
FT                   LTYSPGKKKDTATSTNVYDYDLEEMDDGSLVASGGSGGIHADFAGDDYIINPLQDADDD
FT                   DSLDPFGDDESLFSDTGEEILRRGTTIKKRHSTRRGRRNGTLKRGKSRNTEYGGENEKL
FT                   VNNDNGDEEDGDGDDDDDDFKPKLTYTKTIKKAKLINGNYVIDAPVPKTLLETYGKKIN
FT                   YHQDNVSREMSFVRYTAATCGPSNYVKFNYNLRQELYAPSRQTEIMICITMYNEDEVLL
FT                   ARTLKGVFENIRDLTNRSDPNWGDDSWKKIVVCIVNDGRLELNKRTETLLAALGIFQDG
FT                   YAKSKINDKSVKAHIYEYTSTVGIDAVNDKVHLACNSTPVQFLFCLKEKNSRKINSHRW
FT                   CFQAFAPILNPKVIMLLDCGTKPSRDAFFHLWKSFKDPNVAGACGEMRVALGPNKNLLM
FT                   NPLVAAQNFEYKISNVLDKPMESVFGFISVLPGAFSAYRYEALLNVNGEGPLEKYFKGE
FT                   YLHQMTTEGDSNDPDFDDERDVKEKNFQQAGIFTSNMYLAEDRILCFELVAKKNHNYIL
FT                   RYVNEAKAETDVPENIDEFVLQRRRWLNGSMFAAGYAVFHWTKIWRSNHSLFRKLFLQL
FT                   EFYYQLVTILVSWFSLASFFLVFRILTANLGSSDMNFNVGKYLAIIFLWFYVGSVVCTF
FT                   VLAFGNTPRGTRKFYLVIAVFFAILMAYMMFAAIFLAVHTVNSIVHNHKTDFTIALVFT
FT                   NTKFRDLVVSMVSTYLLYFIGAFMYGEPSFMFTSFAQYVLLSPTYINVLNIYAFCNIHD
FT                   VSWGTKGVEQAKDLGSAKSFGKNSDELVMIAPENLTQELNDKYVATLENLRTMIPVKDI
FT                   PQESNKKKDDLAYYAFIRTITVLVWMLTNAILIAIVLEAGGVDILSGNKSGQTNADGSI
FT                   SGNSQVFLTIILWIVAGLALFRFIGAFLFLIFKSFRPLKWKLRAKRENKRNRNQNRNV"
FT   gene            <114190..>116877
FT                   /locus_tag="CAWG_02408"
FT   mRNA            <114190..>116877
FT                   /locus_tag="CAWG_02408"
FT                   /product="plasma membrane ATPase"
FT   CDS_pept        114190..116877
FT                   /codon_start=1
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02408"
FT                   /product="plasma membrane ATPase"
FT                   /db_xref="GOA:C4YPK7"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK7"
FT                   /protein_id="EEQ44146.1"
FT                   /translation="MSATEPTNEKVDKIVSDDEDEDIDQLVADLQSNPGAGDEEEEEEN
FT                   DSSFKAVPEELLQTDPRVGLTDDEVTKRRKRYGLNQMAEEQENLVLKFVMFFVGPIQFV
FT                   MEAAAVLAAGLEDWVDFGVICALLLLNAFVGFIQEYQAGSIVDELKKTLANSALVVRNG
FT                   QLVEIPANEVVPGDILQLEDGTVIPTDGRIVSEDCLLQVDQSAITGESLAVDKRSGDSC
FT                   YSSSTVKTGEAFMIVTATGDSTFVGRAAALVNKASAGTGHFTEVLNGIGTTLLVFVIVT
FT                   LLVVWVACFYRTVRIVPILRYTLAITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKL
FT                   SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLDAI
FT                   DKAFLKSLINYPRAKAALPKYKVIEFQPFDPVSKKVTAIVESPEGERIICVKGAPLFVL
FT                   KTVEDDHPIPEDVHENYQNTVAEFASRGFRSLGVARKRGEGHWEILGIMPCMDPPRDDT
FT                   AATVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYDADRLGLSGGGDMAGSEIAD
FT                   FVENADGFAEVFPQHKYNAVEILQSRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAA
FT                   RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLELFLGLWIAILNRSL
FT                   DINLIVFIAIFADVATLAIAYDNAPYDPKPVKWNLPRLWGMSIVLGIILAIGTWITLTT
FT                   MLLPKGGIIQNFGGLDGILFLQISLTENWLIFVTRAQGPFWSSIPSWQLSGAVLIVDII
FT                   ATCFTLFGWWSQNWTDIVTVVRTWIWSFGVFCVMGGAYYLMSTSEAFDNFCNGRKPQQH
FT                   TDKRSLEDFLVSMQRVSTQHEKST"
FT   gene            <118709..>121060
FT                   /locus_tag="CAWG_02409"
FT   mRNA            <118709..>121060
FT                   /locus_tag="CAWG_02409"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        118709..121060
FT                   /codon_start=1
FT                   /gene_family="HOG000093810" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPK8"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK8"
FT                   /protein_id="EEQ44147.1"
FT                   /translation="MTSGSRSVSLSSGKDLKYHQPHNSINSTASLRSSSIGSSFFTPNN
FT                   THGAGSNSSSSNDPSFLNGENTSANCTNSTESDDNELIEPTKDIDIVGAISTLHLDDDD
FT                   EDEEATTTGTNNISRVKSGNKHNPQYGSLTPQNLAKTGSGNTKNTWNITQSAPPQPIRS
FT                   NVSENGNHPNDQNVFVKPFELPESQEDASKKQTTNGLNLPLLEKILDSEGRTKDNDQNI
FT                   SSSKPQFYDGAIPFVPVNQNVTGNGNSQIPPPLGNIPPPMSNMPPPLPPHSMGLPSFSP
FT                   FPHPSFYQGYIPSPPAHTPTPGDYQSFDKIPSVPSPAPPIIQESQVPTPAPVPVPALQP
FT                   NQPQPPTMWNPLHSPLVRLPFGQQQLQTVYSPTQSTQSPLLPQQGPPQPQPAFPMMPQH
FT                   NFHQHNQYHPRPHYRNNNGMMNVHRKNLRRKEDSAKYSDAKLQDFTGSILTLCKDQHGC
FT                   RFLQRELINETNATLIFNEIYFKAVELMIDPFGNYLIQKLFTMINLEQRLVLINQCSNE
FT                   LFRIALDPHGTRSLQKLIDVIETNEEIEIITRNLYSNIVVLSRDLNGNHVVQKILTKFN
FT                   TISSDSNSSDSNRDGAQHQNQNQFIFDIIQANLLYIACHRHGCCVLQRCLDYGNKQQCQ
FT                   QLSQEIAKHTIKLSLDPYGNYVVQYVLNKYSVGGDAQNTDNQVIDIIIQEIKSNFIQLS
FT                   LHKFGSNVIEKCLKISSISKDLIDNLIVLDHGQAFNQLLNDPFGNYVLQTSLDVANLEQ
FT                   FEQLSKILLPLLPNIKSTPHGRRILNKIQQ"
FT   gene            <119433..>119894
FT                   /locus_tag="CAWG_02410"
FT   mRNA            <119433..>119894
FT                   /locus_tag="CAWG_02410"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        119433..119894
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPK9"
FT                   /protein_id="EEQ44148.1"
FT                   /translation="MLSVMETHKYHHLSATFHHQCQICHHRYHLTQWVFPLLVPFHILL
FT                   FTKGIFLLHQLILLHSVITNLLTRFHQCHPQHLQLSRNHKYQHQRQYQYQHYNLTNHNP
FT                   RLCGIHYIHHLLDCHLVNNNCKQYTHQPNQRNCHYYHNRDHLNRNPHSQ"
FT   gene            <121511..>124099
FT                   /locus_tag="CAWG_02411"
FT   mRNA            <121511..>124099
FT                   /locus_tag="CAWG_02411"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        121511..124099
FT                   /codon_start=1
FT                   /gene_family="HOG000093812" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPL0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPL0"
FT                   /protein_id="EEQ44149.1"
FT                   /translation="MGSSSSNPTKSPLGETSQQEATTTTTAKPTKKVIKKSKYSRGGCA
FT                   ECRRRKIKCDELKPYCHNCTRLNKLCVYPTKPKFKFETPKTTLNNDNNMSNDQALPNGN
FT                   NIGNNSVSYQFLHDKSNISNLQIYYNETQKRILNGSNGNNIPNLQQHQQNVIPYIDTGN
FT                   LGTLSPPHHRRPPTKKFKISDMLSPDNDNQSNTTTTTNNNSNNRNAYDFINMDYYNWDT
FT                   LPITDIQNLFDDASLLVQDSLGLFTALENELNLPINADGNNFGENNNNDIQLPILDSSS
FT                   DKVSSSNSPSTTLSPSSFAVPQKSLSNKKLIEKTLLMHDIQGPHKLYLDKLTKTKLSYH
FT                   VYPFAESIETNQVLRILLQYSLGSPYLLTAILATSATFQFIETRQMIHKDHQFKYTNIS
FT                   LKYLSEAFPQESNKDIHNSNNSGTTDNANFKMMTKDVEKLLLTILVLTLNFTALAYFQS
FT                   NNRDGSTGISSVNKNNWKIHLRGVKDLLLKYSKLAHSNNQQYITDGLALAKTWFFAIES
FT                   VAELNDPLGGTIKYSTKNISSHVDIIKTNQNVLDCSDSSRLWVETGYFNRGKNQDYHDA
FT                   LYRIGMVTNPNLPISTQFNMFLGFSIDVVKLIDEMTKSLDLLRENKPGQLSGTSIANIF
FT                   TLISRARNNDIVPKVNKETFVIPKESIGHPEYKEFDKLVLPKSCYTHEIINDNSTTTSK
FT                   DGSSKETIYYSWYDWSEQLHIDSVYMKLFHIKGLMKLPRDHPLVQELKDKVLTSMFFLK
FT                   DKQQNIVDTEINNDSKIFLESDHYYLHSDLFDTRAIMAQSSYRECIKIANSLLDFEKLE
FT                   LYFQGLIKLGNGSSLLALDNVKRFKQNFIDGKDVDDDVDLAFDSEIIPFS"
FT   gene            <124651..>126060
FT                   /locus_tag="CAWG_02412"
FT   mRNA            <124651..>126060
FT                   /locus_tag="CAWG_02412"
FT                   /product="Delta(24(24(1)))-sterol reductase"
FT   CDS_pept        124651..126060
FT                   /codon_start=1
FT                   /gene_family="HOG000177774" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02412"
FT                   /product="Delta(24(24(1)))-sterol reductase"
FT                   /db_xref="GOA:Q5A7T7"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A7T7"
FT                   /protein_id="EEQ44150.1"
FT                   /translation="MAASDTQSTSDETTPLVRSDESRYIPKDQIEYEFGGPIGALGMMI
FT                   GFPLLMWYMWISAQFYNGQFALPSEGQSWKDFIIDDLFSKWVEYGIPSFGNWAFFTGFI
FT                   LIQALFYVTLPGVWTKGQPLTHLNNKQLPYFCNAIWSFYTSIVLSLVLHFTGVLPVYYM
FT                   LDNVGGIMTTAIFYGISLSIILYLICIFVTGDYHRMTGNHIYDMFMGAPLNPRIGKYLD
FT                   LKMFFEVRIPWFILFFLSFGLCFKQYETYGYVTPQACFMLYAHWLYANACAKGEELIVP
FT                   TWDMAYEKFGFMLLFWNIAGVPFSYCQCILYIAYQEPEVYQWSIGYNVFLFVLITIAYY
FT                   FFDTGNRQKNSFRRSVAGNSQLRKTFPYLPYSDLVNPKYIKCANGSLLLTDGWYVYARK
FT                   MHYTADYIQTLTWALMCGFGSPFPWFFPIFFFIVLVHRGYRDQRKCAKKYGKDWDRYLE
FT                   ACPYMFIPYVW"
FT   gene            complement(<126260..>127003)
FT                   /locus_tag="CAWG_02413"
FT   mRNA            complement(<126260..>127003)
FT                   /locus_tag="CAWG_02413"
FT                   /product="proteasome component C7-alpha"
FT   CDS_pept        complement(126260..127003)
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02413"
FT                   /product="proteasome component C7-alpha"
FT                   /db_xref="GOA:Q5A838"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A838"
FT                   /protein_id="EEQ44151.1"
FT                   /translation="MSNSAGFDRHITIFSPEGRLYQVEYAFKAINSANITSLGITGQDS
FT                   AVIISQKKIPDKLLDPKTVSYIFKITPSIGMVATGSIADARAQAMRARSEATEFRYKYG
FT                   YEMPVESLSRRMANISQLYTQRAYMRPLGVALTFIQVDFADEGRGPQIFKCDPAGYFTG
FT                   VKAVATGPKQQEATTYLEKKFKKTDAVKGDWQKTVEFAIIALSSVIGTEFRKNDIEIGV
FT                   ATEGEFRILTPEEIDERLISIAEQD"
FT   gene            <127344..>128708
FT                   /locus_tag="CAWG_02414"
FT   mRNA            <127344..>128708
FT                   /locus_tag="CAWG_02414"
FT                   /product="histone deacetylase phd1"
FT   CDS_pept        127344..128708
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02414"
FT                   /product="histone deacetylase phd1"
FT                   /db_xref="GOA:Q5A839"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A839"
FT                   /protein_id="EEQ44152.1"
FT                   /translation="MTISISETDTFTTDTKTRENTPIYDPNHPGTNNKYNVSYHYNPEV
FT                   SRFHYGALHPMKPFRLMLTDHLVISYKLYEKMDLYTPRRATKDELLEFHSEDYIDFLQS
FT                   ITPEKCKTISNDTLAQFNIGDDCPIFDGMYDYSAIYAGASLDATRKLISGMSDIAINWS
FT                   GGLHHAKKFEPSGFCYVNDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYNTDRVMT
FT                   VSFHKYNGEFFPGTGSVDEVGIGSGKNYAINVPLRDGIDDESYIRLFKSIMEPLITKFQ
FT                   PTCIVQQCGADSLGYDRLGCFNLNIRAHGECVKFIKSFGIPMLVVGGGGYTPRNVSRLW
FT                   CYETSVLNDVNLDHKIPNYLPTYDWFGPDYSLHPQLDGRIDNKNSKKYLQSVQTTIMEQ
FT                   IRYLNHAPSVQMYEIPPDLTGLTEDEDKAIQELNEDMERDEKIMKDETKLGELMT"
FT   gene            <129337..>131766
FT                   /locus_tag="CAWG_02415"
FT   mRNA            <129337..>131766
FT                   /locus_tag="CAWG_02415"
FT                   /product="hypothetical protein"
FT   CDS_pept        129337..131766
FT                   /codon_start=1
FT                   /gene_family="HOG000093813" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02415"
FT                   /product="hypothetical protein"
FT                   /note="similar to DNA polymerase alpha suppressing protein
FT                   kinase."
FT                   /db_xref="GOA:C4YPL4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPL4"
FT                   /protein_id="EEQ44153.1"
FT                   /translation="MDTNKLAIVLDPKSNRKIINHRYKIIKKIGQGQYGKVLLGEDVTT
FT                   TVTSTEKNKSTTISTYVAIKTINRIDKSRLLLVKNSSNNISMKIKREISIMKQCNHPNI
FT                   VKLYQVIDDLRFDKILLILEYCQYGEIDWKRYNHYREKYRKIDTESTRGNTNSIPQTRL
FT                   TLNKILRDIINGLEYLHDYKHIIHRDLKPSNLLINQDNTVKISDFGVSLLLENNANDAK
FT                   ELAKIMGTPAFYAPELCQFVNNRFSMVTNEDHAGNKIKISYNIDIWSLGVTLYCLSFNN
FT                   LPFNGNNEFEMCKNIVKSELQFPLIKHSSKVTENDIQELKCLKDLIKKILVKDPDERIS
FT                   LKEIKVHPFTTFDLSELEKKKFFKFNQNIFKAEDCKKELDVEEAIPASSPQSSSLSKRI
FT                   KNLFSSKSPVATTATTTTSSPPPATTLPSTPGNSSSKHTPSNLKYNNLSLKELEHVDDL
FT                   LDSYLDDSSSLGSIEGDDEGVDTSNILGDLDKDTNYDHSPSQLQEKASDLTKNATQVET
FT                   KHKPQPLDLKQAVTSFPPLPPPRGNFSSSLEVTNNSNNNTSSPVTPINENITTIIGERS
FT                   PVNNYNGINDNIGDFPKSSRQSFEKQNKSASLASMTYQPTIISLSSPVKTKSESWGGKP
FT                   NNTSIHNSIGGISDNHKHLNMFEPPSIFRESKPQPPSEGNKSATVGNTENSFGSTSRRN
FT                   SNTSQHFGYGLSRITSSSSSLNLNAYLTDDDDDNDINSALMPESNRSSSISTRYSLKGI
FT                   QQQSQPPPPQQQDKSQNIEHNEEHDESEEGDSTIIANNYQIMRNYNDMSSYLDGLD"
FT   gene            <136083..>138764
FT                   /locus_tag="CAWG_02416"
FT   mRNA            <136083..>138764
FT                   /locus_tag="CAWG_02416"
FT                   /product="hypothetical protein"
FT   CDS_pept        136083..138764
FT                   /codon_start=1
FT                   /gene_family="HOG000093814" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02416"
FT                   /product="hypothetical protein"
FT                   /note="similar to mitotic inducer phosphatase NimT"
FT                   /db_xref="GOA:C4YPL5"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPL5"
FT                   /protein_id="EEQ44154.1"
FT                   /translation="MLHNEDFIPNFLQDSSSASMTHTLRVKRNRPKSSYFEDFSPEASQ
FT                   DDTNVEDANCSSPTLMRKSALRKSSSKTLNNNSKSPSPTFSNTNATSGSPLSNLSRAPL
FT                   RNLSNFVIPSSVKSKTKQFTNSLTRSMTEVVSKSSHSFFNNLHLATSTASSSVSSTTPK
FT                   IEFNSIAENDDIPTNYDSDEEFEDGDTFDTIHLDSPVQRKSSNNNNNNNNTNDGNDNNI
FT                   PTKIRRFHSMYQTDKEIASYQLHEDNSILKFTNIEYSHSESDLLPRIDAHQLARILRGD
FT                   HDDQFDEFIIIDCRFEYEFNGGHITKAINISTQEALQEKLFQYQETDTKDTESKKRLII
FT                   FHCEFSMFRGPMMAKHLRKCDRMCNYDNYPLLTYPDIAILEGGYKNFYENYPQWCDPQG
FT                   YVEMKNLRHKKLCESNLDKVRKDNKLTRAKSYQFGIQHRRGGSTGGLFGNYNYNVMNSS
FT                   DQQFWSSSTSNTAHHRSSSSSGFINNMHSGASSYHHRSQSFVTINNEKIIKRQRSTPKV
FT                   SNSPTKPTSSTVSPDKPIPLANIHRLTRANTISSDQTLFSNKSVSSPMISPLAASFEQS
FT                   SIGMSSSELSVNTQDFQPPTTSFRNSTHNFNNVNRRRKSLSSNFSSCSINSITSSVADS
FT                   DYAGSVDSALTEPYTSSSPILDSADYFDNGAKRQNLIAMPISKGQPSLLTSSSSSSIHR
FT                   KHASKSGSNIQASLANPPSLPPPPPPTTTTDSSLSTNPSQLSPGIQQQPCLQFQFPRSR
FT                   SANKLLATPSKSNHSFTSPSTNNEIGSNNNLPMVSPFFTPGTDASANITTNTYDGYNTS
FT                   TINTNCHGNRSSIIDPINDTPVDFSVPTSISLSSSKSIRFKLHKRSGSLINSSISESQE
FT                   LYNVTSDEHGLQYHNHKDGTHC"
FT   gene            complement(<136184..>136588)
FT                   /locus_tag="CAWG_02417"
FT   mRNA            complement(<136184..>136588)
FT                   /locus_tag="CAWG_02417"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(136184..136588)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPL6"
FT                   /protein_id="EEQ44155.1"
FT                   /translation="MELNSILGVVLDTEEDAVEVARCKLLKNECDDFETTSVIERVKEF
FT                   VNCFVFDLTDEGITKLDKFLNGARERFDNGEPDVAFVFEKVGDGDLELLFNVFEDDFLN
FT                   ALFLIKVGEEQFASSTFVSSCDASGEKSSK"
FT   gene            complement(<138997..>141717)
FT                   /locus_tag="CAWG_02418"
FT   mRNA            complement(<138997..>141717)
FT                   /locus_tag="CAWG_02418"
FT                   /product="peroxisomal hydratase-dehydrogenase-epimerase"
FT   CDS_pept        complement(138997..141717)
FT                   /codon_start=1
FT                   /gene_family="HOG000170895" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02418"
FT                   /product="peroxisomal hydratase-dehydrogenase-epimerase"
FT                   /db_xref="GOA:Q59JZ8"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q59JZ8"
FT                   /protein_id="EEQ44156.1"
FT                   /translation="MSPIDFKDKVVIITGAGGGLGKYYSLEFAKLGAKVVVNDLGGALD
FT                   GQGGNSKAADIVVDEITKNGGVAVADYNNVLDGAKIVETAVKSFGTVHIIINNAGILRD
FT                   SSIKKMTEKDFKLVIDVHLNGAYAVTKAAWPYFQKQKFGRVVNTSSPAGLYGNFGQTNY
FT                   SAAKSALLGFAETLAKEGDRYNIKANAIAPLARSRMTESILPPPILEKLGPEKVAPLVL
FT                   YLSSAENEVTGQFFEVAAGFYAQIRWERSGGVLFKPDQSFTAEVVAKRFSEVLNFDDSG
FT                   KPEYLKNQHPFMLNDYTTLTTEARKLPSNDASGAPKVTLKDKVVLITGAGAGLGKEYAK
FT                   WFARYGAKVVVNDFKDATKTVEEIKAAGGEAWADQHDVASQAEEIIKNVIDKYGTIDVL
FT                   VNNAGILRDKSFAKMSDQEWDQVQKVHLLGTFNLSRLAWPYFAEKKYGRIVNISSTSGI
FT                   YGNFGQANYASAKAGILGLSKTLAVEGARNNIKVNVVAPHAETAMTLTIFREQDKNLYH
FT                   ADQVAPLLVYLGSEEVEVTGETFEAGGGWIGNTRWQRAKGAVSHDEHTTVEFIRDNLKD
FT                   ITNFDSDTENPKSTTESSMAILSAVGGDDDDDDDEEEEDEGDEEEEEEDEEEDDPVWRF
FT                   NDRDVILYNIALGATTKQLHYVYENDSDFQVIPTFGHLITFNSGKSQNSFAKLLRNFNP
FT                   MLLLHGEHYLKVHKWPPPTEGAIKTTFEPISTTPKGSNVVIVHGSKSVDNDSGEVIYSN
FT                   EATYFIRNCQADNKVYAERRSFATNPFPAPKRAPDYQVDVPISEDLAALYRLTGDRNPL
FT                   HIDPNFAKGAKFPKPILHGMCTYGLSAKVLIDKFGMFDEIKARFTGIVFPGETLRVLAW
FT                   KESDDTVVFQTHVVDRGTIAINNAAIKLVGDKAKI"
FT   gene            <143874..>146186
FT                   /locus_tag="CAWG_02419"
FT   mRNA            <143874..>146186
FT                   /locus_tag="CAWG_02419"
FT                   /product="glycerol-3-phosphate O-acyltransferase 1"
FT   CDS_pept        143874..146186
FT                   /codon_start=1
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02419"
FT                   /product="glycerol-3-phosphate O-acyltransferase 1"
FT                   /db_xref="GOA:C4YPL8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPL8"
FT                   /protein_id="EEQ44157.1"
FT                   /translation="MAPSSSSSLDLHYERPKWYRLAIYDTLLWLLSVIFDCFFREIRPR
FT                   GAFKIPREGPVIFVAAPHHNQFVDPVLLMNQIKKEANRRISFLIAAKSYKLKAVGTMAK
FT                   CQLSIPVVRPQDCLVKGTGKIFVDFDKDPLRVTGKDTKFTKECMVKGLIALPQSLGASE
FT                   IVEIISDTELVIRKEFKSSDKVKVLLTNGTAYKRADKIDQKQVYQMVFDHLLDDGCIGI
FT                   FPEGGSHDRPDLLPLKAGVAVMALGAMDKNPGCNIKIVPCGMNYFNAHKFRSRAVVEFG
FT                   DPIEIPKELVKKYANPETNREAVKELLDTITTGLKAVTVTCEDYETLMLIHAVRRLYAG
FT                   NFAQQLPLPLIVEMNRRLVIGYQHFKNVPKVQEIKEKVLHYNDFLKTLYLPDHDVESCN
FT                   DEAHKITLIPIFFFRVFKLLILFILALPGATLFSPVFLSTKIISKKKAKEALANSVVKI
FT                   QANDVIATWKILVSMGIAPIVYSFYASVGTYYCSTHDYFSHWKLFWVWIFLYSCGVLVT
FT                   YSALITGEQGMDLFKSIRPLYLSITSGSSIKELKKMRHELSEEITELVNHYGPQLFPND
FT                   FNLLDLQKSLNINGDVVYADSDEEEDMKTEELRNRRIARRKAEKKKKQTQENEDTQELQ
FT                   SSDMKHSSSMSDGISLLNSDNSLTNLPMFSDYVLHKNAKNPDLQLDPQSHYGSRVNSNL
FT                   NSSANSSVSIYDDYRFASQSEHGGTASPVRYSRLPHLPETSSSDHMELNFASKPEGQKM
FT                   RLRDRIKTKLRENRKEN"
FT   gene            complement(<146352..>148670)
FT                   /locus_tag="CAWG_02420"
FT   mRNA            complement(<146352..>148670)
FT                   /locus_tag="CAWG_02420"
FT                   /product="DNA ligase I, mitochondrial precursor"
FT   CDS_pept        complement(146352..148670)
FT                   /codon_start=1
FT                   /gene_family="HOG000036006" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02420"
FT                   /product="DNA ligase I, mitochondrial precursor"
FT                   /db_xref="GOA:C4YPL9"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPL9"
FT                   /protein_id="EEQ44158.1"
FT                   /translation="MFSRLVSYRYPIGVQLKQANRIMSNKKQQSLARFFGGITPPTGSN
FT                   STSPKKQQSLTRFFGSSSNNSSPKKATTEAKQKREATPPKSPPRSKKARIETKSDESSS
FT                   SSSSSSNGDIEMETEPKLEKNNGSGNDVRNEAEELIKLSESEQAKHSNEKLGVKIPYAK
FT                   LASIFEAIENESSRLAIIAIISQFFLEVLQQSTIDKLIRIVYLCINRLGPDYEPGLELG
FT                   LGETILIKAISECYGRETSKIKADYKSTGDLGLIAQKSRSLQPTMFKTAPLDVDTVFDN
FT                   SLKIAKSTGKESQSKKISIIKQMLTACKMKSSEAKFLIRSLQGKLRIGSAEKSIIVGLA
FT                   QAFVNYENKSNKKIDPSKLAEAEEIMKEAFSRVPNYEVVLKTAYQYGIFNLLEHCFVTP
FT                   GIPLKPMLANPTKSIGEVLDRFQNEEFTCEYKYDGVRAQVHILSDGSIKVFSRNLEDMT
FT                   QTYPDLISIGKQFAVGGNAISMILDCEAVAWDREDHKILPFQKLTTRKRKDVNEEDIKV
FT                   QICLFAFDLLYYDNESLLPKSLAERRKIMQENLSPIEDRFQFATATNSSSNLEVLQQFL
FT                   DQSIKDSCEGLMVKMLNGSESFYEPSKRSRNWLKLKKDYLEGVGDSLDLVVIGAYNGKG
FT                   KRTGTYGGFLLASYNEDSGDLETCCKIGTGFSDEDLLNLYNKLHPTEIASPKNYFVYDT
FT                   NNSNAVPDVWFEPSMLFEVLTADLSLSPIYKTGHQEFGKGVSLRFPRFIRVRDDKGIED
FT                   ATSSDRVCEFYQRQAHVNN"
FT   gene            complement(<148969..>149466)
FT                   /locus_tag="CAWG_02421"
FT   mRNA            complement(<148969..>149466)
FT                   /locus_tag="CAWG_02421"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(148969..149466)
FT                   /codon_start=1
FT                   /gene_family="HOG000066101" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q59LP6"
FT                   /protein_id="EEQ44159.1"
FT                   /translation="MSDLLHKLNFKIADASPEYKQRRKIQMIRFFTASAVTIFASRFAY
FT                   RATVSRQYIPTLFQGNHSPPLSYNFTTDAAVAVGTGTLLCGSVTGMTVFGLCWILDVSN
FT                   IKEFGWRMKSMLGGWESEKKLSEAPMDEESSYIQDSLNDILDGKYDFENDTEEVAGELK
FT                   TN"
FT   gene            complement(<149913..>152348)
FT                   /locus_tag="CAWG_02422"
FT   mRNA            complement(<149913..>152348)
FT                   /locus_tag="CAWG_02422"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(149913..152348)
FT                   /codon_start=1
FT                   /gene_family="HOG000093815" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPM1"
FT                   /protein_id="EEQ44160.1"
FT                   /translation="MSHSAYKASGKPLSAEALYHQQVKQGVFQSPSGTIVGVNSNASDT
FT                   AALLAASSDLSVQPSYVRSVAPEAHTAALAAKQQEIKAWERGQEDPDASAAASNAKRTN
FT                   TLSSTTPSTTVKVGIPSMNSNTIYKAASANSTSTMTSRINPEKDIRRSGIQSKQGATSL
FT                   NIDKINKLATKNSTKSLSSRFNPDLDYRSGLKKQAPAEFLNQDEEDLAASGAAASLKHG
FT                   AGFTDQVSSQKRSQTFTAASVVNASLLKAANEKAELRLNSLKSNNPATLKAQAQLYANA
FT                   LALAQKRSDERSQSRAAGLINLGGGLTISQSELDKLASTYVQPILDDIEGKAEAKRQID
FT                   IEKKQKELELQQLHEKAKKEEHEAKEKEKRDIEIAKLERNAQNDKRKKAEDEKYAEYQA
FT                   GRNEEVQTKLQEYKDVEAKHAEEKQVLLDEKKENQDRIDTEEAEKIAARKQELEELQAE
FT                   KDEILKPTLDELKEESAKLEEVTNARDELANEVKASEDLNKEYEEKLAELESKLQEAKN
FT                   DIEKYTTDIEEATAKHESTDKEVAELQELHDKEKADAEKEHEDLDGKLEELEKQKQSHL
FT                   EDKATKKKDILAAIDEKVKDEHKINSELPEHLREEVDEGKIRDTSSIFSGEEPEIKHVP
FT                   LIKESETTEPEKKTAKAAEDSTATKAADTTASTASKPVATAATDSTSKRPVTPSAAQSP
FT                   TKKKSSFSRRLSSIFKYTNTEEKPKSTTTPSSAVKKETKPVKKATETEAEPKKTTKTAK
FT                   AAETTKAPATKQEQPAAKDAEKEAKSVKDGDVSEFADFEDEVSLNRKENKGGVFTEEI"
FT   gene            <154060..>154695
FT                   /locus_tag="CAWG_02423"
FT   mRNA            <154060..>154695
FT                   /locus_tag="CAWG_02423"
FT                   /product="histone H3"
FT   CDS_pept        154060..154695
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02423"
FT                   /product="histone H3"
FT                   /db_xref="GOA:C4YPM2"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPM2"
FT                   /protein_id="EEQ44161.1"
FT                   /translation="MARLSGQSSGRQTGQGTSAEAIRQQREELRRQRELRLQQQQQAER
FT                   QQQRQQYRTEQSPIVPAATSSSRYSQFGIYRNQPGDVVDTLASSLPRRTTTTRPEVNRT
FT                   VPRVKKRYRPGTKALREIRQYQKSTDLLIRKLPFARLVREISLDFVGPSYGLRWQSNAI
FT                   LALQEASESFLIHLLEDTNLCAIHAKRVTIMQKDIQLARRIRGQSWIL"
FT   gene            <155388..>155714
FT                   /locus_tag="CAWG_02424"
FT   mRNA            <155388..>155714
FT                   /locus_tag="CAWG_02424"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        155388..155714
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPM3"
FT                   /protein_id="EEQ44162.1"
FT                   /translation="MTCIFCYNRIKNDQVSFSKKMQVAILQKVMFMLQNFIFPWLNATF
FT                   SFLFFFSEFSAIIGPIKATQINETVLFPDLSFTSELINCRRVLFSVKLLPPRPEQSISM
FT                   AHPI"
FT   gene            <156333..>159323
FT                   /locus_tag="CAWG_02425"
FT   mRNA            <156333..>159323
FT                   /locus_tag="CAWG_02425"
FT                   /product="2-oxoglutarate dehydrogenase E1 component,
FT                   mitochondrial precursor"
FT   CDS_pept        156333..159323
FT                   /codon_start=1
FT                   /gene_family="HOG000259586" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02425"
FT                   /product="2-oxoglutarate dehydrogenase E1 component,
FT                   mitochondrial precursor"
FT                   /db_xref="GOA:Q59LN7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="UniProtKB/TrEMBL:Q59LN7"
FT                   /protein_id="EEQ44163.1"
FT                   /translation="MLRAFRSAVPRTQLLKSRLTIPKTSVIGRRYLATDSFLQGSNSNY
FT                   VDEMYEAWRQDPSSVHASWNAYFKNIENDNIPPSKAFQAPPTIVPTVSGGAAGFYPGQS
FT                   PISEDVVTHLKVQLLVRAYQVRGHQKAKIDPLGISFGDNTTVPKELTLDYYGFTEQDLA
FT                   KEITLGPGILPRFAQGGKKSMTLKEIINFCEKTYCSSYGVEYVHIPSKEQCDWLRDRIE
FT                   VPQPFKYSPDQKRQILDRLIWATSFESFLSSKFPNDKRFGLEGAEAVVPGMKALIDTSV
FT                   EYGVEDVVIGMPHRGRLNMLSNVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARP
FT                   TTSGKHVNLSIVANPSHLEAEDGVVLGKTRAIQQYKQDIGSFKKAMAVLLHGDAAFAGQ
FT                   GVVYETMGFANLPAYSTGGTIHVIVNNQIGFTTDPRFARSTLYPSDIAKAIDAPIFHVN
FT                   ADDVEACTFVFNLAAEWRATYHTDCIIDVVGYRKHGHNETDQPSFTQPLMYQEIAKKNS
FT                   VIDIYEKQLIDEGTFTAEDIKEHKQWVWNILEDNFKKAKEYKPTSREWLTTPWEDFKSP
FT                   KELATEVLPHLPTAVDEATLKKIGNAISETPEGFEVHRNLKRILNARKKSVETGEGIDY
FT                   ATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQNSESVWTPLSNLSEDQGAF
FT                   NISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVVIDQFVAGAESKWKQR
FT                   SGVVLSLPHGYDGQGPEHSSSRLERYLQLCNEDQRFFPSPEKLERQHQDCNMQVAYPTT
FT                   PANVFHLLRRQMHRQFRKPLILVFSKSLLRHPLARSNLSEFTGDSHFQWIIEDVLGDKS
FT                   EVKRVVLLTGQVYAALHKKRASLDDKSTAFIKIEQLHPFPYAQLRDALNEYPNLEDLVW
FT                   TQEEPLNMGAYNFAAPRVEAVLGETQKYKDLKLRYAGRDPSASVAAGSKAMHVAEEEEF
FT                   LEETFRQ"
FT   gene            complement(<159641..>161791)
FT                   /locus_tag="CAWG_02426"
FT   mRNA            complement(<159641..>161791)
FT                   /locus_tag="CAWG_02426"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(159641..161791)
FT                   /codon_start=1
FT                   /gene_family="HOG000248811" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPM5"
FT                   /protein_id="EEQ44164.1"
FT                   /translation="MAAHPSLWYRDKDSLRIGGVARYTIEYTRLDPTIKRIYFRLKNIE
FT                   KSSIRAIHLLSGPFILYCHVVPCNYNPRKPFHPENVQKNTEVVFENQIKPNQAFNVSLL
FT                   LNSNSLKGKDDKGYDIFQWEIEIVSQIVITKKTEVVYDFMIGDDLHFMKKLGQSIIQQT
FT                   LTSLGTKIDMNGGTKPTIMDKAMDEIHNDSHKIYNTQLKVSKLTTDDIWSNEPKDPKKP
FT                   VHLVIVTHGIFSNLTADMLYIKDQLELKVKENILVRGYRYNAGRTERGVKKLGTNVANY
FT                   ITDLIENSLYQYDKISFIGHSLGGVVQLYAIKYILMTKGPDYFERMRIKPVNFIGMASP
FT                   FLGILNEMNFLISWVLDMGTLGKTGRDLTLSKRLPAWSDISIGESKKRDSFKPVLETLP
FT                   EDPLQKFLTQFEQLVVYANAMNDGIVPLRTSALLYLDYEALGDVSELKKSKHMHVHPEL
FT                   EEADHKIQVNRSRDTVSEVPEEANQMVQDIQDAAKSTDNSQSTESSETMGKNHVISRYK
FT                   EFLNLNFSEHNSNNHKPKLTKRQRKYKNFSVRGTDYNVFNDVLPEDHSFQSEETNSTQD
FT                   SQTIVVPPRASAIESAINTLICPIPSNEFLINPESRQHVIFHDKYYQFNKSPQEEGNLN
FT                   KHSKVEWFASVLLRYHSKWKLEKQKQIADKYHNACGWRKVLVNLPPDAHNNIVVRRRFA
FT                   NGYGWGVVDHLCDLFRVSENKL"
FT   gene            complement(<162145..>163026)
FT                   /locus_tag="CAWG_02427"
FT   mRNA            complement(<162145..>163026)
FT                   /locus_tag="CAWG_02427"
FT                   /product="NADPH-dependent 1-acyldihydroxyacetone phosphate
FT                   reductase"
FT   CDS_pept        complement(162145..163026)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02427"
FT                   /product="NADPH-dependent 1-acyldihydroxyacetone phosphate
FT                   reductase"
FT                   /db_xref="GOA:Q59LN5"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q59LN5"
FT                   /protein_id="EEQ44165.1"
FT                   /translation="MSERQKVALVTGASSGIGYATAIEFAKRGYKVFAGARRLEPMQKL
FT                   KDDYGVIIFKLDVSDLESVKNAKKFIESETGADYLDFLYNNAGQSCTFPATDVTDAQMK
FT                   QCFEVNVFGAIRTVRELVPLIINAQGVIGFTGSVSGIIPFPFSCIYSASKAAIHQYAAT
FT                   LRLEMKPFGVKVINIVTGGVKTDIEDKRDLPESSIYNVPGIKEAFNERRQMAARNKPMP
FT                   AEVYAKKVVTDFESANLGGALNIYRGTMSTFLSFVLTFVPRFIVEAALVSKFKLNSVFQ
FT                   YLHEKYSKEKVN"
FT   gene            <164137..>166815
FT                   /locus_tag="CAWG_02428"
FT   mRNA            <164137..>166815
FT                   /locus_tag="CAWG_02428"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        164137..166815
FT                   /codon_start=1
FT                   /gene_family="HOG000093816" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPM7"
FT                   /protein_id="EEQ44166.1"
FT                   /translation="MGLDFNKEDLHEKFSDSVFEPKKNVDKSELSLVTTFTESSKSNET
FT                   RASLNSCTDASIIEHETEPETKKGLDTRTHKTNTLCLFNQPKSNKSKKTENSTSTTKME
FT                   TKKLITPRVFDGKTTMQLEERSKAKTISISREGVSKTQPQSQISSNFSAVSFSELIGQV
FT                   EATKCNLEKELDLTRRKLSKVESEKLERDQNIRILTDVNARTKSQVEALFKHVTRLDSD
FT                   FNDLRHEKDKAGKKYQKIKDDTNRYKAKVGELSSILDESKQSLNSMRMQMQVHFKVKEL
FT                   EIQQKDVQLDEISGLLSEEKIKLAEMQKMSFDLSQWESKMLEMNQNLATDISDRFFNSI
FT                   KQFIGSENLNNSLESKFQFIEKEFKSFLSNEIGSKVAELGAASLDKNQKLSVLVSTEFE
FT                   KATMAGTKNHATTRDYLLKQFQANIGLIQKGALDVQDVRLEYDQKFKSLESKITHLETT
FT                   KTQLERELSSHKSLSHDKILHLTEKSHGLQEQLAIAKQKLIDCDSTAERSALNILQAQE
FT                   ELEAKDVLLHEKDTKFCEMQKNLELQSSALQSKTNEENKNRLFFIESRNSLSKEVEVLK
FT                   LVIKNLTRDYEACQRVKATETLECDKWKIKYDDMKEQNDLLQETLRNCFAQNQESNDTV
FT                   SQLMQQHVEQLNTVKSELNAERKKTTSLEQTNLKLQSEIEAKELSMKSEEGINYCKRMF
FT                   EVVGETLKNGEAVTKGLEVQIKDISEFTKNSNMIYQRDFKDLYETLSSLKSQLKQSTEI
FT                   SSFRYDNSSTLEGPKVNTERQVLLPSTNQNLRGHKPVGVSEPSTKTTQRIKSRKKIPKS
FT                   KELDISQEPYKTHRKHTNIGSNLGANQCKDTITVENSSDQKELDLKSRNPQKTLNKQIA
FT                   EDVFSLSHITSSPPSKKSKKK"
FT   gene            <168400..>169269
FT                   /locus_tag="CAWG_02429"
FT   mRNA            <168400..>169269
FT                   /locus_tag="CAWG_02429"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        168400..169269
FT                   /codon_start=1
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPM8"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPM8"
FT                   /protein_id="EEQ44167.1"
FT                   /translation="MFICFSYYFVRSTKNLIIDLSLKNMPSTSSQKSVGSSVMDPNEPP
FT                   VGKVEVSGDGGEFVVINRHKYYRHELMAAFGGTLNPGAVPWPKININPAPLGLCAFALS
FT                   TFVLSLFNAQAMGIKIPNIAVSLALFYGGLAQFLAGCWEFVTGNTFGMTALTSYGAFWL
FT                   SFGAIFIDSFGIVAAYEKSEETVPQLKNALGFYLLAWAIFTFILWLNTLKSTVAFCALF
FT                   FCLFVTFILLAAGEFSQKTALARAGGVLGVITAIIAWYVALAGTATTTNSYFRPISIPM
FT                   PGNVAFKN"
FT   gene            <170370..>171167
FT                   /locus_tag="CAWG_02430"
FT   mRNA            <170370..>171167
FT                   /locus_tag="CAWG_02430"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        170370..171167
FT                   /codon_start=1
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5A9Y8"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q5A9Y8"
FT                   /protein_id="EEQ44168.1"
FT                   /translation="MTSSSSQKSVGSSIIDANQGPIKKVEIAGEGGEFVIINRHKYYRH
FT                   DLMAAFGGTLNPGASPWPKININPAPLGLCGFAMTTFVLSLYNAQAMGIKVPNVVVSLA
FT                   CFYGGAAQFFAGCFEFVTGNTFGMTALTSYGAFWLSYSAILVDSFGIAAAYEASEETAS
FT                   QLPNAIGFFLLAWGIFTFMLWLNTLKSTVTFSSLFFLLFVTFLLLAGGEFSGRVGVTRA
FT                   GGVFGVITAIVAWWNALAGTATPTNSYFQPVSIPLPGNVVFKK"
FT   gene            <172179..>173864
FT                   /locus_tag="CAWG_02431"
FT   mRNA            <172179..>173864
FT                   /locus_tag="CAWG_02431"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        172179..173864
FT                   /codon_start=1
FT                   /gene_family="HOG000093817" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPN0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN0"
FT                   /protein_id="EEQ44169.1"
FT                   /translation="MPDDSGSSNGRNNSNDLSGGSEEGSNNRRTNEGNHNGHSNRNDRT
FT                   STSQNSSSNSNNSNRSHRLDFGIFDRFMDTFLRGSRQRNHSTPGPSPVRNDISEQLTNE
FT                   NNARDQQQQHQHHGQAQQHQQGSEQSSQRVSSEPPSSNSSTNNRDEESDRAIIITVNYV
FT                   FSDENRPAVPNRSGSLIMSLPNNASNREPSVIQEFIRLATQMAYSSIVTGLNRERGTTI
FT                   EKFKSFDTVKLHDLGENQICSICYEKFEADEEDETVSHKKRRLVDETSQTTSSSSNARN
FT                   TREGESEEEQQPSQSNTSQPVYLSEYVGEFNHSAVKMPCSHIFGKGCLCEWLKLHTTCP
FT                   LCRFSVSEETASEPTTNDTTNNVSFFTIPTDGNTNPLGNVTVQNNFTNTPSNDQPTPRV
FT                   HYFGFSPIPSPGSATPSSNPRSEATETPLRRIFRSTRARREREARQDQESNEFPHIDPF
FT                   AFDYLRNRLSTSDRQPEPLFPFGMSSRRTANGVETTSTDHLASESEDNLNMRSLFDASP
FT                   MPEARRNEDDTRVGDSGSNNESANNNNESSTNISHGDDDDVDNS"
FT   gene            complement(<174096..>175220)
FT                   /locus_tag="CAWG_02432"
FT   mRNA            complement(<174096..>175220)
FT                   /locus_tag="CAWG_02432"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(174096..175220)
FT                   /codon_start=1
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPN1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN1"
FT                   /protein_id="EEQ44170.1"
FT                   /translation="MQIEKVQPKAYFDITNGSKKLGRVVFELYDDLAPKATENFLNLCK
FT                   GITLNDKSYSYQDTIFDKVIKNFMIQGGSLNANVSTIYGDQGINKPILGENLSDDLSHP
FT                   FKLCMANNGDVNCNGSQFFIITSKQSHMAGKYSIFGHVIHGKSIIREIERVKTNKDDVP
FT                   ESNVVIDQCGVWTDDMPVPIFNASYDTIGGDIYEEYPEDDNSNFNQESTEEAFSVASKI
FT                   KESGTLLYKKGDKENARFKYIKALRYIMEFIPDPDQDPEWYKKFIDLKKKTYLNLSLCC
FT                   LQLKDYHRCIDYCSYLLDMDDSVLTKQDKTKTLFRKGSANVGLKKYKLGLDDLKSANIL
FT                   TPDDVSIQKSIESTEKLLQQQKQNEKATYSKFFG"
FT   gene            <175360..>176502
FT                   /locus_tag="CAWG_02433"
FT   mRNA            <175360..>176502
FT                   /locus_tag="CAWG_02433"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        175360..176502
FT                   /codon_start=1
FT                   /gene_family="HOG000248823" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPN2"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN2"
FT                   /protein_id="EEQ44171.1"
FT                   /translation="MITRSRHISKRLYSTNYSAILFNAQENVNQLLESQDRSSYILAQY
FT                   IPEPVRNTYLAIRAFNLEINKINESGSNVQSRAARASSQMSNTLGVSTADLKFKFWSDL
FT                   ILRVFTEDSRNETDLGEPIAILLRDGLKHDFNLDISYFQQFLQTRRHFIKNNSSFQTVN
FT                   DICSYGEGTFSQLNYLTQGLLLSPSISPSVIRLLEYSTELQSQMSDIAAHIGQATAVSS
FT                   MILGVPFYAQSRNQITLPVDLMTSSGLSQESLLRLFQGHIKDSAEENQIKEALKNVVYE
FT                   TAITANDHMLTAKSKLEMARQEIKKIVQEQPQDQLLNKFSKKWRKGIPDSLYVPTMAGI
FT                   PTSLFLNKLEKCNFDLFHGRLQKEWRLPMKSFYYYHMRLM"
FT   gene            177105..177175
FT                   /locus_tag="CAWG_08053"
FT   tRNA            177105..177175
FT                   /locus_tag="CAWG_08053"
FT                   /product="tRNA-Gly"
FT   gene            <179723..>182149
FT                   /locus_tag="CAWG_02434"
FT   mRNA            <179723..>182149
FT                   /locus_tag="CAWG_02434"
FT                   /product="hypothetical protein"
FT   CDS_pept        179723..182149
FT                   /codon_start=1
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02434"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved fungal protein CFP2"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN3"
FT                   /protein_id="EEQ44172.1"
FT                   /translation="MLSSVFFSILTLLLSCFVSTTEARRKLSATSLVTCMDNSQISPSY
FT                   FNVTFNPDDRSLRYALDLTTSISAYITAHVQVYAYGFLIIEKDINVCSLGWKQFCPIFP
FT                   GALQIDSVQYISSEYTKQIPGIAYQVPDIDAVVKLVVKERDSGDTLSCLQANFSNGKTI
FT                   SQTGVKWATACIAGLGLIVAAMLSTFGNSNAASHISANSLSLFLYFQSVVVVSMQAVER
FT                   VPPIASAWSENLAWSMGLIRIQFMQNIFRWYIQSTGGSPTTYFISSTKQVLVQKHKRSL
FT                   DYVAGVAKRSLEYALRSHSNLYVLRGIKRIGYNSKIEPTSIVATGYTWFVLIGYLLVVL
FT                   LVLVKSVIILLTRAKKINPRTFNSFRGSFPNLIKGSLLRYIAIGSTQLIIFSLWEFTQN
FT                   DSPAMVVLAVLFVLLLLGVLGWSYFNVMKIGRQSIRTYNNPAALLYGDNKVLQKWGFCY
FT                   TMFHANKYWFGVVLMGYNVFKALFIAFCQDAGKVSVLPIFVADLAYTIYLIWTGPYLNK
FT                   PTNVINYMMSIVTTINSFLFLFFSDLFGQPAPVASIMGWVFFILNAAFSLILLILVIVF
FT                   VLLSVMSKNPDARFAPAKDDRFSFQRKSSIKHKSLTEKTGFGNTNGGHGGVGGGDEELT
FT                   ALGVAAQDHSADWESQMYKLNDLSLDEEDDSRTNQDFVRPDKTRELTSDYDDDTSFTNE
FT                   DNTRVVNNEEDKNKKLAEKWKSKISRKLSKKKSLKDKNNNTTTTTNNNITTVRRLSDTL
FT                   LNDERDSNEKREENDELSPITHPYNQSTSFNNHKREHSTTSTISNNNPTHTKGFI"
FT   gene            complement(<182347..>183603)
FT                   /locus_tag="CAWG_02435"
FT   mRNA            complement(<182347..>183603)
FT                   /locus_tag="CAWG_02435"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(182347..183603)
FT                   /codon_start=1
FT                   /gene_family="HOG000093818" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN4"
FT                   /protein_id="EEQ44173.1"
FT                   /translation="MDKVLFIIHFLLYNIPLIHCKLFYNQQHKICNPKQSTPFFPFTGF
FT                   KITRQYKISGYKLPVSMHFITISHCNHGQVDYQKVIRTDSSGKIDWGKPFCMLKPKLGE
FT                   MLTLPDHDTIGDPETQDYHNTEETDDFIIGIFGFIMYKGNKLSRLLRKKIDIQLEKLTN
FT                   GKWLEYTGKNKNLHQEDLMMTKDPQASLQWESKNLVCYKMARRKKYAKRKFDFYMPHTF
FT                   VGGLFECILPMDLKQQIFHQFTSSDLIFQQIQIQCDPNLSRPISPLIAEDSTTQWFENK
FT                   LYNIVNPGIIQTIPYLTTSTPLNLRFSTSETPDMFKDSWATKIEVNENYVYLEADIHLI
FT                   SRAIALSSDLLNKLISPIDFNQLIKSYNKANERENPDMEEFLQDITWTQKIHLWLSTID
FT                   RKMSNQILTQIERFWNDIE"
FT   gene            <183848..>187477
FT                   /locus_tag="CAWG_02436"
FT   mRNA            <183848..>187477
FT                   /locus_tag="CAWG_02436"
FT                   /product="ribosome biogenesis protein BMS1"
FT   CDS_pept        183848..187477
FT                   /codon_start=1
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02436"
FT                   /product="ribosome biogenesis protein BMS1"
FT                   /db_xref="GOA:C4YPN5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN5"
FT                   /protein_id="EEQ44174.1"
FT                   /translation="MEQQQQSNKAHRGGTKKPGAKKKLHQDGQNKKAFAVSAPRKLERM
FT                   ARRSHDVNEKKLHVPMVDRTPDDDPPPVIIAVVGPPGTGKSTLIKSLIRRLTKTTLTEI
FT                   NGPITVVSGKRRRLTFIEVNNDLNSMIDIAKVADLVLLLIDGNYGLEMETMEFLNIAQH
FT                   HGMPRVLGVATHLDLFKSQSTLRTSKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDREI
FT                   LNLSRFISVMKFRPLKWRNEHPYLLADRITDLTHPQKIAENSKCDRKVAIYGYLHGTPL
FT                   PVENAHIHIAGVGDHYVHSVEKLPDPCPTPYYEQKLEELERERVKNAAASGEPLAKTTR
FT                   RRKRLEDKQKIIYAPMSDVGGVLVDKDAVYIDVGGKEIYKTGTGTSELKGEGEKLVNDL
FT                   QEISQTMTERLEDGPGLQLFSSSKALNQVDEDDNNEEEDDDEEGLLSDEETIVDTGRSS
FT                   LRKARVYGKSVSEDDEFDELESDEEQDGDQFSDDEDKAENNLKSRGMVEVDFGSNNKYK
FT                   ENDLEYVEDSSLSSDEDYYKKSAAKLTASVRRKWDINKLIYLKDIDAKEVIKKWRNNDV
FT                   QDDDDDDDEEEEEDIEQDDQDFFVKKKVQDDKEDLDTSLPRFPTLEALKAKFNPNTIDE
FT                   NNSDDEYENGYKILKSRLLVAPKVTDETEEGKEIKENNDDDDELYGDFEDLEATENQDQ
FT                   EEEQNKSTKTAEDEDDFADFDAEEEKEEEEEDDDNVDEESMTTEEKRQLNAAKKAKLKM
FT                   QFEEEEDREFGASDPEDESETWYEYQKNKMAKQLEINKVQYEEMTPEMRIKIEGYRAGS
FT                   YVKIVFDNIPCEFIDNFDPTYPLVLGGLLATESRFGIMNARIRRHRWHKKILKSQDPLI
FT                   LSLGWRRFQTLPIYTTSDSRTRNRMLKYTPEHAYCFASFYGPLVAPNTTFVGFNIVDSK
FT                   STTGAFRVAASGIIEDINSSVEIVKKLKLVGYPYKIFRNTAFIKDMFSNSLEVAKFEGA
FT                   QIRTVSGIRGEIKRALSKPDGYFRATFEDKILMSDTIFLKTWYPVKVKKFYNPVTSLLL
FT                   GQHSEWKGMRLTGQVRADENIATPLNVDSQYKKVERVERRFNPLKVPKSIQAELPFKSQ
FT                   IHTMKPQKKKTYMSKRAVVLGGEEKKARDLMQKINSIRKEKDTKRKAKKDEKFKEKLKK
FT                   IAKTEELRKEKERERKKDYFSKEGKKRKLGSSDGQAFGKKQRV"
FT   gene            <187579..>187884
FT                   /locus_tag="CAWG_02437"
FT   mRNA            <187579..>187884
FT                   /locus_tag="CAWG_02437"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        187579..187884
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN6"
FT                   /protein_id="EEQ44175.1"
FT                   /translation="MTDTITFLRTCIVTTSSSIEQKDNIKFDVIALLLHHPIVILCRVT
FT                   IVFAPPAVLFDSLLKPFFPTSIRKCHWKIYTLVHLNSLFQKRYTLTHLIRRSHHTI"
FT   gene            <190743..>192542
FT                   /locus_tag="CAWG_02438"
FT   mRNA            <190743..>192542
FT                   /locus_tag="CAWG_02438"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        190743..192542
FT                   /codon_start=1
FT                   /gene_family="HOG000093819" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN7"
FT                   /protein_id="EEQ44176.1"
FT                   /translation="MATTTKTKKKKLVYRQDPDGVFRLKKIDDNNSIKSVDLANRKKEV
FT                   DNYLNELIDCSYSIVDDIPDKEIAREEEEEKIIHEIPNPPSTQPEPKPKPKPTTIKKVK
FT                   PTTVNTSSKNLTIKPASTPPQPAVVITEKIVESKTSPPTPPTTLPEAQPPQEENKTQEQ
FT                   ETPITKIPSPTDFVTHEETEEKIVEEVIIPAKPSIMSTIHEFLRFHIPSFVFGIIATVI
FT                   GTRYKDEIIYGAIGLTVLATGLAIVGVLGLCLCLYLGLVKQSDLKVLDRYIDILKFRAT
FT                   EERSQEKIVINEEVVAEPEPEPEPESQPVETSEEVEMEELVPAPAPQAEPEPEQYDVHD
FT                   TEVIREIPIEPQPKLYQPKLKRNSHSKTTPILVKDPQETGYQPLEEPQPPKPRRKSSTI
FT                   RVTPYVYEPREPRKYSVIPTSNTIPLPGDSPTKTTKHKLVHPKPMLQRIQTEPIKEVSR
FT                   RNSKRSTGSASPTSTRSDPYYLLQNAPQHHQHQQQHIFKERTHEIPPQIFKTKDLPNLP
FT                   HQAEELPFINEVRLVDAVSDDESDMIIPMEAPMSHYTGGGGHGHGVDNNIYRNQSTKSK
FT                   QSVLGTRANYRRFVSNVDNDYEY"
FT   gene            <192960..>194414
FT                   /locus_tag="CAWG_02439"
FT   mRNA            <192960..>194414
FT                   /locus_tag="CAWG_02439"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        192960..194414
FT                   /codon_start=1
FT                   /gene_family="HOG000034076" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPN8"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN8"
FT                   /protein_id="EEQ44177.1"
FT                   /translation="MPLYKEDNFLIIYPGSKHTLFLFGLSDTLSPPQFKIPSIVYQDSI
FT                   TKQYQATSNSENATEEIYPIIESKIVNLDAFNYLLKIILQSVIANHPTITINQIPMLLI
FT                   TPSLTWSRQSIEYITKYVIENLEITAFNIIDLSLAATFGVGQSTNSTVVYADDENIQIV
FT                   PVVGYQAIKFAGKLIKNEGSITISRELKQNLPNLTSQQIEDLKNSDIFEVVIDQQGMVL
FT                   DYIKDITKTNNDEDNEFDVAKIVTENQNGIPEAIISNTPTEQQQKEQQDSNKPNKELEK
FT                   NYFIDSKTQEKIWIGKERFSGTNNLVKLISSSIYSSLLSIPDIDKRQDCYDNIILVGSI
FT                   FKTPGLKEAVLIKLNQDYLVKEPNAIDQSINDPGVNTAILKYQQSTTINDYNEGGSGDN
FT                   NNSNSNSNSNQVPNSIKLVKYPDYFPEWKKPKEKGGSWHDVYFLGGQIYSKQIYSGSSH
FT                   HHGKELFVGSDMYEERGPQSIWDASI"
FT   gene            complement(<194633..>195550)
FT                   /locus_tag="CAWG_02440"
FT   mRNA            complement(<194633..>195550)
FT                   /locus_tag="CAWG_02440"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(194633..195550)
FT                   /codon_start=1
FT                   /gene_family="HOG000093820" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPN9"
FT                   /protein_id="EEQ44178.1"
FT                   /translation="MEPVINQYIEFLENDGKKDTSGLAPILRSVSLFGKRANDSTLELG
FT                   KNSKVPINSATRITIIKGYMCMLRCQYVEAENYFTQSLNDIPNEHHSQLSLLKCYNQMR
FT                   GTGIFKKKELELMLHNVQKLELDGSLKQQILAKIYHDLHNIEGNFKSKKSGKKKNGILR
FT                   LNQWNDYLKLSVETYIQAIIMAPVDDLFIPSLYDQILFLLIVNQINIRVIAFFYQIRYH
FT                   FAIRADYEYLYIPGVLDDFDPTSVGGEIIYDIKQYLEKGIINGATVLKEDHADYVKYWM
FT                   KEYRKEHKVTQAIKYYYDKVFMET"
FT   gene            complement(<195860..>196387)
FT                   /locus_tag="CAWG_02441"
FT   mRNA            complement(<195860..>196387)
FT                   /locus_tag="CAWG_02441"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(195860..196387)
FT                   /codon_start=1
FT                   /gene_family="HOG000093821" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP0"
FT                   /protein_id="EEQ44179.1"
FT                   /translation="MNLFSKLDNNESNKESNLILFSDFLPEVLSFTTSENERIQDLYLQ
FT                   LCSLFNHHSYNEILFLLPQLSSFSMLPAIINLIIGATMIKLGRLDSGFRELAVAIIMSS
FT                   RGEQRISFLIVAATLHAELNDRERVQGYLGEILDLSRQVVQSSEEFDIVKENLEELENT
FT                   LLIKLENVKDKE"
FT   gene            complement(<198185..>200992)
FT                   /locus_tag="CAWG_02442"
FT   mRNA            complement(<198185..>200992)
FT                   /locus_tag="CAWG_02442"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(198185..200992)
FT                   /codon_start=1
FT                   /gene_family="HOG000093823" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP1"
FT                   /protein_id="EEQ44180.1"
FT                   /translation="MDDFENEQIFTKKSVQLHNDIDSLISKLESLVEAVDIASQDKQRL
FT                   IQITTTKINLIINEFETNPKLLDSHLQNYITQLCDLYLNQLSIRSHCGEIVYNLAKIRQ
FT                   MKNIILYFPSDLYLINKILSIVTTTTKANEFITFFALLWICNLSLLPFPLNSIDKNLSI
FT                   TIYKLGIENLHKYHNGSKNQIASSILLSKLLTRNDCSHLLQHFFQNIDINNWVILDANS
FT                   KLSYYLTVNKLLKSQNIVGEDELLKINQCINNDLLQSKSLNPSNLNVLYSVKIFSKLAL
FT                   NYISRGDFSQVQSIINNLINDILLEAGNLDYNLRYCIAKALSNIVDKLSNYAINYQQQL
FT                   IEFILSNLDITDDVSISKNHTILLTLGYLCLNKTMSNQYIGKLLNIVHATMFIKIRTHS
FT                   QKADLGNCIRDSSCFITWAIIKNQKYQNELLETTDQLTTIFTDLIKLLIFDQELLLKKC
FT                   SIAVLQELIGRYGQQIFQNYYVDKELLGAFIINFMESFSDLRLKQKCITFEMIDLMYDK
FT                   IDLKFLLPNLLDEIYDNEDPNDELGLYLHKLLTQQDNLLSVVQYNYNLDEIKLTLIDKN
FT                   RLKYLYDLPKVPYQELSEKFSNFNYHDNSQLLSGYLTFLLNKIELTDLDWENLFQIIKL
FT                   NDGKFDSYIGKIIRSQNTIPKNSILHLLMKNNVTLSTTIFNFQNWSTQDVEFIVNIIKN
FT                   PNIDIEIRRNLIYNINDNYTTYPIIEQMYSLFDDYTLTVQGDIGSKLRLAMVELVQQHN
FT                   LSNDTIKSKLIRLSGEIIDKIRLFAFQLLVDATVDGNKYWQDWFEYYNSLNNDYEKIEF
FT                   WKGSLHTIGSFKGDPKIINDSFTQLLNHGPKTNDFNIWLKLLDKPKSGNKESSRDLKLK
FT                   LMILQTFLKLFQANYNFNNYIDYNELYEKCYQLYSNGGNINQISIILSIFIILPRNQNQ
FT                   HHQQV"
FT   gene            <201300..>201590
FT                   /locus_tag="CAWG_02443"
FT   mRNA            <201300..>201590
FT                   /locus_tag="CAWG_02443"
FT                   /product="predicted protein"
FT   CDS_pept        201300..201590
FT                   /codon_start=1
FT                   /gene_family="HOG000039916" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02443"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C4YPP2"
FT                   /db_xref="InterPro:IPR000517"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP2"
FT                   /protein_id="EEQ44181.1"
FT                   /translation="MSTVPKQLYYRITQLRSSIGMPPKTRNTLLSLGLKRRYQVTYVKV
FT                   DQSSAHQLAMVKELVKVELSEDKKTRQEINQERKYKTGFELIKDGMKKSYA"
FT   gap             203946..204045
FT                   /estimated_length=unknown
FT   gene            <204046..>204441
FT                   /locus_tag="CAWG_02444"
FT   mRNA            <204046..>204441
FT                   /locus_tag="CAWG_02444"
FT                   /product="predicted protein"
FT   CDS_pept        <204046..204441
FT                   /codon_start=1
FT                   /gene_family="HOG000213132" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02444"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP3"
FT                   /protein_id="EEQ44182.1"
FT                   /translation="RNDIVGVSKTVDLNQSTPIKKLPPTIPSAAPAPIPLRNKKSDNLA
FT                   CHADNILRMAIDSTIISSNSFTINSFEEDDDDEEGEGVDDHDHDHDFLQENSLIQLLKY
FT                   KNSKRELRFKPPVIKFNINADDINSVL"
FT   gene            complement(<204513..>206654)
FT                   /locus_tag="CAWG_02445"
FT   mRNA            complement(<204513..>206654)
FT                   /locus_tag="CAWG_02445"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(204513..206654)
FT                   /codon_start=1
FT                   /gene_family="HOG000093824" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP4"
FT                   /protein_id="EEQ44183.1"
FT                   /translation="MFRNVVITVKNTIRKLNQSYKYRGQFLRLQHNSTMLNHNNNNHHH
FT                   QYRSITNSKPSSLSKHPKFNSTHGKNSLSNNHISSKQLTNISLDQILLNISKCNDYNSL
FT                   TKYISTINHQYLNSQNSILQLVTKWIKFNNKFNNKLPSFNALNGIFESLIRQQHEVTTT
FT                   KNINYVSNLLTLYLYLYRFNHSALNILPLNLIWIQYGNRLIYNIYFITYLENLFNTNQN
FT                   QLCITTLINKLKTFQFDQDMEEIKILENIPRSMILYMIEMKNFDSLNFLISRFLIHKVV
FT                   IDNELWNLLLQLGLENNNYQLVTLVYDNYIMKDFHQGKITLDDIILNTKLVSQNSNIDL
FT                   QSFGDSLIFQILHTISMNGDIKRTEELITSHFIYKSLSNMDHGLSKELCIKIIESYCYY
FT                   KPNNIKSSSSYIPDNSVKEILSLIDVMLDNQKDLSSIDFFECMNYKFKNWTITSFNENK
FT                   SDSQQQHQEEEEEDKKELPLLQGNKNLHNSEYGIILANLSNLHEFINIHMNYMDENNHK
FT                   LKTKTIFINCLLNHIMIFLNHSGIVSLLKNLHYLKGSSIIITNNYLDSISWKLILKSLS
FT                   DSTSKKCGKIYYNYLKTRQNDIEITPMMYSQLIMTCMNGDSNGYFHDVLFYIIEYFKQY
FT                   SKLSSEIKGVLDYGGQYDINVKTLLDNIINWQNSNENIEILLSKLKDIQLKPIDNPIKR
FT                   QYLEKYDSRDSETLMKIFQ"
FT   gene            <206890..>207969
FT                   /locus_tag="CAWG_02446"
FT   mRNA            <206890..>207969
FT                   /locus_tag="CAWG_02446"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        206890..207969
FT                   /codon_start=1
FT                   /gene_family="HOG000265011" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPP5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP5"
FT                   /protein_id="EEQ44184.1"
FT                   /translation="MNKYISITRSLATAAKKSTTTTTTTTTTTTTTPTPINNSQPQFKV
FT                   FDKSTKFLQRSKHAKLTPELSRKKDYLRDEIAIKTIERLAFITRPMDNLLDFGSNAGNF
FT                   LNQLIKDSKLPPRSKDEEKEEGDDDMEMKLIEQLNKDKQIVRDKIKNLIMFDTSKDLLY
FT                   RDVNETDQNGNFPGKITRCVGNDEETFNHEIFKTDNQYDAVISNLSLHWINDLPKVLTN
FT                   IHRILKKDGFFMATLFGGDTLYELRTSLQLAELERKGGISPRVSPLIHLNDIGSLLTKA
FT                   GFSMLTIDSEDIIVNGYPNIINVCEDLQIMGENNGLISRNYLDRDVLIAADQIYKSLHG
FT                   DEHGLPATFSVIFFIGWKN"
FT   gene            complement(<209086..>210909)
FT                   /locus_tag="CAWG_02447"
FT   mRNA            complement(<209086..>210909)
FT                   /locus_tag="CAWG_02447"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(209086..210909)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPP6"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP6"
FT                   /protein_id="EEQ44185.1"
FT                   /translation="MPSQNHNREVIIKLSITRTHTPPPDSTTTTTPTTSIEKTICVKRE
FT                   LFTKIKSKPALTEFLNKQLPGYLSNDDNYLVYTRKSKRNKDFVSLITQDDFKSLARSLK
FT                   VKNHVKLNVIDTSTPPKVNNTNQDNKNNDNNININNNNNQQYGYTYTGTTYKSGKPPSI
FT                   DFGNLRDALIDAAYDHFKEIFNEFSNGLKKEMASTTTTTTTATTSNTKESPPAPISTPA
FT                   ESVVEEPKAETKTETKTESKVEPEVEPEVETDSSPIHPNICCDVCHPYDFVPLKGIRYN
FT                   CLVCSNFDLCSKCEAKQHIEKLQFGPHSYLHPMAKITYPTMTSTRGFGFGYTNHFSRAS
FT                   SNCGFASTGGTGGIGGIGGGRDHHHHQQWTANDIVYDIPLENCNADTKRKLEELLKSKG
FT                   FEGFIKDVEHYISNSERYEKLCAMMDFEEEDEEVKYLILMSALEYANNEFNEEELIASF
FT                   NQSTAGDNKSKEMTSSESSSAPPPPQESESETETGVLNIEGDVIARPKNFGGNVSQIVS
FT                   LQLINNTNETIQGGELLFEFFNQEQTIPVKVKNASDIKPGRVKYYHLGKLPEEFKKTDA
FT                   NNNVQLRNYLTLMQYYWVIINLISIQCKSYK"
FT   gene            <212164..>213408
FT                   /locus_tag="CAWG_02448"
FT   mRNA            <212164..>213408
FT                   /locus_tag="CAWG_02448"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        212164..213408
FT                   /codon_start=1
FT                   /gene_family="HOG000176389" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPP7"
FT                   /db_xref="InterPro:IPR011679"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP7"
FT                   /protein_id="EEQ44186.1"
FT                   /translation="MMKLLSIITTVLYFFTFLVSSYTTSNIIQANDNNLQSLIKTRGKF
FT                   SFVDFYADWCRHCKKISPIIDELSELFIDYPEIQIIKINGDKDGKKMSKKYVDIGYPTL
FT                   LFFYDDGKKIEFDGIRDLTSLSNFIQQLSGIRLNESKSTDNNEEEEEKKEKKESSSSGS
FT                   SSNVNDAVEETNKLIELTPENFDEKVSQSPISIVSFGASWCKYCQELDTALDKLANEVY
FT                   IRDSNNNNNNNNKKKIMIGHIVIDQYQNNSIDKRYNIQDLPTVLFFQNGDLQSPLVYKG
FT                   KKNFHNLLNDINKFTGLNRDAQGNLNNEAGIINEISQLIKNYYNSGDNELEIFDELEKV
FT                   KTSTSISTSGGGGNDDGDDNDDVIGYYEKLINAKEYIPIELSRINNILQNDIDKLNGIT
FT                   IDSLTKRANILRSLL"
FT   gene            complement(<213466..>214413)
FT                   /locus_tag="CAWG_02449"
FT   mRNA            complement(<213466..>214413)
FT                   /locus_tag="CAWG_02449"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(213466..214413)
FT                   /codon_start=1
FT                   /gene_family="HOG000248817" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP8"
FT                   /protein_id="EEQ44187.1"
FT                   /translation="MSIVKNLFKGTTTNNLDKEIQQKGFEISQCSEICESCTSKFPKHL
FT                   KFEGESEGTSLWNTTKPYGMHIIIATGKKDWSHDAINEDGKKKDTLKYKIGKWAENNTN
FT                   SPLGTIKVNVSSMSSDELYINENYKLEKQGDLLILPYFLNIKGITIDEVDTYLNELESL
FT                   LIKNNNNNNSTTNNNDSTIIIDEIITKLPKISPNLNQSFVFFCSHTTRDKRCGITAPIM
FT                   KQEIDNYLQELDLIRNFGDYRPNGIQTEFINHIGGHKYAANVIIYLKKSGKNIWLGLCK
FT                   PNNIKPIVDECILGDGKVWPNKVRLLQKFDPIEW"
FT   gene            <217304..>219439
FT                   /locus_tag="CAWG_02450"
FT   mRNA            <217304..>219439
FT                   /locus_tag="CAWG_02450"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        217304..219439
FT                   /codon_start=1
FT                   /gene_family="HOG000193875" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPP9"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPP9"
FT                   /protein_id="EEQ44188.1"
FT                   /translation="MLSTISPSSSSAPHPPQDHFHNDSPKSGDKNSSLPAQFQTQPSDD
FT                   ELTIKLPLLTSENLLQRQEEEEQVQVQKGNPIVESSNNKNTTFTNNNNDNDNHRSPSTP
FT                   TSFKGTRSETNSNYTHETTPSSLDHNDSKSTLPPSDTSYQFNLKINNPRSSFDIDPLHK
FT                   PISNNHEQHHSGANHTIKSPQPVSQPTADPISIPQNTIISSTTTTTETPKNIRRHTSPM
FT                   PMPMLPRRSLDGHVGSSKLQKLTSRTDSAIALTRHSINIDRPTNRSTFGGTGSPRALPI
FT                   SSTHEIQRMRDSILLKRHMKKRPTEEDKVLVGNKISEGHENFVMAYNMLTGIRVAVSRC
FT                   SGVMRKLTEEDFKATKKLSFNFDGSELTPSSKYDFKFKDYCPEVFRELRQIFGIDPADY
FT                   LVSITGKYILSELGSPGKSGSFFYYSRDFRFIIKTIHHSEHKQLLRMLKDYHHHVKDNP
FT                   NTLISQFYGLHRVKMPLFGGGSRKVHFVVMNNLFPPHRDIHLKYDLKGSTWGRNTTIFP
FT                   GWDEKELSKHTLKDLNWLERHQKIQFGPEKRHIFFKQLEADVKLLQKVNVMDYSLLLGI
FT                   HDVKKGNTADIEKQLSVFEPKSFDKRALINTNPRDLDRQQDLPNDVFPGRSKYVFYGHD
FT                   GGIRATSEENIPTSEIYYLGIIDCLTNYSLKKRLETCWRSLSHPRNTISAVPAREYGDR
FT                   FLEFIKKGTTQLKKKRN"
FT   gene            <219973..>221400
FT                   /locus_tag="CAWG_02451"
FT   mRNA            <219973..>221400
FT                   /locus_tag="CAWG_02451"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        219973..221400
FT                   /codon_start=1
FT                   /gene_family="HOG000248818" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ0"
FT                   /protein_id="EEQ44189.1"
FT                   /translation="MSLNQYIRPVRTKLSHISFIRNISITQSSINTTIKNDESISKTTT
FT                   IPENIQQAKELAGYRALEIPEFKTLGSAEGTTATATGSSSILSINVPPSVPVYIRRGSL
FT                   LSIYGIQEISSIDSVRSQLQFPNFWKRLIYGGYVSGYQKLISTTPFSLLISSKSRSSGS
FT                   GSGSGFEKSFVNLVLDGTTDWAILDKSALQVYTGNSLSITMHKLPKFISKKLSRSLKKD
FT                   KKSKTNTNKLETGLFSWKKLGYTLLSGRGKVGLVGNGSSSGYGSSIYNINLNQNEEILI
FT                   NKNNLLGITVNGPYDLQNCIVKYEFPIINNANPTNTNTNINIKEPVTIVKPKLIQPTTW
FT                   NLIVLKLKNFNNGFKKIFQIINKYTLGLKTTSYNYLAGNQDFIKVIGPRNLLLQSNTNK
FT                   SHRGFYNIIPRNKPQAKVWPTNQTTTKVDESSSFSTPKDYLNYVTIEPGKGAVFKSTLD
FT                   FSETVESIENKNKNKNK"
FT   gene            complement(<221625..>224861)
FT                   /locus_tag="CAWG_02452"
FT   mRNA            complement(<221625..>224861)
FT                   /locus_tag="CAWG_02452"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(221625..224861)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ1"
FT                   /protein_id="EEQ44190.1"
FT                   /translation="MANRNDDKKLSQNEGQNYYHQQPTSHTINQSNVAPPPLPPPPGAN
FT                   FSVPGINQLPGQQLPTHFSLPHQQQTQTPISQPQPIIHPFPHQHQLLQQQQQQQPHQQQ
FT                   PQFQLLTQPHQQQQQQYPPPEPLSSTSSYHNNTNSNNIQYVRSFRNHLNPYYAVNLKFL
FT                   KDLNTMTKFWTNNEIENSRRLVKFNFKSEGSTQMVNFEPITPEQYDNVSPIISCIYWKE
FT                   KSRYISTSVDIITLLEYMVKQTFDVDEKNRIRRNLQSLKPTTISRINKNDRRFFDLIMS
FT                   MENPRPRNIEKDLKVFDWSDLGRAVQKVMSKYYVVPSSAPTTSSSFSSSSSFQHPNPQQ
FT                   MQSMPGIVGNPSQQQQQQPLSVPTPTPLPSSMPAVPVYGIYTGRSSFPINQTPIHYLTS
FT                   PIGNNNNTGGSFPKSQVASPSVHQQHTFNQRPGTFFPSHNYYQFFDQPKSQPHLQPLTS
FT                   GGGGGGSGSNTNVLASPSHTFESSNRQTLPNESSDKYQENQTGTISGSNDDSRKTKSDF
FT                   KENNNTTTKNEEISGTTKETDNNDGSNEDNNKLYSNQYHSRSSSFPQSIISLESISSSG
FT                   SGSGSGPGSQLKNPPNSDPTKLPSSSINNANPVGFSAVPLSSSSGNNSVSPPVSLNPRN
FT                   ESESSSSANMITPPVPITGISDEKDDQKSLSSSNGDNDGHTSSSSSSGSSSSASGSNGI
FT                   SCRSSGGSGGGGTSKKRRKRKNRKKKNKKKNLKFKDKSNSYFSSVSNDVSSSTSSGKEL
FT                   QDGLSGSSSGFVSGSTPSSGSASVSAAGSGSGSGSGSGSGSGSGSGSGSENSNNEGNIS
FT                   SGDRRRRRRHKRRQHRGAKDIDREASNSGSDSIYSKDSALSLNKGSTNSSTNSSTNSSV
FT                   IWDKDSNGSGGGGGGVKPSTNSTKNGISLLSKNDKKKPINIATTNSSDKKKNNKKKKNN
FT                   SSTHRHRHDDGPDQHGTNNGSEEGGDEDEDISMDEGDEEEEDYVLMEEKNNNNNDDKLK
FT                   LKLNNNDNNPTIQVLQKEKENIKSVVDKDSPSPPPPPPPPPKLPSISQLLGENFQSNTR
FT                   PFGGDGGDDDNGSNNKLPPITKKVEKWKDR"
FT   gene            complement(<228874..>230271)
FT                   /locus_tag="CAWG_02453"
FT   mRNA            complement(<228874..>230271)
FT                   /locus_tag="CAWG_02453"
FT                   /product="sporulation protein RMD1"
FT   CDS_pept        complement(228874..230271)
FT                   /codon_start=1
FT                   /gene_family="HOG000164450" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02453"
FT                   /product="sporulation protein RMD1"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ2"
FT                   /protein_id="EEQ44191.1"
FT                   /translation="MKSRRINRITFIDAASSSSQSSAKPSSSSSSSSSSTTASTSSITP
FT                   TPSLVSLKQPTLSPSSNTAKTNSKLVKSNKIGLQRTSRTSQKLKLLPEDPDLDIINTLS
FT                   GKDGDNDDDDDDDENAPPTRVYSQVKKITDTSARKDAETLNKSHRDLLPRVTAYCTCGS
FT                   YRMKELLRWLKDKKKIHNTSPKLFDECLYTPFTYKDWRGSNNNNNGSDTIISDDDDAVR
FT                   KLIRLADEGGEIDIGKKNDIFIFEYGVVIMWGYTTKEEAAFLEDLARFESEKLSEEDIQ
FT                   IEEFNYYITKSYQPRIYNDFITLRDDDNYMLKLSISHGLAQSVKISLFEELVDNTIEDT
FT                   QEIPQQIAHTGKVEMTRDEIMKSIGELFILRININLHGSVLDSPELMWAEPHLEPIYQA
FT                   MRGYLEINQRVELLNQRLEVISDLLSMLKEQLGHSHEENLEFIVVVLVGVEVLVSVINI
FT                   IIDIMAF"
FT   gene            <230707..>238206
FT                   /locus_tag="CAWG_02454"
FT   mRNA            <230707..>238206
FT                   /locus_tag="CAWG_02454"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        230707..238206
FT                   /codon_start=1
FT                   /gene_family="HOG000248819" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPQ3"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ3"
FT                   /protein_id="EEQ44192.1"
FT                   /translation="MSKPRTKTTESSRRHAFSSFRERVDSIKIEPSKKLTKRVYDYIDT
FT                   EDQTDSYFLTTLEHWKETNLSGNFTEFLNKIEQNCQSLPQLIYHQSSIYQALFDAISKN
FT                   DVHSIQPLLELMSQFIHDLGSDFLPFYTRTLKLLTDLVLSVNPNDFQNNRNTSNVLEWA
FT                   FNTLAFAFKYLSRNLASDLKPTFMELLPLLQLTKKTYISRFCAEALSFLIRKSNPESLN
FT                   ETVQFSLFDQIDIILYNDAYCESLTILYSEAMKNTKGTFHSKANVIFSKLMENTLYKVD
FT                   AKAQPKLISIISDIILDILNHGTVESCDKFYAMVTKYLNSLLQKNDPSEVELLTTCQIL
FT                   STLAFAESGKKITSWDIVLETVDLLVEKLNSINITTKQELLESYIYLLVIVFRNADIQS
FT                   LTIRHKKYFDSIYNTPGFLTFTEASLSIAKSKVINFGITKLVQNYINNCSSNDSEKLTY
FT                   FLEKNDISSKLQIPQSLVTRIANEVNQDIESQSFKSIHWKLLLLNFANNFQDINLQSLK
FT                   TLLFNLGNGNKNLAAITLDIISHKLKELSDSQTTHLHEVTSFLETNFHKFDTSAKFLNA
FT                   INNYVKATTQSGDFLSKAITCLHYPTHELRTNAIELISTLVGDSSSTYLSQIRLIEQIP
FT                   LNISTGRDITLRIRNLTTEFSKEINPNDLDKNLIVNYFFGLLSNKFQPSWTAVYESLPL
FT                   ISSTCKPEIWQVAYKLLTLDYTNDENHEEDEDLVNFPFESTLIDWQPRNSRLLNNFESF
FT                   ENSYLAPYRNISEAIDNSLERNAHFDNMVRSHVLSALKTVPSVAEKNAGKLIPIITHQQ
FT                   PTTDEDDGLQFWSRKDRNELLELFAKFKNLRKIPEGEELYDYLLDYLLTSKYVKVQQLA
FT                   LDVLFTWNNPSINKYRDNLKNLLDDAIFSDEISNFIMTNTTSSSSSSSSSTTSIIEPQD
FT                   KPIVMKFVIRILFGRVQGSPKSNSKQGKKFAVISVLPSLTNSEIISFIELGANKIGYEG
FT                   FFSGQIPKASLGLDQSELKKISGFINLLSEVYNTLGANYSESLQTTIKPLVFSLVSAQN
FT                   RIESTSLVDSIITEKMAKNIRSNGMRCLTELFKIIGDGFDWNDYLSLIYDNLLNPRMDT
FT                   FADENLQQPSAMLKLISFWIGQSNTLPFLYIDEFAATRAILSLLSKSSEAKEAVTITVL
FT                   DFTINALERKDNEIDEKYFTLLAFVVDSLLQYLPQTIEMIYNKDVGSRAIKVLLLLISG
FT                   KYIEDHDTKSSLIKSLTIALEKNNNQIDLDDKANILVSLSSLIDDYDCEFHEIQPLYEI
FT                   CSKLLKMFAARNVRETLVVVINTLGNKFKPIEPIAPIIAGLNAYSDRMSEYDFEKRLEA
FT                   YRLVNEELYKELTPIQWLPLLYCALFFINDCDELAIRVNAGYMLKRFVDCYSSKEEPKE
FT                   YIRLLKDIVLPNLKIGIRKDNEDVQTEYILVLEHIIEHSKYYTDLDDMRVLVGNTRNAA
FT                   TDDDDDEDGEDNFFQSINHIQLHRRQKVIRKLRDYKDDLKDNSISHYILPIIEGYVTTK
FT                   EDKLRNIGLEALETIGVLLKSVTWNQYKAIVKRYIANLNKAQDTLKQRVNLIVAVSSAL
FT                   AQSVKENNTNLPDQQELDQFVLYEISPPLLKILQVRDDETIVARAPLAEHLPNFMLCIT
FT                   KDKIDGELPSILTSTCQVMRSRSEELRDAVRKTLGKIAVSLGPNYLSFIFKELKTALSR
FT                   GSQIHVLSFTVHYLLTCVATILKHSDLDDCIEIIIGIVMEDIFGAAGQEKDAEGYTSKM
FT                   KEVKFKKSFDTAEIVASNVSLNQFGTIIEPIKMLLQEMISHKTQVKLDELLRRLSLGLN
FT                   HNQEASNIEILHLCYEIYMMSKENDDDDNETNGKSKVSAKEQHFLTTLDRKVKKRVDKS
FT                   LYKQTMQRLSFELLRTAISRHDNLMSVTNLQGFIPLLEEGVKSENETVITASLKILNII
FT                   IRLPFPDQGIFKACARRTLILIKDSPSTNSDICQAALKFLATTIRHNPEVTMKESAISY
FT                   VLTRIQPDLEEPNKQGLAFNFLKAVVSQHIMIPEIYDLMDNVAKLMIVNHSKEIRDMSR
FT                   SVYFQFLMEYDQGKGRLEKQFKYLVSNLTYPTEEGRQSIMELIHLIVVKAGKDLLNKLA
FT                   SSFFVSLANVLVSDVSSRCREMASSLITTILKKLDDTSSMEKYCLAWIKQSTNSLLKRC
FT                   GLNIYKLIIMARGFGKNKELDKIALDNILNIIEASRNSKDDDEEERSMPSTSTSGGGGD
FT                   VEWELVYACLSTFSSIASILKDRIFEYRKIWNGIINILLFPHSWIRLITCRLVTILLSN
FT                   NVVSESRKYDLETIATKLIHQLRAPSITEDLGTQITKNLVLIAMKWEKESYEWDEKFAN
FT                   DQLLSKICGIIKSEHVHSIVSKKSCIKLTAMFIQFTNETRIIKISEMIISALYNYTDPT
FT                   YATPDDELTNLSLEALELVQEKIGTTEYTKLYSNVKVNVNIKRQERKAKRAQMAVSAPE
FT                   IAAKRKLKKHERVREKRKHEKDINGYYKPKKKRMM"
FT   gene            complement(<238281..>239290)
FT                   /locus_tag="CAWG_02455"
FT   mRNA            complement(join(<238281..239169,239247..>239290))
FT                   /locus_tag="CAWG_02455"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(238281..239169,239247..239290))
FT                   /codon_start=1
FT                   /gene_family="HOG000001026" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPQ4"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ4"
FT                   /protein_id="EEQ44193.1"
FT                   /translation="MKAPSRDNIPESEGIFKQKCKELRKRVLEIEENNEIATIALSRTQ
FT                   ATIRRLRLEYAILLERLEDRATQLPDGIVAFEEMACPPTPTILDDSLVKSKTGYKKSKS
FT                   SSSSSSSSSTTSSSAMKIALASGSSKSSNGPSDVASTTMGKQKARDPDLPKRPTNAYLI
FT                   FCEMEKERIKQDDPNASDLSKSMTEAWKNLSEERRRPYYKLYEDDRIRYQREMAEYNQK
FT                   KGGGGSGGGEPDLKKQKLAPQPEQEEADDDEANETRNSPIVKQTTETASSNENKQTTNV
FT                   IKSEENGAIAAEENKSLENVNPSNETPES"
FT   gene            <240533..>241537
FT                   /locus_tag="CAWG_02456"
FT   mRNA            <240533..>241537
FT                   /locus_tag="CAWG_02456"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        240533..241537
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPQ5"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ5"
FT                   /protein_id="EEQ44194.1"
FT                   /translation="MEIFINKIYPFFPVIEISDNKDSLNKFPPLLLNAIFLVASRCLPQ
FT                   NDNKDNNNNNQSIRERCQELFERCKLLELCENNKIALIQSFLLMSIHEEGINGSSLSKE
FT                   YITRACNLCGDLGITTLSGSNGTAVQDTQHRVYKKLYYDKSILIRLFWISYACDILSAS
FT                   THAREVYYNMNDVFIDDVPKEFPELIKFVELSTLLYRTLGSHYRPHKGRIIDEKLFTDI
FT                   QNWNSLVDHPWLKLLYSYICMINLRCEVDPITLDPQLINSLQIQFDNVANIDPFWFKFH
FT                   IVGVHSLLHVTSLLNLLGNNDENLDTNNKIKTRLEDLKEIWWLAASGLKLFGK"
FT   gene            complement(<241573..>242205)
FT                   /locus_tag="CAWG_02457"
FT   mRNA            complement(<241573..>242205)
FT                   /locus_tag="CAWG_02457"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(241573..242205)
FT                   /codon_start=1
FT                   /gene_family="HOG000093825" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ64"
FT                   /protein_id="EEQ44195.1"
FT                   /translation="MPLISRTSISFNQDNFKILVFFIIPILLSIYLIPKFINPEMINNL
FT                   SINFKIGLLSKQYCQIQPIYCSILLDDKYGDPNQLKRIQFKYFELIYVVHDWIYNIDQF
FT                   IIHKIILSSPIKKLVGSIIIMKRSYTSNGGGEAAGAGQVEEMWDFLIEIVQIMLAVINS
FT                   MIYHLIWGLIVSRMYVFFIFGTLITVFEPWERLIGPIISVINTNNVY"
FT   gene            complement(242557..242645)
FT                   /locus_tag="CAWG_08054"
FT   tRNA            complement(242557..242645)
FT                   /locus_tag="CAWG_08054"
FT                   /product="tRNA-Arg"
FT   gene            <245637..>249272
FT                   /locus_tag="CAWG_02458"
FT   mRNA            <245637..>249272
FT                   /locus_tag="CAWG_02458"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        245637..249272
FT                   /codon_start=1
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPQ7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ7"
FT                   /protein_id="EEQ44196.1"
FT                   /translation="MAPRTPADKLGHASTLQLPTYDNDDQSSTNSTTPLHKDTPEETTD
FT                   TSTTTNDVEPFHPPKLLSKTTTSPSIKLTSMLSKTSTKQNPNFPISLQSLSELHDPKSL
FT                   KQLYDLGGIDNLLASLHTSFDGLNEHNETDLSQRKQYFGINRLPQKVQKSFLKLCWEAL
FT                   KDKVLVILCIAAIVSLALGCYESFGSGTHYDDEGLPLPKVDYVEGVAILVAVAIVVLVG
FT                   AANDYQKERQFAKLNAKKEDREVIVVRNGGEQKLISIYDLMVGDVINLQTGDVVPADCI
FT                   LIQGEVECDESALTGESHTIHKVPVAKAMKVYQNHLPTNEDIGSTQIKFRDPYLISGAK
FT                   VLSGLGNAVITAVGTNSIHGRTMMSLNHEPESTPMQVRLNDLAEGISKYGFLAAIVLFV
FT                   VLFIRFCVEIAPNGNMNGAEPADKGKRFIDIIITAVTIVVVAIPEGLPLAVTLALAFAT
FT                   TRMAQNGNLVRVLKSCETMGGATAVCSDKTGTLTENKMRIVRGFFGLNKQGQPLEFNDT
FT                   VGNQHDEPTSIDIINNEISSEQKVYLTTNIILNSTAFENSEYDEEKAKLARQKPPKRSF
FT                   FSSLFKNSKKSQYQQMGLVDEPYLGNKTESALLTLAKDKFHLFDNKSLETCRQENNSDV
FT                   IQVIPFESSRKWAGIVMKIPNGFRLYVKGAAEIIFKNCGFENNINDELIKLDRSKRDDV
FT                   LSKIDEYANDALRAIALAHRDFVGISSWPPSELSSSSENKKTTTTAKEADPAKLINTSS
FT                   SASEIHKMFILDALVGIQDPLKKGVAEAVLQCKRAGVTVRMVTGDNINTAKSISKECNI
FT                   LTSDDLSNEYSCMEGPQFRKLSIQKRREIVPQLKVLARSSPEDKRILVDTLRKAGEVVA
FT                   VTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFTDIVQAIKWGRTVSTSI
FT                   KKFIQFQLTVNITACVLTFVSAVASSENKSVLTAVQLLWVNLIMDTLAALALATDKPDD
FT                   SFLNRKPAGRTAPLISTSMWKMIIGQSMTQLIITFILHFAGKQLFFPGQSHINNHSEKQ
FT                   LAAMTFNTFVWLQFWKLFVTRKLDEADEITTIRGRISRENLDFFQHLFRNWYFITIALI
FT                   IGGFQILIMFVGGAAFSIARQTPGMWATAILCGFLSIPVGLLIRIIPNIWIETIFPTKA
FT                   FKKFLYIVGFGWLKFRKNKKTKDNEEDDEMDLEGGGNSDLKESKE"
FT   gene            complement(<250076..>252218)
FT                   /locus_tag="CAWG_02459"
FT                   /note="predicted protein; frameshift"
FT   gene            <254529..>254924
FT                   /locus_tag="CAWG_02460"
FT   mRNA            <254529..>254924
FT                   /locus_tag="CAWG_02460"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        254529..254924
FT                   /codon_start=1
FT                   /gene_family="HOG000213058" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPQ8"
FT                   /protein_id="EEQ44197.1"
FT                   /translation="MRSIFYLNLLKNKKIKKTHYTRIFMYLNFSNSTEFSVDNEIHQKF
FT                   SRRRKITVPICSVVLFDQVSTGTPPTTECDITTIYTEVVNLKAVPQSLLISCSYICVCV
FT                   KLSPTSSNHTHYQSMCYQESPTEQNYV"
FT   gene            <255200..>255868
FT                   /locus_tag="CAWG_02461"
FT   mRNA            <255200..>255868
FT                   /locus_tag="CAWG_02461"
FT                   /product="hypothetical protein"
FT   CDS_pept        255200..255868
FT                   /codon_start=1
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02461"
FT                   /product="hypothetical protein"
FT                   /note="similar to decarboxylase family protein"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ69"
FT                   /protein_id="EEQ44198.1"
FT                   /translation="MTQKSIKVCVFCGSSFGNKPVYAEEASKFGKALADKKWGLVYGGG
FT                   STGLMGAVASGCATNGGYVHGIIPEALISRERTVDEEAFNAKLKSSIDNHDGSTPIPDS
FT                   KQYGKTTLVKDMHTRKRLMAQEADAFVALPGGIGSIDELAEITTWCQLNIHGKPIVVYN
FT                   VDGYYDNFFKMIQGFVDCGFLSEKNGQIIKVANSVEEVLEIIENYEIPEGRFNLKWETT
FT                   "
FT   gene            <256133..>256456
FT                   /locus_tag="CAWG_02462"
FT   mRNA            <256133..>256456
FT                   /locus_tag="CAWG_02462"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        256133..256456
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR0"
FT                   /protein_id="EEQ44199.1"
FT                   /translation="MRRSFVIHFTITNFFIQTRTGLKVRNLFLFLTNDNNYLNHTNITN
FT                   IFIIIYKLYKLNEGYILLHHVHHEHGINPQIHLEESLLEINNQLPHHITSPKLQFHSSL
FT                   MQH"
FT   gene            complement(<256299..>257144)
FT                   /locus_tag="CAWG_02463"
FT   mRNA            complement(<256299..>257144)
FT                   /locus_tag="CAWG_02463"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(256299..257144)
FT                   /codon_start=1
FT                   /gene_family="HOG000125184" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AJ71"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ71"
FT                   /protein_id="EEQ44200.1"
FT                   /translation="MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTH
FT                   PVRVSSGNHNNFPFTLSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWI
FT                   GCSDSRAGDQCLATLPGEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTD
FT                   CGGIWASLSKKKIGGVLDLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVT
FT                   ALKRHPSASVALKKNEIEVWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
FT                   "
FT   gene            <258142..>260736
FT                   /locus_tag="CAWG_02464"
FT   mRNA            <258142..>260736
FT                   /locus_tag="CAWG_02464"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        258142..260736
FT                   /codon_start=1
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPR2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR2"
FT                   /protein_id="EEQ44201.1"
FT                   /translation="MTTSPPIQDDEQDEEFKLKQIIKEQNLIPQINNHNHEDGASEQQQ
FT                   QQFNQLSKDKKMNRLNKLIEKSQIYSQIIADNILQTSLERKEEQNNVAPPAPVPAKSDS
FT                   KNESDTQPIKKRRKTKPKSKSTANGKQDIVSMLSTNISDSTKSTREAIEKSQNSSKITN
FT                   NKQPKLITGGQLKDYQMDGLEWLITLFQNGLNGILADEMGLGKTLQCISFLGHLIENGI
FT                   NGPFLVVVPVSTLSNWYNEIRKFAPKIKVTKYIGTKQERNDIDLLQQQETTNIILTSYE
FT                   ISIRDFNKLVKINWKYLIVDEGHRLKNSQCLLIKILKKLNVSNRLLLTGTPLQNNLNEL
FT                   WSLLNFILPDIFHDLELFQQWFNFDELTELAGELEGTNNEEDEETKNLIKLNIQETLIK
FT                   NLHTILKPFMLRRLKRDVIKNLPPKKEYLLHIPMTKLQKKIYYDAVNDKLFDSLVETNL
FT                   KAFIKFNHEELFNGFDVDEYLKIRRQRDSFIETGGLSKLRGSRSDRNSLKRSYKEADSD
FT                   EEFEIMDAEDDSLTGRGNTTPSYDEALVKIRHIKSKTKIQSILIDAIYQDILKEAKHLK
FT                   LQNLKMIQLRNICNSPFIYYNYPILDQAEVIRNSAKFQVLNQLLPPLLSSGHKVLIFAQ
FT                   FTKVLDLLEDWLEESPLLHGKICRLDGSTNHQIRDEQISQFNNNPKFKVFLLSTRAGGL
FT                   GINLVAADTVILMDNDWNPQMDLQAIDRVHRIGQINPVKIFRFVIKDSIEEVLISRSGS
FT                   KRFLERLVIQMGQFKFSNFNKKLTAATTANEQGAIKNDWSINDMMELSKIHFKSTQNGQ
FT                   TSQDSAEEDEKILLSDQEIDELLDRSVECYNSIDDSKFDKVRIFETVNNMDK"
FT   gene            complement(<261079..>262785)
FT                   /locus_tag="CAWG_02465"
FT   mRNA            complement(<261079..>262785)
FT                   /locus_tag="CAWG_02465"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(261079..262785)
FT                   /codon_start=1
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02465"
FT                   /product="hypothetical protein"
FT                   /note="similar to glucoamylase"
FT                   /db_xref="GOA:C4YPR3"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR3"
FT                   /protein_id="EEQ44202.1"
FT                   /translation="MRLLSFNLFIIFIINLGYVNSFLIPTKGLNLFHLQQQQQQTQQQS
FT                   IFSTNLKQTLTTPPPNSFDDWLVFQKQVCLKSILNNIGGDFTIDNKDLLPGVVIASPST
FT                   SNPDYYYQWTRDSAIIINILIDHLSQTPLHLINKNSTSSLVYIIESYIFNTQVLQQLPN
FT                   LSGNVDNLENLGEPKFHVNLTAFNESWGRPQRDGPGLRSIAIMNYLSLLNNTQHQPSFS
FT                   NLTMNDTSKIYHDIIKPDLKYSIEFWQFEGFDLWEEIKGIHFFTSLVQLKSLTMGLKFA
FT                   QFYNDSFEFRLDIMNSIELLTKYIELESGFINNEDSDGDEDNEQQLLSKSYIISSPKLF
FT                   YTKSRSGLDIASILAVLYTHNNNNANDDDDNDFPFDVDNGLVLTTLRYLIQDMTLRYPI
FT                   NFQDNFQGVALGRYPEDIYDGYGKSEGNPWFISTATASELIYRLIYKLKSNNQAIIIDQ
FT                   KNIEFYKEFIHSVSATEISNNELKFETHINGHPMMIINKDDKLYDELINKLFHYADGFL
FT                   KVVQKHVDNNGDMNEQFNKYIGFMQGAEKLTWSYGAVFTAINWRNKTLSIL"
FT   gene            <266109..>268340
FT                   /locus_tag="CAWG_02466"
FT   mRNA            <266109..>268340
FT                   /locus_tag="CAWG_02466"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        266109..268340
FT                   /codon_start=1
FT                   /gene_family="HOG000248824" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPR4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR4"
FT                   /protein_id="EEQ44203.1"
FT                   /translation="MESNLSNTESPSPSPSSPSSSATPTTTNISTNTTNNENPRIHTSA
FT                   TTNTTPSSADTTTKPKRQRRSYSCGPCKLLKIKCDLQIPCTACKKFNRVNRCLLQPPQP
FT                   PSQQELSKIQERKKRTTIKKMKLSNEFVQAYNVNPNALPSMISTMETTSKNYEKKTQKH
FT                   KMNQISLDKDSSPKENTNNTLKQLNNSNGNTKDTQLTKNSNSMSPHSLIEIQRHHLSFQ
FT                   QPQMNKQQLHPISYITSVSSPSSALTSTSLNFPQGSQQEDVIQYLLTMDSQKTIDLTMV
FT                   DIKRIKRLLPNDFGLFKSMFDCYLNTVNPIAIDMQDFSEIFKQSNLVYNKLLSIDDENP
FT                   KNLSINVSFTLIELRNLSLFFLILVNGLLFDFRGKKPPLDSTRQTHNNRYTNFLLERSI
FT                   YKSKHDVIEDWIKISKFIKLKVLAYESLTDIIFLIDWYMILKNYYDYENMVVENYLEFN
FT                   NLLNYLVLNNDFINTIEDPYNEVGRNSNEEEEEDAATTSVDENEVVYPDTRQFKVLSKY
FT                   WIQLRLIEIDYTFFQFKGSLLFANQLKGTVVPHKKILKTLYKDVELDPITTHLMKIWGL
FT                   YYKRSKNTTSVREIIKDYLLLYCNMMGTLKDELNEFETNKPLELPNSRSINLKDIELLI
FT                   KNQRLLHLFVRWLSFIRIESNYFPSLRYTTYFTTVMNLFNHFNYLDDKSNNNVLSMIFN
FT                   NYSLSNIKLFYQCLVFQGIFLVLLKNALNRNHNYPNNNPSTSLPKFKLI"
FT   gene            <269401..>270780
FT                   /locus_tag="CAWG_02467"
FT   mRNA            <269401..>270780
FT                   /locus_tag="CAWG_02467"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        269401..270780
FT                   /codon_start=1
FT                   /gene_family="HOG000209080" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPR5"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR5"
FT                   /protein_id="EEQ44204.1"
FT                   /translation="MNHNNNTYHGGSSTPPQTTELCNLLNCFLSHPIYNDSTLLLNDNS
FT                   QKKNNTSTTSNQTVSLSAAGMRALIYQLQSIYLRTPIKLFRPSRFDYLAYVRALANKHD
FT                   NIENKPYRFMTHSSLGMVINVVRKQGWKFIPDQILPPLIANSATGVILYATYLTTLDYY
FT                   TKQHEKNKVESHTTTSGGGGGTATTTTSRANFNWYAPIDTWRAGFVAGAVQSLAAAPVD
FT                   AIYTRSTVAEMLEGSHENLWVFGFNKLREIGLIGVFAGYGFSLVKESFGFAFYFSTFEI
FT                   IKTQGYNLTYKLINYYKRSEQLIKSNLKKIFHWDDDKIDEKLEKLEKYRSMKILKSSFI
FT                   LIAGASAAFSLLAVQYPISKVQKIHLSRLEALDVYNASRFVGNTSPFFKLYYNSYVDTY
FT                   KQVLRMKQRANITWFEAAYSGFVRNALTTIPATSIALLVFEIMRTKLSDNFEDYNDVLE
FT                   A"
FT   gene            complement(<270935..>271747)
FT                   /locus_tag="CAWG_02468"
FT   mRNA            complement(<270935..>271747)
FT                   /locus_tag="CAWG_02468"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT   CDS_pept        complement(270935..271747)
FT                   /codon_start=1
FT                   /gene_family="HOG000213905" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02468"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="GOA:C4YPR6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR6"
FT                   /protein_id="EEQ44205.1"
FT                   /translation="MTVNTKTYSERAETHASPVAQRLFRLMESKKTNLCASIDVDTTKE
FT                   FLELIDKLGPYVCLIKTHIDIINDFSYESTIEPLLELSRKHQFMIFEDRKFADIGNTVK
FT                   KQYIGGVYKISSWADITNAHGVTGNGVVEGLKQGAKETTTNQEPRGLLMLAELSSVGSL
FT                   AYGEYSQKTVEIAKSDKEFVIGFIAQRDMGGQEEGFDWLIMTPGVGLDDKGDGLGQQYR
FT                   TVDEVVSTGTDIIIVGRGLFGKGRDPDIEGKRYRNAGWNAYLKKTGQL"
FT   gene            complement(<272183..>273973)
FT                   /locus_tag="CAWG_02469"
FT   mRNA            complement(<272183..>273973)
FT                   /locus_tag="CAWG_02469"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(272183..273973)
FT                   /codon_start=1
FT                   /gene_family="HOG000093826" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR7"
FT                   /protein_id="EEQ44206.1"
FT                   /translation="MLDRLNRKQSKERFVNKIPISTTKIDKSLEHTRRDDESNNAKRGV
FT                   NPDESYSSDTSFTPTVVSGTEDAALTRTSTNRQRQGKSSFKSFFRTMSLKVNSKTRNKD
FT                   RKTKEELAAEKALAELRNLPRNPLDLELNELHVASNFNEVRKIIDDIFIDENHDAASKA
FT                   IRISTQNKSFSAMEKPYSLTKIKSLQTEDDYSLPITSFIIETLEENSIHADLSHNDNAI
FT                   TSTDILIEEEEEMEQEEEEEMLNYDDLDVISDKIDEVGAESSISTSNDRGIIENATANG
FT                   PIIVGDSTESVDTSNIENRKLVVVNSTPDDHDYYATNDMNDNFITPNPSNESVETLAGV
FT                   YKDFEVTNATEANTEAGETTDINAETSNAIDAVADTENKVTAEDDATDTVNTGESMTDT
FT                   TTSTTDNKNDKEVDKEVENAVDSNVTTNDTIPDKVANIDNESSSDNSIDATTANTTNTN
FT                   NFNDAEVNTEATNTIVDNVTNDKFNSVDVSTTTPTATTVSGIPTADEMTNNVNANRIST
FT                   ATVDSFTGKTGENYESFITNAGKDSNDNNADLKTPTNNSATTTTNTQSGVSNKKSNSKT
FT                   GSSEQNPFQKKLMNYLNSLN"
FT   gene            complement(<275057..>275980)
FT                   /locus_tag="CAWG_02470"
FT   mRNA            complement(<275057..>275980)
FT                   /locus_tag="CAWG_02470"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(275057..275980)
FT                   /codon_start=1
FT                   /gene_family="HOG000093827" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR8"
FT                   /protein_id="EEQ44207.1"
FT                   /translation="MLSINNLLILSIFSFLITNVKSDLGGPCFSMSTMEGFACGLGVHK
FT                   NIQIITDCLCYIPGYWEQLDGCDKLVRGPHHTPIDGAEICSRASEYAANPAGFTGETDY
FT                   YESSTTVMHVVMLDFPTYSPGVTNFLDSSSNDLTTTNTDEINSSITTDEVIPSSSSSYI
FT                   EIPSETLMESSISTQPSTIETSETSNATSLEVSSIITGVSSEPLTIVSESGGLSSTEIA
FT                   STPVVITSPTPQPLLETPSQESSAPDIDSTTPTTIDNTVVDETTTNDATSVASSTSDVA
FT                   YVYIGGAMGYPSISVALGLVFIAYLV"
FT   gene            complement(<276998..>280375)
FT                   /locus_tag="CAWG_02471"
FT   mRNA            complement(<276998..>280375)
FT                   /locus_tag="CAWG_02471"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(276998..280375)
FT                   /codon_start=1
FT                   /gene_family="HOG000248822" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPR9"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPR9"
FT                   /protein_id="EEQ44208.1"
FT                   /translation="MEISKPSTPLSIVGRPPLRNANVHHHKTTLVSVDPITLAINECMI
FT                   MASAMRKSNRWAQSGAAALFSSGDIFGDDDEQEERHAEEDEEDEGEQNGSLNNLGVKPS
FT                   NLDRTNANTNIAVSPRKPSTTQGNPLLASFLQLKSILIDTKNIYDIDSLTLLQPFLMVI
FT                   KSSSTSGYITELALNTISKFLNYDIISFKSKNLQTSLIQIISSLTHCRFEAADQNSDDA
FT                   VLLKVLRLLERIIEDELSRLLPNDVVSEVVQTCLSLACNKKRSEVLRRAAEMSMDSMTV
FT                   EIFSKLKDIDPELDNGDDLQTNFSDTILPEDRIGGTDVPTEINSPRNSISGRENILVDE
FT                   NHEIKSEEKHQEPKDTRQEDDQQLKVQPVEDETKDMIEEQNEKQEIPPIENIPSSSSLK
FT                   EKTEFDVYSNEEPYGIICINEFLGILVSMISPSNQYQHMESTRVFALSLINTAIEVAGV
FT                   EIPKHPSLLNLVTDPISKHVLSIITTTESPALLRASLKLFTTITIVLDQHCKPQFELSI
FT                   SLIFQSILPQSEIQMKGSSQMSFRNPISKEILIESLSLLWIRSPSFFTNLFIDYDCDFE
FT                   KSDLAINILQYLCRLSLPESAFMTTDNVPPLCLEGVLSFISGINERSKKFKETKQKNDL
FT                   VEKRKQKIAFIKCTELFNENPKLGVKQLAIDGFIKDGNDLKEIANFFFSKSGRLNKKVL
FT                   GEFLAKPSNSELFGHFIDLFDFHDMRVDEALRVLLKTFRLPGESQQIERVVERFAERYV
FT                   ECQGQGHINPDKSTIENNINEAVYPDKDSVFILSYSIIMLNTDLHNPQVKKQMALDEYR
FT                   RNLRGVYNGQDFPEWYLSKIYFSIKSREIIMPEEHHGTDKWFDDIWNNIVVTTQSSIPK
FT                   FSDIKIEEVDKVLLSSVFPQIISTIFHIFHHAREDQVITTLIGYVYKLTQICLKFELHS
FT                   EIRKIIDKLIKFTTLTHTPKNLNEILITEVKLDNKTEIYVSDYACSFGRDFKAQLSTVV
FT                   LFKIIKKNNLKLKNWDKIVEIIERLYQYSLIIDEKDTTTTTTTTNDNKEGDDEKDNKEA
FT                   TVETDNSILKLLPSKDIKKFPIKRITNDSFLSILKNLIDNQPTEEEIQSTLAAMDCIKS
FT                   LDILNVLRIVAESKKQAN"
FT   gene            <281615..>282805
FT                   /locus_tag="CAWG_02472"
FT   mRNA            <281615..>282805
FT                   /locus_tag="CAWG_02472"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        281615..282805
FT                   /codon_start=1
FT                   /gene_family="HOG000076607" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPS0"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPS0"
FT                   /protein_id="EEQ44209.1"
FT                   /translation="MPRLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKNSQLPQQQL
FT                   SAIWELSDIDNDGKLDFEEFCIIMRLIFDVINGKLPNVPQELPSWLIPASKSAIIQANK
FT                   AVNQGNNNFGGIDDDEDDKLSNDFDWYISPTDKSIYEKIYDSKCDSFGRIKYSSLNELY
FT                   NGLTNVPSSEISSAWNLINPKSFETIDKDQTLVFLHILNQRENGKRIPRGVPASLRATF
FT                   SKEVPNYDLSAQAKPSISATTETGKKSFAENYLNKIGGGGGGGSSTINNGRNEKGTDFS
FT                   ATQGTDWEEVRLRRELQDLERLLDKVQNDTKNQKDNSNNNQDNNDMLIKYEFEQLLKYK
FT                   QNQLNSTTNASKNSTDLSSVKQDIEEIQNQVNTLQEFLTTKNQELLKLNQQIESLK"
FT   gene            complement(<282882..>283721)
FT                   /locus_tag="CAWG_02473"
FT   mRNA            complement(<282882..>283721)
FT                   /locus_tag="CAWG_02473"
FT                   /product="NADH-ubiquinone oxidoreductase subunit 9"
FT   CDS_pept        complement(282882..283721)
FT                   /codon_start=1
FT                   /gene_family="HOG000009797" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02473"
FT                   /product="NADH-ubiquinone oxidoreductase subunit 9"
FT                   /db_xref="GOA:C4YPS1"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPS1"
FT                   /protein_id="EEQ44210.1"
FT                   /translation="MISRTLLKRSLPTVQFLRPFTGSSIRRSAHEEDLVNLNELPRQKS
FT                   LEENYVPLINPTEKYKVQIEELHKFGTYIMACLPKYVQQFSVWKDELTIYVAPSAILPT
FT                   MLFLKNNTACQFKQVSDVTAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETTPVPS
FT                   ITPLFNGANWFERETYDLFGVFFEGHPDLRRILTDYGFEGHPLRKDFPTTGYTEVRYDE
FT                   EKKRIIYEPLELTQAWRNFTVGSSVWEPVGEGKDFTPESFKLPTPEPEPEKESDEKK"
FT   gene            complement(<284889..>285272)
FT                   /locus_tag="CAWG_02474"
FT   mRNA            complement(<284889..>285272)
FT                   /locus_tag="CAWG_02474"
FT                   /product="oleate-induced peroxisomal protein POX18"
FT   CDS_pept        complement(284889..285272)
FT                   /codon_start=1
FT                   /gene_family="HOG000141680" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02474"
FT                   /product="oleate-induced peroxisomal protein POX18"
FT                   /db_xref="GOA:Q5AJ84"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ84"
FT                   /protein_id="EEQ44211.1"
FT                   /translation="MSVEVDGFNASALFKELNEGLQDKSKAQEAIKGVNAVIVITLKNK
FT                   EGKDQSWVLDLKKEGTLTKVEGSVPKGDVQLLLKDADFVKLANGKANGQKLFMNGKLKV
FT                   KGNMMKATAIESVFKKLDPRPKL"
FT   gene            <286912..>287571
FT                   /locus_tag="CAWG_02475"
FT   mRNA            <286912..>287571
FT                   /locus_tag="CAWG_02475"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        286912..287571
FT                   /codon_start=1
FT                   /gene_family="HOG000093828" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPS3"
FT                   /protein_id="EEQ44212.1"
FT                   /translation="MSFNSNASKYQAENTVDKLFSNILHTSTTSKSVSKSKSKSKSKPK
FT                   PISSTQLLVNQLQSTNTTANNNNTKRKKHNNNKRINKTLLEEKKFSKFIKYNHIKQKSN
FT                   KSELDEKYLNKLVRKNINSLNKINKIDDLLIDEELNQIKQELLEENEFVGMGGGQLKGG
FT                   KRLRKKLLNNTKQVIDEFDGFGEISSSNNNNKKKNSSHPGLTPGLAPVDYEEEDDE"
FT   gene            complement(<287730..>288047)
FT                   /locus_tag="CAWG_02476"
FT   mRNA            complement(<287730..>288047)
FT                   /locus_tag="CAWG_02476"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(287730..>288047)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPS4"
FT                   /protein_id="EEQ44213.1"
FT                   /translation="KEKEKEKDTIATINTNSSLLTKKNITELIPILIELITSATTKGKS
FT                   KSNIDIKVLSLKNLKLIIEKFDDIINKQKLLNDLLPALDDKKRVVRKLTIDLRQSLYDS
FT                   K"
FT   gene            complement(<291611..>292843)
FT                   /locus_tag="CAWG_02477"
FT   mRNA            complement(<291611..>292843)
FT                   /locus_tag="CAWG_02477"
FT                   /product="3-ketoacyl-CoA thiolase B"
FT   CDS_pept        complement(291611..292843)
FT                   /codon_start=1
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02477"
FT                   /product="3-ketoacyl-CoA thiolase B"
FT                   /db_xref="GOA:Q5AJ90"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ90"
FT                   /protein_id="EEQ44214.1"
FT                   /translation="MSSKQQYLKKNPDDVVVVAAYRTALTKGGRGGFKDVGSDFLLKKL
FT                   TEEFVKKTGVDPKIIQDAAIGNVLNRRAGDFEHRGALLSAGLPYSVPFVALNRQCSSGL
FT                   MAISQVANKIKTGEIECGLAGGVESMTKNYGPEALIAIDPAYEKDPEFVKNGIPMGITN
FT                   ENVCAKFNISRDVQDQFAAESYQKAEKAQKEGKFDDEILPIEVFQEDEDAEDEDEDEDE
FT                   DAEPKEKLVVISKDEGIRPGVTKEKLAKIKPAFKSDGVSSAGNSSQVSDGAALVLLMKR
FT                   SFAEKNGFKPLAKYISCGVAGVPPEIMGIGPAVAIPKVLKQTGLSVSDIDIYEINEAFA
FT                   GQCLYSIESCNIPREKVNLNGGAIALGHPLGCTGARQYATILRLLKPGEFGVTSMCIGT
FT                   GMGAASVLVRE"
FT   gene            <295379..>295867
FT                   /locus_tag="CAWG_02478"
FT   mRNA            <295379..>295867
FT                   /locus_tag="CAWG_02478"
FT                   /product="ADP-ribosylation factor 6"
FT   CDS_pept        295379..295867
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02478"
FT                   /product="ADP-ribosylation factor 6"
FT                   /db_xref="GOA:Q5AJ91"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ91"
FT                   /protein_id="EEQ44215.1"
FT                   /translation="MRILMLGLDNAGKTTILYKLKLGKTSKTVPTVGFNVETVKHKNVS
FT                   FAVWDCGGQERIRPLWRHYFTGTNALIYVVDSSDVDRLEESKQELFRIVTDKELTNCLL
FT                   VVLANKQDVDGAVKPKDLIERFQLNKLTGEHTWSVIPTIAIDGTGLVETLNWISSHSK"
FT   gene            complement(<296094..>296816)
FT                   /locus_tag="CAWG_02479"
FT   mRNA            complement(<296094..>296816)
FT                   /locus_tag="CAWG_02479"
FT                   /product="ribose-5-phosphate isomerase"
FT   CDS_pept        complement(296094..296816)
FT                   /codon_start=1
FT                   /gene_family="HOG000276369" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02479"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /db_xref="GOA:C4YPS7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPS7"
FT                   /protein_id="EEQ44216.1"
FT                   /translation="MSSTSKVESAKKLAAYKAVDENFPKDAKVIGIGSGSTVIYAAERI
FT                   GQLDNKDSFICIPTGFQSKQLIIDNGLRLGTIEQYPDIDIAFDGADEVDPQLNLIKGGG
FT                   ACLFQEKLVAASAKKFVVVADYRKKSDKLGQSWRQGVPIEIVPNSYSKIIQELSKKLGA
FT                   KNVDLRQGGKAKAGPIITDNNNFLLDADFGEIEIDNVGKLHEQIKLLVGVVETGLFTNM
FT                   ANKAYFGEEDGSVSVWSK"
FT   gene            <297487..>298047
FT                   /locus_tag="CAWG_02480"
FT   mRNA            <297487..>298047
FT                   /locus_tag="CAWG_02480"
FT                   /product="40S ribosomal protein S7-A"
FT   CDS_pept        297487..298047
FT                   /codon_start=1
FT                   /gene_family="HOG000197237" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02480"
FT                   /product="40S ribosomal protein S7-A"
FT                   /db_xref="GOA:Q5AJ93"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ93"
FT                   /protein_id="EEQ44217.1"
FT                   /translation="MSSKILSENPTELELKVAQAFVDLESQADLKAELRPLQFKSIKEI
FT                   DVNGGKKALAVFVPPPSLQAYRKVQTRLTRELEKKFPDRHVVFLAERRILPKPARKARK
FT                   QQKRPRSRTLTAVHDKILEDLVFPTEIIGKRVRYLVGGNKIQKVLLDSKDSTAVDYKLD
FT                   SFQQLYSKLTGKQVVFEIPGESH"
FT   gene            complement(<298326..>300188)
FT                   /locus_tag="CAWG_02481"
FT   mRNA            complement(<298326..>300188)
FT                   /locus_tag="CAWG_02481"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(298326..300188)
FT                   /codon_start=1
FT                   /gene_family="HOG000185865" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR020473"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ94"
FT                   /protein_id="EEQ44218.1"
FT                   /translation="MSIETISIGNELKDSYKSTSKWVNNGINWLQDISDFYQERSNLEK
FT                   EYSTKLKELTKKYFDKKSKLSASLSVGDEPAITPGSLENASLVLWTDLLTQTEAIADEK
FT                   SNLSREFQSKIADNLITLKNKCERVANLANSINDYLVEEKNKFEDEVNKAKKHYDSLCQ
FT                   TTETARDKNEKAPNDKHQKKLDEKQVIMNNGKNEYLIKINVANRLKDKYYYQDVPEILD
FT                   YLQELNEDRVELMNKLLKNASIIERNSADKVKEKLHAIDQTIEQNNPKLDITMFIKHNA
FT                   VDWKEPQDFYFIPCSFWHDDESLIIKEPELTELKKKLSIASNEYYKFEQSCIDVKQKLE
FT                   ESTNKRKRDNENITLKFDTGLQGSLSILHKFMKEDTNRVKNEVEIEVIQNFAGDKDLTY
FT                   VAPVKEKKSRFGFLTGNHKKSQSGGGGGGGATQSDASSEVHSLNPVKTSTSLHSGIFDL
FT                   RRNKSIASTVSGGAGNGAASIQARALYDYTAAGSDETTIVAGDQLSVIEEDDGSGWTMV
FT                   NGPQGQGLVPTSYIEITSRGPPPSSQQPQQKKKGPSVAPRRGAKKVQYLEALYDYTADG
FT                   DDEISITAGDRIVLVQDDTDGSGWTEGELNGQTGMFPTSYVKKI"
FT   gene            <300969..>302867
FT                   /locus_tag="CAWG_02482"
FT   mRNA            <300969..>302867
FT                   /locus_tag="CAWG_02482"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        300969..302867
FT                   /codon_start=1
FT                   /gene_family="HOG000093830" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR017210"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPT0"
FT                   /protein_id="EEQ44219.1"
FT                   /translation="MTARNESTVPLSRRQRLMGLARNTRDNYIPKITGSVSSFASGASR
FT                   AFTNTDVYDENGRILLPKDSTIQLFPSYTRHQDGKYFVDVQGWVFTPGVMNRKNRVVLS
FT                   VVKQIMKQRETSRAALNSIENDSTMKQEVFNPDSASSDTESIISVDSSHSSRSSNASLN
FT                   PDDVIKERLSSFFARSIPNTELSITIGSESKVDNLKQLYISTDGYGHFETTIEVPYKPS
FT                   VIQASSKLVDTVFAFQDINVYSNSGIGIISDIDDTVKLTGVIGEKMVLLRNLLTNEVSS
FT                   WSIPAVIKWYQNIYKRENVSFFYVSNSPWQLYNTINEYFQHTGLPPGSVHLKRYSGNII
FT                   ASLLEPSSSRKRRALHKILQDFPDKKFVCIGDSGEHDLEAYVDLARSFPNRILSINIRY
FT                   VEDSFSDDNDQKIYNEVIRLITLKRKEIPKTTDTLKPSANKKSLSPSADDQIEDLIDLS
FT                   DASVQQTPKKLPPMVPKKPTKLKGQNMTRKPPPPPPPPPSRNRGNTLTHSYTDSVMLSP
FT                   HSTTQSLLPTSPPSSSNVASDGNSIDEELPPLPPRRQTSPSINSSTSHDSELDSICNSP
FT                   GFIELEEYDQKGANWIKRIISSIHQLENVDTKLNIFKDDDDAFFKSSCIELDELKK"
FT   gene            complement(<302994..>304055)
FT                   /locus_tag="CAWG_02483"
FT   mRNA            complement(<302994..>304055)
FT                   /locus_tag="CAWG_02483"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(302994..304055)
FT                   /codon_start=1
FT                   /gene_family="HOG000177574" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AJ98"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJ98"
FT                   /protein_id="EEQ44220.1"
FT                   /translation="MPPKKKVNQPADKAKAKAKAKSAEDKSFGLKNKNKSKKVQQQINQ
FT                   MKAGIDGGLAKKKEAEAKRKAEEKKAQEEAKKEAAALFGIQQQKVPFGVDPKSILCEFF
FT                   KQGLCTKGNKCKFSHDPNVGRKVVKKDLYTDSRQEEKENDTMDNWDEEKLRKVILSKHG
FT                   NPKTTTEKVCKFFIEAVENGKYGWFWVCPNGGNECKYKHSLPPGFVLKTKEQKKLERLA
FT                   AENEPKITLEEFLELERSKLDKSKFTPITAESFAKWKQEQTSKKESQRKEDEKRGRRVL
FT                   TGREVILEKFSDKYYTEEDNGETWDLSQFKSNLPDDSDPNIKDYGDGSKAQEYYQQEDN
FT                   QSESLENKDAITA"
FT   gene            complement(<304325..>310042)
FT                   /locus_tag="CAWG_02484"
FT   mRNA            complement(<304325..>310042)
FT                   /locus_tag="CAWG_02484"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(304325..310042)
FT                   /codon_start=1
FT                   /gene_family="HOG000093831" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPT2"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPT2"
FT                   /protein_id="EEQ44221.1"
FT                   /translation="MKLVTNLVFQQDFPNEQKKKVNEFLFISKNSTNSAAHEEICRTLV
FT                   LLLKILDSQYGSGFNNESNSLFSLGSSKSQSSFGFHFNYDPTPQTTKEVHIQLFATVIE
FT                   AIPWGIVGASGDNNQNLIPFKQVVDILIRGAIHPDSRISMASIKSLKYLASKKNPTSLM
FT                   TIYAKLAFHFSDKTGPTYDTQYLYSDQFTKLLKLYTELLDCWLISFQDLLEKKKADQSI
FT                   GVLAGNDKSNNRDALNNLYKINRKNADLSDSHPTRLNPSDEFEWKTIITAIEDIEGNGL
FT                   FFLCSQNPKTRYYGIKVLKLVEQFDQAVYNVTDSATDTSSGTKQHSRSSSKFAADVGTR
FT                   LIHILEDLDFVELIQPYRKELSVPERTRLTKLKNKKNILIRLAESDYGIDSAIWLRLYP
FT                   KVLEIFFDRCPMPVAMCRNLVCVCLVQMHEFVLEFSDSYKSYTSSLFSKSATNVPPEVL
FT                   VNQWKLYLIFACSTLTATNDQKISFPNQPTHGRKKSLQMFIQHQKITSAKSVFKMVLPL
FT                   LKSSQPMVKESVIVGLSHININILKSFLENIPLAVEEWNTNMKTRNPQDDAFRIEVVHI
FT                   LTNLTEKFGSHELIYTDDSIVANLVAIVKNVKNFLSEPAIQTNFECQRLRRYFCGFLEN
FT                   VYTGLEAKSDLEKWLPFEARVACFNYLKEWCGYGDSSAVTEERYNAIISRIKTEKAGPS
FT                   ALAILEIERKKLQLASLKCMAILCSGQIKKKIEIPGNLAVVSFDIPGLMNWIQALLESN
FT                   IEKIKEIGHCASRNVIEKNFEFQDIISAVVQRCYVSQTSLESYFCLFVEIFMEKNTFEM
FT                   VPDELLCLASVLTANESFQVRKSAIALLKYFEKKSLGSESLERYTEAICSKSSVVYKKV
FT                   LFDLSNDVQNIKPESLYNRISYLTQNINFIFPAAREAILSLLVPMVSKVILNYETPLPE
FT                   KDSTTDIHEKAFDSSSLMVLSNLFEITVNFGSNMSNQVEVLWISLSNNVQNIDKIVEFL
FT                   LQSSLESKNPSFVEQSRQIIDYLAFARSDPAYIIDKLINNLQPRMMVPPQLGNKSTAPI
FT                   SKDYPYVCDIKKIIQTNEKDVIFSLGQLSMVFLVDIVTLKNDLMIEKLPSLLHVSLSLM
FT                   DHYLPIVQEQAGTFLVHLIHALVRDDPKAQETISSLRENDHIKHLWVYDDLNNDKKGAR
FT                   TPKNMDLLIRSAIKMFAAVAPNIQDDWSRVSLHWATTCAVRHIACRSFQVFRSLLSFLD
FT                   QSMLKDMLHRLSNTISDETVDIQGFAMQILMTLNAITAELDSEKLIDFPQLFWSSVACL
FT                   STIHEQEFIEVLSTLNKFISKIDLDAADTVACLTKTFPQKWEGKFEGLQQVILVGLRSS
FT                   TSWEPTLKFLDKLIVHKDSLIIGMGDSRVLTALLANMPRFLHHLSEENVTPEIENTAMA
FT                   LSQLAEDSGKSSLAKLLVSFAKRRFRSKSDFLDQSILCIKNAFFPEYQAQTLVLLLGLL
FT                   FNKMPWVKTETLGLLQSIFPLVDLQRDEFIGVGADLISPLLRLLLTDYAEWALQVLDEA
FT                   EIIPGSQSDKDILRMSLGSTSMKKEYENTATLFGIPDESGWSIPMPAITAATTRNNVHA
FT                   VFSTCTLDNIVDENVEQEEDGIDIQFHSEDYYGPASDQTQFVDSVSVSVDEREASLSNV
FT                   WAALDDFDSFFTKESEQAGSIPVVANRAMRRSHAHPRHHVHSASVDTKYSNSSDTLMPM
FT                   ESAPNVYDKKASVILNRSLARTTSNTSFRANLADSIGSTQIATNSNHSNKRSYIPFRSS
FT                   RHGNKARAEVFSTPKIPLSAGFDANDLDQTPSSIQSTAISSPTISVARNDGDHELASNA
FT                   NENVTRFEGILGTKKRSKKGIRQNSPNESTTNISPDLTANNSFRNSHVSSIASPKGTAA
FT                   VISSPIQVVGSNTAVTPNSGKEKKRISQKFR"
FT   gene            complement(<309978..>312821)
FT                   /locus_tag="CAWG_02485"
FT   mRNA            complement(<309978..>312821)
FT                   /locus_tag="CAWG_02485"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(309978..312821)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPT3"
FT                   /protein_id="EEQ44222.1"
FT                   /translation="MIEIPDLDELSLHNYSASNNVTPEENHSEDESQQPPPPQQQQQQF
FT                   TLQPQHSIHSPSIEENGYLQHQQNQLHQYMQQQQHNTLTPEPPTISDFTKDQLPPSATS
FT                   FQNSTIGSDILGETIALYNSSANSSNIHKPQPQLPQESSDHLTQKETSTVSASPHPMLD
FT                   QAPQMIDARLERIEHEVDNFNERENNYQHPQMQPYSQDTESGLSLGTEDSQNISSQKVD
FT                   YVQTKNSSLEFDAPIGLVYMPDNLDEHKTSFKLQQPPIVTDYRDTTTTTPDLASESNDQ
FT                   LGQLETPLMAGFDFNLGTNTSSANQLSSPMSSFPLHNRVEPSPQLPPPMSSASLQKLTL
FT                   RNGEEFGSIRRDLAIDSKTSAEYTLHIIFTQFVRHAERKLNLCLDYPLNEEPPILDLIA
FT                   EGVDTEFDKIISALGYIARRKPKPVIDSVMFWRKSKSEVASMAATEVEKAVGVAQTNLL
FT                   RISKTSSATATTTTSPISPSNPGIAKNSNTASTTKRSLSLMRKKSFSRIAHRRNVSSSA
FT                   AIQSSQNIPESESVFMKQKQFYDDQISQAKETAVHADRKSLASIYILCRVLIEIVKQTP
FT                   LSVMGSDLSSKLEEIVYTQLKTTDPISTSQSLVRAANWNLFAELLGFMSRERFVSVNDR
FT                   FIADLEKVPQQIRHEDEPKLYLLINGMKYLKLTIYPLEEFEESAEFIQSLAKFFDKTTN
FT                   ETVLYAYCEVFSQLFLPLANVMTAEANYPSWVEGVEKVYCKAFKLWRQSLGSPSSPPSL
FT                   ALPTSNTSGVSSNNGWSHSLILMASALSVSRKELFSEVWVNVINENSFKLKPKVEAEDK
FT                   TTYIMSITRLIWVYLNRLPDTLNNTIKRLDAIFELLFFHNNATSKKHQWISPDLFLIGS
FT                   LIELIRIVGYNHLNYVLEQVLIRLLNTSFNGTSLENAFPEKLIIVIKSYLAILKDYEIG
FT                   DKPSFPAGFSKRTKEKS"
FT   gene            <315927..>316514
FT                   /locus_tag="CAWG_02486"
FT   mRNA            <315927..>316514
FT                   /locus_tag="CAWG_02486"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        315927..316514
FT                   /codon_start=1
FT                   /gene_family="HOG000248887" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJA1"
FT                   /protein_id="EEQ44223.1"
FT                   /translation="MKLITENEKNDHKSHIMKEGSKGFLIGSVIGLGLIRYFKFKQPLK
FT                   YNSFNWTVKACLYTMPTLGFTAFLTDNGGTQFFKSRYRSTHLQQEKQVKSQQLDNLSMS
FT                   EKIIYRLNEHKYKLVVGAWAGFLFGAWKIINKDLLLTKTQKLIHARVYAQAFTIGVLLS
FT                   TLYLNMKEVELNNKLPQLPQSWERVLQDKGEL"
FT   gene            complement(<316975..>318381)
FT                   /locus_tag="CAWG_02487"
FT   mRNA            complement(<316975..>318381)
FT                   /locus_tag="CAWG_02487"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(316975..318381)
FT                   /codon_start=1
FT                   /gene_family="HOG000093832" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPT5"
FT                   /protein_id="EEQ44224.1"
FT                   /translation="MKFSSTTLLAVLSSLTATVSAGCSFEGGNYYCSETKKVIYKGIGF
FT                   SGSYMDVTNMDENTGKCTQQLYSFSGNLSPLDEELSVHFRGPLTLLQFGVYYPSSSGNS
FT                   KRQIDDQDCNVKHVHHKHKRATEVVQVTQTVFVDGNGNTVTSQALQTSTVESSPAVSSA
FT                   AAANDNANSGSGSGSSAGSGSGYGSVSALDGEGKAYRSDISTKSAPTSTSAQPSSSETA
FT                   SVDGAWTRDSYYTPGSTDNCVFLNYHGGSGSGVWSAKFGNSLSYANADNSGGSSTPVPL
FT                   EETTIKSGEEYIIFSGSKCGSSSDCGYYREGTVAYHGFKGASKIFVFEFEMPSDTNGNG
FT                   YNQDMPAVWLLNAKIPRTLQYGEATCSCWKTGCGELDLFEVLSSGSNKMISHLHDGQGS
FT                   SQNSNNGGGGSQDYFERPTSGTFKGVVIFYGDEIHILQVDDETEFGSSLDEETVNAWLN
FT                   EAGSVATIGY"
FT   gene            <322743..>325046
FT                   /locus_tag="CAWG_02488"
FT   mRNA            <322743..>325046
FT                   /locus_tag="CAWG_02488"
FT                   /product="pre-mRNA splicing factor ATP-dependent RNA
FT                   helicase PRP43"
FT   CDS_pept        322743..325046
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02488"
FT                   /product="pre-mRNA splicing factor ATP-dependent RNA
FT                   helicase PRP43"
FT                   /db_xref="GOA:Q5AJA5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJA5"
FT                   /protein_id="EEQ44225.1"
FT                   /translation="MANEEKRSNKRQKLIDNYEAEKIAEASEESLRTHPHPSDKIELIH
FT                   HDQGEFKGLIRHQTTAEQAQKLEDGPKNPFTGHDFTTKYFDILKTRRDLPVHAQREEFL
FT                   KIFHSTQIMVFVGETGSGKTTQIPQFVLYDEMPHLTGKQVACTQPRRVAAMSVAARVAD
FT                   EMDVELGEEVGYNIRFENNSGPKTILKYMTDGMLLREAMEDHDLTRYSCIILDEAHERT
FT                   LATDILMGLLKQVSVRRPDLKIIIMSATLDAEKFQNYFNNAPLLAVPGRTHPVEIYYTP
FT                   EFQRDYLDAAIRTVLQIHATEGEGDILLFLTGEEEIEDACRKISLEGDELVREQNCGPL
FT                   KVYPLYGSLPPHQQQKIFEPAPTNPNPNGRPGRKVIISTNIAETSLTIDGIVYVVDPGF
FT                   SKQKVYNPRVRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKELIEQSYP
FT                   EILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLQCLSDEGDLTALG
FT                   RLASQFPLDPMLAVMLIGSPAYSCSEEILTIVAMLSVPNVFVRPASARKRADEAKLSFA
FT                   QADGDHLTLINVYEAFISPEASEIGTHKWCRDNFLSYRSLTSAKNVRNQLQRLMQKYDL
FT                   QLISQYNQVSEFEYWENVKKALVAGFFMQVAKKKSGNKGYLTVKDNQDVLIHPSTVLSK
FT                   EGEWLIYNEFVLTSKNYIRTVTVVKPEWLVEIAPKYYNLDHFAKGDVKLSLERVVERVG
FT                   NMKKLDKKKKKSKN"
FT   gene            <325492..>327201
FT                   /locus_tag="CAWG_02489"
FT   mRNA            <325492..>327201
FT                   /locus_tag="CAWG_02489"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        325492..327201
FT                   /codon_start=1
FT                   /gene_family="HOG000093834" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPT7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPT7"
FT                   /protein_id="EEQ44226.1"
FT                   /translation="MDTSTIVAIGVDIGTGSVRVYHNETLTSLPITTENDIYITQSSFE
FT                   IYSKLIQLLSRPQLDWNFDSICITATCSMVVLSKITIDEETYLTPVSLNKSHPNSDVLL
FT                   WMDNSATLQCNQLNEYLKVAYQNILNLVGGQFVPELGLPKLKMINDNIAEGDNNDNFSK
FT                   SDLVCFELYDWISYLLKVGGFQNINASTNGNGDDKLIVPYIPSKPFDFGDAIDGSIKGW
FT                   PHQFLQDLGITVEIGRSESNIGNRLLPIGTPIGKVNDTDIIIGHGCIDCYSGFMNMYRS
FT                   SPSEKSSTLSTMSMIAGTSTCFIYSTMTPTRTTDENSAPPDYIPTVWGPVEIGKSGLYL
FT                   YEFGQPASGKLFEDFLTIGFDQLEQETQNLELKHNKSIHELIKGYFYYGDVYGNRNPYG
FT                   DPKMSQMIIDNNNDILPSVISPNNQNKKSGNVLSQVIKYILILEFLVFQTKQLLEPLSN
FT                   VSQIIINGSQSKNTRFLKLLSTVTGLPIIIANHDVARGAQLMALIGKLCSFGWHYDDAF
FT                   DQAIQNNNNDYLGNENSINIREDYYQLLMTKYEIFKDMASAQQRYRKLMGDV"
FT   gene            <327847..>329192
FT                   /locus_tag="CAWG_02490"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            <329314..>330996
FT                   /locus_tag="CAWG_02491"
FT   mRNA            <329314..>330996
FT                   /locus_tag="CAWG_02491"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        329314..330996
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJN6"
FT                   /protein_id="EEQ44227.1"
FT                   /translation="MHLNHYQIYYNLSLSSIQLCNYYHILNLTNTLNYTNSNEYNYGNE
FT                   AQEHQKILYMHRAITYFQLINVRNSDAVDPVQELYELLYSCERYYLVMSSHNYNINVTR
FT                   NNDIVLQLRSNKYRGKSYTYELMRFLDSKHTIDELCYKSNFNVLLHYTKPVSGYFELKT
FT                   EMNKLNATEPIHKIIHNIVLFKLLLIKPLNFVETKQEIVTIIRNLNLLLEENDSDTFKI
FT                   KISNYQIIQPMLHCLKSFLEIKQVEVKLGTPQLDLQDQVLLVRFSENLILHFPFFNNIN
FT                   KLIRAHKILNNWFLNLSEIKKDDLEEQNEKNQQQGKLQSLQQPIQPSPQQPLPSLPQHQ
FT                   QQPQEQQPSMSHNLENDLQNQILTPTPDSFSMNFPMHNSVSHMSPNLNQVSSQQKIASQ
FT                   INLNELLRDLNGTPSSTTDFINQYNNFKVPDTLISTNSNPITQHQADDEEEDVIDNEED
FT                   DAEDDQDQFFSIVPQNQHGHKFANLQAPQPVSNTGSNTLNNGPVTTATPSGAIGGGGNN
FT                   TGSFLSLFNATNFVDDQTDGNNGATGVGSSFFNLYQLNNLPEK"
FT   gene            <331901..>332983
FT                   /locus_tag="CAWG_02492"
FT   mRNA            <331901..>332983
FT                   /locus_tag="CAWG_02492"
FT                   /product="serine/threonine-protein phosphatase PP2A-2
FT                   catalytic subunit"
FT   CDS_pept        331901..332983
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02492"
FT                   /product="serine/threonine-protein phosphatase PP2A-2
FT                   catalytic subunit"
FT                   /db_xref="GOA:C4YPT9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPT9"
FT                   /protein_id="EEQ44228.1"
FT                   /translation="MDLDTDVPMEDVEEQQSQQEQSLSKQSATKSLTNPQGTGATATSS
FT                   AQQQRKDLDGSSINQLDVWIEKLSKCEPLSETDVKKLCDMAVEVLQFEENVQPVQVPVT
FT                   ICGDVHGQFHDLMELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVCMKVRFPNRIT
FT                   ILRGNHESRQITQVYGFYDECLRKYGSATVWKLFTDLFDYFPITALVDNKVFCLHGGLS
FT                   PMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNH
FT                   TNDLSLIARAHQLVMEGFSWSHHENVVTIFSAPNYCYRCGNQAAIMEVDEQHNRQFLQY
FT                   DPSVRPGEPTVTRKTPDYFL"
FT   gene            <333670..>334830
FT                   /locus_tag="CAWG_02493"
FT   mRNA            <333670..>334830
FT                   /locus_tag="CAWG_02493"
FT                   /product="hypothetical protein"
FT   CDS_pept        333670..334830
FT                   /codon_start=1
FT                   /gene_family="HOG000168008" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02493"
FT                   /product="hypothetical protein"
FT                   /note="similar to NADH-ubiquinone oxidoreductase 39 kDa
FT                   subunit"
FT                   /db_xref="GOA:C4YPU0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU0"
FT                   /protein_id="EEQ44229.1"
FT                   /translation="MLKLSARPISRSTGVFSRRSVYTSVLESDINITKNGKVNVAVGAG
FT                   GRSSRTGYTATVFGASGFLGRYVTSKLARHGTTTIVPFRDDMKKRFLKVTGDLGVVNFV
FT                   EIDARNLQSIEDSVAHSDIVINCIGVDYDTKNFKMADVNIALAERIAEATKKANVPRYI
FT                   HVSSYNADPNSESVFYATKGIAEQVVRDIIPDTTIVRPAPMYGREDSLLNYLGPKVKMW
FT                   TPNKNAKEVWPVYVLDVARALERIAYDDSTAGQTFELYGPEKVTFQEIRNMIHGITENY
FT                   AQVGPWSYQFADYAIPLPLAKTIAKVQQLVWWKLTNPDQVQRLVINQKIDPNAKTFHDL
FT                   GIDDLTRLPDVLFSYVKQWRHPLIAQKGAPGKKELERLRDVQHFTP"
FT   gene            <335097..>335657
FT                   /locus_tag="CAWG_02494"
FT   mRNA            <335097..>335657
FT                   /locus_tag="CAWG_02494"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        335097..335657
FT                   /codon_start=1
FT                   /gene_family="HOG000176434" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJN9"
FT                   /protein_id="EEQ44230.1"
FT                   /translation="MALPTIESFKRLSSKDKRQVLDHLFEPCNTLSNFIFIKVLHQQYN
FT                   TYPEFINLVRKELLEFLKQSETFQSQYQGEINPVINEIISAHPRLGEPKKETLSVHSNN
FT                   EQKTLNNDPEIIKKLKELNAAYEKTFPGLRYVVFVNGRSRHEIMDNMQKRIERNDINLE
FT                   RVEAFNAMCDIALDRANKLGIKL"
FT   gene            <336238..>337971
FT                   /locus_tag="CAWG_02495"
FT   mRNA            <336238..>337971
FT                   /locus_tag="CAWG_02495"
FT                   /product="vacuolar ATP synthase catalytic subunit A"
FT   CDS_pept        336238..337971
FT                   /codon_start=1
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02495"
FT                   /product="vacuolar ATP synthase catalytic subunit A"
FT                   /db_xref="GOA:Q5AJB1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJB1"
FT                   /protein_id="EEQ44231.1"
FT                   /translation="MIGCAMYELVKVGHDNLVGEVIRINGDKATIQVYEETAGVTVGDP
FT                   VLRTGKPLSVELGPGLMETIYDGIQRPLKAIKDESQSIYIPRGIDVPALSRTTQYDFTP
FT                   GKLKVGDHITGGDIFGSIYENSLLDDHKILLPPRARGTITSIAESGSYNVEDTVLEVEF
FT                   DGKKHKYSMMHTWPVRVPRPVAEKLSADYPLLTGQRVLDSLFPCVQGGTTCIPGAFGCG
FT                   KTVISQSLSKFSNSDVIIYVGCGERGNEMAEVLMEFPELYTEISGRKEPIMKRTTLVAN
FT                   TSNMPVAAREASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQG
FT                   FPAYLGAKLASFYERAGKATALGSPDRIGSVSIVAAVSPAGGDFSDPVTTATLGITQVF
FT                   WGLDKKLAQRKHFPSINTSVSYSKYTNVLNKYYDSNYPEFAQLRDKIREILSNAEELEQ
FT                   VVQLVGKSALSDSDKITLDVATLIKEDFLQQNGYSSYDAFCPIWKTFDMMRAFISYYDE
FT                   AQKAVANGAQWSKLAESTSDVKHSVSSAKFFEPSRGQKEGEKEFSELLSTISERFAEAS
FT                   E"
FT   gene            complement(<338264..>339193)
FT                   /locus_tag="CAWG_02496"
FT   mRNA            complement(<338264..>339193)
FT                   /locus_tag="CAWG_02496"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(338264..339193)
FT                   /codon_start=1
FT                   /gene_family="HOG000093835" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU3"
FT                   /protein_id="EEQ44232.1"
FT                   /translation="MQYENTKHHQQQQQPSPKLIQTLGPMNLLSPTNIQLPNISPSSFE
FT                   ITSQSTSQSPFHSSIISPHYPPYEADLYYPLRNPRQQQHSQQQRQTSLQRPQRQRQSSL
FT                   TSGFNRRDAFYEFAEDRYNRFRPSDSQHNNNAILSGLHPFQQDNYGLPKKTFLQSVSNW
FT                   FKLKKPESQIIENNGLIQNSSNKSTDTNTNTNTNTIETGTGIGTGTTISGSGGDDGGEV
FT                   SINQNEPYDATPQPIYTPRGIPINEFQLNFNNKENQDSIVRRNDEIINSFDDEVRDLIN
FT                   GADNFLTSCFQGCWDIGKIVSDSFVELC"
FT   gene            <340271..>340621
FT                   /locus_tag="CAWG_02497"
FT   mRNA            <340271..>340621
FT                   /locus_tag="CAWG_02497"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        340271..340621
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU4"
FT                   /protein_id="EEQ44233.1"
FT                   /translation="MKIPPLPTSQNRFMIRISMTKKSNWLISVVLIIRIGNQSPNLITN
FT                   PMIIHWLITTDHPTNNSHIINGVITKILPTLSINVTTTSDINRRITISTLLRSSIQYGT
FT                   ITDLKTNLRFIR"
FT   gene            <340700..>341497
FT                   /locus_tag="CAWG_02498"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            complement(<342773..>343882)
FT                   /locus_tag="CAWG_02499"
FT   mRNA            complement(<342773..>343882)
FT                   /locus_tag="CAWG_02499"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(342773..343882)
FT                   /codon_start=1
FT                   /gene_family="HOG000093836" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU5"
FT                   /protein_id="EEQ44234.1"
FT                   /translation="MITTRSIQKYHSLYRPSIITCRRFQSSRSTTTTTTTATTPISQLP
FT                   NKNSIYVISIPITTSKSYIYCNHRPSTLSPKQLANIPLIYKLENKLINLASKGWSKLTN
FT                   SKQSVNQKVVSFIKKLLDTIPYEENCLKSFPTKATMIREINEESSHFTEGNKDQSGSDS
FT                   SGQMPVHKIVQAQVDDLKISTDQLKPIPLYHPQFQNPSVILNQLYSFEEENKKKHKNQA
FT                   ILCAIGIPITLPFALVPILPNVPGFYLAYRLYCNIKALLGLQHLNYLLETKKGGDPEIA
FT                   NQSTVNDTLHITFKEIEGLNQLYLQHNNPNLLQDPIEDDEETVIINEDIINQIVEKFEL
FT                   TNLKEDLLKALKQETKRLNRDIKAEDQVE"
FT   gene            <345406..>346608
FT                   /locus_tag="CAWG_02500"
FT   mRNA            <345406..>346608
FT                   /locus_tag="CAWG_02500"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        345406..346608
FT                   /codon_start=1
FT                   /gene_family="HOG000093837" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU6"
FT                   /protein_id="EEQ44235.1"
FT                   /translation="MTEDDDKQTNYFESHPGTTRNHSTPSPSTLDEHQSNVESVDIPLD
FT                   PFSHIVINSYSHKANVVPPYVLDTLSKAYHRNHLHQTNTNISDQVTSKTLTFETDADKS
FT                   NTAYSGIVHDPYIRAMDGNWFKFMQSIRHQTAYTHDKIAYDPELLKEYDLNGTWGGDER
FT                   LKNEFVNNINNGGSITDSEKRGVFGFFGKEKGENDTRMRSTAGYWMGENRSQLKPTLKK
FT                   IFLFNPLVPLFLRVLIIVFCAIALALAGSIFIFSKRDYEGHKVEQQPSTIMALVVQSCA
FT                   LVYVIYIAYDEYTGKPLGLREPMSKMRLILLDLLFIIFSSANLSLAFNTMNDDEWVCKA
FT                   NKTPGLADIGVAFPTIGSICRRQRALSSFLFMVLVLWVITFTVSLLRVIDRVNTPGPRN
FT                   V"
FT   gene            <347479..>349737
FT                   /locus_tag="CAWG_02501"
FT   mRNA            <347479..>349737
FT                   /locus_tag="CAWG_02501"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        347479..349737
FT                   /codon_start=1
FT                   /gene_family="HOG000176713" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPU7"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU7"
FT                   /protein_id="EEQ44236.1"
FT                   /translation="MSSTLPPFSDLNATWTFIQPGLEYILGAHGEQGVTATVYMNCYTA
FT                   VYNYCVNKSRRGTTPVSISNNSDNNSYSLAGAEIYKKLEEYLTEFIKNLKRLPNESFLE
FT                   FYVRKWTRFTIGAVYMNNVFDYMNRYWVQKERSDGRKDVYDVNTLSFIKWKDEMFKPNS
FT                   KLLIEQILTCIQQQRDNMIVDTNLISSAIKSLVFLSIDIQDLKKPNLIIYVNSFEIPFL
FT                   EATMEYYAKESAAFLASHNVIDYMKKCETRIGEEVSRSNNYLEERTKKPLLEVLNAALI
FT                   EKHANEMYDQFLVLLEQNQIDHIQRMYKLLARVQKTLDPLANTLELYIKKEAAAALEEI
FT                   QTQAENSEAKKKIVEPKVYVHTLISIYNRFNDIVVRAFSKDTKFIKSLDNACRHFVNNN
FT                   PIATPKPRSPCRTPELLARYADGFLKSNSKDNEMNADNLMIVFKFIAERDSFEEYYRRL
FT                   LAKRLVNGTSKSEEMEESVIHRLQEENSIEYTSKMTKMFTDIKASDDLKIKFKDGMNVL
FT                   FDFSPMVLARSTWPFHSSQDYNDLKLAPELKVTIDSFKAMYLQQGKGKQIEWLWNHGRA
FT                   ELKAHLTKGKGGKPFNFIVSQIQLMVLLAYNYSKTYTLDDLVKIVGIKKELLQNHVTPF
FT                   VKYKLLKEEGDQLVIVDHYPSKKNKVSFIGAITKTKEEDVEEITKEVQQSRTIFLEASI
FT                   VRIMKSKKSMAPNNLLNEVVVQAGNRFNAKNIDVKRAIDSLIDKEYLKRNGDDYEYIS"
FT   gene            complement(<350060..>351499)
FT                   /locus_tag="CAWG_02502"
FT   mRNA            complement(<350060..>351499)
FT                   /locus_tag="CAWG_02502"
FT                   /product="serine/threonine-protein phosphatase T"
FT   CDS_pept        complement(350060..351499)
FT                   /codon_start=1
FT                   /gene_family="HOG000172698" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02502"
FT                   /product="serine/threonine-protein phosphatase T"
FT                   /db_xref="GOA:C4YPU8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU8"
FT                   /protein_id="EEQ44237.1"
FT                   /translation="MAILNHKQALENFKFILKKLPNDKLTLENYKQCTNYLKRQAFEKA
FT                   IAGNDDNESIFNKIDYQSIQIEKSWSGPELNITTNTTTTTTTTTTTTTTTAGDNNNKKK
FT                   SDVIVNIEGLDHDYLKYMIKLFKNGGKLPKRHVFAIIAKVYEILKQENTMTEISLLHSQ
FT                   IDFNNDNDDTINNPHGKGKGKGDQIIGGKKLTVVGDTHGQFFDLLNLFDKFGHVTQDHI
FT                   YLFNGDFVDRGSWSCEVALYLYVLKILYPKSIFINRGNHETNDMNKTYGFTDECEFKYS
FT                   KKIFEAFNQSFGALPLACLINQTYLCMHGGLFSNDKVTLKDIKSINRFPSNGSSQPPKE
FT                   GLAMELLWTDPQEINGRSPSKRGIGMQFGPDITERFCLSNKIRKIIRSHEVRMNGIENE
FT                   QNGRLMTVFSAPNYCDSTGNLGGVIHIEENSNYKKDLDDGQGYKTVEEKNCPWILTTET
FT                   FEAVPHPDLKPMAYSKGGFGF"
FT   gene            complement(<351592..>351945)
FT                   /locus_tag="CAWG_02503"
FT   mRNA            complement(<351592..>351945)
FT                   /locus_tag="CAWG_02503"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(351592..351945)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPU9"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPU9"
FT                   /protein_id="EEQ44238.1"
FT                   /translation="MVHKGRMKNEEEEKNNGKKFSFFFCFVLFPFLIFEVEIFHNNSLL
FT                   NFFKPKRFFYNYYSRHPHTMSSPKEALEWKDKGNNLLKQHKYDEAIEAYTKPLKSILIM
FT                   PFFIPIELKFKLN"
FT   gene            complement(<352352..>356023)
FT                   /locus_tag="CAWG_02504"
FT   mRNA            complement(<352352..>356023)
FT                   /locus_tag="CAWG_02504"
FT                   /product="coatomer alpha subunit"
FT   CDS_pept        complement(352352..356023)
FT                   /codon_start=1
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02504"
FT                   /product="coatomer alpha subunit"
FT                   /db_xref="GOA:C4YPV0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV0"
FT                   /protein_id="EEQ44239.1"
FT                   /translation="MKMLTKFESKSSRAKGVAFHPKRPWALVSLHSSTIQLWDYRMGTL
FT                   IDRFEDHVGPVRSVDFHPTQPLFVSGGDDYTIKVWSLNTRKCIFTLNGHLDYIRGVSFH
FT                   HDLPWIISCSDDQTIRIWNWQNRQEIACLTGHNHYVMSAQFHPSEDLIVSASLDQTVRV
FT                   WDISGLRKKHSAPTSSVRAFEDQLQRQQLPQQDIFGNINAVVKYVLEGHDKGVNYASFH
FT                   PTLPLIVSAGDDRVVKLWRMSDTKAWEVDTCRGHTGNVLSAIFHPHQDLILSVSDDKTI
FT                   RVWDLNKRVPVKQFRREHDRFWLIASHPTISLFAACHDSGIMVFKLERERPAHTIFQNK
FT                   LYYVNGEKQIQTFDFNKQENSLPMLSLKKIGKTWSFMRTLSYNQSDNSVLVVHGEGDNG
FT                   NYALITLPKHVTGAIEPTDIRQGEANFAAFISRNRFVTFVKSTKTLQVKDLNNNTTKTV
FT                   QLDSSIVDVLPGSPGRILLVKAHSVINYDVQQRKELAEISVNNVKYVSWSSNGQYLALL
FT                   SKHTITIADKDLELITSMHETIRIKSAAWDDTGVLLYSTLNHIKYTLLNGDNGIIKTLE
FT                   NTLYITKVQGNLIHCLNRQGQVETITIDPTEYRFKRALVNKNFGEVLRLIKNSTLVGQN
FT                   IIGYLQKKGFPEVALHFVQDPETRFELALECSNLQVALEQAKILNNNQIWEKLGEEALL
FT                   QGNIEIVEYIYQQLHHFDKLSFLYLYKGDDERLDKMSTIAQHRDDTSSLVQNTLYNNDI
FT                   KKRCQVYIQNGMLPLAYTLAKSNGLNELAEQILQEANISEKDVELPELGDVVPLPKPIG
FT                   EPVGNWPLKDSELSYFETALITGKIENLSINEDNLTTGAEGFESGAANIDDNLGFDNNN
FT                   NNDDDDDDVGEGGAFGGEDDAEAWDLDDELDIGDDDIVDENVPEFVTTENEIGDWLRNA
FT                   KTPATYVAAGGFEQAASLLNKQIGVVNFEPLRTRFNQVYGASKLYLPGMDELPAMKTYI
FT                   RHDNDEDNPRKFKPVVPGYDKLEELLSLGFKKFKANNLEEAIITFRKVIYTITVLNVDD
FT                   EDEETKCHEILRLCREYILGLSIELERRKLPSSDVKRNLELAAYFTRAQLQPSHKLNAL
FT                   QVAMTQSFKNKNYASASYFAEELLKISNNSGPRAEQAMKLKNKADTIANDTIEINFDPF
FT                   AEFDICCGSFTPIYKGEPSIKEALVGATYKPEFKGKLCNITDITAVGVPASGLRIKG"
FT   gene            complement(<356528..>357940)
FT                   /locus_tag="CAWG_02505"
FT   mRNA            complement(<356528..>357940)
FT                   /locus_tag="CAWG_02505"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(356528..357940)
FT                   /codon_start=1
FT                   /gene_family="HOG000184016" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPV1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV1"
FT                   /protein_id="EEQ44240.1"
FT                   /translation="MRFSTLNFAFLATLSSIFTVVAASDTTTCSSSKHCPEDKPCCSQF
FT                   GICGTGAYCLGGCDIRYSYNLTACMPMPRMSTFQESFDSKDKVKEIELQSDYLGNSTEA
FT                   DWVYTGWVDYYDNSLLIQMPNHTTGTVVSSTKYLWYGKVGATLKTSHDGGVVTAFILFS
FT                   DVQDEIDYEFVGYNLTNPQSNYYSQGILNYNNSRNSSVNNTFEYYHNYEMDWTEDKIEW
FT                   YIDGEKVRTLNKNDTWNETSNRYDYPQTPSRIQFSLWPGGDSSNAKGTIEWAGGLINWD
FT                   SEDIKKYGYYYAHIKEIYATAYDIPNDVKLDGNSTKESDYHAFLYNSTDGDASNVMLTT
FT                   KKTWLGSDDATGFDPQNDDEDSSSNKAQETTITSVSGSSTITSVKTDSTKKTANVPAQN
FT                   TAAAAQATAKSSTGTNTYDPSAGVGGFVQDSKSTDSGSSGSSSQGVANSLNESVISGIF
FT                   ASICLGILSFFM"
FT   gene            complement(<362138..>364957)
FT                   /locus_tag="CAWG_02506"
FT   mRNA            complement(<362138..>364957)
FT                   /locus_tag="CAWG_02506"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(362138..364957)
FT                   /codon_start=1
FT                   /gene_family="HOG000093838" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV2"
FT                   /protein_id="EEQ44241.1"
FT                   /translation="MKTHLLVVPSKKTEEVNWVKPLNNYLLSIYGNTSQYQDDINSLNK
FT                   LRQDIRGVNADDTGLKLYYSYYSKLELIDLRIPFHDLNKSKKLQFEWFDSFSSLPYTQN
FT                   SLAFEKANVLYNIGAILSRFAQFKYNESQQLNGPEGETAFKQSISMLQQSSGIYQFINE
FT                   NFLHAPSQDLAQSTIKFLSKLMMAQSQEIFTLKVISGDLNQSKNSLIAKLCKSTSVLYE
FT                   DCYNMINKNKKEGFKITNESYDGNDYEDDLDDDDGDDLEGFLERPEDTDDSDNRYVVAE
FT                   LDSSWISIIYFKYEYYKSLAYYFNGLHLDANRKYGDAIAYLTKSQEVLNGVHSSTLKQV
FT                   SKGSGDVYELLDNYKYQKDAVTIRLNDLNKDNDLIYHDIVPNLVTLPEIKPMDSTKIIK
FT                   LGDNAMFHEINEKNYNNFLVNVVPVNIHELSSYYSEEKSQYLRNEIDHFEVSNEEVSSV
FT                   LEYLKLPKALVSIKESLRGTSSKGSTGNIDELLSQSVIDKVNEISSQYSNDIQRKNTIE
FT                   NSRKEIYQLIKFLTENNCQDDAIQLKKILYDASVSDTKLFGLVDETYHQTLGKGIQSTE
FT                   FKSLFKTVDNKSSNQDSEISLLDIIDDDDDDDNTNQDKQIKNIEDYLNDLNNIKQAKFK
FT                   LIEKLKKEIHNDDISDILVLNMKLKSTNEIKSIIFPEELKKFNPFTNELDKLITNEKSI
FT                   IEQLKSRWNQLISNPQIKNLQTETNSKNRLIISQSEKIDQFYGNWLKYHNGLIAGEKFY
FT                   NQLLDQFKNFRNNIDNQLNQGMRSLNISQQFPTQPMLNRTQSSGLQSNYTGQSSISHSE
FT                   SLSGQPSGGYNQPQPQQQQLQQQQQQQQQAQFSGAYNQQYSQPHGGYTQFQGYGQGQGQ
FT                   SQTGYQRQPPPPPPQLPLKQSMGSYNFATTLQQQQQPQQQRTPQNESNLIYDNPSTYNP
FT                   NMYNFFSSK"
FT   gene            <365744..>368131
FT                   /locus_tag="CAWG_02507"
FT   mRNA            <365744..>368131
FT                   /locus_tag="CAWG_02507"
FT                   /product="hypothetical protein"
FT   CDS_pept        365744..368131
FT                   /codon_start=1
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02507"
FT                   /product="hypothetical protein"
FT                   /note="similar to ATP-dependent metalloprotease"
FT                   /db_xref="GOA:C4YPV3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV3"
FT                   /protein_id="EEQ44242.1"
FT                   /translation="MLAVNSARLLNRAIISRPVLYRSAIPRHFSTYTPLAFRTSRQLFN
FT                   KSNNDNKKSNNNDHEKDSERKPKKDQNKDEEEQLREELKKKFAAKHPGTNPDNLKIYKF
FT                   DLRTLGNYVLLFGSTILTFYLINRTSESEIQQLTFQDFITNYIEKGLVTKLTVVNKAVV
FT                   EAELIPGAVSNISHNRNGKPYVVFTIGSLEFFEDEMNKVQDRLKIPINERLPVVYEDHT
FT                   SWLSYIMPILPTVLLIGGLYYLTMRRMPGGAGGAGGAGGPGGIFKIGKSKAKLFNQENE
FT                   VKIKFKDVAGCDESKEEIMEFVKFLQDPHKYEKLGAKIPRGAILSGPPGTGKTLLAKAT
FT                   AGEAGVPFLSVSGSEFVEMFVGVGASRVRDLFKTAREMAPAIIFVDEIDAIGKERGNGR
FT                   MGGNDERENTLNQLLVEMDGFDTTDHVVVLAGTNRPDILDKALLRPGRFDRHISIDVPD
FT                   VEGRKQIFKVHLNKLKLKSVQDIDAKQKDVDFSKYQQLKNEEIEKLAGRLAALTPGFAG
FT                   ADIANCCNEGALIAAREDAPAVDTYHFEQAIERVIAGLEKKSRILSPEEKKTVAYHEAG
FT                   HAICGWFLQYADPLVKVSIIPRGQGALGYAQYLPKDQYLTSQEQFKHRMIMTLGGRVSE
FT                   ELHFDTVTSGASDDFKKITQMAQQMILKLGMSDKLGQICYDTSSDNGNGFKVHHNYSET
FT                   TARIIDEEVKRLIDESYEACHKLLTEKLDLVDKVAEELFKKEVLTREDMIKICGPRPFP
FT                   ERNDAFDKYLQGEDAFKGKPKSKDQNSNNDGASSPSSAPETA"
FT   gene            complement(<368300..>370171)
FT                   /locus_tag="CAWG_02508"
FT   mRNA            complement(<368300..>370171)
FT                   /locus_tag="CAWG_02508"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(368300..370171)
FT                   /codon_start=1
FT                   /gene_family="HOG000093839" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPV4"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV4"
FT                   /protein_id="EEQ44243.1"
FT                   /translation="MNTGIENDFKYLHSRNLQQLPNNNTKNPSQNIPYNYPSSDEDIED
FT                   EYYSDDESQNQLDYEINQLINQQNEKQFKNKFKQLENQSLQRFKSQWDAIIDKYSKIDD
FT                   STQSDEIDIVTGELITNNGHLDKLNQNHNQKGDITKMDIWRQDYGQQLENWRQRDFRMK
FT                   KQAKQRKNEQRQILKKLDLFNKPIYGYPKFEKLEENDFLKQSPTKNKVPSGIESDESPT
FT                   KKRRVFTDKKVVSKNSNYLEFSDDDDEEVENKSVYTKTVIAHGKLYKRESDNVLYGSSA
FT                   DTFSPYIDRQSFRPESNELQSEDSQDYESNLSSDISDDEYDDDTYQSIIINDKKYSPKF
FT                   KEHFDESETEPISETPQPQTSSEETPGLSSQTEEISPSPHPESTFDDEYSIIEEPYYFL
FT                   NVKSLPLPTIFNCAFIKCHYCTGNKKLYELHLLQSHSSALAEMGYPINLNSQNAAYENS
FT                   NTDSDKENHKIEFTRDITDVDLNKLYQVFPKTYKLAPQKEALTCGKELANGQTCQKFYL
FT                   VQEQLDQHQEAGDECSDKRQVLFCPILGCGYLTDGGYKEWREHMITANHYQEETAEKET
FT                   KKENLEKLISRPIATRKVSVKVPKFTETDFKVSFIDQGYESIDELFN"
FT   gene            complement(<370395..>370661)
FT                   /locus_tag="CAWG_02509"
FT   mRNA            complement(<370395..>370661)
FT                   /locus_tag="CAWG_02509"
FT                   /product="predicted protein"
FT   CDS_pept        complement(370395..370661)
FT                   /codon_start=1
FT                   /gene_family="HOG000093840" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02509"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV5"
FT                   /protein_id="EEQ44244.1"
FT                   /translation="MKPEPSTTTETIEEKKEQWEEEAEEEEDDEPDEWDQRIINTGCHK
FT                   ENLKLQLCHADTGDWRQCTKELQAFKECWDKNKNNERTSTVDN"
FT   gene            complement(<370877..>374629)
FT                   /locus_tag="CAWG_02510"
FT   mRNA            complement(<370877..>374629)
FT                   /locus_tag="CAWG_02510"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(370877..374629)
FT                   /codon_start=1
FT                   /gene_family="HOG000093841" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPV6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV6"
FT                   /protein_id="EEQ44245.1"
FT                   /translation="MSLNKNIKQKVVAITNDLEKLIPIGTLNFFNLPLDITDLQGVKPS
FT                   YITPKLDNDLQQWSWLDIDYIIYLLSINHKSINPILFTLKYLLEKSYIQAIYKVVKVTR
FT                   SYNRSDGTKSIDYLFSMCRIRLYSIPADVEGARHIREYRQLQSKSLKLDRQYASNFEQL
FT                   LKYLDFSHSNWFIGKQLSIESLLHQGSLLLIDCQCTNELGTASNDELKFHLQRWSNKQS
FT                   ATKFTNDKSHTNNLSNTDTSGDRIKKIYDQIPSPDLSKYMVNEKNYQFIKQSKASISST
FT                   TDKLSTLANDSEHQDMIKIDGIKSTLYPFQAKSVALMLERECIKRRTIMPNFIKLESPL
FT                   SSNFYFDLFTKRIYLHADVMSLPLGGILGENMGLGKTLMCLSLINLTKYEITKIPSDNF
FT                   LLYNEIEIHDEIKTLTEICREKIIHSSIPWKLYNLPTSVTANLAKHPGYFCIDLNDHEK
FT                   NKRSHKSGFLINRNGVDTGKRASRTTGTKSTSYLKLYMSSTTLIIVPDNLFIQWVDEIA
FT                   HHVEPNFLKILCAANYIKSDQIKDQFLPNPKFVNTIPESPVELIEYDVILISQSCLNKS
FT                   FANKNRNSQKNGNSQVPSLRQVYWKRLIIDEGHIVQSKTSNAAQICRLLFSERRWAVSG
FT                   TPTSGLTKIYMEEGEEDTGEKRNSHQAQNNIHVLENQFFAKTELQRLGVLISNFLKLEP
FT                   YYTQPKLWTQDIINPLINSRYGSELIFSNIINSIIIRHQPNQTNIKLPNFHHEKVILEP
FT                   CFQDSLSFNLLAAVLAVNAVTSERTGIDYMFHQSNRQQLRRLLSNIQRATFYWTGFQQQ
FT                   DVETLVSICDEALSRSGKYNESDVELLRRSKNIALIALNNQRWTIAQSIHELGYYIYKD
FT                   ETNQYVSSVWGISAYTPDVSVFAAPQLLRLQMFWKENWFLSFDNEQTFRDKFENTAKTF
FT                   WDQYLHQEFKKNDRHVAMDKLIKKNSGAELYTLDNISKSFNDVTPPKRTIDKEAQAQSP
FT                   PPKKKRKVTFTDAVIEEDERKQKEPPQSKDACDDVSKDNKTIEKSDRSIPPFDMTGLFK
FT                   NMNILGTSSAKLTYLATSLLENQRNRIKSIVFFEFEDSAYYLIELLEILKIRHIIYANF
FT                   ITPIKRAQNLYDFSNYDVDKEENNGGICLVMNIAHSSHGLNIIAATHIYFINPVKQESI
FT                   EAQAIKRAHRIGQTKEVTVKTLYLKGVDELKILSRNEKLKNVKNDKESFDAKEKEDNDN
FT                   LLEFLDFDNSEHEYAAFPHPISIFS"
FT   gene            complement(<375237..>376838)
FT                   /locus_tag="CAWG_02511"
FT   mRNA            complement(<375237..>376838)
FT                   /locus_tag="CAWG_02511"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(375237..376838)
FT                   /codon_start=1
FT                   /gene_family="HOG000093842" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV7"
FT                   /protein_id="EEQ44246.1"
FT                   /translation="MSSKVEIQTNPATATPSLSPPSSSASTSVPPSSNKSTTTTTTTKN
FT                   NDNDNNKTSAQQDEVPMKRKNSATSNGSSASTTPPKRHRPMSLNLGVPDNADVALRIVS
FT                   PGLPPLINESMKTTVQLSKQIQQQQKNLIAARHGKDPEDEEQSQTQAQAQQPTSIAIPA
FT                   SGIPIRQTVQLPPLNQRPAPKSPVYASDDSDLNRLSNVKKLKRSNVPPPLSIGESSGSG
FT                   TGNNSNNTNLRPSIHSAPIRSRAPTRPTPRAIPPTRIVPQIAIPPQPQYYYVSTPYQQY
FT                   YPAQIVGATPTQPVFQPLPRSQLRQVNPRVRMIPLSSTTTHFGRRTLQQGPSQLPPGAI
FT                   LQQQQQQQQQQSLPLQQQPQQQPQSQQAISLQSTAPKPKPNAVTDVFRGDFHKAAPLHS
FT                   QPLSAQREYFENSVHDEPPQKSQVISIAESQEISGSITINGSNVFNFKIFNKNEEEKSN
FT                   DSEGTSKDNTSGKKQEGTLEKEEEPTDEEGKGESNVTEEKTHKSTKSEDLEEDNKKKFL
FT                   KICETCWDQVFNKRDD"
FT   gene            complement(<379231..>380526)
FT                   /locus_tag="CAWG_02512"
FT   mRNA            complement(<379231..>380526)
FT                   /locus_tag="CAWG_02512"
FT                   /product="alpha-1,2 mannosyltransferase KTR1"
FT   CDS_pept        complement(379231..380526)
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02512"
FT                   /product="alpha-1,2 mannosyltransferase KTR1"
FT                   /db_xref="GOA:C4YPV8"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV8"
FT                   /protein_id="EEQ44247.1"
FT                   /translation="MASTRSNARLIRFGIFALVLIGCGYILTRGSSFQPPNYQQTQSPA
FT                   AHEKQTGNVAAGGGAGSGSAGAQVPLGKNRGPIPKAIMGAGEGGSDAPVPQQDIPDSYT
FT                   LNDKIKATFVTLARNSDLYSLAESIRHVEDRFNKKFHYDWVFLNDEEFNDEFKETVGSL
FT                   VSGNTKFGLIPKEHWSYPPWIDQEKAALVREQMREKKIIYGHSESYRHMCRFESGFFWR
FT                   QEILNDYDYYWRVEPDIKLYCDIDYDIFKWMKDNNKDYAFTISLPEYKETIPTLWDTTK
FT                   EFIEKNPQYLAQNNLMDWVSDDKGQTYNGCHFWSNFEIGSLAFWRSEAYRKYFEHLDKA
FT                   GGFFYERWGDAPVHSIAAALFLPREKIHFFEDVGYYHVPFTNCPVDKEVRKARNCNCDP
FT                   NKDFTWRGYSCTTKYYTLNNFKRQKGWEKYTA"
FT   gene            <382798..>385392
FT                   /locus_tag="CAWG_02513"
FT   mRNA            <382798..>385392
FT                   /locus_tag="CAWG_02513"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        382798..385392
FT                   /codon_start=1
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPV9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPV9"
FT                   /protein_id="EEQ44248.1"
FT                   /translation="MTDSFDIDNILSQLTLEEKIGLVGGIDFWHTYPISRLNIPKVRFT
FT                   DGPNGIRGTRFFNGVPSACFPCGTGLAATFDHELLLTTGKLMNIEAKFKNAHVILGPTM
FT                   NIQRGPLGGRGFESFSEDPYLTGQIASAIIKGIQYDNEIGATVKHYVCNDLEDERSASD
FT                   SLVTPRALREIYLEPFRIAIKESNPICLMTGYNKVNGEHVSQSKFFLQNILRDEWNWQG
FT                   TIISDWYGTYTSKKAIENGLDLEMPGSPIFRNKQLLTSMIKSKELHIKHLDDRVKNVLK
FT                   LIKFAKQSSVVVTEDGKESSENNTQETRDILRKLAQDSIVLLKNDNNLLPLKRDDVDFS
FT                   SKSIAIIGPNAKIAAYSGGGSATLPAYYTTTPYNAIVEKLSSISKFDITSQLKYTIGAK
FT                   AYKYLPELGPQVINPKTGKPGFSMKFYKKPKSVPNEDRELFDELDTEISDILLGDYYHK
FT                   DIPSNGLYYIDFECEFTPSKTQHYEFGLTVHGTAQLFIDDKLVVDNKTKQIKGVSFLNS
FT                   GTIEKRGSIELHQGKTYKIIVEYGSAPTFTLKDQVGEYFGGGIRLGMNEIINDDEQEII
FT                   NAVNLAKSVDLVILIIGLNKDWESESYDRPDMKLPGLQDKLIESVLDVNPNTIVVNQSG
FT                   TPVEFSEWLDKSKALLHCWYGGNESGNAIADILFGDVNPNGKLSLTFPLKNNDNPTFLN
FT                   FKTERGRVLYGEDIFVGYRYYEKLNRQVAFPFGFGLSYTKFEFFDLKLEKKTKDKEDKE
FT                   EESLVVSLSVKNIGKMIGSEVIQVYVSKVESDVIRPIKELKGFAKVNLQPNEAKSVNLK
FT                   LIIKDSVSFFDEYANQWSVQSGQYKVHVGNSSDNTPLTESFTIEKSYFWSGL"
FT   gene            complement(<385558..>386943)
FT                   /locus_tag="CAWG_02514"
FT   mRNA            complement(<385558..>386943)
FT                   /locus_tag="CAWG_02514"
FT                   /product="glycolipid 2-alpha-mannosyltransferase"
FT   CDS_pept        complement(385558..386943)
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02514"
FT                   /product="glycolipid 2-alpha-mannosyltransferase"
FT                   /db_xref="GOA:C4YPW0"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW0"
FT                   /protein_id="EEQ44249.1"
FT                   /translation="MKPSIFYSSRQPYLKYLAIILTTITIYVLTHSSYSADPNINDVTT
FT                   KPISETVPQPPPQSPSSPEQQQQQPANQDQIVKVPEELKNKPQDLVVDNNKDQKPAVSG
FT                   VPKSSSSSPQQQEKQDTKKESENSSSSKDPVKSEKVKATFVTLARNSELYDLIKSIRNV
FT                   EDRFNRKFNYDWVFLNDDDFTQEFKDLTTALVSGKTKYGKIPKEHWSYPDWIDLKRAEE
FT                   TRKNMKLQKIIYGDSESYRHMCRFESGFFWRHPLLDDYDWYWRVEPSIDIHCDLNYDLF
FT                   KYMEDNNKVYGFTISIHEFRATIPTLWDTTKKFIKENPQYLAENNFMDFISDDKGETYN
FT                   LCHFWSNFEIANLNFWRGEAYRKYFDYLDQTGGFFYERWGDAPIHSIAAALFLPKDKIH
FT                   YFDDVGYKHSVYTQCPLNPQFRYEHKCHCNPDNDFTFRGYSCGKKYFEKMGLQKPKEWE
FT                   KYQ"
FT   gene            complement(388292..388365)
FT                   /locus_tag="CAWG_08055"
FT   tRNA            complement(388292..388365)
FT                   /locus_tag="CAWG_08055"
FT                   /product="tRNA-Val"
FT   gene            <389280..>390335
FT                   /locus_tag="CAWG_02515"
FT   mRNA            <389280..>390335
FT                   /locus_tag="CAWG_02515"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        389280..390335
FT                   /codon_start=1
FT                   /gene_family="HOG000001062" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPW1"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW1"
FT                   /protein_id="EEQ44250.1"
FT                   /translation="MIRRSSLIFTRSISTSFSLPVNKTLEILKATNANFEGLFTNNAIN
FT                   QLWFQRGQQLVQNLNQHLAQTNNGLLSDSNNINNNTSSTSDNGNGDGENVVNYSLNEII
FT                   SITMNKPELFHIHKNATNLYNLQFFFENIRQLEQQPQEIIPSGSEVLLQTPKDQFKNVP
FT                   SDKELVDWIEHSFGSIQELRNLIINSAKGIKGDGTVWLVAESTMSENYLSKSNFSSPLF
FT                   HNLAIVNTYNGGMIDDSERSGQLRRMKSVLQQQQEQNEEEQDKSTENKQKHNNSTSEFE
FT                   LGSVEQAELETAFHNKRLVPALAIDVSPRNYLVDYGAYGKQQYLENVWECIDWDIVSRR
FT                   LPPRSKQVITV"
FT   gene            complement(<390567..>392180)
FT                   /locus_tag="CAWG_02516"
FT   mRNA            complement(<390567..>392180)
FT                   /locus_tag="CAWG_02516"
FT                   /product="ATP-dependent RNA helicase DDX19B"
FT   CDS_pept        complement(390567..392180)
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02516"
FT                   /product="ATP-dependent RNA helicase DDX19B"
FT                   /db_xref="GOA:C4YPW2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW2"
FT                   /protein_id="EEQ44251.1"
FT                   /translation="MSSEKVKRVEADASDLLASLSIDKSGEKPEEIKKGSTPDPSDLLG
FT                   GLSLEEGDSKKPEEKKEVVEEPENKEINDDKKDEDKKDESKDEVKDGDGAKEETKEEVK
FT                   EESKEEPKEPKEPATNLIKSSYEVKVKLADIQADPNSPLYSVKSFEELGLSPELLKGLY
FT                   AMKFNKPSKIQEKALPLLLSNPPRNMIGQSQSGTGKTAAFSLTMLSRVDPTIKMPQCLC
FT                   LSPTRELARQTLEVITTMGKFTNITTQLVVPNAIPRGSSVNAQVLVGTPGIAIDLIRRR
FT                   QLNLSKMKVFVLDEADNMLEAQGLGDQAIRVKKFLPRGVQLVLFSATFPTEVREYAERL
FT                   VPDANSLELKQEELNVDGIKQLYMDCRSEQHKFEVLCELYGLLTIGSSIIFVEKKETAD
FT                   VLYGKMKKEGHTVSVLHGGLDNTDRDRLIDDFREGRSKVLITTNVLARGIDIASVSMVV
FT                   NYDMPTDKYGKPDPSTYLHRIGRTGRFGRVGVSISFIHDRRSYDILMAIKAYFGNVEMT
FT                   RVPTDDWDEVEKIVKKVIKS"
FT   gene            complement(392376..392450)
FT                   /locus_tag="CAWG_08056"
FT   tRNA            complement(392376..392450)
FT                   /locus_tag="CAWG_08056"
FT                   /product="tRNA-Lys"
FT   gene            <392842..>394605
FT                   /locus_tag="CAWG_02517"
FT   mRNA            <392842..>394605
FT                   /locus_tag="CAWG_02517"
FT                   /product="dolichyl pyrophosphate Glc1Man9GlcNAc2
FT                   alpha-1,3-glucosyltransferase"
FT   CDS_pept        392842..394605
FT                   /codon_start=1
FT                   /gene_family="HOG000168174" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02517"
FT                   /product="dolichyl pyrophosphate Glc1Man9GlcNAc2
FT                   alpha-1,3-glucosyltransferase"
FT                   /db_xref="GOA:C4YPW3"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW3"
FT                   /protein_id="EEQ44252.1"
FT                   /translation="MAKKKSTGPQPSLSSSPNGRAKVTAETITTTTTTTTDTTNSYSLL
FT                   NIWVISLALKILLFIGYHSTDFDVHRNWLAITNKLPISQWYIENTSQWTLDYPPFFAYF
FT                   EYLLSLLVPRFVANDGCLDIVEIGQYGLPTIYFQRLTVIISELVLFYALQTIVKTSPTL
FT                   SAKRRMYVATASLALSPGLILIDHIHFQYNGMMYGILLLCINSARLQQYLLCGFWFSVL
FT                   LCFKHIYLYLAPAVFIFLLRGYCLKFNWNKRKNFFINIFNFIQWINLFKLGSIVILVFI
FT                   IAFGPFYNVLPQLISRLFPFSRGLTHAYWAPNIWAVYSFLDRILIQIYKKIPMSKYPLL
FT                   KIFQFDPNSLNNDQLLKTSTRGIVGDIEFFILPNITPKLTFLLTLFYQIMALIPLFIQP
FT                   TYRRFVGALTLCGYASFLFGWHVHEKAILLVIFPMTLLVARDQKLLTPFNLLVSCGYGS
FT                   LFPLIFTCNEWLIKVVYTYTWYIIFYFNFRKVVRPSKNNIIGNGIGNGNGKGGGIILDR
FT                   MVNLYILLFNVVVIITSLFDLFKHKYPVLQNFEFLNLMIYSVYCAIGIISSWNGFCWLY
FT                   FIDDGIWNQDQ"
FT   gene            complement(<394986..>396872)
FT                   /locus_tag="CAWG_02518"
FT   mRNA            complement(join(<394986..396024,396580..>396872))
FT                   /locus_tag="CAWG_02518"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(394986..396024,396580..396872))
FT                   /codon_start=1
FT                   /gene_family="HOG000246727" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW4"
FT                   /protein_id="EEQ44253.1"
FT                   /translation="MYQQPSNHSYSSTDSLRWSSNNPFRQASISQTQSRNNFDEWVDKN
FT                   KQLLDLSSDEEEEVEEHGAAIGFHQSTESFGKPSAFPPTPVRADSDSSINYARMSKNPF
FT                   ASALSQSEDKPRAQTPTHSSRAPPRPPKPSQKQPPPPSYEEAAGPEAAKKSYPREKEGR
FT                   SEDSRERRRENSRSGHSRENGHSSHSRSHGREHGRGSDRDKDRERRSHRSKKSPSKKKS
FT                   DPVKPKNLDTIDKLDVTGFVGFHHDGPFDACAPHRNVKKEKAPVMAFPIDGPNNSIAGG
FT                   TNMTKDDQLNLAFGNYHEETPVIKTNRTQNDPTSSIYTPKQNPSVINFDSNTNSTPIHG
FT                   STTAGLGSTTFLDGAPAPKGDELLNPNAGVGRKKSIVQRLRKNSGSESNSRRSSNEGLQ
FT                   PPSPPYQEPRRGSLNTLELDNDDNELKPPGNSFIRRVRSLKVRK"
FT   gene            complement(<398697..>400478)
FT                   /locus_tag="CAWG_02519"
FT   mRNA            complement(<398697..>400478)
FT                   /locus_tag="CAWG_02519"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(398697..400478)
FT                   /codon_start=1
FT                   /gene_family="HOG000093843" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPW5"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW5"
FT                   /protein_id="EEQ44254.1"
FT                   /translation="MADTKVLSPAIPSQDEVMTESQQQVQSKFSSTSTTQSPTSTPNSQ
FT                   QFSKNSQKQPRYDKKPLTPSAILQDYNNNTQSSNEQKMVSTASTTPISTNNNTPKRGKN
FT                   QQQQQQQHQSEELGSFSFTKKDIVKVNSVVSDLHSNITSSICRSGKSSCRNSTSTTNSN
FT                   HNNINHNNRNNNDDDLTFKDFDYDEQIRFPRVNTYYTYNTKKTSFSSNDDKPSTKSHPS
FT                   SESIFKHITKEQQNQNQVDQGEEGDEQHEHDYIPANFDLNQPLRRYSVPLQLKESPEEQ
FT                   LLHKFAENNKIYERSMNSQPESVSASVSISGTSTESEPDSESNIESPPPQPRQLRLKNP
FT                   TNCSKSKETNYNKHLKPLYQLKKPLLTPAVLRPAYTNDHENLSPPTIIPPPTSSYTIII
FT                   PNSDYFHSNGGGGLPNCTNEPVHDHWKDNGLTSNCMWCVKPFHNPIVSMICDGPRRHHC
FT                   RFCGLIFCADCLVNKTILIDHEARFVIPILSSTNSNETETKTNKLQQFFSNSKVCKKCG
FT                   MIYDNLIEELNKSENNYTTSFVLVDNPFRKNYSKSNDYSFAQQQHQQQQQLQQQSSRPE
FT                   KRLSVADVPNDWVWSSF"
FT   gene            complement(<402915..>403082)
FT                   /locus_tag="CAWG_02520"
FT   mRNA            complement(<402915..>403082)
FT                   /locus_tag="CAWG_02520"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(402915..403082)
FT                   /codon_start=1
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPW6"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW6"
FT                   /protein_id="EEQ44255.1"
FT                   /translation="MNSEKIIEVIIAIFLPPVAVFMKCGATTPLWINLVLCIFIWFPAI
FT                   LHALYVVLKD"
FT   gene            complement(403979..404093)
FT                   /locus_tag="CAWG_08057"
FT   tRNA            complement(403979..404093)
FT                   /locus_tag="CAWG_08057"
FT                   /product="tRNA-Tyr"
FT   gene            <405542..>407716
FT                   /locus_tag="CAWG_02521"
FT   mRNA            <405542..>407716
FT                   /locus_tag="CAWG_02521"
FT                   /product="acyl-coenzyme A oxidase 2"
FT   CDS_pept        405542..407716
FT                   /codon_start=1
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02521"
FT                   /product="acyl-coenzyme A oxidase 2"
FT                   /db_xref="GOA:Q5AJD6"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJD6"
FT                   /protein_id="EEQ44256.1"
FT                   /translation="MAMLTKSIHDEDHVEKKDPDTNPKTVQNVVSSRSPPNPAKDITEE
FT                   RNRTNWDLKEMHEFLEGGEAKSEQVLRLYQSIERDPILQTRPEQFDITQKEERELVATR
FT                   INQMTKYMEIESAAKFRRRLQLMTIIDPSMGIRMLVNIGLFINCIKGNGTQKQYDFWAK
FT                   SKEGAIIKQIHGSFGMTELGHGSNVAGCETTATFDEKTDTFIIDTPHIGATKWWIGGAA
FT                   HSATHTVCYARLIVKDVDYGVKTFVVPLRDSNHNLLPGVAIGDIGAKMGRHGVDNGWIQ
FT                   FTEVRIPRFFMLQRWCKVDRQGNVTLPPLEQLSYISLLEGRVGMATDSYRIGARYITIA
FT                   LRFAVGRRQFASAKGKEETKLIDYTLHQRRLLPFLAMTYAAALGTDRLERQHEELLANL
FT                   DKALATKDKLLLKNTINGTKSMFVDSGSLKSTLTWFAADLINETRQACGGHGYSSYNGF
FT                   GKSYDDWVVQCTYEGDNNVLAMSAGKTIIKTVQQVLNGKPLQDSTLEFLNDAPTLSKAK
FT                   KAVIRIKEHVDDVDRVLKAVAGLISKFSSDLIAVSHQSWDSIGPQRVILSKLRCHYYLL
FT                   ETFNERLNDNIKAKSPARPHLENIVKLYYVTNILGPFIDEFLRFGVISPKVAKYITGEY
FT                   PQRLCAITRPYVIGLTDSFQQPDNIINSLIGQYDGNIYTNYLDSVKEVNNPLNDKAPYS
FT                   EDLEAMLNRQSISQRERFERSKEAAAKLSR"
FT   gene            complement(<407842..>408429)
FT                   /locus_tag="CAWG_02522"
FT   mRNA            complement(<407842..>408429)
FT                   /locus_tag="CAWG_02522"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(407842..408429)
FT                   /codon_start=1
FT                   /gene_family="HOG000093845" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPW8"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW8"
FT                   /protein_id="EEQ44257.1"
FT                   /translation="MTRQGLISLVSLAICCSGLYDCFQLELPPGLVKGGHFQFLTNVSL
FT                   ILTIIYILQTIVTPTSYNLRLQYNVVSNLEFTVTVSYWVMHLILPHWLNTNSFERDYWL
FT                   DFKIHIWPYVYLIFDNQEQIKPKKSWTLTAIIIVVYWCYIERVVSVNDDGITRFPYPFL
FT                   NNKTLVERFFRVTAMWLLSCLNYFVLGFRNSL"
FT   gene            complement(<408768..>409358)
FT                   /locus_tag="CAWG_02523"
FT   mRNA            complement(<408768..>409358)
FT                   /locus_tag="CAWG_02523"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(408768..409358)
FT                   /codon_start=1
FT                   /gene_family="HOG000093845" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPW9"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPW9"
FT                   /protein_id="EEQ44258.1"
FT                   /translation="MGITITIFRIVNLLFLGNGFIQSISTKLPPHLIKSGQFQFLTNCS
FT                   LLTCLVYIISTFFISTGQIQWLYNLVSNLEFNVLFSYWTMALCFPSMVADDDVDRNLLL
FT                   DLQVHFFPYIYLIIDSQPSLGLKESWGWTIGYIFIYWVYIEWECGKHVHDGVSGYPYPF
FT                   LKGRGVLGRFGCMSVFAAIACCNYFVLKLRNGA"
FT   gene            complement(<409815..>411944)
FT                   /locus_tag="CAWG_02524"
FT   mRNA            complement(<409815..>411944)
FT                   /locus_tag="CAWG_02524"
FT                   /product="acyl-coenzyme A oxidase 4"
FT   CDS_pept        complement(409815..411944)
FT                   /codon_start=1
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02524"
FT                   /product="acyl-coenzyme A oxidase 4"
FT                   /db_xref="GOA:Q5AJD9"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJD9"
FT                   /protein_id="EEQ44259.1"
FT                   /translation="MSFTKKNVSLAEGPDPRSSIQTERANSKFNPEQMNYFLEGSKERS
FT                   ELFKGLAQQMERDPVLFTDGSYYDLTKDQQRELTALKINRLARYRETDSIDTFNKRLSL
FT                   VGVFDPQVGTRIGVNLGLFLSCIRGNGTAEQLKYWAFDKETSNIKGIYGCFGMTELAHG
FT                   SNVAGLETTATFDKETDEFVINTPHIGATKWWIGGAAHSATHCSVYARLIVDGEDYGVK
FT                   TFVVPLRDSNHDLMPGVTVGDIGAKMGRDGIDNGWIQFSNVRIPRFFMLQKFCKVSADG
FT                   DVVLPPLEQLSYSALLGGRVMMVLDSYRMLARMSTIALRYAIGRRQFKGDNVDQNDPNA
FT                   LETQLIDYPLHQKRLFPYLAAAYVISASALKIEHTIETTLEELDQAVAKEDQRAIFKSI
FT                   DDMKSLFVDSGSLKSTATWLAAEAIDQCRQACGGHGYSSYNGFGKAYNDWVVQCTWEGD
FT                   NNVLGMSVGKPIVREIINLEDKDKKVRGSTAFLNQLKEYTGSNSSKVVLDNVADLDDIN
FT                   KVIKAIEVAIIRLGQEAASTVRKESLDFVGAELVQLSKLKAHHYSLSEYVRRVNEFDQK
FT                   ELVPYLLTIAKLYGATVVLDKFAGIFLTFNVASTKAITDLASIQIPKLCAEVRPNVVAY
FT                   TDSFQQSDMIVNAAIGKYDGDIYENYFDLVKAQNPPSKTKAPYSAALEAMLNRPSLEAR
FT                   ERFEKTDETAEILSK"
FT   gene            complement(<414004..>414531)
FT                   /locus_tag="CAWG_02525"
FT   mRNA            complement(<414004..>414531)
FT                   /locus_tag="CAWG_02525"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(414004..414531)
FT                   /codon_start=1
FT                   /gene_family="HOG000093848" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX1"
FT                   /protein_id="EEQ44260.1"
FT                   /translation="MGNSIDEQTWKNATIDYKNLHKLVENSHSIRSFAFKCQDVIINRS
FT                   TVDNAYYQSAKRFLLIINLLGFGTEIRRLLIDDLKKIPNFHLNYHSLSPEEQENMVSHV
FT                   KSIQKWAAHYGINLELAFLLEFSEYIFTKQFIYNSHILYQLLKKEEKIWERRVEFLRLE
FT                   QQQYEKNRENHK"
FT   gene            complement(<416053..>416223)
FT                   /locus_tag="CAWG_02526"
FT   mRNA            complement(<416053..>416223)
FT                   /locus_tag="CAWG_02526"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(416053..416223)
FT                   /codon_start=1
FT                   /gene_family="HOG000000783" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR020266"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX2"
FT                   /protein_id="EEQ44261.1"
FT                   /translation="MNVSGRIPPQGAKEEQSTFEKIKNSPAFTIGTQAALFGLGVLFIQ
FT                   SPLMDMLVPQL"
FT   gene            <416454..>417698
FT                   /locus_tag="CAWG_02527"
FT   mRNA            <416454..>417698
FT                   /locus_tag="CAWG_02527"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        416454..417698
FT                   /codon_start=1
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJS1"
FT                   /protein_id="EEQ44262.1"
FT                   /translation="MASVEVELGVTPETTYSISGKQLKFDSESDIAPYIKELTEKENVK
FT                   KVDFSGNTIGIEASKALSEALLKHKDTIVEINFSDLYTGRLNTEIPQSLEYLLPALLKL
FT                   PNLKLINLSDNAFGLQTIDPIEAYLAKAVSIEHLILSNNGMGPFAGSRIGGSLFKLAKA
FT                   KKAEGKESLKTFICGRNRLENGSVNYLSVGLRNHKDLEVVRLYQNGIRPAGISKLVEQG
FT                   LSNNKKLKVLDLQDNTITTRGAIHIAESLSNWPLLVELNLNDSLLKNKGSLKLVEAFHA
FT                   GDEKPQLITLKLQYNELETDSLRVLADAIASKLPQLKFLELNGNRFEEDSEHIDKINGI
FT                   FEERGYGEIDELDELEELDSEEEEDDEDDEGEDDTLEEDLDLTQLEEELAGVSLEDKDG
FT                   NVDEIAEELSKTHIK"
FT   gene            <417822..>421820
FT                   /locus_tag="CAWG_02528"
FT   mRNA            <417822..>421820
FT                   /locus_tag="CAWG_02528"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        417822..421820
FT                   /codon_start=1
FT                   /gene_family="HOG000192269" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPX4"
FT                   /db_xref="InterPro:IPR004584"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX4"
FT                   /protein_id="EEQ44263.1"
FT                   /translation="MIHIEKLFSFILLFIAVPSPASFIRMSSIYKLSIKGVRAFHPESD
FT                   ETIQFGFPLTLICGQNGCGKTTVIECLKYATTGTLPPNSKGGAFVHDPSLSSRTAVTGQ
FT                   IKLAFKNVNGKSMITTRSVQASSKSTKSATGATVTFKTLEGQLAIIEKGDKISVSSKNA
FT                   ELDAQIPVYLGASPAILENVIFCHQDESLWPLSEPSALKKKFDDIFEASKFTKVLDNFK
FT                   SIKKDMATDIKLIEQSVNHLKIDKERAKKVQDKLHNMNESVEKYTEEITDLNIQIEKKE
FT                   KQAEELFATNQEFQRTLSDYENLLTKKQALEEQIERLKTSIEILPDNDEELLNRQENFS
FT                   AITTEKSNRIDDLQLQSTKLSDELKNKTKQYNELIRLDGSFKAKKAEYDSNWEKLSEIV
FT                   DKNAKDFNVQISNDRVRNVAMFKTELNKRHNTLLNEQKDLLVDNKRKESEKQSALQDVL
FT                   NSISREEQHHEYATNVINTNNEKLSVLKRKVEVGSNNEIELEEKRNDLELTMKLLQEKK
FT                   DLNEVRKLDAKIMECNSEISKLEFELDELAKKLSTSNKQSDLRSKVLFLEESAKSKKAE
FT                   LSKIFATIDSSYFDVLGSKLDVDVGESLLSQKISNLEIKSEEQQKKVGSLESELQINKN
FT                   SIESILKTIEENNSKIDSLKSNITKVIGEDEINDYENVVNDLEDSYRNVSEDVNSAEVT
FT                   RDFKNSAISFAEENKCCLLCKRLFEQGGLGSFIQDLKQSVDEHKIQEIREQSLEIKKEL
FT                   EDVKSINLEVVNYRECLANVQNFECKLKELVDKSSQIENELEQQRKEQQTIKHSLDNAL
FT                   SLKKPLSDATRIHLEVSEIEFQLDELNEDLSGFGGSVVSVDELQKQQQDINLKIKKTRQ
FT                   DLNDYTESKYKAQRELQKLENRVKDTKLQISNLERSLAEVTGIKNNISEAEDIVRSSEE
FT                   KLKQIKTSLEELQVDKQVKSNALRDTQNSNRDSEQKMQQEVEKCHQLLTSFTSLNDAVT
FT                   YFETNVAEKYEANALEMKELSEQCTSLETKIDEHAQEIKLLEKEVMDASRIEHNILANI
FT                   DYRSQLSRLEETELQLGSMDIEDAQSRKEEYQVESKKLRDALSSLTAEHAGKIGEVKQI
FT                   KDQIASLKKELETEYKNVNQSYHEEWIKLQTNLLVSNDIQIYSKALDNGIMKYHSMKME
FT                   EINRILNELWSQTYKGSDISTIAIKSDVNLQAKGNRSYNYRVVMVKESSELDMRGRCSA
FT                   GQKVLASILIRLALAECFGANCGMIALDEPTTNLDAENAEALAAALNRIIEYRKSQSNF
FT                   QLIVITHDEKFLTHIQGDRFTDHFYRIQRDESSKSRIYSLPIGRIQEG"
FT   gene            complement(<421839..>422513)
FT                   /locus_tag="CAWG_02529"
FT   mRNA            complement(<421839..>422513)
FT                   /locus_tag="CAWG_02529"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(421839..422513)
FT                   /codon_start=1
FT                   /gene_family="HOG000093849" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX5"
FT                   /protein_id="EEQ44264.1"
FT                   /translation="MSILGDDYSPMRQCEQFSLPIINFFSWFLVWRVPTVKILLHMLKS
FT                   DENWELESKSLSFVFSRLLRSKFSEWVVLFPEVNIWTPNGAALQGQVSNKYFLPKFNHL
FT                   LYPRFSAFFNIISILNQSKPHAYLNMYDITILYTRNGHGTISNQYKPPTLLDIFASAEP
FT                   ITVIVYVKIRSVSRIPTKRKKLEKYLEHLWIHKEKVISQLKAENDTHIQSRILKDNFSV
FT                   AP"
FT   gene            <423178..>425715
FT                   /locus_tag="CAWG_02530"
FT   mRNA            <423178..>425715
FT                   /locus_tag="CAWG_02530"
FT                   /product="multiple RNA-binding domain-containing protein 1"
FT   CDS_pept        423178..425715
FT                   /codon_start=1
FT                   /gene_family="HOG000211156" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02530"
FT                   /product="multiple RNA-binding domain-containing protein 1"
FT                   /db_xref="GOA:C4YPX6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX6"
FT                   /protein_id="EEQ44265.1"
FT                   /translation="MSRLIVKGLPKYYTEEKLREFFSKQGDVTDVKLMKKRNGESRKFA
FT                   FIGYKSADAAERAVKYFNKSFIDTARIEVEFAKTFSDPTVPLSFKEKRKREEQKLKDEQ
FT                   ERLLEQELRAQAKKQKTKSTSEIDDEIASNPKLREYMEVMKPSHQVKSWANDTIADGSG
FT                   GPSVQDLENALNGNNESPVDKSNIEVVNTVEDASDDEYNDFKELSNKHGENEDEEEEEE
FT                   MMSLGDLPTNEENKDKNESGENLAANENISDLEWLKSRSTRIKENGEVLEIVPEVKEVN
FT                   EVTEVTQQSDNEPELTPEEQIAQKIEETGRLFIRNISYEASEEDFRNLFSQYGALEEVH
FT                   IAIDTRTGKSKGFLYVQFLKKEDATRAYRSLDKQIFQGRLLHILPADKKKDHRLDEFDL
FT                   KNLPLKKQRELKKKAQAAKTQFSWNSLYMNSDAVLESVASKLGVTKSQLIDPENSSSAV
FT                   KQALAEAHVIGDVRKYFEDRGVDLTSFDKKERDDKIILVKNFPFGTTIDEIGELFSAYG
FT                   QLKRMLMPPAGTIAIIEFRDAPSARAAFSKLAYKRFKSSILYLEKGPKDLFTREPTTNE
FT                   VATIPEQQQNEHAVEAKISANEILGESKKDDEIESVQGPTVAVFVKNLNFATTVQALSD
FT                   LFKPLPGFVVATVKTKPDPKNSGKTLSMGFGFVEFRTKEQANVAISTLDGHVLDGHKLQ
FT                   LKLSHKQGTGTSASSIKKSGKSSKIIIKNLPFEATRKDLLELFGAFGQLKSVRVPKKFD
FT                   QSARGFAFVEFNLMKEAETAMSQLEGVHLLGRRLVMQYAEQDAENAEVEIERMTKKVKK
FT                   QVATQNLAAARLAGKGKIELEEKDEEDFDRDFQ"
FT   gene            <425892..>426875
FT                   /locus_tag="CAWG_02531"
FT   mRNA            <425892..>426875
FT                   /locus_tag="CAWG_02531"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        425892..426875
FT                   /codon_start=1
FT                   /gene_family="HOG000000958" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AJS7"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJS7"
FT                   /protein_id="EEQ44266.1"
FT                   /translation="MFPFTKLTSNICLKNHFFSNGNLLSLSLKNMRQQKVLSFRSNIQL
FT                   LQSNFIPIRGYIRETVYQQTRNSPLRRSSTWKQYNSFYNRSNWDKLKKPLLFTIAFCVG
FT                   TTLVTPYLFTYTPLSYFKRNPQSLLWSLIGINGAVFLMWRIPRLQWFTMKYGILFKDNL
FT                   QSPWTLLGSAFSHQSFAHFFINMLAFQSFGSTLVAFLGVSNFTIMYLNSAVISSFASLA
FT                   IPMFLGSSLSVASLGASGAIFSVFGVFSFLFPASPVGLFFIPIPGGAWMLFLGTTLWNA
FT                   AGTVLRWGTFDYAAHLGGSIVGIAYGYWYNRKRKQQIRRRRHTLDF"
FT   gene            complement(<426938..>427558)
FT                   /locus_tag="CAWG_02532"
FT   mRNA            complement(<426938..>427558)
FT                   /locus_tag="CAWG_02532"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(426938..427558)
FT                   /codon_start=1
FT                   /gene_family="HOG000066132" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX8"
FT                   /protein_id="EEQ44267.1"
FT                   /translation="MAPRQSKTAKRNKTQNKTRTVDSEVFSDSAAKNLLADQPKLTPKS
FT                   KVKKISKLALKKQQAKIRLYGAKNGKEYREDQLNIPTLNKAIVPGVKAKRGKKGKKFVD
FT                   DNDTLTMNRLVKSINDKYDQVNESKLEKSRRLEEIRDLKRQEIERKEQQKKDKLEGKKD
FT                   ELRSKASVARSTRRKNAKARRADEESQEQEEESPKKKKKVSFV"
FT   gene            complement(427837..427930)
FT                   /locus_tag="CAWG_08058"
FT   tRNA            complement(427837..427930)
FT                   /locus_tag="CAWG_08058"
FT                   /product="tRNA-Glu"
FT   gene            <428462..>429733
FT                   /locus_tag="CAWG_02533"
FT   mRNA            <428462..>429733
FT                   /locus_tag="CAWG_02533"
FT                   /product="formamidase"
FT   CDS_pept        428462..429733
FT                   /codon_start=1
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02533"
FT                   /product="formamidase"
FT                   /db_xref="GOA:C4YPX9"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPX9"
FT                   /protein_id="EEQ44268.1"
FT                   /translation="MPTEPIRYVTKVDLTKPGDQQPHLHNRWHPDIPFAETIKPGETVK
FT                   IECLDWTGNQIKNDDTADDILNVDLSRIHYLSGPFNIEGAEPGDALVVEIKDVQPLERQ
FT                   PWGYCGIFHKKNGGGFLDKFYPEAAKAIFDLEGIHVTSRHIPHVKFTGLIHPGIMGTAP
FT                   SAEVLKEWNSREIGLINDIQHQHETNVANGPLETNSHPGSGTGTLASKIAKEGARTIPG
FT                   RPENGGNCDIKNLSRGSKCYLPVYVDGAKLSVGDLHFSQGDGEISFCGAIEMPGVITIK
FT                   VSIIKGGIKKLSLKSPIFIPGDVQNHYGPSRYLTFEGFSVDEAGKQQYLCATTAYRQAC
FT                   IRAIEYLRKFGYNDYQIYLLLSSAPIEGHIAGIVDVPNACTTLGIPMDIFDFDISPEGN
FT                   FEEKDMKNCAFVEGAKHSVTYDYK"
FT   gene            complement(<429783..>430949)
FT                   /locus_tag="CAWG_02534"
FT   mRNA            complement(<429783..>430949)
FT                   /locus_tag="CAWG_02534"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(429783..430949)
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02534"
FT                   /product="hypothetical protein"
FT                   /note="similar to alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /db_xref="GOA:Q5AJF3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJF3"
FT                   /protein_id="EEQ44269.1"
FT                   /translation="MPSRYTRPSEALGGGTEYVSDNKGFVQVAPKSAQKINIESSPYLP
FT                   TWDRNESYKPYEFLEFHDPALRANKDLPNLFPKGGDYTTSNISPKLGTEIKGIQLSQLN
FT                   DAAKDEVALLAAQRGVLVFRDQDFIDKGPEFVTKYVSHYGPLHIHPTSGAPKDHPDIHV
FT                   VLSGDTKEYPFEKKTNLVALHSDVSYELNPTALSFLAATNIPQSGGGDTVFVDTVEAYN
FT                   RLSPLFKEKLEGLKAVHSAVEQANFAIFKKGHVKRHPVENVHPIVRTTPLGQKVLYVNN
FT                   GFTRRIEGLKEEESSYLLNFLLDHIWKGHDFQIRAHWEPNTVVIFDNRVVGHTAILDFD
FT                   TTDSRLIIRASARGERPVSDLKDLNKPDENLVYHGAEYLGDRLENLKI"
FT   gene            <431726..>434311
FT                   /locus_tag="CAWG_02535"
FT   mRNA            <431726..>434311
FT                   /locus_tag="CAWG_02535"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        431726..434311
FT                   /codon_start=1
FT                   /gene_family="HOG000246728" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPY1"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY1"
FT                   /protein_id="EEQ44270.1"
FT                   /translation="MSRTQEETEHHSVKFNWNVFPVTRLEESQMSTPLGCVYTPFNDSN
FT                   VPPQTKGLPISCTTCQAFLNPFIKLDRKNGMWWCPFCQKRTYLPESINVPEIATSVEDW
FT                   PIEMRETSTTIDYELPHDITENTTTASPLTYYFVIDRYQHSEEESLNKLLASIVSTIKN
FT                   NIPLGSMIGIMTFNKSVQLHKISTKETVEISRDDIPNCDKYWKLFEKSVIEQLSNRLEL
FT                   TNTSSELDSNNLLRNNYIIELSENNMDSIINYILNIKPTYTEKHKPSRSTGLAHYIYSI
FT                   MFSQSRVKNFIGKVLFFTSGACTEFPGKIVDENSPIRSHKDIYDLEAPFFPEASKFYTV
FT                   LSYIANGQSIAQSVEIVKSSSSKTTQYNIDQASPVWSVSLYAGSLDQVGAYEMKPLVAN
FT                   TMGSFFLTETLGSYQIKDMITRAIGLSHHKALLEVSTSIGLKTSKLIFNGGYALPSSYH
FT                   KSSKYNHLYHIKIDDELGEFDSPHAKKAFTNRWKFNELKKDDTLSLFFKMESAKSTEDL
FT                   SNGSITEIFIQFKLKSWDVVKNKWVTRVTTIRKPTTLSYVKTSTGKKNHQSMILKEHKF
FT                   TLGFDQRVWTILLTRLLINKIDTNLGYSSFDELVDLIDSTIVKLLHYFGGISVANSHTQ
FT                   SSNPYYHLQTMYELNQKFKELPSLIYSLRKNSDLIKIFNSSPDETTYYHSWFLRMNMPL
FT                   SIKVIEPVLINVADHISRLPLDSTCFDLAPADSFLILDTGFTLTLYYKCHNQNKLDLHP
FT                   SDNDFMIENKDSKLPWNIIEQYISERQVVPKIVITQTNHSQARFLVSRLNPTTSDSTKE
FT                   NQPHLDNNKAGFWSFWTSNNRKSSKLIPEDLSLKRYYDDLIEQVQKFKI"
FT   gene            complement(<434320..>435261)
FT                   /locus_tag="CAWG_02536"
FT   mRNA            complement(<434320..>435261)
FT                   /locus_tag="CAWG_02536"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(434320..435261)
FT                   /codon_start=1
FT                   /gene_family="HOG000178252" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY2"
FT                   /protein_id="EEQ44271.1"
FT                   /translation="MSLKLVPQQRGIVHTYGFNLTAFEFTTDPSNISPNIILFVGGLGN
FT                   GLLNIPYLPELADSASNEFQSTDGGSWSLVQVLLSSAYQGWGTSSLDRDTSELQSAIEY
FT                   FRSERGGNRQKIVIMGHSTGCQDVIHYLTKTLYKENIPETSQVQGGILQAPVSDSEALS
FT                   SGRNPTKHEALVQRVYDEYISKGKESEILPQEYRKLTWGVPTSAYRFYSLASKRGDDDY
FT                   FSSYLTQEDYTKSFGKVNKPLLVLYGSIDEFVPEYVDKENLVSTWKQSTSSQYWSEHSQ
FT                   IIKGATHNLGDGSDAGVIEHLVSVVKKFISDL"
FT   gene            <436383..>437765
FT                   /locus_tag="CAWG_02537"
FT   mRNA            <436383..>437765
FT                   /locus_tag="CAWG_02537"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        436383..437765
FT                   /codon_start=1
FT                   /gene_family="HOG000246729" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPY3"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY3"
FT                   /protein_id="EEQ44272.1"
FT                   /translation="MASPISNDSFLQWDAAQVSTYINSILPHEQRRISNVFLDNNVDGS
FT                   LLPFITTEHLKEIGIISLKTRLVIKKGISDLIAAHYSKYPPKSYNDPDYKLNHVNISNN
FT                   YTTVQSLNLSTVLMQDMMKKLNYELHKQKSTFVASSPISPTHDEMKKLNDNFIKLKTDL
FT                   IPIIRLLKDSKPLPTPTLDPGPAASMDSPSYFSSHHHLEHDSFEKGLSRSGSGNAMTSN
FT                   NRTPTTIPSPASNRFSSGSLLSMGTGKIVSQSVPKYPENKANNDFTLQKVGLPRNNSNK
FT                   SLESHDRQQNASGIRPRLVQNPSSNSMHTVTSPGGIPPQSASAVATAAINGHGSGYIPQ
FT                   VSTPPNQLGHHHNPGTEPLKQLRASTDDSCLKILQQAMKRHHIPREDWSRYVLVICYGD
FT                   KERILKLAEKPVVIFKELQELGKHPAIMLRQLADSSTDDSGPESAMYNDARIGTEIPGG
FT                   TL"
FT   gene            <438093..>438590
FT                   /locus_tag="CAWG_02538"
FT   mRNA            <438093..>438590
FT                   /locus_tag="CAWG_02538"
FT                   /product="60S ribosomal protein L12"
FT   CDS_pept        438093..438590
FT                   /codon_start=1
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02538"
FT                   /product="60S ribosomal protein L12"
FT                   /db_xref="GOA:Q5AJF7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJF7"
FT                   /protein_id="EEQ44273.1"
FT                   /translation="MPPKFDPNEVKFLYLRAVGGEVGASSALAPKIGPLGLSPKKVGED
FT                   IAKATKEYKGIKVTVQLRIQNRQATASVVPSASSLVITALKEPVRDRKKEKNVKHSGNI
FT                   PLDEIFEIARKMQHKSFGKNLASVSKEILGTAQSVGCRVDGKNPHDIIDAINAGEIDVP
FT                   EN"
FT   gene            <439604..>440804
FT                   /locus_tag="CAWG_02539"
FT   mRNA            join(<439604..439619,439690..>440804)
FT                   /locus_tag="CAWG_02539"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(439604..439619,439690..440804)
FT                   /codon_start=1
FT                   /gene_family="HOG000246730" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPY5"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY5"
FT                   /protein_id="EEQ44274.1"
FT                   /translation="MSDSVDRVFVKAIATIRALSSRSNYGSLPRPPAENRIKLYGLYKQ
FT                   ATEGDVDGVMPRPVGFTAEDEGAKKKWDAWKREQGLSKTEAKKRYVSYLIETMRVYASG
FT                   TSEARELLNELEYLWEQIKDLPSSDEETDHHHIPLPSRSPTFSQTDRFSNRTPSITGAR
FT                   TTGTSNLNNIYSHSRRNTTLSLNEYVQQQRMQHQNQQQLHDTTSQPEAPVGGGGGGGGS
FT                   IYSLPGRMGANNVIEDFKNWQSEVNMVINKLTREFVNSRREVQGNENGDPSTGDRDEEL
FT                   DDVEIIKRRIIHILKFVGWNALKFLKNFAVSLITFMFIVWCIKKNVHVERTYVKQPTNN
FT                   ANKSKKELIINMVLNTDENKWFIRLLSFINRFIGFV"
FT   gene            <441194..>443425
FT                   /locus_tag="CAWG_02540"
FT   mRNA            <441194..>443425
FT                   /locus_tag="CAWG_02540"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        441194..443425
FT                   /codon_start=1
FT                   /gene_family="HOG000246731" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY6"
FT                   /protein_id="EEQ44275.1"
FT                   /translation="MDIHRCRFVDYTPHTITSLAFSHKSSLTSLPTADVRLAVGRSNGD
FT                   IEIWNPRHNWTHELTLPGSKGRSIEGLCWSYNEQDPLEPPRLFSIGGSTYITEWDLSTG
FT                   RPLINYDCNAGIIWCIDINPQNDRLTVGCDDGSVVIVDISGGRGSLEYDLICQRQDARV
FT                   LSVKWANNEHVIGGCADGRIRSWSSEGETKGRLVATMKVDKAKTESTLVWSLTVLPNKK
FT                   QFVSGDSTGSIKIWDLTRFTLLQTFKIHDADVLCLVHDVKEEKIFSAGVDRKIHQFDLL
FT                   NSKNSSKWTHSFNRLLHSNDVRSLAIFENKNYNLLVSGGVERAIVVQNIETFYDGKYKK
FT                   LLINQQKSNILIVPDSKLVILWQDQTIKIWKVLPDGKHVLMSKLTLSADENITSVDFKD
FT                   NLLVVAKMTSVRFFELTEISDNKFKIQKIRDDKFDSLVEGAKIVKFIDANKVLILTPDE
FT                   ELYTFDIDSDEGKIELNGEIELLESTQQQQQQQQRKNQHLLRINNLVLTPNKKQIIISR
FT                   FNGSIEVYPIVNTETEAYVLTKLSSYPHLIECVNDEKLVVINEENKIFEFFINDKDGQL
FT                   LTPWSKRNSEFLPRQFISLQDKPEGMFIQQKQEKLWIYGSTWLSFFDLSMNIPISKIYK
FT                   NTSTSKKRNHDGLSMNEEIGELEDETEEIIEASLKQSEIDRLRHQIQTEDKDNQNNVDK
FT                   TKKPFWITEKYRPIMKVANFGGNDDIIVVERPYSSLQTGPAFDLPKIKV"
FT   gene            complement(<443497..>444714)
FT                   /locus_tag="CAWG_02541"
FT   mRNA            complement(<443497..>444714)
FT                   /locus_tag="CAWG_02541"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(443497..444714)
FT                   /codon_start=1
FT                   /gene_family="HOG000246732" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AJG0"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJG0"
FT                   /protein_id="EEQ44276.1"
FT                   /translation="MSFPPLENPNLEGYEIARQLWIEYYNQREGTFVARKKCNGCYNEN
FT                   KFVVWAVAVAAQAIVDGARIYPELKPLVGPAIQIFQKYKNNHIKGYSAAENSGNDQDIY
FT                   YDDDAQVASAIITAYEVTGDKIFLDQGRELVRFLMSGWNDKPDAKTKGGVHWHVSKNYL
FT                   NACTTAEVAKACLQISKFLPEEAGVYIDFAAKCIDWQIQVLQDPGDKLIKDGVSDKDTK
FT                   INDVKWTYNVGTTLSAAAHLYFITKDDKWKQISQDLAKAGINRGVFFYDRDFDNSKRYW
FT                   RDSSYFVQLLIEGLADYLLYVGNDVPDELVGKIQEEIKRHLIIFYEFMKDPKDGMYIQS
FT                   FEPHNTYREVYDQKYKNFFGDGKGWGLKGEDKDENGNPSKCLMGYAAAARVFFQGARVV
FT                   PHIDSY"
FT   gene            complement(<445350..>446480)
FT                   /locus_tag="CAWG_02542"
FT   mRNA            complement(<445350..>446480)
FT                   /locus_tag="CAWG_02542"
FT                   /product="sterol 24-C-methyltransferase"
FT   CDS_pept        complement(445350..446480)
FT                   /codon_start=1
FT                   /gene_family="HOG000171097" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02542"
FT                   /product="sterol 24-C-methyltransferase"
FT                   /db_xref="GOA:C4YPY8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY8"
FT                   /protein_id="EEQ44277.1"
FT                   /translation="MSPVQLAEKNYERDEQFTKALHGESYKKTGLSALIAKSKDAASVA
FT                   AEGYFKHWDGGISKDDEEKRLNDYSQLTHHYYNLVTDFYEYGWGSSFHFSRYYKGEAFR
FT                   QATARHEHFLAHKMNLNENMKVLDVGCGVGGPGREITRFTDCEIVGLNNNDYQIERANH
FT                   YAKKYHLDHKLSYVKGDFMQMDFEPESFDAVYAIEATVHAPVLEGVYSEIYKVLKPGGV
FT                   FGVYEWVMTDKYDETNEEHRKIAYGIEVGDGIPKMYSRKVAEQALKNVGFEIEYQKDLA
FT                   DVNDEIPWYYPLSGDLKFCQTFGDYLTVFRTSRIGRFITTESVGLMEKIGLAPKGSKQV
FT                   THALEDAAVNLVEGGRQKLFTPMMLYVVRKPLEKKD"
FT   gene            complement(<447426..>449624)
FT                   /locus_tag="CAWG_02543"
FT   mRNA            complement(<447426..>449624)
FT                   /locus_tag="CAWG_02543"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(447426..449624)
FT                   /codon_start=1
FT                   /gene_family="HOG000093850" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPY9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPY9"
FT                   /protein_id="EEQ44278.1"
FT                   /translation="MASISVPIEKGSFHDGDGFNQHHLGDPVISGPPYIIKLLNLPVTA
FT                   NDSFVQDLFQSRFTPYVKFKIVTDPASNILETHVIRQVAFVELESASDMSKALKWHDLY
FT                   YKANRRVTVEVADFNDFQNCIKFNQEHEREIMQIQQEFIAQKQQQRQPRHMALLDEFER
FT                   NQRGPGSPLHQNHDHHNPHPQQQQHHHFNPNLNRPSGRSSLPIDETSHSRRLSFEAQLH
FT                   PHQQTHGQRIRQPSFDNAFPDTPHPPFGGGGGMRQQIHPTNQPAVPSSAPASKPFVTPI
FT                   SSASTSSKPKSNPFGAAKPVDTLSKQQEIEKKLINLNKTTVQTLGDVETPEEVQATIKK
FT                   FHENGSPKLRRASVGTSRRLSSEKRPSVSILRRDLPERQQPPPPPQQQQQQQQPPQQQD
FT                   QNTKQTALHQPDQLQNHSSNVSSTQPSGESPLAETQSLSTNPYTSNGTGKSLAQLLSEQ
FT                   SDIMSAPPITGKKTPRSNSNTKKPVVAAKPVILKKKTPTSPPVQRIDLTIKESEYLKKQ
FT                   DETDDLIDANVETKLEKLDLNSETLSENGTKESTKTRIDNPKRENDQHDDRPNFKNLDQ
FT                   LVQKRNDSRASSSSSNSRRFEFIRGLKEENERVPSPSSSSSSSSATKTSQNNFEKSSES
FT                   AISRTDDQQDLSSTNTGSEGRMWERGRGRGRGGFSFRSRGGFRGRGAGFRGSGRGGPRG
FT                   RGGNGASGAGGTASGSTGSANYNLHYVRSKPTPVETNE"
FT   gene            complement(<450769..>452322)
FT                   /locus_tag="CAWG_02544"
FT   mRNA            complement(<450769..>452322)
FT                   /locus_tag="CAWG_02544"
FT                   /product="vacuolar aminopeptidase I precursor"
FT   CDS_pept        complement(450769..452322)
FT                   /codon_start=1
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02544"
FT                   /product="vacuolar aminopeptidase I precursor"
FT                   /db_xref="GOA:C4YPZ0"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ0"
FT                   /protein_id="EEQ44279.1"
FT                   /translation="MSNIDDILLGISESLKQLQKASQEKPIEQTQPVQIQNLEVNSTKK
FT                   FTDDYYSKIADDYIEFTYKNPTIYHVVNFFKSQLESKGFTYLPESKSWADLKAGKYFTT
FT                   RNGSSLAAFVVGKDWQASKGVGAIGSHIDSLTTVLKPNSTKAKVDGYELLGVAPYAGTL
FT                   GSVWWDRDLGIGGRLLVKDGKGKVSQHLVDSTPHPIAHIPTLAPHFGAPANGPFNTETQ
FT                   AVPVVGFSGENDKEEEQPTEEEKNAPLYGKHPLKLLRYIAKLANVSVGDILQWDLQLYD
FT                   VQKGTKGGLNKEFVFAPRVDDRVCSFAALNALIDSTVDNNLAEDSFSIVGLFDNEEIGS
FT                   LTRQGARGGLIELVVDRVLSSNFYNPEVLDIQESLRLTYANSIVLSADVNHLFNPNFPG
FT                   VYLEHHKPLPNIGVTLSLDPNGHMATDSIGLALAEELAKKNGDKVQYFQIRNDSRSGGT
FT                   IGPAISTSTGARTIDLGIPQLSMHSIRATLGSKDIGLGIKFFYGFFKNWRDLYDNFADL
FT                   "
FT   gene            complement(<452619..>453758)
FT                   /locus_tag="CAWG_02545"
FT   mRNA            complement(<452619..>453758)
FT                   /locus_tag="CAWG_02545"
FT                   /product="deoxyhypusine synthase"
FT   CDS_pept        complement(452619..453758)
FT                   /codon_start=1
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02545"
FT                   /product="deoxyhypusine synthase"
FT                   /db_xref="GOA:C4YPZ1"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ1"
FT                   /protein_id="EEQ44280.1"
FT                   /translation="MSGLGKLPGLASDAVLKQSIPVPEDFQEVKGIDYSQDNAYNMRAK
FT                   DLIKSMSTMGFQASSLSQACDIIDNMRSWRGKHKDTLEEHEQTGEFDDEGYQKTTIFMG
FT                   YTSNLISSGLRDTLRYLVQHKMVSAIVASAGGVEEDLIKVLAPTYMGDFTLPGKGLRDQ
FT                   GMNRIGNLLVPNDNYCKFEEWIVPILDKCLEEQEEAMKKLGPKGLIADSEAIWTPSKLI
FT                   DRLGKEINDESSVLYWAHKNKIPIFCPALTDGSIGDMLFFHTFKASPQQLRLDIVADIR
FT                   KINSMSMAASKAGMIILGGGLIKHHICNACLMRNGADYAVYINTGQEFDGSDAGARPDE
FT                   AISWGKIKAEAKSVKVYADVSLVFPLIVAATFASEKPQN"
FT   gene            complement(<454207..>454629)
FT                   /locus_tag="CAWG_02546"
FT   mRNA            complement(<454207..>454629)
FT                   /locus_tag="CAWG_02546"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(454207..454629)
FT                   /codon_start=1
FT                   /gene_family="HOG000140337" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AJG7"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJG7"
FT                   /protein_id="EEQ44281.1"
FT                   /translation="MSTSIFRTLKNIYSSGLKRAAWQIHHHNDTKRGWLVGIDDFGNKY
FT                   YETDAPEEIHLRTRWVEYSQWNQDMSQVEPGWHYWLGYGTNTPPNALIGDAKTTRAYPL
FT                   PAHHKPNLTNTPGAYVCYNTAKPKFKSWTPEVKERA"
FT   gene            complement(<455135..>457084)
FT                   /locus_tag="CAWG_02547"
FT   mRNA            complement(<455135..>457084)
FT                   /locus_tag="CAWG_02547"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(455135..457084)
FT                   /codon_start=1
FT                   /gene_family="HOG000246735" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007244"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ3"
FT                   /protein_id="EEQ44282.1"
FT                   /translation="MKDNLNYQFVHRVLKTFTMGLCKFIGFTIYLSRTVLYEEEDLNTK
FT                   SMNLNFFEDISPVYFIEEINDCIEWILSNDEIIEADTLITQLKIVANLVKFENTFKTTQ
FT                   HTSFMDGKNDIATSDSKFDFCLDAINQIIKLQNVKFDDTVIPMGSFSKFIQVDLVNKSI
FT                   PEKLTSIDLETTWDCLTNIFKTIHRFTNQANSIKSINQLYDFLHYNIKFPIEKFSVFAR
FT                   GFFQLYFIRDNKSIFGSNNVNLPNLVIDWIENVIGKSTIMLGKFENNLSQIKDNVKAEI
FT                   IKVHNANLNDLESGMYHYLTTFASNPCRSQQLLSKGLVLWDTLQVGWESFEYEMHKTYG
FT                   VGDEFATGELSISVTSYVYFGKMQLMLELLLNGLSLDLYKPFEMYLIYWYADYLILNII
FT                   EHLENRVSQILLGKINHLETNIPKKIKKLKAGPKKDQLKEINLYNQQVIIPQLTATLNF
FT                   NQDYLIKSLKAMRNLTQCQLKYLSVLSKLQIIDYTKGPINNLTSMENLYYLRMKPWSSI
FT                   GVPMFPTFEQYQSVLTTNTAPGSNNKLTLMKCLELLASAKNNLVVVEKEYHQLIDYIKR
FT                   DTKNNFLQDSLIITWYEELISAIEQLNDNISQISKIISLNKDDLKLKKKYKINITQGCH
FT                   KYFPNISIIPCISK"
FT   gene            <459243..>460748
FT                   /locus_tag="CAWG_02548"
FT   mRNA            <459243..>460748
FT                   /locus_tag="CAWG_02548"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        459243..460748
FT                   /codon_start=1
FT                   /gene_family="HOG000246734" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPZ4"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR013910"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ4"
FT                   /protein_id="EEQ44283.1"
FT                   /translation="MTDIKRNFSDIASPANLDDTKKLHVDSTATTKVGRKPIDTEPKSK
FT                   RTAQNRAAQRAYRERKERKMKELEDKVRLLEDANVRALTETDFLRAQVDVLKNELAKYT
FT                   GGSDFSDLNLPTKVGHLSHPNNHHSNVSTGTPHGSMSSSNSVASLDNDKPSSASSVSNN
FT                   SPGFAFDNPWSKDNIQKLKHQHQQQQQQQKVPQGVPDLVSGSSSSSTPLNDNLLVTPES
FT                   LTGLSTSSKYTGQNNVPTNLDFTNQFDEQVDPFCVKLNEACGTKSNPVPKFKRSGSKAN
FT                   TSVTNNSPLAHLVSPESQQYTNSSNIDFMNDPFFNGVGTDYNFNFDSKNGSIQDPLSFL
FT                   QDDNFDLALAFGDPSPTGNEAEADPISLLTTEESIYDPLTNNSDKLCSTVKTDDVNTDF
FT                   NFNDFVKNSLPEKQEKGKYEPPSTSKTTNNNEEEDKDEVVPAPPQTLKCSEIWDRITSH
FT                   PKYTELDIDGLCNELKSKAKCSEKGVVINTADVNQLLERSIKH"
FT   gene            complement(<460984..>464757)
FT                   /locus_tag="CAWG_02549"
FT   mRNA            complement(<460984..>464757)
FT                   /locus_tag="CAWG_02549"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(460984..464757)
FT                   /codon_start=1
FT                   /gene_family="HOG000246733" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPZ5"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ5"
FT                   /protein_id="EEQ44284.1"
FT                   /translation="MDIPPKPTLKAIKKFRTLDEIKYAMKHVFQDAQLGLAGHRKLVVI
FT                   LKNVFKKAIELNQINFFAMCFTKLLSKVLPLKRGVLAGDRIVKFCYSFVNGLVKDANEE
FT                   KRSKEEEKEEKDKDEDKDTNESDKNEEDQEDQEGEGDQETPISEFISYLIKYLLSGIEA
FT                   KDKSVRYRVVQTLAYLVEFLTEIHENNTLEALYTLLSNRLQDKESSIRIQAVVALSHFQ
FT                   LFEFSIEGDTGEFEDEFISSNQIQNKLINSIQNDDSPEVRRAALMNLVKTQDTIPILLE
FT                   RARDSNSINRRLVYSKIARELITDLDDLEFEDREFLLKWGLNDRDETVKAAATKMLTIY
FT                   WYQSVNEDLLELIDQLNVKSAIAEQAILAFFKNKPEVLETIKIDESYWKNLTTEKAFLM
FT                   RTFYQYCNENQLHALMDANFPELLDLSITLEKYLSVRLKTINENENLVKTWETYNAKID
FT                   ELDDQIFSLENQISRINTDADNFRKSLSNIEEDIIEINIAKDLFKKRIKQLKNNSGNLE
FT                   DLITEENQEIADQIKDFSMEDLQQQLEDINKNLDEIEHQPEDITVKLEELQTKYDSCIK
FT                   ALETTSELKIQTVQIFEQEQENDCIPFVDALKELEFIINQLLLIVKDFDYGDEMARRKL
FT                   LHIIRMTLTEDKLPDALISVALRVLRALSINEKDFVSMAVEIITDIRDSRDDEEFHSAA
FT                   ATFDDDDDILGNGDDESQQSSSLSAVTKKRRIEPDMPPDDIVLRCLTMTQYVLEVITHS
FT                   LDDHLSLSSIYSGIVNYAIQNESKKKLYLAGLTCLGLYSLIDSKIARIATTTLLSAMRS
FT                   NGEEVKEIGMKAIVDILAIYGMSILDKSSKYKYSRMFFKVLNSFDAPKLQCIVAEGLCK
FT                   LFLADILYKTDKRSLFGNAIQGGGGGGGGNDDPTTTNDDETEEETDREHEKHLFEAIVL
FT                   IYFNPNTKSNQELQQILSFCIPVYAFSRINHQINLAAVSGDVIYRLFTETETELSPSVI
FT                   IPQLISWCDPRNLVKLSNEEINQATSHLWQCVYLLQVVEQVDARNVKRCIINNLNKFHI
FT                   TEELESNQLQALIKALDATVELFTNNEDNPNFILDKPTKKNFDTFIESIKNKLEIAQKR
FT                   EENESIKSGTNSILHELDDLDIGTGESSQISIKSETKRRDSDRSSQVSKTTSPETSENE
FT                   DEEDDNEEEEQEKKKSFTDGKNKLELKADKPITFKAEDKREGSVETDHGQEQVLVESKK
FT                   VIDSNVEDSLEDIDKFLEEADDVDYGDISMDD"
FT   gene            complement(<465198..>466706)
FT                   /locus_tag="CAWG_02550"
FT   mRNA            complement(<465198..>466706)
FT                   /locus_tag="CAWG_02550"
FT                   /product="guanine nucleotide-binding protein alpha-2
FT                   subunit"
FT   CDS_pept        complement(465198..466706)
FT                   /codon_start=1
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02550"
FT                   /product="guanine nucleotide-binding protein alpha-2
FT                   subunit"
FT                   /db_xref="GOA:C4YPZ6"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ6"
FT                   /protein_id="EEQ44285.1"
FT                   /translation="MGSCASKSADQGNGTSKQQQSAQSTQGKRQQQSQAIQQKNKEKQQ
FT                   SRQKEQQEKHQQQQQQPQPQSPSDSNADGTLKNGSDFYETLKHPSDSSNDNGHLKENHS
FT                   QDLSNGTANKNLITNPVDAAGNSNPSKDVKVLLLGSGESGKSTIVKQMKILHSDGYTQD
FT                   ELEEYRPFVYKNILDCIKNVINAIIDLQPDLIRKPDSPQLEEDHEEDLKVTGLTSENNH
FT                   VPTANGSVTNQPPPPPKQRKHILEYDMLNEILDYDYPLNLNQQFDPDIAIKIKKVYETP
FT                   EVKEFMLQRQGDFYLIDSTDYFLSNLDRICLAGNYEPNVTDVLRTRKKTSGIFIYSFDL
FT                   GNGLNMNLFDVGGQRSERKKWINCFDNVSTIIFCVALSEYDNFLLEESNTNRLEESLAL
FT                   FDSVVNSRWFSRTTVVLFLNKIDVFAEKLKYSPLENFFPDYKGGSNISNGVKYILWRFN
FT                   KLNRSGLNIYPHVTQATDTSNIELVMAAVKQTILENSLKDSGIL"
FT   gene            complement(<468724..>469212)
FT                   /locus_tag="CAWG_02551"
FT   mRNA            complement(<468724..>469212)
FT                   /locus_tag="CAWG_02551"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(468724..469212)
FT                   /codon_start=1
FT                   /gene_family="HOG000093851" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ7"
FT                   /protein_id="EEQ44286.1"
FT                   /translation="MKTLRPISIFIVLHIIFSLSSWVIVSIPYRVLKMYIRLFLFMIYV
FT                   FTIGVLSNNSPNSPPSFMKPLDQKLLFPYTTIFSKAINNRSIIECMKLSESTSFKIKNC
FT                   TIKGESQYTSNGTGSSSIKDKSCLCYYIKLIQQECEELNSDQSWQLQLLQYPECFSTG"
FT   gene            complement(<469401..>471158)
FT                   /locus_tag="CAWG_02552"
FT   mRNA            complement(<469401..>471158)
FT                   /locus_tag="CAWG_02552"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(469401..471158)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YPZ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ8"
FT                   /protein_id="EEQ44287.1"
FT                   /translation="MSDRYRPRGPRNQQRGGYQSRSSYIPQRRDNRNRDSYIPSGPKRS
FT                   AERDNYRPDNDRYQQQENRPASSIPHGESPSSLSGATASHPPPKGPRDSYASGMKRPLP
FT                   SGPASFRKRRDFNSNSNRIPIPKGPRQGLNEMDGGNGNGNGNVDNYRRARQPEKQKLSL
FT                   EQIYCIKTTNRPNIYQRVSQVGEGTYGKVYKAQHKLTGEYVAMKKLRLESEKEGFPITA
FT                   IREIKLLQSFDHANVVGLLEMMVEYNQIYMVFDYLDHDLTGLLTHPDLQLQECHRKFIF
FT                   KQLMEGLNYLHKKRIIHRDIKGSNILLDNIGRLKIADFGLARTMKIVGANEKPDYTNRV
FT                   ITIWYRPPELLLGATDYGREVDVWGVGCLLIELYCKMAAFRGMDEVSQLCRIFNIMGTP
FT                   TLQNWPEIDQLPWFEMLKPKINVKSKFAQKYSESMSAPAFKLAEQLLQLNPKLRPTAEE
FT                   ALNHEYFQQDPQPKPLYFLKDIQGEWHEFETKKRRRAERKRIKEEDAQLAASKKAAAAP
FT                   AVASAPAEASAVNSIKEEVDSVDAITYSEKLVNGDDNNIKSSEIDSKIVDSVEEHNKME
FT                   ENSLDTKTA"
FT   gene            complement(<473688..>475829)
FT                   /locus_tag="CAWG_02553"
FT   mRNA            complement(<473688..>475829)
FT                   /locus_tag="CAWG_02553"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT   CDS_pept        complement(473688..475829)
FT                   /codon_start=1
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02553"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="GOA:C4YPZ9"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:C4YPZ9"
FT                   /protein_id="EEQ44288.1"
FT                   /translation="MCGIFGYVNFLVDKSRGEIIDNLIEGLQRLEYRGYDSAGIAVDGK
FT                   LTKDPSNGDEEYMDSIIVKTTGKVKVLKQKIIDDQIDRSAIFDNHVGIAHTRWATHGQP
FT                   KTENCHPHKSDPKGEFIVVHNGIITNYAALRKYLLSKGHVFESETDTECIAKLFKHFYD
FT                   LNVKAGVFPDLNELTKQVLHELEGSYGLLVKSYHYPGEVCGTRKGSPLLVGVKTDKKLK
FT                   VDFVDVEFEAQQQHRPQQPQINHNGATSAAELGFIPVAPGEQNLRTSQSRAFLSEDDLP
FT                   MPVEFFLSSDPASVVQHTKKVLFLEDDDIAHIYDGELRIHRASTKSAGESTVRPIQTLE
FT                   MELNEIMKGPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRI
FT                   IMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETAD
FT                   SILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVM
FT                   FALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGR
FT                   GYQFATALEGALKIKEISYMHSEGVLAGELKHGILALVDEDLPIIAFATRDSLFPKVMS
FT                   AIEQVTARDGRPIVICNEGDAIISNDKVHTTLEVPETVDCLQGLLNVIPLQLISYWLAV
FT                   NRGIDVDFPRNLAKSVTVE"
FT   gene            <477698..>478870
FT                   /locus_tag="CAWG_02554"
FT   mRNA            <477698..>478870
FT                   /locus_tag="CAWG_02554"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        477698..478870
FT                   /codon_start=1
FT                   /gene_family="HOG000197559" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ00"
FT                   /protein_id="EEQ44289.1"
FT                   /translation="MLRVNTLSRCLKEVRFMRPLPFYRFNSSSTITTTTTSSPPSVSVT
FT                   NIKRATKNIPKKKIGAQKLRRTDDSKFQHESASYILSLLNANRQETPSPKELEKYLSIV
FT                   TSVTVGDSIDFDKLLTQIKGYEYQIVIPEEVINISTSTTNLMILSNGTLVGWNLTEEEI
FT                   VQFLPILEDDCIENKFDAFESEEIDWIELKQQLPQDPLNQGTSYLHGEIMVIQGPTMEK
FT                   RLLDMAAFAVGLSRSTRLSILETQLEDYLHLTKKNSEILANGKQITTTEHEFLKITGQL
FT                   FLLRGKLNLYSELIDTPDLYWSEPTLEKIYYSISKILDINSRISILNRKLDYATEEQRA
FT                   FLSVLNEKKGTRLEWIIIWLILIEVCFEIFHFYEKYEEKQNKRLNVKEDR"
FT   gene            <479804..>483304
FT                   /locus_tag="CAWG_02555"
FT   mRNA            <479804..>483304
FT                   /locus_tag="CAWG_02555"
FT                   /product="predicted protein"
FT   CDS_pept        479804..483304
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02555"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ01"
FT                   /protein_id="EEQ44290.1"
FT                   /translation="MFAKYLLLVLWIITLVQGDDDQYCDDTGCYPIICDSDGCYVDKFV
FT                   TETQTKTFTPIETNSVVVTVEQYSTFTTCLNCNSSNEIIVTLVTTETQTETIPTAISTT
FT                   DVTQIETKQTTLTSCGSICIKVKIDDVSYNSGQNSDMPPTISSSTSFSSKSLSFKTRTT
FT                   TQKSTSTLPADTITITRTTDSGETVINFTDINSLTTITGSYTFVQTTKTKTVTNIQEIY
FT                   SKVGGSTVTIIYTSTDVVTETVVTCPDHDFATTLTGSATFVPPTTAPKPVETPTPQPST
FT                   TSDIPSITEDTTTSEEATSTTESSTLPSSSTRSIDFQSSVPSTTTSVLDTSITLETSSS
FT                   SIELSTSTQESSSIGTSSSSFIGSCTNSSISSEELSSTAELSSSFTSISSSEKLSSSFT
FT                   QSTTSSNAELSSSFAKSFTTESLLSSIEATSSVKDISSNSVSTSSILSETTTNESSSYT
FT                   DKPSSSEEITNTYEPSSSTESSTTDQFSSLLSSSLPVTTTSSSTISSATPITTVLSISI
FT                   ASQDTNCEATITNIFTNTLIETITVNGNTTIYTETQLSTYLTSNTNINCPKTNSATTTT
FT                   TQAIPTATTEQIHTTTLNGSIIVSTETATLKTTVIITHCPECTISSSTNESSSSLEAES
FT                   SQQVTSIGSSSVELSVSSTLSLVESTASSDCSESTTFTSIVSTTTESIYTITSNESTFE
FT                   MTTTVTNIDPIVITTCPTITPVSSSYSSSESSSSSVSTSLLTESDSTISQSTVSTDKSS
FT                   LTNDNQISTVSTETPLTSITIIETTSKTTESLYTTTSNDSTHIFTTTIIDVQTNTIVTC
FT                   PTTTSTLTSSHTSDNEKPASLSSSSLIESDHIADSTTTSTTFQSTSTTTVDHHCSSCSE
FT                   ILLSSSSSIIGNKSTLTSISSIETSASSSYHSSEPEVMSSSSSTSIKQSSDSIPSTSQT
FT                   HVSTTSSSVSSLETTTTTTENSSTSNGFSSSSIVTSVNVPDYVSSSVSSTSSTTSSPST
FT                   ESSSNGLVSTVTESSTASENTSEITTIDNTSITSEKVTGTNSNPKTSEIIKDATTTTSG
FT                   NVESLHSTTPISSTSIISTNAISSSDTTTLTITNTLTYSIDSITTMKTSSITTAPAPPP
FT                   QKESSLVLSSSLVINNSTPTIIPTMNIPITFEGNANSLGLKNGDNSWIIGIMMIGLLMI
FT                   "
FT   gene            <485161..>486768
FT                   /locus_tag="CAWG_02556"
FT   mRNA            <485161..>486768
FT                   /locus_tag="CAWG_02556"
FT                   /product="ammonium transporter MEP3"
FT   CDS_pept        485161..486768
FT                   /codon_start=1
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02556"
FT                   /product="ammonium transporter MEP3"
FT                   /db_xref="GOA:C4YQ02"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ02"
FT                   /protein_id="EEQ44291.1"
FT                   /translation="MSAEEVIQYISRRKLFTENNEYNESYLLLFTIASSMIWIMIPGLA
FT                   FLYSGLARRKSALSMIWIVIMSSFVGIFQWYFWGYSLAFSDTSKNSFIGDLHFFGFKNL
FT                   LGASDDKTTYPDIAYSLFQLQFLLVTLAIIAGGCIAERGRFLPALVFMFCWATVVYCPV
FT                   VYWIWGGGWASSYRSGALDYAGGGPVEILSGMSAFVYSAFLGRRNETLMINYRPHNIST
FT                   IFLGTSLLYVGWLFFNGFSCGNPSLKVAYSMMNTHLCGAFGAISWCLLDFRLENKWSMV
FT                   AVCSGCISGLVAATPSSGMIPLWASVILGITAGIVCNLSTKIKYLLHVDDSLDVWAEHG
FT                   MAGVVGLIFNALFGSATVIGYDGVTDHQGGWIDHNWKQLYIQIVYILATMAYSGVVTAI
FT                   LCFVINKIPGLHLRIDYNGEEAGVDEDQIGEFAYDYVEVRRDFLDWGIPTVNPTYQNSI
FT                   NDQQQQQQPEVPEITSQQKRVGGGLSGIEEAEEKQVQGIPIKRQTQIIDGTTTQSNSDT
FT                   TSNTSIQEKHDPVEYRPS"
FT   gene            <487557..>489608
FT                   /locus_tag="CAWG_02557"
FT   mRNA            <487557..>489608
FT                   /locus_tag="CAWG_02557"
FT                   /product="acetolactate synthase, mitochondrial precursor"
FT   CDS_pept        487557..489608
FT                   /codon_start=1
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02557"
FT                   /product="acetolactate synthase, mitochondrial precursor"
FT                   /db_xref="GOA:Q5AJI0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AJI0"
FT                   /protein_id="EEQ44292.1"
FT                   /translation="MISRNLRTSSTKTFYGSILRSQIRSISKNNSQQAAAQSTSRPQPS
FT                   PAFNTADTSTQPIINDPTLNKHKSSAISRKKKEQLMDDSFIGLTGGEIFHEMMLRHKVD
FT                   TVFGYAGGAILPVFDAIYNSDKFKFVLPRHEQGAGHMAEGYARASGKPGVVLVTSGPGA
FT                   TNVITPMADALMDGVPLVVFSGQVPTTAIGTDAFQEADIVGISRSCTKWNVMVKNVAEL
FT                   PRRINEAFEIATTGRPGPVLVDLPKDVTASILRESIPINTTLPSNALSQITKKAVSEFT
FT                   SEAIKRAANILNKAKKPIIYAGAGILNNEQGPKLLKELADKANIPVTTTLQGLGAFDQR
FT                   DPKSLDMLGMHGSAAANTAIQNADCIIALGARFDDRVTGNISKFAPEAKLAASEGRGGI
FT                   LHFEISPKNINKVVEATEAIEGDVTANLQSFIPLVDSIENRPEWFNKINEWKKKYPYSY
FT                   QLETPGSLIKPQTLIKEISDQAQTYNKEVIVTTGVGQHQMWAAQHFTWTQPRTMITSGG
FT                   LGTMGYGLPAAIGAQVAKPDAIVIDIDGDASFNMTLTELSSAVQAGAPIKVCVLNNEEQ
FT                   GMVTQWQSLFYEHRYSHTHQSNPDFMKLAESMNVKGIRITNQQELKSGVKEFLDATEPV
FT                   LLEVIVEKKVPVLPMVPAGKALDDFILWDAEVEKQQNDLRKERTGGKY"
FT   gene            complement(<490133..>491095)
FT                   /locus_tag="CAWG_02558"
FT   mRNA            complement(<490133..>491095)
FT                   /locus_tag="CAWG_02558"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(490133..491095)
FT                   /codon_start=1
FT                   /gene_family="HOG000093852" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ04"
FT                   /protein_id="EEQ44293.1"
FT                   /translation="MQSNSSSPSPLSSFNSKKRFSLGSLRRHKQQSTTRTTTTTTTTTT
FT                   TTQQDQTQSSLLTRNNSINNKSTKIITNDTDSSTIKPEKNNSGHNSHRLSKLFIRNNNN
FT                   NNDEEEEGFLDDSSTIITPTIKYFNNTISPSSNSNSNSSFFFNNNKAPTSNSSDGSSNR
FT                   KFRTSSLSNKSPLSKTFKRAYTKIFKKSQIIDTTTNNNNNEKPRLVIRKTMLHNILPSD
FT                   SDEDEDNEEEEEEKAEEGINKVSPNHNDNNNNKDNKKEDEGIENQICIHKSLIFRDVLP
FT                   TNKSNHTANITKENQYSEHITISPIIILDYMNDLNLKYQ"
FT   gene            <491786..>492943
FT                   /locus_tag="CAWG_02559"
FT   mRNA            <491786..>492943
FT                   /locus_tag="CAWG_02559"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        491786..492943
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ05"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ05"
FT                   /protein_id="EEQ44294.1"
FT                   /translation="MKNQRLNHQEIINSCFKPPQEAIDDLQKHKESFPLGFITSDCSTL
FT                   LDKYGTLKVYQAIDTSLNETGKNHAEILSHYPEYIENDSFEYFSSQITISNKETGYTCE
FT                   ELLKLRDELIYIYRSQYFQFVNKLMVFDPFIEELAYDNNSLEMMTLTNLINNLDLNFNG
FT                   TVEHIKVDQFKNRQLLSFQLPMYIRSQARSLFETNFLNKKDKIVKEYDPVISYTQPPGK
FT                   KGQSEIKDYVCYFIVDLYSGQVPKRRIITTTTTTTTTKRKSTKTKANSGKQKNILDKCT
FT                   SKVVSRCRFCAYCRAMTHTKYQCPFIKPCTKCGIKGHKTSSCKNDTLTAKEDTKNLEKK
FT                   QYFPPLPNKEVQRYTEKESIKSKTLKEPKREVNILLLKKNQVIST"
FT   gene            <493245..>495239
FT                   /locus_tag="CAWG_02560"
FT   mRNA            <493245..>495239
FT                   /locus_tag="CAWG_02560"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        493245..495239
FT                   /codon_start=1
FT                   /gene_family="HOG000248807" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007851"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ06"
FT                   /protein_id="EEQ44295.1"
FT                   /translation="MARKKSAAKKAREAAAAAAAAAAAATATTTNSTENAKDIKFEKPS
FT                   LQKLPQNKKTLSPSKESDLDSDESLSSSSSSSEEEDEYGDLITEDVETGINQVLQTIKT
FT                   DPSKLLDPNVKFFEDPESIEYNETIKKHKPLYITDYNRMQLLEKAKGEKHQEDEEGENG
FT                   SVPFDDQKTIDGQKSFVTVQKEEKDQLLAEIKKAFDEDVEDDSDSDSDEKEQAENNDDD
FT                   DFFRKKEGKRSKNEEDKEEIAVGGSGSNLPDPNQDQQGFLNAFLDSKAWIPKKGDKIIN
FT                   LDKIDQTDEEEFDDAVEKFENAYNFRYEDPNGGAEIISYARNQATLRRSKTNSRKRQRE
FT                   KRQELKRQENEIVQDLLKKKKTATVNKVMDRLSKIKQAIGGDNINVDDKTIERVFGDSL
FT                   LNDDFDDADWDNKMAEIFNEQYYEAELEKPTWDDDDDEIMGGDINSDEEDEEEQEEEEE
FT                   EKEEDNASEEPPHKKSRKDLLKAKKSAKKEKQSLKEKAQAIVEANTLKLMDEIEEERGR
FT                   QRENEHGKEIKFKYREVSPETFGLTTRDIILADDKQLNNFISIKKFAPYRPKELRLKDK
FT                   RKYTKKKHLQEWKKETFKNLKLPKEIEQNGNDDNSNEIWIPNEDGFDTNYSNKGKNDKK
FT                   KHNKSKSKTKTKKHDDKLENKNDLKISSK"
FT   gene            complement(<495389..>497149)
FT                   /locus_tag="CAWG_02561"
FT   mRNA            complement(<495389..>497149)
FT                   /locus_tag="CAWG_02561"
FT                   /product="arylsulfatase"
FT   CDS_pept        complement(495389..497149)
FT                   /codon_start=1
FT                   /gene_family="HOG000135353" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02561"
FT                   /product="arylsulfatase"
FT                   /db_xref="GOA:C4YQ07"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ07"
FT                   /protein_id="EEQ44296.1"
FT                   /translation="MTVTSSSSKQPNFLIIVADDLGFTDLSPFGGEINTPNLNKLATGA
FT                   NGVRLTDFHTASACSPTRSMLLSGTDNHIAGLGQMAEFAQRHPEKFNNQPGYEGYLNDK
FT                   VVALPEILQDNGYHTFISGKWHLGLKKPYWPNKRGFNKSFTLLPGAGNHYKYITRDSQG
FT                   NQIPFLPAIYVEDDKELLQPEIELPDDFYSTNYFTDKAIEFIKETPQGKPFFGMITYTA
FT                   PHWPYQAPQDKIAKYNGVYDNGPEELRQKRLQSAKNLGLIDTNIIPHPIKTIRKSWDEL
FT                   TSLEKLKEIKIMQTYAAMVEILDENIGRLIDHLNSIDELNNTFILFMSDNGAEGMLMEA
FT                   LPLTNQKINKFIDEYYDNSLSNIGNKNSFTYYGDQWAQAATAPHAMYKMWSTEGAIVCP
FT                   LIIHYPNLFSSSAVSGGGSGDGDGDGGKILKEFTTVMDILPTILELANVSHPGETYKGR
FT                   QVVKPRGKSWVNYLINKTDQVHDENTVTGWELFGQQAIRKGSFKAIYIPKPFGPEKWQL
FT                   FNIIKDPGEINDLSESSSEYQTILNELLDHWAVYAAETGLIELGSDLFEKEKIEGESNE
FT                   VVYRTILDNN"
FT   gene            complement(<498087..>500873)
FT                   /locus_tag="CAWG_02562"
FT   mRNA            complement(<498087..>500873)
FT                   /locus_tag="CAWG_02562"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(498087..500873)
FT                   /codon_start=1
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ08"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ08"
FT                   /protein_id="EEQ44297.1"
FT                   /translation="MSDSESYYQNSTTNQPIPRSDEVLDDHRNQITNDCAISDSEDELE
FT                   LKSELESEVVKSEKQQQHHQEITSDNAKPLTRKSGSSIKKKSNLTDKDRITNPMSLSGG
FT                   DDTINSGHKNRNYNMSSLRKDFYLKDNTDDNSTNNHTHLAIPIPIPIPTPIITNANKSR
FT                   RKSQLENLPPLIKKKTIGRNNSNNFENDLVSPMTKMKTNDSEDITNTSTTANHMKLGIG
FT                   ATTLGVGTGTTATATATAAAGRRPSRSSIDSEADSHASRSSQETEEDVCFPMVGDHIRV
FT                   NGIDFDEIDEFIREEREEAYLQKQMIAKNISRIDEFQNLSKNNTTSGASRHPYHHHSNN
FT                   NKKNNGGDGGGSSMAALKYTPKNILKKTLSRFEFTHENSSSSEEIYELKTKQQPPYKYD
FT                   DQLSLTSSTSSTSGSGSGQVKFGGARISDGINGGSLPDRFSLFHSESEETIHAPDIPSL
FT                   VSPGQSVRDLFRNGEETWWLDCTCPTDSEMKMLAKAFGIHPLTAEDIRMQETREKVELF
FT                   KSYYFVCFHTFEADKESEDYLEPINVYIVVFHDGILTFHFSPISHPANVRRRVRQLRDY
FT                   VDVSADWLCYALIDEITDGFAPVIHGIEYEADAIEDAVFTARDTDFSSMLQRIGESRRK
FT                   VMTLMRLLSGKADVIKMFAKRCQEEANSSSGYYQRQYNLQQQQQQAPPPPPPNPIITSP
FT                   INSTLNLNSLGTSTGGGVGVGGINFGPNPTGNNTNTNTNTTGSPSPPQQQQQQQQQQHG
FT                   ITNKSFPIPDARPRADIALYLGDIQDHIITMFQNLLAYEKIFSRSHSNYLAQLQVESFN
FT                   SNNKITEMFSKITLIGTMLVPLNLVTGLFGMNVRVPGEGGTNLGWFFGIVGVLIFIIIG
FT                   SFIFAQWWLKKLNNSIEGQNNGNRPIFNHSSRRSIRSLGLKKHGGNKSIISFPNKYE"
FT   gene            <504116..>505729
FT                   /locus_tag="CAWG_02563"
FT   mRNA            <504116..>505729
FT                   /locus_tag="CAWG_02563"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        504116..505729
FT                   /codon_start=1
FT                   /gene_family="HOG000093853" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ09"
FT                   /protein_id="EEQ44298.1"
FT                   /translation="MATYAKRRNGNGGGNTFKRARLSTSNSNNNNNNNNNSSTSTSTLL
FT                   SPISKRSITKSINNKINNNKNGQGQLYDDFLEIYNFQTDTKSNEDKSTNSQLDLFEMPD
FT                   IDGDKSISRPKKISDDSITGACKKKVTYNRSNKSKSKSKSKSNSNSNSNSKPKPKPRPK
FT                   PKPKPVSKNISKINQTSNINPWNELLDNIEESTVYLPKISLIDDENESDENDQVQIGVN
FT                   EAQEGGETITTTSIINLPILLNFDNEREDDEEDEEEEEENLQQQLIQPRSLSTSPSNSN
FT                   SNSNSSKPNKTYAQDRSYLILDQSYIDVKQELGESISRKHDFDNNNNDNTEEEGEEKEK
FT                   EDINNNKLLSSSSSSSSGGGRVINVHDFKIKSEFKINPILQDIIDGLLSNSFNLQLSSL
FT                   LEIISKKKKLSISTDTTDMTDTTDMTEGIIDIIIQYVLPLIDSNNKLINWLSSKIIFDI
FT                   WKSQKSTTIKLREVEVEVKVKEKEEKRISFRDTFVNSIQNRLNDIEKNLNLEEKNIDEL
FT                   KIIINQIPKIYRSMINELLE"
FT   gene            complement(<506396..>506575)
FT                   /locus_tag="CAWG_02564"
FT   mRNA            complement(<506396..>506575)
FT                   /locus_tag="CAWG_02564"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(506396..506575)
FT                   /codon_start=1
FT                   /gene_family="HOG000248810" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ10"
FT                   /protein_id="EEQ44299.1"
FT                   /translation="MNPQRIIELQKHYQNTPKPLWLRGRQSAFLVYPFYALFAVSTAIP
FT                   LYYSVRAVAGIKDE"
FT   gene            complement(<507070..>508248)
FT                   /locus_tag="CAWG_02565"
FT   mRNA            complement(<507070..>508248)
FT                   /locus_tag="CAWG_02565"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(507070..508248)
FT                   /codon_start=1
FT                   /gene_family="HOG000093854" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ11"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ11"
FT                   /protein_id="EEQ44300.1"
FT                   /translation="MIIPMTIECGHSFCYDCIYQWFSNKINCPTCRHDIENKPILNIHL
FT                   KEICHKIIESIIENTSNGDGDGDSGGVDHLMNRKLECLKTYNLDVKNKSIFGDLFNNTV
FT                   TTLIDCSDGVARCGNCHWEVHGSICSHCGTRFRRSTRNINGESEEDEDEEEDDDEDAFE
FT                   DVVAGFRQSVEINEYDSDDSFIDSRTANEIPVGTDSDSEISIHINTNNNNNNNNNGNVY
FT                   DNESNENNNTDDDDEEEEEYGNNHLGHTESFGNNSAIHDDWHGFESATSSVIDRAFSDD
FT                   DEEEVVDEEEEDVSIQRSMNSPYNNDSIELSSSEHENIIQLSGDDEDDSYYDSEDIRDA
FT                   MEEMDNFNIDNTDYSNEEDDDVVELSDYNSYSDNMISDVDNDNDDDDDECWW"
FT   gene            complement(<509152..>511779)
FT                   /locus_tag="CAWG_02566"
FT   mRNA            complement(<509152..>511779)
FT                   /locus_tag="CAWG_02566"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(509152..511779)
FT                   /codon_start=1
FT                   /gene_family="HOG000093856" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ12"
FT                   /protein_id="EEQ44301.1"
FT                   /translation="MSNISSIFGKQVTKNTEQLFYTRIRHINCNNNIKDHLSRLSSLQI
FT                   KSCHYFSTDNSRIQQVYSPTCFDWISRTDQDENVHSWQNNYFSSRFSRNNIPIKNKYAS
FT                   LPFQQQQFIEEMVELIKSGKPILDKVLGNQLLPELIAIIIDKSFENCPSMPSTSTGLEI
FT                   PYFKTANKIHYDIPYYNFINSRIPILYELIKINEVENDGSSTLLYPYRIWLYYHMNDLE
FT                   SMKQLQKKIDIMINNQQLNEKTILYYLSTFINNYEIIEFKKNFHKLIINTQYNLSNSLI
FT                   NSLTPNLIGHDCLFEHLFFIYQLWMNSPKCQPPSIKTISLLLLEFYRFGTNHELKEFKR
FT                   LIKKYQHQHNMEYYDHYLIQSIDYQYEIINREYLSFTKNITEEDLQFIESIAPKMENYT
FT                   SIGVGVGDDDNDYENVIEFYHRWLYFMIRYSKNMDNINFIFKLYKNSIATTTATNSDNN
FT                   NNNDQFFLPPRFFKILLDYYVKHDQFIPMLQLIEASKTSIPYDPSYLILIAKTFIYSYS
FT                   RFAPQFIDRLNGWIGKSSFQLKKSWSPFHPYRIYEPLNRIKYNDPQWEEFRYDKRSKGN
FT                   RYNNNPNNESDSQLQQQQQIEFRVNRGFENLINRGIRPDINLLLETFKFTTNDLNYRLK
FT                   IKSLMMETRQYNHKNSKFMELISLNHPSLQQEDLLRYYITNSSSQLNDSHKFLFIKMLI
FT                   DYELYEEAQILINSIDDDANVNSIPPNNQGSNLLDKYKMLKLILQLKIYVLTDQFELII
FT                   DSLNKFAIHEKQIYLTPYLLDQTLLIENMLFKKLRSIQKSSTTTTTTNNNNNSLDDVDD
FT                   QEHLSSSSSLLLLGEGKKSLMKLRHFIGDVKLMLENDENEIMELIDKTIYILNQWKDNN
FT                   NNNR"
FT   gene            <512586..>514913
FT                   /locus_tag="CAWG_02567"
FT   mRNA            <512586..>514913
FT                   /locus_tag="CAWG_02567"
FT                   /product="hypothetical protein"
FT   CDS_pept        512586..514913
FT                   /codon_start=1
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02567"
FT                   /product="hypothetical protein"
FT                   /note="similar to AP-1 adaptor complex subunit beta"
FT                   /db_xref="GOA:C4YQ13"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ13"
FT                   /protein_id="EEQ44302.1"
FT                   /translation="MSSSYKQTINKNFNKVNSILERKLRKYLVGPKKGETFELKNGLVS
FT                   QYKHERKDAIQRVIQAMTVGKDVSSLFPDVLKNIATYDLEQKKLVYLYLMNYAKTNPEL
FT                   CILAVNTFVQDTEDPNPLIRALAIRTMGCIRVAKMVEYLEIPLQRTLADENPYVRKTAA
FT                   ICVAKLFDLNPEMCVEFGFLDELKKLLSDPNPMVVANAINALSEIRDMNTNENLEILAF
FT                   NREVINSLLLCLNECTEWGRITILNTLAEYDTDNSEEANHIMERVIPQLQHVNPSVVLS
FT                   SIKAILHHLNAIPVTAQRSNILKKLSAPLVSLVSTSIPEAQYVGLKNIRIILEKYPNVL
FT                   SKELRVFFIKYSDPLYLKLEKLEIMIRLASEQNSALLLGELKEYAMEFEPALVTKAIKS
FT                   IGSVAIKLQESAVKAINLLHEIIDERGGDLIINESVTVLVNILRRYPGKNDLATLIIPV
FT                   ISNHVNELNKTEALSGYIWLLGEYPKYFSGLHKKLSDLVDGFLEDDSVLQLNILSTIVK
FT                   INLELSSNGGSGNSQYSNLLQKVLELATKECENADVRDKAYIYWRLLSSSSSEDQQKKI
FT                   LLTKLPPIETTISSFSPGLLETLLDELSTLSSVYYKPAKSFIDPNAYSRVPVEKKNKTK
FT                   IEDLKNMAKEEIITNARNDNLLDFDDDDDEEGDGVSGSNGDSGNVGNLLDELNDLFSTP
FT                   PPPPSSSSQNSQSQIAGGQTSTNDILSLFNTINTTTTTTTTPQQSTQSSTTHGIENLSV
FT                   SGNASTTTKNKNNVNNDLLDLF"
FT   gene            complement(<515024..>515923)
FT                   /locus_tag="CAWG_02568"
FT   mRNA            complement(<515024..>515923)
FT                   /locus_tag="CAWG_02568"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(515024..515923)
FT                   /codon_start=1
FT                   /gene_family="HOG000000771" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02568"
FT                   /product="hypothetical protein"
FT                   /note="similar to RNA polymerase II holoenzyme/mediator
FT                   subunit"
FT                   /db_xref="GOA:C4YQ14"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ14"
FT                   /protein_id="EEQ44303.1"
FT                   /translation="MSTNNTTTNNEDLISSLYPPPPPYYKFFTKDNLQKLSTWQENNQT
FT                   TTVSSEVKLEEENTDPDSNNSEENSIPPGELRFLIPPKQPEGPQYRGYGNIWLFEDKLP
FT                   NLKDSQWEQLYNTSTSTSTSTANTNIITNTDTDINGNQEVDAGDSTGDENLTSETKIKE
FT                   LHKLMDSLLLNFLELIGILSIDPIKYDKKIHDINLILININHLLNTYRPHQSRESLIML
FT                   LKNQIDYKFLEIDQINKKCLDIKSKIKNLINERITVVSDDTTTNTTTTKTTGLGDGDSI
FT                   DEKEQLKQDIINRLLSSI"
FT   gene            <516373..>516818
FT                   /locus_tag="CAWG_02569"
FT   mRNA            join(<516373..516406,516481..>516818)
FT                   /locus_tag="CAWG_02569"
FT                   /product="RING-box protein HRT1"
FT   CDS_pept        join(516373..516406,516481..516818)
FT                   /codon_start=1
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02569"
FT                   /product="RING-box protein HRT1"
FT                   /db_xref="GOA:C4YQ15"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ15"
FT                   /protein_id="EEQ44304.1"
FT                   /translation="MADDQDRMDVDEVESKEPTTEPTTEPTSKPSSKPRFEVKKWTAVA
FT                   FWSWDMQIENCAICRNHLMEPCIECQPNAMGNIPSEECIPAWGVCNHAFHLHCIRRWLK
FT                   TRNACPLDSTNWTYQKLGN"
FT   gene            complement(<517080..>518090)
FT                   /locus_tag="CAWG_02570"
FT   mRNA            complement(join(<517080..517961,518040..>518090))
FT                   /locus_tag="CAWG_02570"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(517080..517961,518040..518090))
FT                   /codon_start=1
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ16"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ16"
FT                   /protein_id="EEQ44305.1"
FT                   /translation="MTIKVAFLGPEGTYTHQALIQQFGTENVSIYPQQSIGDCFHILNE
FT                   KKVDYAVVPFENSTNGQVVFTYDLLRDWYFQTSTPPKFRIIAEQFVSIHHNLLTNASKI
FT                   EDIKTIYSHPQVWTQVNKFLQSLPQQITKIDVGSTSKAAEIVSQDTITTSGSSSAAISS
FT                   YMSSELYKLPILKEGIEDNQSNTTRFLILGYDSPISPPPPPPASNNDDDNSKRNTTIVS
FT                   SIMFTLNHDDPGALCDVLVKFKEYGITLTSINSRPANLKPWQYVFFVEMIGDIHQEGLV
FT                   EKIKESCLELVILGVFQRSWRYNNNSNDQ"
FT   gene            complement(<518796..>519371)
FT                   /locus_tag="CAWG_02571"
FT   mRNA            complement(<518796..>519371)
FT                   /locus_tag="CAWG_02571"
FT                   /product="60S ribosomal protein L9-B"
FT   CDS_pept        complement(518796..519371)
FT                   /codon_start=1
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02571"
FT                   /product="60S ribosomal protein L9-B"
FT                   /db_xref="GOA:Q5AEN2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEN2"
FT                   /protein_id="EEQ44306.1"
FT                   /translation="MKYIQTDQILDIPEGVTVDIKARVVKVTGPRGELTKDLKHIDVTF
FT                   NKINNRAIKITVHNGDRKHVAALRTVKSLIANLITGVTKGYKYKMRFVYAHFPINVNII
FT                   KKDGQDYVEIRNFLGEKRVREVKIHEGVTMEISSTQKDELIVSGNSLEAVSQNAADIQQ
FT                   ICRVRNKDIRKFLDGIYVSERGTIVEEI"
FT   gene            complement(<519865..>520965)
FT                   /locus_tag="CAWG_02572"
FT   mRNA            complement(<519865..>520965)
FT                   /locus_tag="CAWG_02572"
FT                   /product="cytochrome c peroxidase, mitochondrial precursor"
FT   CDS_pept        complement(519865..520965)
FT                   /codon_start=1
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02572"
FT                   /product="cytochrome c peroxidase, mitochondrial precursor"
FT                   /db_xref="GOA:C4YQ18"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ18"
FT                   /protein_id="EEQ44307.1"
FT                   /translation="MATFAPHISKITKSSTKFNYGRIAKTFLGVAGSAAIATYFYNNGN
FT                   PFNNNNNNNNNNGGSKNAAKALFGASAGANVKIAKVPEGKSASDYQKVYNDIATKISEN
FT                   LEFDENAGYYGQLLRLAWHTSGTYDKSDNSGGSYGGTMIFAPEEFDPENAGLQVGREFL
FT                   MEFLVKYPWISRGDLWTLGGVAAVQESGGPKIEWRPGRVDDNTASKVPPNGRLPDASKD
FT                   GKYVKDLFARMGFNERETVALLGAHVLGRCHKHNSGYDGPWGPSFNQFTNVFYTTLLGD
FT                   WHVKKWDGKKQYEDDETGEFMMLPTDMALKEESYFLKYVKMYADDQDLFFKDFAKAFSK
FT                   LISNGIKYPADSKPILFKTLDEQDEE"
FT   gene            complement(<522133..>526041)
FT                   /locus_tag="CAWG_02573"
FT   mRNA            complement(<522133..>526041)
FT                   /locus_tag="CAWG_02573"
FT                   /product="SNF2-family ATP dependent chromatin remodeling
FT                   factor snf21"
FT   CDS_pept        complement(522133..526041)
FT                   /codon_start=1
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02573"
FT                   /product="SNF2-family ATP dependent chromatin remodeling
FT                   factor snf21"
FT                   /db_xref="GOA:C4YQ19"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ19"
FT                   /protein_id="EEQ44308.1"
FT                   /translation="MNGSAIANGNGSVGVTPALSQVQLQPGSANLTTQSNVSVVPKNKE
FT                   ELNELLSKYYKLLFDSNKLKKEFEKSEDKSEGKFEDVNAQAKLDIESVLAQVSKEHEEY
FT                   IKDESEFMQELFSENLKGTIKSEGFDNELFEKQVAGLLLLSRDYDLPEKFQKEFTTISD
FT                   QTKKDDLVNEILEKLTELETDFETRAQNLGIKVPSPSSSPSSKTDKDTLHSPLGTIHAE
FT                   KIISNKISQRLKELENLPANIGTFGDTDGIDKFKIQALIELKALRLLGKQKLLRHNILV
FT                   HEAQQVKYADPNLKSLPLALSEKRSFNVRPKIEQRNPQLLAVQLEELKKLEAREAKRKQ
FT                   HIEKVDLVVEKSTSRSEAKYVRDHYRSHYLVRQINNFHQTTEKEESKKLERTAKQRLQA
FT                   LRSNDEEAYLKLLDKTKDHRITHLLKQTNQFLDSLTEKVRAQQEEASGGSMGTPRHGSP
FT                   EVAVENKSDDKAELREKTDYYEVAHRIKEKITEQPTILVGGKLKEYQMKGLEWMVSLYN
FT                   NHLNGILADEMGLGKTIQSISLVTYLIEKKHENKFLIIVPLSTITNWTLEFEKWAPSIK
FT                   VIVYKGSQQQRRSLQPDIRYGNFQVLLTTYEYVIRERPMLAKFHYSHMIIDEGHRMKNA
FT                   QSKLSQTLRTYYKTKNRLILTGTPLQNNLPELWALLNFVLPGIFNSVKSFDDWFNTPFA
FT                   NTGAQEKIELTEEESLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCNLSGLQY
FT                   VLYQQMLKHNALFVGADVGGAKSGIKGLNNKIMQLRKICNHPFVFEEVESVLNSSRLTN
FT                   DLIWRVSGKFELLDRVLPKFKKSGHRVLMFFQMTQIMDIMEDFLRWKDMKYLRLDGSTK
FT                   AEERQDMLKVFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRA
FT                   HRIGQKNEVRILRLITNDSVEEVILERAHQKLDIDGKVIQAGKFDNKSTAEEQEAFLKR
FT                   LLEADANGADNEENDSLDDDELNEILARSEEEKVLFASMDEERKSEKVPYKSRLIEKDE
FT                   LPAVFTEDISHHFEKKEKELSKMRDKKRVRYDDGLSEEQWLKAMDDDNDTVEEAIKRKE
FT                   ERIAKRKRNKAIREGLLEEDIKDDEVGEEDDEDFEEAAQPRKRQRRARTPLPHIDNDDI
FT                   NGDSGNGGGGAAIELDDDDDDNEPETDGFTSKCLSVIDEITALTDETDGHNLSDIFIKL
FT                   PSRKLYPDYYSIIKKPVSINQVKKQLDQEKFASFEDFIAELKQMCLNAKTYNQEGSFVH
FT                   TDATVIEKLLDEKLANQE"
FT   gene            <527178..>527735
FT                   /locus_tag="CAWG_02574"
FT   mRNA            <527178..>527735
FT                   /locus_tag="CAWG_02574"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        527178..527735
FT                   /codon_start=1
FT                   /gene_family="HOG000213138" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ20"
FT                   /protein_id="EEQ44309.1"
FT                   /translation="MFSLGVQNRLFTRRALFSGFRFNSTTTTTTTASQPRLTWVDYFQL
FT                   KKQNNRINTIAGVFTGLGGAFITLSYLGNIEIDVEKPIMGFDPLMVMGGAVILGGLVGF
FT                   LVGPFIGSSIFRLTNRAQLKQFELKNTEFLSRLRIKRPDPSSQSFSNPIPDYYGEKIYS
FT                   LKDYKQWLRDCNAFRRKSKEFL"
FT   gene            complement(<528092..>529309)
FT                   /locus_tag="CAWG_02575"
FT   mRNA            complement(<528092..>529309)
FT                   /locus_tag="CAWG_02575"
FT                   /product="candidapepsin precursor"
FT   CDS_pept        complement(528092..529309)
FT                   /codon_start=1
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02575"
FT                   /product="candidapepsin precursor"
FT                   /db_xref="GOA:Q5AEM6"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEM6"
FT                   /protein_id="EEQ44310.1"
FT                   /translation="MVSIITFTKNVLVTLAFALLAQGLAIPEDIDKRAEKVVSLDFTVT
FT                   RKPFNATAHGQHHQSQQQQQQQQQQPAQKRGTVQTSLINEGPSYAATITVGSNKQQQTV
FT                   IVDTGSSDLWVVDSAAVCQVTYPGQSPTFCKQDGTYKPSSSTTSQNLGKAFSIRYEDGS
FT                   SSQGTVYKDTVGLGGASITNQQFADVTTTSVDQGILGIGFTGDESSPTYDNVPVTLKKQ
FT                   GIINKNAYSLYLNSASASSGTIIFGGVDNAKYTGSLTALPITSSNELRVQLSTINIAGT
FT                   TVSASTTPVLDSGTTLTYFSQTIADKLAAAVGAKWNSYYQLYTSSCNLAGNIVFNFAKG
FT                   VTISVPLSEFVLQDGNSCYFGVSRDSATILGDNFLRRAYAVYDLDGNTISLAQVKYTTS
FT                   SSISTL"
FT   gene            530931..531002
FT                   /locus_tag="CAWG_08059"
FT   tRNA            530931..531002
FT                   /locus_tag="CAWG_08059"
FT                   /product="tRNA-Met"
FT   gene            <531502..>531690
FT                   /locus_tag="CAWG_02576"
FT   mRNA            <531502..>531690
FT                   /locus_tag="CAWG_02576"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        531502..531690
FT                   /codon_start=1
FT                   /gene_family="HOG000072576" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ22"
FT                   /protein_id="EEQ44311.1"
FT                   /translation="MALQTPKQRAANARFEKKNTNQWGKPKKENTKTEYPVSKSWLFVL
FT                   LFLVCGGAILELIRLIF"
FT   gene            complement(<532285..>533322)
FT                   /locus_tag="CAWG_02577"
FT   mRNA            complement(<532285..>533322)
FT                   /locus_tag="CAWG_02577"
FT                   /product="oxidation resistance protein 1"
FT   CDS_pept        complement(532285..533322)
FT                   /codon_start=1
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02577"
FT                   /product="oxidation resistance protein 1"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ23"
FT                   /protein_id="EEQ44312.1"
FT                   /translation="MSFLFRRSTEQPRVNEEETNKEIKDESQQQQQEKEDDNSKQEELL
FT                   SDSVNEKPKEQPKPVKRRGTFFGNLLGNGSKNSSSASLNSSHSSVSSSSKFPPLGPLTL
FT                   TGYKESTHHRLLDSELANNIRNLIPARFQLFDNWELVYSLEQHGISLNTLYRNSNPEHQ
FT                   LRLLKKQKAAEKGFADSIVKNMVVGDTSRPRYSFEPKRSQSYVLVIKDNHNNKFGAYLS
FT                   ENLKPMEHRRYYGNGECFLWKCEKYDPSKLDHAVDKRATQEIRFKAFMYTGINDNIVYS
FT                   NHDFIAIGSSNGQNGLFIDKSLLLGVSYSCDTFGNEILNSSPQNAKFGSFKIKGLEVWR
FT                   IGTLE"
FT   gene            complement(<533674..>534372)
FT                   /locus_tag="CAWG_02578"
FT   mRNA            complement(<533674..>534372)
FT                   /locus_tag="CAWG_02578"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(533674..534372)
FT                   /codon_start=1
FT                   /gene_family="HOG000205771" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ24"
FT                   /protein_id="EEQ44313.1"
FT                   /translation="MTVKILVINPNSSEKVTKNLEKTITQPENVQLFFYTGPSDSPKEI
FT                   TPTTSLQSEKAVLEDFKVNIEDRLNYDGYLVCCYSDHPLVYSLGKLTKKPVMGIMQATL
FT                   LFALSQPTTKTTKSFILTSTSEWESVLDQSIIDFVGADNFPVKKFEKTRGLNVNVTNLA
FT                   DEEQFSKIYNVTKSIFNEYKDVGCVLLGCAGMAGLDTKLGEKFPNVRFIDSVKIGIEQL
FT                   VTLIRFDRQV"
FT   gene            <534567..>536033
FT                   /locus_tag="CAWG_02579"
FT   mRNA            <534567..>536033
FT                   /locus_tag="CAWG_02579"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        534567..536033
FT                   /codon_start=1
FT                   /gene_family="HOG000248223" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ25"
FT                   /db_xref="InterPro:IPR007268"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ25"
FT                   /protein_id="EEQ44314.1"
FT                   /translation="MVFEAEIGLNKHKLMWSKSIASLSNIAEAITFTINKDSISLSATN
FT                   TSKTSYAQIYFKKTFFNKLSVDFNNILPEGYDDGKQQKEEPSYSFLINSRHMATLFKSL
FT                   DSSGMKHLSFRINWSRNAPINSRYKLFIEIHTKKLIVKKFQASYTPATKQNLHIASIYK
FT                   DTLYKQREEEEDLHDKTRINHIMIDQLIPKQFLEMVPASAEDFKIDIKSERISFCGYTK
FT                   QIIKDRDYLKQPMAVTVTISLDELTDSNLLSSNSDQEPIRKQINFGMRDFKNFLNLANF
FT                   FTTPSSSSERLDENYVTTANNDYFHIFFRNPGDPILFDLQNYQHTEVQFIQITSEDKSE
FT                   LHSKEIDAELIRKGLTIEAPIPQKIQSDETATTTASTSTTKTKTTTPSLTRLTTNTVFG
FT                   KPSITKKRGKHRLINKDQVSQGTINDDFDDGVTYGQEPEPERDRDRANYAETDYSNSSD
FT                   DESKEPPFKKYAFDEELGPTQLNNKPKSIF"
FT   gene            <536563..>538794
FT                   /locus_tag="CAWG_02580"
FT   mRNA            <536563..>538794
FT                   /locus_tag="CAWG_02580"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        536563..538794
FT                   /codon_start=1
FT                   /gene_family="HOG000197526" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR021917"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ26"
FT                   /protein_id="EEQ44315.1"
FT                   /translation="MTVSFNYQNNEIVSSPTVIVSGSTLTRLYRGVVSFTNNQNKVFPP
FT                   QYFEVNNGHFKAIIHVSPGERNIFQVDISDNGYINDFGFVEYGNGRRPNIVDSGSLTLS
FT                   FNPLPQNKPIHLCLIRGKDSNNTYDMPKYRLQRGEVPNLENAIKKLIVAGRLMQAYTQD
FT                   EMRSAGFSNRCFQFVEETIHDQTIFGYKVNSPTPHQEIKIHVLTSPKTVAELRSPELAQ
FT                   QNPNAKDSGGLFDHAIDLVKNCPEIYNQRNGTAVQCACMYLDSTWQNNLILTHAALGGG
FT                   TNEVKMAIFGSHGLHSYPQNFPLVTPSFLDATHLTTTEVANDCNECGTSWECLNICLGA
FT                   FLHEIGHSLGCPHQVDGVMLRDYVMLNRSFMTRENECLRTQSRGQIIANNGTWPKVCHW
FT                   NRLDLVRFLYHDSFSLPIDRFGKTYSTTWNPDNSYQDNSAPSSYAMPLNESLVKSSAGI
FT                   FLIEVITDDLARYHIEFLPKEYGGPGLQHASDLEFNNLYNALRSRKNDAKDVFKLRILS
FT                   LGGDLNIDNFKDHCSKQSKQVIQSDFGLNRGHLQGFKSATLGRTDDLKMEFVGFDIKTI
FT                   YKVRVYHGSALDGIKFYYKSGTGTAARSSNGGGGAPKIPKRDYLSKMFRSKLNISNQSH
FT                   HEQSPQQLTNGSGGEKRTTLVGKETGNYSEFIFNPNEYITFFNFRDGAWMDAVQFGTNQ
FT                   GRISPMFGNADGGHLSTLDAPNDDFEIVGMYFYLNQWLRGLGIIYTPKH"
FT   gene            complement(<538791..>539519)
FT                   /locus_tag="CAWG_02581"
FT   mRNA            complement(<538791..>539519)
FT                   /locus_tag="CAWG_02581"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(538791..539519)
FT                   /codon_start=1
FT                   /gene_family="HOG000248225" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ27"
FT                   /protein_id="EEQ44316.1"
FT                   /translation="MQDLDTPKEVSQAIRQANTDEEANIENGNESQQQQQHNNRQQEPE
FT                   NHTNEIITNSNNSTDSTFSDTEDDYMLSDDEELNRILSRETSSHHHGLPSSGSMVDHAQ
FT                   FFAEALSHALDSIDIDRSLVLQAQISGKLNNENQKIIEKKEILIEKLKNIQLMYGKNFG
FT                   LLADGKESRVDKMKKDISFIENRITKLMHGGSETKSSIPFFKNKSNMGVEQKYPIEFNQ
FT                   AKDKVIERQIDDDDNEEIDF"
FT   gene            <539803..>543099
FT                   /locus_tag="CAWG_02582"
FT   mRNA            <539803..>543099
FT                   /locus_tag="CAWG_02582"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        539803..543099
FT                   /codon_start=1
FT                   /gene_family="HOG000000981" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ28"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ28"
FT                   /protein_id="EEQ44317.1"
FT                   /translation="MSSFQLQNSEVLARLKPFGISFEKSLNDLIKGIRAHTKESPESLG
FT                   NFLDVAIQECRNELTTTDLETKAMAILKLAYLEMYGFDMSWCNFQILEVMSSSKFQQKR
FT                   IGYLAAIQSFKNEQDLLILATNQFKKDLNSHNHVDIGLALSGIATIVTPSLAKDINDDV
FT                   LMKLNHSKPYIRKKAILAMYKIFLQYPESLRLNFNRVIEKLDDSEIAVVSATVNVICEI
FT                   SKKNPNIFINYLPKFFAILEDTKNNWLIIRILKLFQSLSKVEPRMKKKILPTIIDLMLR
FT                   TQASSLIYECINCIVSGQMLSADSSKDKETAKLCINQLKLFFLTNDSNLKFVGLIALIN
FT                   TLKIFPILINDVEGISEIVLECLNDRDLIIKRKALEVSNYLVNEDNITEVVKIMLMQLV
FT                   PDNNMIDDMLKLEVTLKILQIASQNNYVNIPNFRWYVAVLKDVINLTLLPVEGATNSGL
FT                   IASHIANEISTEVGKEFKNLATKVPSVRSYLLQNVVLELVQDVRLLDSSALILKDLYWI
FT                   LGEYISELKVTQNDDGDDDSDSDSDGEDAQVMVLDIDKKIKVFNTLINYQIDKKLGLTS
FT                   NIHFPVSAKLINLHFTSVVAVLIQALVKLYNGIATDYINNFATTNGQLPLEKYHELCYH
FT                   LYRLIGFLSNWENHPNYEVQERALSWLEFLKLILEAMTDNDFTDIKKLEESDLKMYKDL
FT                   PIAKGGDSESESESESEDDDEEEEEEERNDYSEDDSESEDDGYENLVSSDEEGNSKPSK
FT                   STLPIQEEEYNPFAENEESESKNLTGGNEAEEETQEQENQQQDNNGMKQLPMLLTHVLP
FT                   SFFTAYTLNPVAKNAQRNVGVPEDLDLNTQIRSPDFKLEQFDDDSSDNYELYLSEVEDI
FT                   EPLIHLSSDEPQEKKKERLERLKDDPYYLDDDYVVKTKKKSKSKKIKSESISPDVESEN
FT                   ASITNTIVSETDTDMNKKKKQTKKKKSNKLKKEKVLILDEETIVGESNITTPIESTQIQ
FT                   THKEKKKPTKKNTFKIDSSNLDNFDLVSNDSETQLRNDKEYEIDLEALREKLKKTTVEP
FT                   KIKDKEAKSKKKSKKSKKTSEEGKSTTTESNGVEPLKPKKVKKKKAIILE"
FT   gene            complement(<543317..>544198)
FT                   /locus_tag="CAWG_02583"
FT   mRNA            complement(<543317..>544198)
FT                   /locus_tag="CAWG_02583"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(543317..544198)
FT                   /codon_start=1
FT                   /gene_family="HOG000026375" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02583"
FT                   /product="hypothetical protein"
FT                   /note="similar to acyltransferase"
FT                   /db_xref="GOA:C4YQ29"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ29"
FT                   /protein_id="EEQ44318.1"
FT                   /translation="MSAVSSFFTKLKFYLKSGLYGTLVAGCAIYGVLASIILRIVNKAE
FT                   YAQYAVAKACYYVVSLFLGLKINIKNEKYLQNLPAIVVANHQSALDIYVLGKIFQPGYT
FT                   VTSKKSLKYVPFLGWFMVLSGTFFLDRSKSASAKKVLDGALTGLKNQGKALFIFPEGTR
FT                   SATEDLTMLPFKKGAFHLARQAGIPIIPVVVSNTSTIFNSKRKIFNTGEINIEVLPPVS
FT                   TSDWETHEDVTNACNNIRDDMIKTLKKLGNSKIPGSKPREDFYPSESEDTSETDVEIIN
FT                   EQTPLKATAVSD"
FT   gene            complement(<545140..>545850)
FT                   /locus_tag="CAWG_02584"
FT   mRNA            complement(<545140..>545850)
FT                   /locus_tag="CAWG_02584"
FT                   /product="protein SNO4"
FT   CDS_pept        complement(545140..545850)
FT                   /codon_start=1
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02584"
FT                   /product="protein SNO4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ30"
FT                   /protein_id="EEQ44319.1"
FT                   /translation="MVKVLLALTSYNETFYSDGKKTGVFVVEALHPFEVFRKKGYEIQL
FT                   ASETGTFGWDDHSVVPDFLNGEDKEIFDNANSEFNVALKNLKKASDLDPNDYDIFFGSA
FT                   GHGTLFDYPHAKDLQKIATTVYNKGGVVSAVCHGPAIFENLNDPKTGEPLIKGKKITGF
FT                   TDIGEDILGVTDIMKKGNLLTIKQVAEKEGATYIEPEGPWDNFTVTDGRIVTGVNPQSA
FT                   VKTAEDVIAAFECN"
FT   gene            complement(<547599..>547952)
FT                   /locus_tag="CAWG_02585"
FT   mRNA            complement(<547599..>547952)
FT                   /locus_tag="CAWG_02585"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(547599..547952)
FT                   /codon_start=1
FT                   /gene_family="HOG000188911" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02585"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEL6"
FT                   /protein_id="EEQ44320.1"
FT                   /translation="MSSFKKFTDFLFSKQSLRYVCTTHFWGPVSNFGIPIAAILDLKKD
FT                   PDLISGPMTGSLILYSLVFMRYSMAVTPQNYLLFGCHFVNELAQLSQGFRWVKHHYDTS
FT                   SNDGEDTKKITQN"
FT   gene            complement(<548701..>549963)
FT                   /locus_tag="CAWG_02586"
FT   mRNA            complement(<548701..>549963)
FT                   /locus_tag="CAWG_02586"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(548701..549963)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ32"
FT                   /protein_id="EEQ44321.1"
FT                   /translation="MLGQGMIVIFIFLHHKAKEFVENDPKTKLNNGFLQLIEKNLDTLL
FT                   QFEFRLSTKYITTSRMWSSNMVYLINRVLNLIKMIYEKQEELEREKEKEQEFEESDKQS
FT                   LITMRSASSSEEPSNSAPPIPSIEDEFPITTAQGNLLYLFNTNSFGDPSQFEYLNGFHL
FT                   NDPNWLTVSDNIPYYLDPLVDGSKEQIADYKQYGPVTETTNGNIDTSLEPVGAVIMENL
FT                   STNGPSGSNSVNNTAIANGSGMDNSTTVSNTIDPVTAAAVAAGTTTSTNVTANSSTIPL
FT                   QPQSKSSSTTPAIFNQSSGDGFGLNYYNNGSWTSASPMIQTPSVQEQPMSKVSPNSGMP
FT                   PTIGSRIPSQTKFPNQVSPIPPILPPLAQQQQAQQQAQPVANLNISYVFPHQMANYNAQ
FT                   QYGNYNGQSMKSTKNDNRSNQ"
FT   gene            complement(<550180..>552693)
FT                   /locus_tag="CAWG_02587"
FT   mRNA            complement(<550180..>552693)
FT                   /locus_tag="CAWG_02587"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(<550180..552693)
FT                   /codon_start=1
FT                   /gene_family="HOG000213131" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ33"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ33"
FT                   /protein_id="EEQ44322.1"
FT                   /translation="MSSALLPISCISCRKRKIKCNRIKPCDQCIKRHLPCEFPEKFRNI
FT                   KIQEDEIKPELDGEPELEPEDDMNSIYDHLRKPSENPSISTSGSASILSSAPSKSTDST
FT                   DSIPTSTDSATNSDSREKCMVMKNHLAGKITHSSPSAIPITVGSLNNSIISSSKNLIDS
FT                   DAPNQDSDSWTLLRDDYDIMKAANSQLLSSNRLLTRQLEELQQSTLCHFRRSDMRNCHD
FT                   NAHKNGSCSCNKTTKTIDNGNHNRGDANANLLPNLPRSGDKRANTSDSFSDESPNKKEK
FT                   VGVFGYSKSSFPKDSASQNQGIYSNNQFNEDNSSSPPKETSTTSTDSSSSGGEIGQTLS
FT                   FQPLSKEQRELLNGRKVHRVKRNRGQGFYEHQVSSQPPVNKNGLPNRSVNLNHNWEQDA
FT                   ETYQDQESIKSNIQIQKSLKKKTLPILPSYLLKYDDPGISVDSTTYQDISRLNFEVVVK
FT                   LVEKFFENNSYYRTFISSVHVFDFLNGYNSINDRDWENDDDLLLVYMILCLSIERLSPQ
FT                   DFVELNLLPDGSLNICTKYRKFLTRQVLYKSFERLKENLVDESMITIQAYILCSEWLFL
FT                   QQNYEECWQMMFHACSISFSIGLHIMNQFRATNTKENKPFKNVVDATMGESDSSSEKKD
FT                   TMELEEDKKNEDEELNAQQYRLWYALKYSTSVICSIFGRPNPISVKVGMINSTALNQID
FT                   QKLHVLLKSESSESLRLSNLMLIENYMIDISFENVMTLKLKFDTDILTLEDSYDNIHGK
FT                   TKNSLVDGLEQQNESNDSADKWVSYDDYTKGSLTTKELDVLSDTIILHINSVKLLEPFV
FT                   KKYETQKGNDTLSEKQIDSIGKFLQL"
FT   gene            <552853..>553179
FT                   /locus_tag="CAWG_02588"
FT   mRNA            <552853..>553179
FT                   /locus_tag="CAWG_02588"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        552853..553179
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ34"
FT                   /protein_id="EEQ44323.1"
FT                   /translation="MFYYLETEVLATTYFIHKKEFTLMLFIVEIYCISRPIKSQIYPKS
FT                   TKYLGLSISGELCCQKKYVRIKYLNIQTLFLRNKNFVRRSAGSPNQKKIKQKKTTSDVE
FT                   TKIQ"
FT   gene            <556545..>557303
FT                   /locus_tag="CAWG_02589"
FT   mRNA            <556545..>557303
FT                   /locus_tag="CAWG_02589"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        556545..557303
FT                   /codon_start=1
FT                   /gene_family="HOG000248231" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ35"
FT                   /protein_id="EEQ44324.1"
FT                   /translation="MTKEPYFISNLTSIKPSNNRNYSIVSPDLPSLATTQLKYAPPLTT
FT                   NIDNSVNADVGNKARKRSIEPYYSKPVKIGVLPPAILNQFAYHFHDECAIIDDDDEDDE
FT                   ELINYSGSVIAPGNMLGTVFDNYDQHESETYTEEYSNIDCFRKLMAKVKVPLVNDGVGS
FT                   NINTFRLEHYFKHNGESLKEKLLDKSNNPNVLINERSRKLSDSLSAPDLQQVGFASDHY
FT                   DYSEDSYSTVIRGNARDDYGDNNEPYSFLI"
FT   gene            <558155..>558910
FT                   /locus_tag="CAWG_02590"
FT   mRNA            <558155..>558910
FT                   /locus_tag="CAWG_02590"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        558155..558910
FT                   /codon_start=1
FT                   /gene_family="HOG000248232" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ36"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ36"
FT                   /protein_id="EEQ44325.1"
FT                   /translation="MDNSFIFDLPTHLPNETPKEPELASESQNRVPVNIETGKQNQIDH
FT                   RDEDEEDNNDHEETLPKTNGTIYIQGTNISLQTEEDIAKWIEERKRNWPTNKNIELKRQ
FT                   QKQKQEEEEQQQQKDIKNAKSDNKKRMNEDESSNGPTKKQKSICRFYQLNKKCKFGNKC
FT                   KNLHEEPTNENPVTLSYNELTHYRKYVNGIPILVPKLYSNRTENTSVKKSSLFKHLVTR
FT                   DHMTNENEKVIEFIRYLNDQGLIDHDVMK"
FT   gene            complement(<559038..>560639)
FT                   /locus_tag="CAWG_02591"
FT   mRNA            complement(<559038..>560639)
FT                   /locus_tag="CAWG_02591"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(559038..560639)
FT                   /codon_start=1
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02591"
FT                   /product="hypothetical protein"
FT                   /note="similar to delta 8-(E)-sphingolipid desaturase"
FT                   /db_xref="GOA:C4YQ37"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ37"
FT                   /protein_id="EEQ44326.1"
FT                   /translation="MVGKDATDEMHAYHCDETVDTFTRFKIGEIEGPRWENLLPPIQGG
FT                   IYAKGGHYGSLNNKNTSNKKTLDSKLDNDSSNSTSDLECLTTTNSCDSDISETEIANYK
FT                   GIGFVPSVKPVVPQNQLVSKSNMDIVFPIIDEETKKKVIRNPKTLLNNYDNKLSQEDVM
FT                   SLPALDYDSQQVLRDKYNELHQTIIDYGLYECDLWDYVREVTKIGSLFLYSLSFLKINQ
FT                   LFLSAVFMGMAWHQGTFIAHDAGHIGITHNYQIDNIFGMLIADWFGGLSLGWWKRNHNV
FT                   HHLITNDPVHDPDIQHLPFFAVSVRLFQNVYSTYYDKILPFDKFSQFLIPLQKYLYYPI
FT                   LCFGRFNLYRLSWTHVLCGQGPRQGKAAWFRYFEFFGLSFFFYWFFYLLVFKTIEGGWN
FT                   RFNYVMVSHITTMLVHVQITLSHFAMSTADLGVSESFPSRQVRTTMDVDCPEWLDFLHG
FT                   GLQFQAIHHLFPRLPRHNLRKAQPFVIKFCEEVGLSYSIYGFGEGNEIVISRLADIGKQ
FT                   CSIFLDATKHYEGDLY"
FT   gene            complement(<561269..>563029)
FT                   /locus_tag="CAWG_02592"
FT   mRNA            complement(<561269..>563029)
FT                   /locus_tag="CAWG_02592"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(561269..563029)
FT                   /codon_start=1
FT                   /gene_family="HOG000074569" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02592"
FT                   /product="hypothetical protein"
FT                   /note="similar to dolichol kinase"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ38"
FT                   /protein_id="EEQ44327.1"
FT                   /translation="MAGRKRKNETKKPNPTARSTAAIFQDINNLDELESKTEIDNNKSN
FT                   EETNDEPAGSPEEDIANASFPFNYLYRVQDHLNENMSVVHAVQCLVSLFFIQMVYLDRV
FT                   KIIDYSKDEHLPMQVIAVIFFNWVGVFLCTVLGMVKNKSENKVMPDFNYIYSLLLPALL
FT                   SVLHFNKDWLLVNLSLNYFVIDSMNPIFNLFSSLGFYEVYKDEETTLISTFQFGQYAAI
FT                   FLVFQYILNYINTEETDDDSNAKPRTSLKRSEIHLIVLLLINILFNPAFTGGNVLPMKI
FT                   FQKLIISFIISSFFTFPIISFTPGILVILIFGGIFYGFTIFQLTPILNDNAVNWLYNYV
FT                   MKDETRVHIISIWVAMSVTIIPMVFYFANYLRLNTRRKIWHGLMVIALCFTPEILFGQI
FT                   EFTLISLLGTLIVFMVVEGIRYNRLSYIGEFLHKTLSVFQDTKDLQGPLNLSYIYLLAG
FT                   VTIPIVYDYLVNKDTVTIIRYSGLITLGVGDTFASVIGKKFGTFKWKGSNKSVQGTIAF
FT                   IVSVLLCTYGADYYLTQNNTNYLPIKNWENTFVTILLAGFLEGTCDINDNYLIPIFFPI
FT                   SYELLNKSYK"
FT   gene            <563613..>567335
FT                   /locus_tag="CAWG_02593"
FT   mRNA            join(<563613..566691,566818..>567335)
FT                   /locus_tag="CAWG_02593"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(563613..566691,566818..567335)
FT                   /codon_start=1
FT                   /gene_family="HOG000166512" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ39"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ39"
FT                   /protein_id="EEQ44328.1"
FT                   /translation="MHIKKIIIQGFKTYKNTTTIDLLSPHCNVVVGRNGSGKSNFFAAI
FT                   RFVLSDAYTHMSREERQGLIHEGSGTVMSAYVEIIFDNTDGRFPINKPEISIRRTIGLK
FT                   KDDYSLDGKSATRSDIMNLLESAGFSRSNPYYIVPQGRITSLTNSKNHERLNLLKEVSG
FT                   ANVFENKLKESMKEMNQSNLKRARIDETLVSIEERLKDLQIESADLKDFQKLDKLKKIL
FT                   EFNIFDREYNELNESLEELEEKHQSILQESKQDLIELEKREKLCVELQDSINELKISAK
FT                   VLKLEKEQSDLDCDQLLKVIAEKEIKLRELSLNNELSKEQNIHINEQIGILQSEINQHK
FT                   QEISRYKPELNKLQQQESSLKQQLSEISSKQRALYAKQSRFSKFVNKKDRDSWLNTEIS
FT                   KLKRQITDKDQEMRHISNEVKTRESSLEELSESIKKLNDSLNDEEHIKTLANLKTTIND
FT                   SKQQITQLVDQRKILWRDEIRLKSVHDSLTNDLTNATNIVNQTMDRAQAQGIAAVKQIA
FT                   QRLNLSDRVYGTVAELFNVNDKYKTAAEVIAGNSLFHIVVDTDVTAATIMEELIRNKAG
FT                   RVTFVPLNRIDNIEVEYPDSHENQCLPLIKKLKYNEQVYKAINQIFGKTLVVSELSKGG
FT                   ELSRKYKLSCITLDGDRVDTRGVLSGGYRDYKNSRIDALKIQTRKKQELEKTDRELIKV
FT                   TKEIESTNSQLNKLNNELQLNVRDLDRLSVSKEPIKIELSQLTNKKFNLDQEISSLKSN
FT                   LQNLQNTKNSIKVNLKQHESELNSEFTQVLTQDEQNELDELSKSAIELESKLDHIVTRS
FT                   SELDTKISGIESEVINNLQPKLNKYRQEQQKQHQQQLQLQLQQESSRSSDTKSNLEYEE
FT                   LQQELESLHIQLDTSQSRNSQVVENLTKINEEINNCEQELAQANKQQIKIIKNIEKSSK
FT                   QTNNLLNQKSIKSQMRDDANQKIRELGVLPEEAFQSEKYDQYSSDQLLSKLNGINQELT
FT                   KYSHINKKAIEQFNLFNRQKEDLMARRIDLNNSKASIVQKKNDNNNNVNVTDDVNSDND
FT                   DDDDDDIDNYSGVAISVSFNSKNDEQQRIEQLSGGQKSLCAIALIFAIQNCDPAPFYLF
FT                   DEIDSNLDTQYRISVARLIHQLSRNNEDNNNNEGRSRGAQFICTTFRPELLQLSGDKFY
FT                   GVTFSNKVSSVNEINKEEAMSFVEGQQQQQQS"
FT   gene            <570902..>572251
FT                   /locus_tag="CAWG_02594"
FT   mRNA            <570902..>572251
FT                   /locus_tag="CAWG_02594"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        570902..572251
FT                   /codon_start=1
FT                   /gene_family="HOG000248234" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ40"
FT                   /protein_id="EEQ44329.1"
FT                   /translation="MITTTTTTATSQIGDLNEIPNLKPPRETFVDQPKSPEDVNLEELI
FT                   YDLQNGTKNVNNLHLYHSIFILSKTLQFIVKLQEHPDLYNEFRWQQLNRLGINEDDLID
FT                   KDTGNINENNERNANASSTLFQPQPSHMTKDTDFANEMSNIRSNTPSLSPPPLKMAKFH
FT                   KNSIINDNKYYDELETSIEARIVDDVEVDRDSSIRSPDDISTLNIPSPTNEFESVIDEN
FT                   IDDIKYFSDNNNNENNNNNNDEPPPYIPIEQLVESTTITNQTYNDEQINEIYINKLKLE
FT                   IFNQHKHFQKKSESQLESLKIFNLLKTPNISIDQFLNRIKTYSSNISIISYLNTTFLLF
FT                   KLSIYLNKITLNLNNSFRFLIGSLRCSIKIFEDIYQHQSKFNNVVGINNLPDLLKIELK
FT                   FVYLINFNFNSNFNCFIIDQFLKLEFIQLCLFMKSNLPDDYNKIVNNIKS"
FT   gene            complement(572395..572482)
FT                   /locus_tag="CAWG_08060"
FT   tRNA            complement(572395..572482)
FT                   /locus_tag="CAWG_08060"
FT                   /product="tRNA-Phe"
FT   gene            complement(572491..572563)
FT                   /locus_tag="CAWG_08061"
FT   tRNA            complement(572491..572563)
FT                   /locus_tag="CAWG_08061"
FT                   /product="tRNA-Arg"
FT   gene            <574257..>575759
FT                   /locus_tag="CAWG_02595"
FT   mRNA            <574257..>575759
FT                   /locus_tag="CAWG_02595"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        574257..575759
FT                   /codon_start=1
FT                   /gene_family="HOG000074571" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ41"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ41"
FT                   /protein_id="EEQ44330.1"
FT                   /translation="MITTRIRPIMNNTSTHTNTKTSTTILTKRSATATTTTTSIPKQSS
FT                   MSGQSKHAILIPSALNSLLHTDKQIKYHFYSLGGDFIRLASYRRFKQLFQVGGGSLVKQ
FT                   FVFDLSTFLKEELNDINSLRHHQLKNFLTCNKTILEKEKSMTLCDHHFGLKNWLYIIFG
FT                   YMLQNYNEQEVNNCLDQLVSMYLEARSNRFSINDIRIIRDERDQFILSTFEQYLLDVPV
FT                   RNDLLYNDNGNNEDVNYIILSNIKHHKRSNKNATIASNKDNNTTNRINLPKLPKIKDKS
FT                   LLVKSLMHKEFYRVLLDPNHYFGKKMLDRNYSLDPQDYSLIRKELSILDGLGDLFLAQE
FT                   TSKLIYELICQKNHININSSTTYQLLKIMLATNTLMAKLTKAYNLYQGLDDSIINKRIA
FT                   KEWLPFTILGETPPHSESSDWQSKDEIRIYEEEFLGDFFESYMAALLIEQPEVAKSFIR
FT                   EIYHRILMVMTETLPPDITYQTWTSNILGRNIYRKKSESIQC"
FT   gene            complement(<575900..>579760)
FT                   /locus_tag="CAWG_02596"
FT   mRNA            complement(<575900..>579760)
FT                   /locus_tag="CAWG_02596"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(575900..579760)
FT                   /codon_start=1
FT                   /gene_family="HOG000093857" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018844"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ42"
FT                   /protein_id="EEQ44331.1"
FT                   /translation="MSKIKLKALLIPKEFEQIDASNIDPRKYVKFLYLVDRTANIESLE
FT                   EGLITRFSKRYPRERKLRVLAFQNKDLCDLDPEFAVEDVFNESNDELRVLVDNKFKSIT
FT                   YTPEPAISTPINFSQAETIRGGVYSTVDITDDKTTPKKSKQSPLSSPVSLAPPPESRSN
FT                   RKIPQKKKSVSSLKQRITSGMLEAPPATPMNNPDKVYFDERSFTSPKKKQQKAKKNDSF
FT                   VASSSLDEVSSGDEYKESEESAAETADYEPEEEEKIQPEELLSMYEELDFHENDDLPLS
FT                   QTSNPKHSTINKALQIDMVEGNPAMYLSRTKRRAAREANLVFTSSKKAAKTPSSTPKPA
FT                   STIKTTPKPGKVQKPTPTTKQKHTSPVVGVNGQSKSLPKPTQTAGTEKKSSISTSSKQA
FT                   KTTVGKAQTKATPVTHTKTVSTTTSQSSNKALPKSTNKPSVSKSTLEDLYDRMKVFGQK
FT                   VKTLMVHGEDGNIIGYEKIPNDFGDGIQLAHDISSEAIDTALRLTVQKDSQDSDIVKTE
FT                   EKVSNPEPISSNPEPSLQPVEKIVSISSDTEVKSKTSANNLDSEDTDDIVIKPPVKNRK
FT                   TGSTKAASKDLDSDDDLKEIASATAPPNVTSTKPISKESDSHVANDNGSDSDDIDIKAA
FT                   DAAFVPAKISTATSAPISTNVNSNVANDNGSDSDDIDIKAADAAFVPAKISTAASASIV
FT                   NNNAANESDSDDIDIDIKTDSAAFVPVKTGTASSASIVNSNVANESDSDGVDIDIKAAG
FT                   QAFVPVKTGTTEALAPIVNRKVTNDSDSDDMDIDIKTAGAAFVPTRSGTTETSAPIATI
FT                   VDSSEEETGNNETGNNTISISREQLKTFAKIINKSKMGSGSFSNNSSNGQDVVDNKISP
FT                   DTAPSAFAGMVEISDDGNGISGNNTPNRLNYDDNESYIPKSFASNFRAHERKTQALGSL
FT                   QIVHQDPVVDKTPTKNYELASDNMLSYIYVGDSGGEDINAVGRGIDDRSRGYNKSSDPS
FT                   SPFGKTDTSSSFLFGGGGSSTNANTSIPKSAFGAGDLFATKPNNGNGTNNRNDYSMGNN
FT                   NGNSSISVGGINANNTTGSEWNNNNTHRNGTGATSGSVLSNKTSNSNDQNSSIPSAQQQ
FT                   ANNNINLATRAALSRLSSLQNLVNSNKRSRPDSESEESDDGEDEEDEDHDEPERVRKKS
FT                   KLIASTPIPKPIMTPLSGNGNKLRSNLIPWSSKAKPIIPKPIPAPDPTNENDEVKNKNP
FT                   REGAQVIDKSKNRLLSSLTDLVSKGLPDVKDKKTVAKKPLTIFGDSSDSEGHDDSDSSD
FT                   SD"
FT   gene            complement(<580080..>581423)
FT                   /locus_tag="CAWG_02597"
FT   mRNA            complement(<580080..>581423)
FT                   /locus_tag="CAWG_02597"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(580080..581423)
FT                   /codon_start=1
FT                   /gene_family="HOG000248233" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ43"
FT                   /protein_id="EEQ44332.1"
FT                   /translation="MEKLLLDRSLGRITPSRFSNIITENFYSEIYQLGKHDVFPGNCHD
FT                   NAAVNSLSLETTDYQYLLSGSNDSSIKLWDLKQQETIHEENEIDANLHLHPSTFDNFDY
FT                   DNPVSTFVNLATIPKRHHHKFGISCIQWWPYDTGMFASSSFDHTVKIWDTNELTPVHTF
FT                   DLSNKVYDIDISAENALIATANDQPFIRLLDLNSTSSAHTLSGHKGKTLVVKWHPINSN
FT                   ILASGGYDGEVKIWDIRRSQSCLTQLDMSRTNDSSYTTKLSKAHSGPVNGLVWDPSGSL
FT                   LYTVGNDDKIRVWDMVNVSTPPPINKLINFGPLIRNKHPHTIPLLLNPQGETETQFLLF
FT                   PSESGDVFIFRTIDGKLVNRLARKGSRNTGRTVSMCNGGPSTAKYFCGTIDGEIISWGP
FT                   CLDKPDLSELRQQDENNDFDDDEDINERLLKQFQLENKRKQFLESIEK"
FT   gene            <581711..>583099
FT                   /locus_tag="CAWG_02598"
FT   mRNA            <581711..>583099
FT                   /locus_tag="CAWG_02598"
FT                   /product="seryl-tRNA synthetase"
FT   CDS_pept        581711..583099
FT                   /codon_start=1
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02598"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="GOA:C4YQ44"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR018156"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ44"
FT                   /protein_id="EEQ44333.1"
FT                   /translation="MLDINAFLVEKGGDPEIIKASQKKRGDSVELVDEIIAEYKEWVKL
FT                   RFDLDEHNKKLNSVQKEIGKRFKAKEDAKDLIAEKEKLSNEKKEIIEKEAEADKNLRSK
FT                   INQVGNIVHESVVDSQDEENNELVRTWTPENYKKPEQIAAATGAPAKLSHHEVLLRLDG
FT                   YDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTA
FT                   QLSQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRRE
FT                   AGSHGKDAWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIV
FT                   SGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQEKKYVH
FT                   CLNSTLSATERTICCILENYQKEDGLVIPEVLRKYIPGEPEFIPYIKELPKNTTSVKKA
FT                   KGKN"
FT   gene            <583521..>583835
FT                   /locus_tag="CAWG_02599"
FT   mRNA            <583521..>583835
FT                   /locus_tag="CAWG_02599"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        583521..583835
FT                   /codon_start=1
FT                   /gene_family="HOG000093858" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEJ8"
FT                   /protein_id="EEQ44334.1"
FT                   /translation="MSNMESSHVNNVESPPEYVSQPPPKYVPRQSSSSSSSISDQESDI
FT                   HNPPQKASENQLSTCCSDCWCNCFDSCSGTNCTASDKNICGSILVVLCCGSTIGYATNA
FT                   "
FT   gene            <584576..>585352
FT                   /locus_tag="CAWG_02600"
FT   mRNA            <584576..>585352
FT                   /locus_tag="CAWG_02600"
FT                   /product="hypothetical protein"
FT   CDS_pept        584576..585352
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02600"
FT                   /product="hypothetical protein"
FT                   /note="similar to short chain dehydrogenase"
FT                   /db_xref="GOA:C4YQ46"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ46"
FT                   /protein_id="EEQ44335.1"
FT                   /translation="MSSITLAPESQIKGKTAIITGGTKHLGGETARELAKLGANLFLHY
FT                   RSDANQAETFKQELTKEFPDLKIEIYGSKLDKAEDLTKLFTTAKSKFPQGIDIAINNVG
FT                   KVLKKPITEISEEEFDEMDIANNKSAFFFIKEAGINLNDNERIVSIVTSLLAAYTDSYG
FT                   LYQGTKSGVEYYSKAASKELHGRGISVNCCAPGPMDTPFLYGQETEQSVAFFKTMGLHG
FT                   RLTKVSDIVPIVRFLVTEGGWMTGQTLYASGGFTAH"
FT   gene            complement(<585556..>587712)
FT                   /locus_tag="CAWG_02601"
FT   mRNA            complement(<585556..>587712)
FT                   /locus_tag="CAWG_02601"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(585556..587712)
FT                   /codon_start=1
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ47"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ47"
FT                   /protein_id="EEQ44336.1"
FT                   /translation="MVSLFREDPKHISKTINAHLPVDPRSLAKSVPLPNTEAPGFSPIY
FT                   RNAFSPDALLNVPYPGLDTLYKLFEYAVDVHGNKPALGSRVKNSDGTFGDYVFQNYDTI
FT                   RTRRNNLGSGIFFILQNNPYKTDSDAHKKLKYDPNSENSFILTIFSHNRPEWALCDLAS
FT                   VAYSITNTALYDTLGPDTSKYILNLTESPIVICSKDKIRGLIDMKNKYPEELSNLITLV
FT                   SMDDLTTEDSILKNYAHENNITVFDIKQVEKLGEINQLDPIPPTPETEFTITFTSGTTG
FT                   ANPKGVVLTHKNAAAGVTFLYCNFMGKENVRFYSFLPLAHIYERANIQFALSLGSAIGF
FT                   PQGPSPLTLLDDVKVLKPDLLALVPRVYTKLEAAIRAQTINNMEKPWLQSIFSTAINAK
FT                   MEAHAKKENEHTNPSFLVYDRILGLLKKKIGFDNVITMTTGSAPIAPETIKFLKAAVNV
FT                   GFAQGYGLSESFAGVMASSKYETESTSCGAISVTTEMKIRDIPEMGYSAHDKEGARGEL
FT                   LLRGPQIFKEYYKNPEETAKAVDEDGWFYTGDVACIDSEGKVKIIDRVKNFFKLAQGEY
FT                   VSPEKIEGLYLSQFPYIAQLFVHGDSLQTFLVGVVGLDPTTIGTYIKKRFKDEIVNQAD
FT                   IIEFFKSPRNRKVLLDDMNKSIGKHLQGFEKLHNIDISFEPLTVERNVITPTMKIRRPI
FT                   AANYFKQEIENMYNEGSLIRNNNL"
FT   gene            complement(<590447..>591451)
FT                   /locus_tag="CAWG_02602"
FT   mRNA            complement(<590447..>591451)
FT                   /locus_tag="CAWG_02602"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(590447..591451)
FT                   /codon_start=1
FT                   /gene_family="HOG000093859" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ48"
FT                   /protein_id="EEQ44337.1"
FT                   /translation="MAELRKIALSNSNLKNMASPSSSTPGSSGASSPQGNGMAKTDSLV
FT                   NLTQPELYGIFRNDSDTSLSKEFEEDSAEIEFKVNSRLNKSTGTTTSSSSSSEAKYSKN
FT                   EDFEKYLPLPLKIVVLTLASFIYNEVTSQINFNHTQSNYPLTIKHLFKISSYIHLDEYL
FT                   AFVGQSKYGYLIDETFALMIQGLVMASFHPILDYYLPKSLTKRLLSSNPNPSSSTSYST
FT                   LINDLIRSSVAFLGVSYAIRNIEWSSFLQVAIIYSLVSPGLWLLLDGTISGLIGSLVVS
FT                   IAACSVVYYQNYQYLNGVGDASPVELVAIWLWIGSFVFGGLIVFGKLGRFLFQ"
FT   gene            <592501..>595674
FT                   /locus_tag="CAWG_02603"
FT   mRNA            <592501..>595674
FT                   /locus_tag="CAWG_02603"
FT                   /product="hypothetical protein"
FT   CDS_pept        592501..595674
FT                   /codon_start=1
FT                   /gene_family="HOG000248222" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02603"
FT                   /product="hypothetical protein"
FT                   /note="similar to RNA polymerase III initiation factor
FT                   tfiiic"
FT                   /db_xref="GOA:C4YQ49"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ49"
FT                   /protein_id="EEQ44338.1"
FT                   /translation="MEEDNTGSHIRRSTRQQLKQQQRQQLELQQQQLAEEEEEEEEEQQ
FT                   IQLQQQKQKQLDQNQRTTKNQETPEYHNLKEEDFERLMEEMQIDKNDDGDDGSSDEYIF
FT                   SDESDDYDDYDNINNNNNGNNKIGGPILSDEPEEDDYDEDYNFKDALKGASNFRVRNRR
FT                   EKISKNSRSYYKRKMMRADNRELDPEVRSNLSQANEAFVRKDLQVAQQLYLEVIKKDPK
FT                   NFSAYKALGEISKAQGQLNECCNYWLLAANIHPWDTEFWGQVAQLSAELGHIDQAVYCY
FT                   GRAITPDIAKSCEFILQRAILYQERKQYGKALDGFQKVRQLYPKDSNIIKYLASVYSEQ
FT                   KRLNDAINLYMKVLDSNIHPERESNELYPKFDWAELNILLELHLQNHSWRMGLNVLKLA
FT                   SRWIQNRSQETWWDENEDLEFDSRQRFEVISTLSSQDQIDLAENKPFDLPIDIRFKLGC
FT                   LRLGLQQKDVAVQHFDYLLEEQDVSDLHFEAGKLLEEHGHYEDALKFLSKASEDEEFTI
FT                   SLELVQLLAKCYFEVGDYHESKQAYETLLQHDPDNLDFKLSLAENLYYLGDSAGAQSLI
FT                   RQVRQSKPKVHHKNGASIEEEEEEEEEDLNLDTAQSGNIRSLIPNEFKVHGKRKLTEQE
FT                   KEEIENNAKRKVLEKFGRMERLQESIDSGDRIAIGAWLQLASQLIEIFTNVKSFFPRDK
FT                   NRTFNGIVRYRRRKDMGLDEKLARAYNLLEGIVQDEHYTRHTLTNKTEYRGLSYDQWFD
FT                   IFAQYAVLISRYENNIDYADEIVDIALAVNVFIQDKRKETILRALKLAFGVRRNRVVDS
FT                   LFIYLRHFLNLNQFSPFIYKLFMCCYGSGIEYWEQFASYNHQKYFLRQLKSYDSCYTGK
FT                   NVSGMAHITTDLSGFKLGPHHLDLIYVYGNLLGGNKSYVSSLFYLNRAYKQYNQDPMLC
FT                   LILGLGHLHRSMQRLSANRHIQLLQGISYILEYKKLRQLNATIYELQEIEYNLGRLFHT
FT                   LGLFTLAVRHYEQVLAMKDDIVNSSKDNNDNYEYDMSWEAAYNLSLIYNIDGNPKLAKE
FT                   IIDKYLTIV"
FT   gene            <595929..>596501
FT                   /locus_tag="CAWG_02604"
FT   mRNA            <595929..>596501
FT                   /locus_tag="CAWG_02604"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        595929..596501
FT                   /codon_start=1
FT                   /gene_family="HOG000216538" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ50"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ50"
FT                   /protein_id="EEQ44339.1"
FT                   /translation="MVRIKHRYILFEILYPPTADTRVTPREDFNQFSQSESNALLTLHQ
FT                   SSPNSINVKTILNVIRKSLSDHYGDVGAGKAGMLLNVKYFSNRTSTGILRCGRDQSDYI
FT                   IGAMSLIEKMENNYVIIRCLHVSGTIKKCEEYSIERTKQLINVIKNKSKGKVDEYISQM
FT                   NEINHVEEDKEEEQEEKNQDDVRISKS"
FT   gene            complement(<596471..>597883)
FT                   /locus_tag="CAWG_02605"
FT   mRNA            complement(<596471..>597883)
FT                   /locus_tag="CAWG_02605"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(596471..597883)
FT                   /codon_start=1
FT                   /gene_family="HOG000248269" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ51"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ51"
FT                   /protein_id="EEQ44340.1"
FT                   /translation="MLIQPNHRRKPEFNERYYICRTIENYSTNFSIIVQYNRQISHNLL
FT                   SNALYSLIKKNSWFVQNFFQIDQRNPATANGHNFEVRILEHVKFNDVVKFHQIDKFDEI
FT                   IMESLNDHIFSMNNATLPLWKINVFEEMRPNGNQFISVSFDHSNYDGLSGVQFQKDLAK
FT                   ELSTAKDDLFYDVLFDYQRDFGNLPAKILPAVDNLTDLFDLGVLSSSSSILKKWVPFYD
FT                   TICGFIWPSDPPIFDTDTPVTKNLQTKYKFLKLTSNQIGQISKYCRSHGITLTTYFDII
FT                   CICALQETVFSVVKSSATHTSSLVAINGRRYYSDEIKNFLYGTLVCGAPIILPTIENKL
FT                   EAMQIFHQEMTNDINTKKSFQSTGNLLKHANVWEYFQNKINKIGGRFTLTISNLGKISN
FT                   SNDIFKFEQMYFVSNTGVVYNFVLNITTLPNGELTAVVGYIPEFEKYELNNKPIMDTFI
FT                   EKFYDLLILTSS"
FT   gene            <598568..>600112
FT                   /locus_tag="CAWG_02606"
FT   mRNA            <598568..>600112
FT                   /locus_tag="CAWG_02606"
FT                   /product="hypothetical protein"
FT   CDS_pept        598568..600112
FT                   /codon_start=1
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02606"
FT                   /product="hypothetical protein"
FT                   /note="similar to thiamine-phosphate
FT                   pyrophosphorylase/hydroxyethylthiazole kinase"
FT                   /db_xref="GOA:C4YQ52"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ52"
FT                   /protein_id="EEQ44341.1"
FT                   /translation="MTLSKMKVDYTLYLVTDSGMVPESSSFLKQVEDSINSGATIVQLR
FT                   EKSLSTLEFIKRAEQVHKLTQKQGIPLIINDRVDVALAVNAEGVHVGQDDMPAAIARKL
FT                   IGDDKILGVTCSNVTEVQEVVEQGIADYVGLGTVYKTNTKKDVTDPEGTGPSGIRRMLR
FT                   VLQKHNSKSGAKKIQSVAIGGINHSNVRNVMFQCAVPGEKINGVAVVSCIMANENAAEA
FT                   TLLLSQLISSAPYGYEPYEESQYLDDYQHSLKQLSSSSPMIHHITNNVVKNFSANVTLA
FT                   IGASPIMSEFDEEFNELASTPNTALVLNLGTPSKEMMKIFKNSIIAHQSRNPIVFDPVG
FT                   CGASKGRLKCCRQLLDTGYFAVIKGNVGEISALRKLTSSYRESQSKSYMRGVDSISNLT
FT                   EEEIIEIGKDVSIEFKAVVVITGPTNYIIEGEDKVVKVEGGNKLMGSITGSGCALGSTI
FT                   AAFVSSQARSPQGPNNFYAAVHAVKLYNKAGAAVSEKTPGKFMASFIDELYKLTHS"
FT   gene            complement(<600149..>601576)
FT                   /locus_tag="CAWG_02607"
FT   mRNA            complement(<600149..>601576)
FT                   /locus_tag="CAWG_02607"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(600149..601576)
FT                   /codon_start=1
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AEJ0"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEJ0"
FT                   /protein_id="EEQ44342.1"
FT                   /translation="MSEEKVDLDQIEENSLDTEAYLQKEIEDENNHAINYRNCSWQRTA
FT                   GLLFSEYICLAIMSFPWSYSVLGLGLGLIVTVIVSLLCLYTGLIIADYCAAYPHLTDVC
FT                   DIGRHLIGPKWVWYATAVAFLLNNTLIQALHVLVGAKYFNTISDNHTICSIVFGVVSAI
FT                   ICFLISLPRTFSHMSSVGYFSAITMFIAVVLAMAFVGVQSHPYGFKEGTPVHWRAWPAK
FT                   GEKYVNIMSAVLNIVYTFVGQITYPSFISQMKQPKDFKKALIVVTICELITFSLAGSII
FT                   YVYVGNAYVTAPAFGSLVGNYKKIAFSFALPTIIFLGALYSNVSSQFLFQKIFSKDSVH
FT                   RNSHTVAGWAVWIGLNGILWAIAFVIAEVIPFFSDLLSLMSSLFDCFFGFIFWALAFFR
FT                   LKRLYHYKKTGEKISLFQLFKQASIFQKVEYGLNVIIFGLGVYILGPGLYATIQSIIWS
FT                   YQASLYGKPFSCVSNAI"
FT   gene            <602233..>602643
FT                   /locus_tag="CAWG_02608"
FT   mRNA            <602233..>602643
FT                   /locus_tag="CAWG_02608"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT   CDS_pept        602233..602643
FT                   /codon_start=1
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02608"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="GOA:C4YQ54"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ54"
FT                   /protein_id="EEQ44343.1"
FT                   /translation="MVLVGITTTDTEDDIAKLSKKLLSLRVFEDLSEPPQTATKWYGKP
FT                   WAKSIVDIQGEILSVSQFTLYGTVKKGTKPDFHRAAKGHHAVEMYNKLLEQLRAGLGQE
FT                   KVKDGEFGAMMDVALVNDGPVTIVWDTQDSSL"
FT   gene            complement(<602744..>603154)
FT                   /locus_tag="CAWG_02609"
FT   mRNA            complement(<602744..>603154)
FT                   /locus_tag="CAWG_02609"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(602744..603154)
FT                   /codon_start=1
FT                   /gene_family="HOG000093860" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02609"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEV7"
FT                   /protein_id="EEQ44344.1"
FT                   /translation="MQRSWLQLISIVSRNIADDLKNNILNRPPILLILNPDSFEPPFTN
FT                   GFDEYFNVTSTALLGQYSNSKAANYAIVALSIVLAGLDIIYSIIRLSISTMLMGAFLGS
FT                   LLFFGLWFVVTASRRWKLVVLLFQNNDYNVLY"
FT   gene            <603411..>604505
FT                   /locus_tag="CAWG_02610"
FT   mRNA            <603411..>604505
FT                   /locus_tag="CAWG_02610"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        603411..604505
FT                   /codon_start=1
FT                   /gene_family="HOG000093861" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ56"
FT                   /protein_id="EEQ44345.1"
FT                   /translation="MKRQQEEPASQKEESVPQRKAVKYNQELTLLTLPTDILDLIFQDL
FT                   SRQDAINLSTLDHEHRNVLKAIVFSRIRASWNDMRSEIDGRTGFLKQHRHLVTQLRIVD
FT                   CDSYGEWNMDIFSDLLIDLPRLRHLLINSKFSSNWLKYRQDDNLQQLTLYFEPQDTRQV
FT                   PGEIVSSSSTTTTTINRIFSLEHIANFKMLTKLRLWHYHLYWEDVYPVLIVEDVELHNC
FT                   TWEFPFTLSQFNYNSNIRRLVVSYAEGNAFAVSERYREFLQYGNGEDFSSLEELTVTVA
FT                   RGSLNSSVMSRFMNTGNFPRLRALRVLAREGAYNLSHWFGKLPTNSTLRVLDMQVDYEA
FT                   RDRERALKEANRYFPFLDVKIHRP"
FT   gene            <604645..>605301
FT                   /locus_tag="CAWG_02611"
FT   mRNA            <604645..>605301
FT                   /locus_tag="CAWG_02611"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        604645..605301
FT                   /codon_start=1
FT                   /gene_family="HOG000248404" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEH6"
FT                   /protein_id="EEQ44346.1"
FT                   /translation="MYWVLLLFVSICMANTETCLVRVPEYYNIVPHPSPISRDARFSRE
FT                   LHRLNTTHTVLLDYPIGSIDDQDMSNIITVTYDTVAQPRSTLLVRVNNYGDNTFTNGDM
FT                   LNIKLCWPATMPYDFSIDHVYMHSNELVESVEDEFDLYVAVTYEFHAFSYDNGRFLQEE
FT                   TALSFQLYVNKLPSRFLPIPLELYDTIVYLVDITIFIVWNILPYLVKGVLEAVGQ"
FT   gene            <605577..>606497
FT                   /locus_tag="CAWG_02612"
FT   mRNA            <605577..>606497
FT                   /locus_tag="CAWG_02612"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        605577..606497
FT                   /codon_start=1
FT                   /gene_family="HOG000093863" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ58"
FT                   /protein_id="EEQ44347.1"
FT                   /translation="MVKEGHGAFPVPKANDIPPPANIKKIGALKRFSDEAYAKSLLYDA
FT                   ARLVAPIIHEQKFKVGKLYEMYPDKAELWGLNVNHGQKIYLRLREHHNDKSFLPMGDIV
FT                   GTLLHELTHNLYSAHDSKFYKFLDKLKSRYDDIHCRGAKTKYLCEENKVGRGVLLSGSL
FT                   VSVREQRLKELSKPKFANESKVLGSNSKINKPIGGSPRDLRQAILEAAERRLRDSKWCH
FT                   SENAETESVPKEDEYDTTQVELIGPTEGKPVGTFANDIIDLTSDTEETPIQPDNPKRRI
FT                   LHEIIDLTSDTEDIEPTSPEVICID"
FT   gene            <606682..>611025
FT                   /locus_tag="CAWG_02613"
FT   mRNA            <606682..>611025
FT                   /locus_tag="CAWG_02613"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        606682..611025
FT                   /codon_start=1
FT                   /gene_family="HOG000184622" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ59"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ59"
FT                   /protein_id="EEQ44348.1"
FT                   /translation="MSFARYIYYTIAVAVLLNFVKATENNNFKLELEASWSNIDFLPSF
FT                   IEAIVGFNDSLYEQTIETIFGLGDTEVELEDDASDQEIYSTVINSLGLTDQDLDFINFD
FT                   LTNKKHTPRIAAHYDHYSDVLTKFGDRLKSECAKDSFGNAVETKNGQIQTWLLYNDKIY
FT                   CSANDLFALRTDLSSHSTLLFDRIIGKSKDAPLVILYGSPTEESTKDFLKILYPDAKAG
FT                   KLKFVWRYIPSGIKKSDSISGYGVSLKMEKYDYSGAEGNPKYDLSRDFTRINDSQELVS
FT                   VNEKHSYELGVKLTSFILSNRYKSTKYDLLDTILTNFPKFIPYIARLPKLLNHEKVKSK
FT                   VLGNEDIGLSQDSYGIYINGSPINPLELDIYNLGTRIKEELQTVKDLVKLGFDTVQAKL
FT                   LIAKFALLSAVKQTQFRNGNTLMGNNENRFKVYENEFKKGSSEKGGVLFFNNIELDNTF
FT                   KEYTTDREEAYLGVGSHKLKPNQIPLLKENIHDLIFALNFGNKNQLRVFFTLSKVILDS
FT                   GIPQQVGVLPVIGDDPMDSLLAEKFYWIAEKSSTQEALAILYKYFESNSPDEVDDLLDK
FT                   VEVPEDYKVDYNHVLNKFSISTASVIFNGVIYDLRAPNWQIAMSKQISQDISLIKTFLR
FT                   QGPIEGRLKDVLYSNAKSERNLRIIPLEPSDIIYKKIDKELINNSIAFKKLDKAQGVSG
FT                   TFWLVSDFTKSAIITQLIDLLLLLKKKAIQIRIINTGDTDVFGKLKTKFKLTALTNGQI
FT                   DEIIEILKKSNASSANNDELKKMLETKQLPAHHSFLLFNSRYFRLDGNFGYEELDQIIE
FT                   FEVSQRLNLIPDIMEAYPDEFRSKKVSDFNSVLSGLDNMDWFDLVTSIVTKSFHVDEKR
FT                   FIVDVNRFDFSSLDFSNSIDVTTYEENSPVDVLIILNPMDEYSQKLISLVNSITDFSFL
FT                   NIRILLQPRVDSKEEIKIHKFYRGVYPQPTPKFDSNGKWIQHYSAQFESIPSNVTYSTE
FT                   LDVPHKWIVVPQSSSMDLNTINFSESHSVDAKYSLKNILIEGYARDIHTGKAPDGLIFR
FT                   AFNKNYSTDTLVMTSLDYFQIKAYPSIFNFSTISNDTLLSASENKYQANTEELESIEVP
FT                   VFKIDGSTIYPRVMKSGNNKPMSTRKHADINIFTIAGGQLYEKLTSIMIASVRKHNPSS
FT                   TIKFWILEDFVTPQFKHLVELISVKYNVEYEFISYKWPNFLRKQKTKERMIWGYKILFL
FT                   DVLFPQDLNKIIFIDADQICRADLTELVNMDLEGAPYGFTPMCDSREEMEGFRFWKEGY
FT                   WSDVLKDDLKYHISALFVVDLQKFRSIKAGDRLRAHYQKLSSDPNSLSNLDQDLPNNMQ
FT                   RSIKIFSLPQNWLWCETWCSDKSLEDAKMIDLCNNPLTRENKLDAAKRLIPEWIEYEQE
FT                   IEPLVSLVQNNTAKEVVQEIEIDTDGEQEEQKQESNDDDFIHDEL"
FT   gene            <611513..>613357
FT                   /locus_tag="CAWG_02614"
FT   mRNA            <611513..>613357
FT                   /locus_tag="CAWG_02614"
FT                   /product="methylenetetrahydrofolate reductase 2"
FT   CDS_pept        611513..613357
FT                   /codon_start=1
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02614"
FT                   /product="methylenetetrahydrofolate reductase 2"
FT                   /db_xref="GOA:Q5AEI0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEI0"
FT                   /protein_id="EEQ44349.1"
FT                   /translation="MKISEKLTQAHKGSNPPPATFSFEFFVPKTSQGVQNLYDRMDRMY
FT                   DLNPIFIDITWNAGGRSSTLTNEMVYTAQSTLGLETCMHLTCTNMKVELIDEALEKAFK
FT                   SGCQNILALRGDPPLDGSESTGDFKYAKDLIKYIHEKYDNHFNIGVAGYPEGHPEEEDE
FT                   QKTLRYLKEKCDAGADFIITQMFYDVDNFISWCSKLRKIGVDIPIIPGIMPISTYAAFI
FT                   RRAKWSEIAIPQHFLDALDPIKDDDFLVRERGTELVSEMCNKLLQSGYVNHLHFYTMNL
FT                   EKATVMILEKLNLIEAIKSHDVVGGSELPWRKSLHPERSKESIRPIFWQHRKYSYISRT
FT                   ATWDEFPNGRWGDSRSPAFGDIDLCASELLRQSPKKAFELWGLPQSLAELSGIIINYLK
FT                   GDLKSLPWSDGPVGDDTKVIVDDLIYLNQHGFFTMNSQPALNAVKSSEKVFGWGPKNGY
FT                   VYQKQYLEFFCHKDVVSKLLDHVEEFNVKGAESSSAFISYYAVDKDGNLSTNCKDDDIN
FT                   AVTWGVFPGEEILQPTIVEKTSFLAWKDEVYRLFTEWAKIASSNLVEANQTQVDEFVQL
FT                   MKKFGDEFVLCNLVNNDFVDGNSTLFDLIKRLNIDDLN"
FT   gene            <614333..>614917
FT                   /locus_tag="CAWG_02615"
FT   mRNA            <614333..>614917
FT                   /locus_tag="CAWG_02615"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        614333..614917
FT                   /codon_start=1
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEI1"
FT                   /protein_id="EEQ44350.1"
FT                   /translation="MSGGPVPVWKKYTTRPQGIWEKIRQLLVLVPNRSSGNPLVSLFRQ
FT                   VPPGERIKEAQNYKDPVTIPAGDIKGNPYFKRDYRRNYPQVHTFNQTKISGLLNLGSES
FT                   NPRISIGEKGNKELAVFTNGQDVSLASTLKSVPASVVKGEVLGKSGEPIVAPSLNKFKW
FT                   EILPEPVHGMYSEAYPCRIFTEKKVRSQSSA"
FT   gene            complement(<614957..>615481)
FT                   /locus_tag="CAWG_02616"
FT   mRNA            complement(<614957..>615481)
FT                   /locus_tag="CAWG_02616"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(614957..615481)
FT                   /codon_start=1
FT                   /gene_family="HOG000093862" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ62"
FT                   /protein_id="EEQ44351.1"
FT                   /translation="MITNQQFNDNIEEFILIMLANLKLKGTDFEFSVNNNYVNKWNIDK
FT                   MYSFVSVSVKQLRIDFTISFDDLYGVPLLNMRLYDNDMFLTSPMAQRTLAVGICPVDLH
FT                   NHHLLQQPWLQVHPCETLQTIDSHLKNTPICKYNSVIQYLCCWFGLYGLPSIFPQFSVR
FT                   PNIYINNVQSC"
FT   gene            complement(<615971..>616360)
FT                   /locus_tag="CAWG_02617"
FT   mRNA            complement(<615971..>616360)
FT                   /locus_tag="CAWG_02617"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(615971..616360)
FT                   /codon_start=1
FT                   /gene_family="HOG000248406" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEI3"
FT                   /protein_id="EEQ44352.1"
FT                   /translation="MSYSEEDPLSEPKNTQQLDLSKLSPQELRIYKMYGKLPTTQQILS
FT                   SKFQDKKYFDSGDYAMQKQMGGGLKSGIPGGMSMKHPNAERMKEMSVRNSISATNAQVL
FT                   LNGKSGLLNERTVGKDDNGEEQNKQ"
FT   gene            complement(<616610..>617266)
FT                   /locus_tag="CAWG_02618"
FT   mRNA            complement(<616610..>617266)
FT                   /locus_tag="CAWG_02618"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(616610..617266)
FT                   /codon_start=1
FT                   /gene_family="HOG000248404" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ64"
FT                   /protein_id="EEQ44353.1"
FT                   /translation="MYWVLLLFVSICMANTETCLVRVPEYYNIVPHPSPISRDARFSRE
FT                   LHRLNTTHTVLLDYPIGSIDDQDMSNIITVTYDTVAQPRSTLLVRVNNYGDNTFTNGDM
FT                   LNIKLCWPATIPYDFSIDHVYMHSNELVESVEDEFDLYVAVTYEFHAFSYDNGRFLQEE
FT                   TALSFQLYVNKLPSRFLPIPLELYDTIVYLVDITIFIVWNILPYLVKGVLEAVGQ"
FT   gene            complement(<617406..>618500)
FT                   /locus_tag="CAWG_02619"
FT   mRNA            complement(<617406..>618500)
FT                   /locus_tag="CAWG_02619"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(617406..618500)
FT                   /codon_start=1
FT                   /gene_family="HOG000093861" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ56"
FT                   /protein_id="EEQ44354.1"
FT                   /translation="MKRQQEEPASQKEESVPQRKAVKYNQELTLLTLPTDILDLIFQDL
FT                   SRQDAINLSTLDHEHRNVLKAIVFSRIRASWNDMRSEIDGRTGFLKQHRHLVTQLRIVD
FT                   CDSYGEWNMDIFSDLLIDLPRLRHLLINSKFSSNWLKYRQDDNLQQLTLYFEPQDTRQV
FT                   PGEIVSSSSTTTTTINRIFSLEHIANFKMLTKLRLWHYHLYWEDVYPVLIVEDVELHNC
FT                   TWEFPFTLSQFNYNSNIRRLVVSYAEGNAFAVSERYREFLQYGNGEDFSSLEELTVTVA
FT                   RGSLNSSVMSRFMNTGNFPRLRALRVLAREGAYNLSHWFGKLPTNSTLRVLDMQVDYEA
FT                   RDRERALKEANRYFPFLDVKIHRP"
FT   gene            <618757..>619167
FT                   /locus_tag="CAWG_02620"
FT   mRNA            <618757..>619167
FT                   /locus_tag="CAWG_02620"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        618757..619167
FT                   /codon_start=1
FT                   /gene_family="HOG000093860" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEV7"
FT                   /protein_id="EEQ44355.1"
FT                   /translation="MQRSWLQLISIVSRNIADDLKNNILNRPPILLILNPDSFEPPFTN
FT                   GFDEYFNVTSTALLGQYSNSKAANYAIVALSIVLAGLDIIYSIIRLSISTMLMGAFLGS
FT                   LLFFGLWFVVTASRRWKLVVLLFQNNDYNVLY"
FT   gene            complement(<619268..>619678)
FT                   /locus_tag="CAWG_02621"
FT   mRNA            complement(<619268..>619678)
FT                   /locus_tag="CAWG_02621"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT   CDS_pept        complement(619268..619678)
FT                   /codon_start=1
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02621"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="GOA:C4YQ54"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ54"
FT                   /protein_id="EEQ44356.1"
FT                   /translation="MVLVGITTTDTEDDIAKLSKKLLSLRVFEDLSEPPQTATKWYGKP
FT                   WAKSIVDIQGEILSVSQFTLYGTVKKGTKPDFHRAAKGHHAVEMYNKLLEQLRAGLGQE
FT                   KVKDGEFGAMMDVALVNDGPVTIVWDTQDSSL"
FT   gene            <619839..>620340
FT                   /locus_tag="CAWG_02622"
FT                   /note="predicted protein; frameshift"
FT   gene            complement(<620075..>621487)
FT                   /locus_tag="CAWG_02623"
FT   mRNA            complement(<620075..>621487)
FT                   /locus_tag="CAWG_02623"
FT                   /product="extracellular matrix protein 14 precursor"
FT   CDS_pept        complement(620075..621487)
FT                   /codon_start=1
FT                   /gene_family="HOG000214206" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02623"
FT                   /product="extracellular matrix protein 14 precursor"
FT                   /db_xref="GOA:C4YQ68"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ68"
FT                   /protein_id="EEQ44357.1"
FT                   /translation="MNCIKLISLLLIQLVVTHQIQIPFNFNGLFSSKDVTRPHYTSVDP
FT                   QYHPIDLSQYNDKHVVRIDYSNDPDLGKYLISSPLRGDANVHFAKWSHASNLKTIDIQI
FT                   DKESLAKLHEMFPSMSFKVIVGDLAQKIFETYPSQVNQLNEDPVVANELFFKEYRSLET
FT                   IDAWLGLLQATYPDIISVEEIGETYEHRKYKVVHFTVPSSEGNDDHGDRRTVVVSGGIH
FT                   AREWISTSSVLYSIYALIEFYKNAPDSDIWSKLDFIFIPVSNPDGYEYTWTTDRLWRKN
FT                   RQPTIHPKCFGIDIDHSYDYHWTRSSDWACGEEYSGEAPFEAFESQIWTEYLNNTNANH
FT                   KIWGYIDLHSYSQEILYPYAFSCNEQPRDEENLLEVAWGLAKAIRMQSGTSYNVLPACI
FT                   DRDADLMLDLGSGTALDYMYHHRADYAFQLKLRDTGNHGFLLPAKYIEPVGREVVAALK
FT                   YLCNFLVDEQSQ"
FT   gene            <622247..>623830
FT                   /locus_tag="CAWG_02624"
FT   mRNA            <622247..>623830
FT                   /locus_tag="CAWG_02624"
FT                   /product="D-lactate dehydrogenase 2, mitochondrial
FT                   precursor"
FT   CDS_pept        622247..623830
FT                   /codon_start=1
FT                   /gene_family="HOG000230997" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02624"
FT                   /product="D-lactate dehydrogenase 2, mitochondrial
FT                   precursor"
FT                   /db_xref="GOA:C4YQ69"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ69"
FT                   /protein_id="EEQ44358.1"
FT                   /translation="MQRRLVQTASYLIRRNNVACRFSRYNGLPVASYSTKTVPFTADTY
FT                   SQKVQRDAKFKQLESQDIEYFKSVLPENSIITDEDDLLFFNEDWMRKYRGQSQLVLKPK
FT                   TTEQVASILKYCNDNKLAVVPQGGNTGLVGGSNPIFDEIIISLSAMNKIRSFDPVSGIL
FT                   KVDAGVILETADQYLAEQGYIFPLDLGAKGSCHVGGNVACNAGGLRLLRYGSLHGSVLG
FT                   LEAVLPDGTVYNSMHSLRKDNTGYDLKQLFIGSEGTLGIITGVSILCPSRPQAQNVAFL
FT                   AVSSYEAVQKVFVQARKELQEILSAFEFMDNTSQKLTAKHLGLEHPIESGDFPFYVLIE
FT                   TSGSNKEHDDEKLETFLGNAMEEGLVDDGIIAQDEAQIQSLWSWRESIPEATTIGGGVY
FT                   KYDVSIPLADLYGLVEDINTRLNDAGIASLDDESKPVLAALGYGHIGDGNLHLNVSVRK
FT                   YSPEIETILEPFVYEWIAKKNGSISAEHGLGFQKKNYIGYSKNEIEVKLIKEIKQHYDP
FT                   NGIMNPYKYV"
FT   gene            complement(<624500..>626863)
FT                   /locus_tag="CAWG_02625"
FT   mRNA            complement(<624500..>626863)
FT                   /locus_tag="CAWG_02625"
FT                   /product="predicted protein"
FT   CDS_pept        complement(624500..626863)
FT                   /codon_start=1
FT                   /gene_family="HOG000093864" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02625"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ70"
FT                   /protein_id="EEQ44359.1"
FT                   /translation="MKLESIAVFAGIVSTALAGVYHKPPPATTYWTTIYAPSTSVVTVT
FT                   SCSKGGCGTQSYATGVTKTKTVHEGVTTEYTTYCPLTTSHEVVKSTCSNTLVVWSTRSF
FT                   SWVWSFSKPDGCGQSTSTIKTTAQTDVPTTATATPSVSTTCTTGTKTKWWWVIKTTDCS
FT                   VYTVSSTSSSLISTSQVTSSSSIASTTATAPATPSVSTTCTTGTKTKWWWVIKTTDCSV
FT                   YTVSSTSSSLISTSKATSSSSVASSTGSTPATTPGSSTESTPATATGSSTKSTPATTPG
FT                   SSVTTGKTSTDWITSFTTHTAHTTTVITVTDCDHHTCTPTVVTTGVTVITVTTTGTVTE
FT                   YTTYCPLTSTETIVTSESTAVTTPGSSSSIESTPATTPGSSSTTTPGSSSATTPGSSTA
FT                   TTPGSSSVKSTPGTSTGSCWVSVSTGGYGHKTTVTICSDVSSTPGSSSATTPGSSSATT
FT                   PGTSSVESTPGSSSATTPGSSSVESTSGSSSATTPGSSSATTPGSSSATTPGSSSATTP
FT                   GSSSATTPGSSSVESTLGSSSATTPGSSTIESTSGSSSATTPGSSSATTPGTSSVESTP
FT                   GSSSATTPGSSSVESTPGTSTGSCWISVSTSGYGYETTVTICSDVTSGQSVTTPTTISV
FT                   PSTFCTTVPTAGTDETVITSYVTSTAHSTEVITVTSCADNGCQTHTTHTGVVVVTVTTT
FT                   DVATTYTTYCPLTTTKAVYRVAKLANYKRDQTEFIATETNENTSNWPAPTLVPYVGISN
FT                   DSSAAVSTFEGAANSVVPRLGLIAGFFSALLFLF"
FT   gene            <632136..>632618
FT                   /locus_tag="CAWG_02626"
FT   mRNA            <632136..>632618
FT                   /locus_tag="CAWG_02626"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        632136..632618
FT                   /codon_start=1
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ71"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ71"
FT                   /protein_id="EEQ44360.1"
FT                   /translation="MTIYSFFIFDRHCNCIYNREYTHTASSNDTLSGQINKSNDSNSSK
FT                   LLFGILYSLKTISNKLANDEETEMNELKSFTIGSFKVHFWESLSRFKFVIVTNGEVSQL
FT                   SDVLFELYSNYFIKYVVKNGLMPVEFTAEGEYSKINNGKFIEETDNYLQSLSIFRT"
FT   gene            <633337..>634854
FT                   /locus_tag="CAWG_02627"
FT   mRNA            <633337..>634854
FT                   /locus_tag="CAWG_02627"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        633337..634854
FT                   /codon_start=1
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ72"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ72"
FT                   /protein_id="EEQ44361.1"
FT                   /translation="MAVSLDPRPTIFTSSHHEIIVVTLICLAQFFTQAGITLSLSTMNI
FT                   ILKSFDTIDSAKQVWFMGSYALTVGTFILISGKLGDLLGLKLIFVIGWIWTTVFSAITG
FT                   LSNYVSVEFFIICRALQGIGFALLIPCGMGILGNIYPNGERKNLVFGCVGANGPAGAFF
FT                   GAFIAALIAQLWWWPWIFWLLSIGCVVLTIISIIYIPPITHHKLESYSEFFKRIDPLGT
FT                   LTGIIGLILFNFVWTQGPVVGWNTAYIIALLIIAVLSIVAFFIIELYIAEYPLVPKSVF
FT                   NLKIGMVLACISCGWGSFGIWQYYYWNIILNLRKYTPIAGSLTYVPFLVMGIIAAIASS
FT                   IIISHTKPSYIISFSTICFMVGCLMLSVTPIQQSYFRLTLGQMFILCWAMDMSFPAASI
FT                   ILSDYLPNHHQGMAGSLVSTVINYSVSLFLGMSSCVETEIKLSTHNVLLSYRSGLYFGI
FT                   GVASLGIFCSLIFIFVQRNDGKGTNALLVDSEEEIIRESTEDVMEKK"
FT   gene            <635067..>636317
FT                   /locus_tag="CAWG_02628"
FT   mRNA            <635067..>636317
FT                   /locus_tag="CAWG_02628"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        635067..636317
FT                   /codon_start=1
FT                   /gene_family="HOG000093865" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ73"
FT                   /protein_id="EEQ44362.1"
FT                   /translation="MKLITLLGLLPFTLARTFHIATNQNVACLEIKAPTTISLTKTIGT
FT                   ASGENPPVLIFNYDEKLLLPIPNFDYLVTDGKIDDYFNEEGFTFAKGFIGSSYNDILID
FT                   KLTYDVTTPGTYCIYSPLIDGYEYRVDVEESSIQFDNVVFCIVNIIVNLFYNQFFSRQN
FT                   KVLFKLIGKFELTKVGIFAVSLLLLLRFNIINYTEDIVSAVDDVFTMVFLMGYGTLYSS
FT                   YKDQDIGKIVIVTLFTVTPAISSRFFDLKSDVTNLVINNEYYNVVDGVLGSGKFDGLSV
FT                   VQRIVRDVKAHRFSAVVAALFGVSKLVKFTMYIATIRQTLNKLTPGGTKSGYIYTVVLW
FT                   LFVYPFASFAFYPDLVYNYYLVTDYGSVLKQFLLESVRDKYIVLMADECHWVLIFLIWF
FT                   VGNNGLTVEPTSSKKDE"
FT   gene            <636646..>638499
FT                   /locus_tag="CAWG_02629"
FT   mRNA            <636646..>638499
FT                   /locus_tag="CAWG_02629"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        636646..638499
FT                   /codon_start=1
FT                   /gene_family="HOG000093869" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ74"
FT                   /protein_id="EEQ44363.1"
FT                   /translation="MTTPSYTKNLNMNTKSSKEQTRSKRPLSEISPNLRRDPLKKRRNS
FT                   LGFEMASIPSNSIKSFPSRIPPPTASKSATIASSSSSSSSMSSLSSIPQAILSIQERLR
FT                   RKASVNDNNGQSSSSFAARPQSTVSRSNELQEEYYSLNELYKQQASSYEKLEVELGKLK
FT                   EIYKNYYYKIDLINDLVHQKQSEFEILEHDIINDVEQEEKLTYSKLHENKIKLDGQFKE
FT                   LEFEMLNQLEDAKQFDFKELLTKIESLKTEKMTVLSEYEKVMSEVNAKLNAEREQFSKD
FT                   LEDKLHPLNKNKQLINDQLINKKDELTKLETNYNELKDQLAERNDSIDSIKHEIANIEQ
FT                   EMNNYQATRKNLELKLSEAESELHEALAKDKQEQREYDNVRSEYSVLHSKIAKHDEHRR
FT                   ILENSIMKIQGKFRVYAIGEDLDTYNKCFAKDTPSSFIIDEFQCLVQSTLKGHNVAIIN
FT                   NYLRGSQIVIDSYKNIQRQQKYIYQCISIKNGDKNTDICDLLNSNAPVDSLFQHQQMVI
FT                   DDFDQFKQIVKKIDATLSQEIAIHIISTDKSKLMIIDCSRIDPDQQDKILEKFKSNSSL
FT                   GFLEKLLTWIYHNCSTLFLYEPKTSQSNSLLKFINSIDSPI"
FT   gene            complement(<638552..>640042)
FT                   /locus_tag="CAWG_02630"
FT   mRNA            complement(<638552..>640042)
FT                   /locus_tag="CAWG_02630"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(638552..640042)
FT                   /codon_start=1
FT                   /gene_family="HOG000093870" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ75"
FT                   /protein_id="EEQ44364.1"
FT                   /translation="MTSQIADGSSTTTINPLKNGLAALKPTHQAHGTSTTTHLTNGSPK
FT                   KIKSYKRLELERLIREFQNKLGKNWEKYHETLSLFLIGKLSRAELISTITPILKGKNLL
FT                   KYHNKLLLLNFANSLKDNSSDLSTEFAGFWNKKAGKVTKNKNTQFERFKSVIMGLPVKE
FT                   RKRIIDISRDSGKKGKIATDIILTRHAILPKIPMIQDKEQQQLQVNNLVQWQQDVLNGI
FT                   NTPIATENYEIPDYDNLSRMMLMIMREHGLTGGLNPGVMEVMLLGLESHLKNIVETAID
FT                   VAKYRKNKYTNDNYIPYIKPNEDAQNISNENALPSSKDITLCIEDLHDTLEMYPHLVES
FT                   EGPKLRLSNVMLENDDMINDDLNYYLPPKSIEYLAKERQAATTNNASTGTTKPGNNKGS
FT                   SAGGSSAGATTNSPVVNKTDSMAAVSEKTDTNQPLQTPTATQTPVQTSAQAPASAPAQT
FT                   PAPAQTPAPVSTPILRPDAHIGTTDELKWVLHDLVSTM"
FT   gene            <641450..>642985
FT                   /locus_tag="CAWG_02631"
FT   mRNA            <641450..>642985
FT                   /locus_tag="CAWG_02631"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        641450..642985
FT                   /codon_start=1
FT                   /gene_family="HOG000093871" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ76"
FT                   /protein_id="EEQ44365.1"
FT                   /translation="MSHDDSNSNSNPSSNPTSNPVSKPSDMGRSSNDSGSEPSIQHFTL
FT                   ATLEPQGDEEDMEMGEPISRQSTFLERVQSRYSFFHENLRAQRKELSMKYLKIYLVMAI
FT                   GCLGVFSIYWGSMYQRETRIKNLKMLVVLEDEEINGIPPLFGNQLRDLLATPTARTLGD
FT                   WKIYNTSEFETIASKHNNTINEEVIRQIHHQNYWASIYVKQNSSYNIYNALANGNQYNV
FT                   SDSVYCYYETGRHLTSVGPYVVASIDAIQTMWLDQNSVMRDIVRIGNITLDNANSVAVA
FT                   TTALAFQIIDMRPSTSGVLVAALQIGLLYLVIVSFFSFNFFVDIHRSVALMVKQRNFLL
FT                   YRVFASIISYFVISLMFGLVTLAFQVDFAVTFGKSGFLVYWMVTFLTMWSVGLANELAA
FT                   MLILTIYPPMVGFWLIFWVIINITPTFTPIALLPEFYRYGYAMPLHNAFEIYSVIFFNT
FT                   YKGLIGRSIGIIIAWVVFLTLMAPIVVVYFGSTMSKKAAAAAAAAKKEKEKSK"
FT   gene            complement(<643785..>645362)
FT                   /locus_tag="CAWG_02632"
FT   mRNA            complement(<643785..>645362)
FT                   /locus_tag="CAWG_02632"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(643785..645362)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ77"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ77"
FT                   /protein_id="EEQ44366.1"
FT                   /translation="MTEKKELENQTNIQPIISFTKEDIEDNKPHVLTTIISSSGKEIAI
FT                   TNDVDQAMKLALEHKGETIEVDSVQASKLLRKIDLYLLPVMCLLYCFQFMDKLTTSYAS
FT                   VLGLRKELKMQGDMYSWTATAFYLGYLVFEFPVSMLLQRFPVAKTVSVFIILWGMILAL
FT                   HSVPQYPGFVALRTILGMLESSVTPAFTIITSQWYRKEEQFLRTAWWFASNGIGTIVGS
FT                   AIAYGLFENNGNYSLPAWKLVFVVTGCLTIFLGFIIMVHIPDTPAGAWFLTDEEKLMVV
FT                   ERIRTNQQGFGNTHFKKHQFIEALTDHRTWLFFLFALSGNIPNGGLTSFGTILLNEDFG
FT                   YTPSKSLLIQMPQGAVEIVGCVLFAWVCKFFPSRMLMGIITTSIAVLANCLLAFCKGTS
FT                   ARLAGFYLNLLGPLGFICCLSCVSSNVAGHTKKVTTNAMFLIAYYVGNLIGPQTFISTQ
FT                   APGYTGAKVAIVVCGFVSLFTLIAIYVSYYIENKKRNSRPPVDMSHIENYEFADLTDKE
FT                   NPNFRYSI"
FT   gene            complement(<646237..>647757)
FT                   /locus_tag="CAWG_02633"
FT   mRNA            complement(<646237..>647757)
FT                   /locus_tag="CAWG_02633"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(646237..647757)
FT                   /codon_start=1
FT                   /gene_family="HOG000093872" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ78"
FT                   /protein_id="EEQ44367.1"
FT                   /translation="MGVFGRGAASRISIRSIHLRNTANFVVPENYKPNRSLLKQLPWKA
FT                   GLDIWWKSLSPNRLSDLQKDLVEFMLPSHLQENQRIIKEFKKTTIDDKGNYINEVGFKI
FT                   INNKDKPTKHLVFIHGYGASLGCFARNFQIINKFKDTDYNYHVHFLDNLTFGLSSNPRV
FT                   NNDTINYWRIPATAIVKLFDKTPTDSKKLYRKYYKLIEGYQLDPENFEKYRSYFTPILK
FT                   DLENFYCSAIEKWRLNSDIESIDYLVGHSFGGYWCGSYALKYPENVNNLVLLSPVGIER
FT                   HVQAVTNTDPISDRIEVPTLDPTSYKFLSRLPILSKKHVLSWYYKLPHLPRLLPFLGPW
FT                   GAQLYFKMWMGKLYKINKLIDKHGGAQAIFNSNNDLVYGSEKELTLIIEYLYNSITSGT
FT                   NSDIYSRYLLTTATTSKWPLYDKFYQAVKEDPAKLKFKFHIMYGQFDFMNSEAGEKLVK
FT                   LLNENKVGAKYYEINEGGHNLYIDNPFDTNQKIFEIVSQDATKAYNND"
FT   gene            <647783..>648089
FT                   /locus_tag="CAWG_02634"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            complement(<648086..>649798)
FT                   /locus_tag="CAWG_02635"
FT   mRNA            complement(<648086..>649798)
FT                   /locus_tag="CAWG_02635"
FT                   /product="uracil permease"
FT   CDS_pept        complement(648086..649798)
FT                   /codon_start=1
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02635"
FT                   /product="uracil permease"
FT                   /db_xref="GOA:C4YQ79"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ79"
FT                   /protein_id="EEQ44368.1"
FT                   /translation="MNKPKSFWKKLVVSMEVQPKGDLSTAQMFLYNHDLRPVEEARREW
FT                   AWYNYVFFWIADSFNINTWQIAATGIQAGGMNWWQTWISVWLGYALCGIFVSIGARVGT
FT                   LYHISFPVAARSSFGIYGSLWPVLNRVFMSCIWYSVQTAIAGPTFELMLHSIFGKNLPQ
FT                   RIHDTIPDKDLTTFQFLGIFLFWLFQLPFLWFPPHKIRHLFTVKAYVAPIAGIAFLVWT
FT                   IVKAGGIGPVVHQKSKVHGSELAWVFVESTMNSLGNFATLIVNAPDFSRFASQPSFGMK
FT                   YLVYTLSIPICFSITSLIGILVTSASEAMYGKPFWSPLDVLGTFLNDYTPGNRAGVFFI
FT                   SAAFALAQLGTNISANSLSFGTDCSALLPRFLNIRRGGYICAFLALAICPWKLISTSSK
FT                   FTTYLSAYSVFLSSVAGVVACDYFYVRRGFISLIDLYSLTNPDNKHQDSIYRYNKIGVN
FT                   WRAYVAYICGILPNIVGFVGATETHKVPIGATQVYRLNFFMGFFTAWIIYSVLCYFFPV
FT                   PTGTVKVGPFEKGWFEEWQDVETFDEELVGHEVHDGIEKIEYLEESVSSKKKI"
FT   gene            <650782..>651168
FT                   /locus_tag="CAWG_02636"
FT   mRNA            <650782..>651168
FT                   /locus_tag="CAWG_02636"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        650782..651168
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ80"
FT                   /protein_id="EEQ44369.1"
FT                   /translation="MVHGVAKKKAPFGARFLMGLLMGSIDDAFYIPDLKKNLKYLENII
FT                   HKQHEKGSKYFVGDKLSGADIILEFPVITNIFQNKRGAEQLGAGDVEKEYPHLNQWAED
FT                   IKKEPKYIKAQELVAKHETVKPNI"
FT   gene            complement(<651236..>652087)
FT                   /locus_tag="CAWG_02637"
FT   mRNA            complement(<651236..>652087)
FT                   /locus_tag="CAWG_02637"
FT                   /product="prohibitin"
FT   CDS_pept        complement(651236..652087)
FT                   /codon_start=1
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02637"
FT                   /product="prohibitin"
FT                   /db_xref="GOA:C4YQ81"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ81"
FT                   /protein_id="EEQ44370.1"
FT                   /translation="MSQRIADFVSKIALPAGITIALAQSALYDVPGGKRAVIFDRLKGV
FT                   KQGVIGEGTHFLVPWLQKAVIFDVRVEPRVITTTTGSKDLQNVSLTLRVLSRPEVRKLP
FT                   TIYQTLGLDYGERVLPAIGNEILKSIVAQFDAAELITQREVVSARIRQELSRRAAEFNI
FT                   ELEDVSITHMTFGREFTKAVEKKQIAQQDAERSKFLVERAEQEKKAAIIRAEGEAESAD
FT                   VVSKALAKAGDGLLMIRRLEASKDIASTLANSPNITYLPNGGAGGGDSDGSKNSLLLNI
FT                   GR"
FT   gene            <653885..>654307
FT                   /locus_tag="CAWG_02638"
FT   mRNA            <653885..>654307
FT                   /locus_tag="CAWG_02638"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        653885..654307
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEB2"
FT                   /protein_id="EEQ44371.1"
FT                   /translation="MALLINSVAKHVAPFATKAVVKIITKAINNGYYKHEWYLNFQYLE
FT                   DRLAQNGTGFFVGNKLTGADVILSFPVYENVFDNPGGVREICGEKRDLRKVYPHLAKWS
FT                   RMIKNNPTYKRVTEMMNEEVEDLIAMNPRFDYGKEK"
FT   gene            <654850..>656121
FT                   /locus_tag="CAWG_02639"
FT   mRNA            <654850..>656121
FT                   /locus_tag="CAWG_02639"
FT                   /product="hypothetical protein"
FT   CDS_pept        654850..656121
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02639"
FT                   /product="hypothetical protein"
FT                   /note="similar to alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /db_xref="GOA:C4YQ83"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ83"
FT                   /protein_id="EEQ44372.1"
FT                   /translation="MAPTAVIQEPEDVQETIKRLAGLKVIGHSKNSKGIITGYDPEWAD
FT                   KLPETTKQRYAKYGVDISKGYPYVPVNEKVPKFVDEVFAIRNEEYPYIERGKNADPEKK
FT                   SLFDAAEDVIHLTPYIGTEIVGLQLSELTEQQRDELALLIAERVVVFFKDQDLSPQKQL
FT                   ELGHYWGQVEVHPQATRIGEEYDGISVIWQEQQRDRWGLNLTFKQSKKGNSQWHSDLVH
FT                   EKQTAGITHLHLDAIPGIGGETLWSSTYGAYDKLSPALQKFLDGKTAIYRSAHQYLDRN
FT                   DPLKGPKYVEREHPIVRTHPVTGWKYLFVNRSMTVRIVGLLPEESDLILNYLYSVIETN
FT                   RDIQVRWSWQKELGSVKNNKKDEPKQYRGVSALWDNRISNHSVVHSEESIVGRHGTRVT
FT                   SLADTGYYDPNSKSQRESLGLSLD"
FT   gene            complement(<656288..>657760)
FT                   /locus_tag="CAWG_02640"
FT   mRNA            complement(<656288..>657760)
FT                   /locus_tag="CAWG_02640"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(656288..657760)
FT                   /codon_start=1
FT                   /gene_family="HOG000008762" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02640"
FT                   /product="hypothetical protein"
FT                   /note="similar to aminopeptidase"
FT                   /db_xref="GOA:C4YQ84"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ84"
FT                   /protein_id="EEQ44373.1"
FT                   /translation="MKSRIALTLRRFISTRPRLFTTYTTGQPTYETRPHIITQPGVLTP
FT                   GISAMEYYQRRLKLSTHLPSKSLAIIIGNTTQFSSGSVFYDFQQDNDLYYLTGWLEPDS
FT                   VVAIEKKGENGEDDVVLHMLVPPKDPKKELWEGPKSGLEGAYNIFNADLVEDISQAPSY
FT                   LKQLIKQNDYIYWDKKFNSKQNEGLRQFFNFSTNHRHHQDINEIIENSKKSVQKLSPVV
FT                   AKLRAIKSDAEVSVMKRACEISSVAINRAMATVGSDDPINSENMLARYLEYQFVKGGCE
FT                   KNAYIPVVASGSNALCLHYTRNDDLIKKNELIFIDAGGKLGGYCADISRAWPNSTDGFT
FT                   DTQRDIYEVVLATNKKCITLCSESLGYSFHDIHEVSVNTLKHELKNLPGFGDVTFSDIS
FT                   RIYYPHYVGHNVGLDLHDIPSVSNRLPLKQNQVITIEPGLYIPHDGPKHYRGIGLRIED
FT                   NVVVGKTHRDIINLTSGCKKEVSDIEALVRGG"
FT   gene            <658105..>659160
FT                   /locus_tag="CAWG_02641"
FT   mRNA            <658105..>659160
FT                   /locus_tag="CAWG_02641"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        658105..659160
FT                   /codon_start=1
FT                   /gene_family="HOG000093885" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ85"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ85"
FT                   /protein_id="EEQ44374.1"
FT                   /translation="MASVIYDERKGYCVTNEPINKVNENEGIINNGLQTLPWDLYLPEE
FT                   TDDLSSASDNTSTSTPKPLTKQEKREAKQLKKINASRRRKLKREQELDNKRESKFPDFK
FT                   PYLAKQELKALFSSIVKSTCQNSEADAKILQYHSIALYKSDLEHILPGEWLNDNNISLI
FT                   YELIIQIFIKHGRKFSNQIQLLFPSLIQLLMHFPDDVESLLPVDELKSSKLIFLPINFI
FT                   DEMDVDLEDANNGDHWSLGVLSLLDNTLYVYDSMQIDDDEISEIQLKKLVQKLQSCNTI
FT                   VHGKLKVRHLKCDQQQNFDDCGVYVIMITCYLINQLLHQDEMSLDISRVKFNPLDARLY
FT                   IMKLISRLIKE"
FT   gene            complement(<659204..>660835)
FT                   /locus_tag="CAWG_02642"
FT   mRNA            complement(<659204..>660835)
FT                   /locus_tag="CAWG_02642"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(659204..660835)
FT                   /codon_start=1
FT                   /gene_family="HOG000093884" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ86"
FT                   /protein_id="EEQ44375.1"
FT                   /translation="MCLLSQGNKVEAGKKKRDYHHQFCYIPTYMVIITNNMTDAFDLNY
FT                   LFINQLAFTFNKYISSSSSNIPKSSISNTAKQCLDYMKQYEIIHPIAETLIDYLSKEDR
FT                   LQSDYSTQWIESTRLMNNSYLEQVREEIKQVLETSMQSLHTNEAEKLFSKIRRAIAITI
FT                   VQTSYDVGLSLLNNYVAVVDISTQPKTKEQLVSNSYVEYLFYQYVLHIFSSIWFPSYDN
FT                   EFHRYNLSQRQFPGRYETKTNVTSNSFKTLDQIYSKAINYYQKNELLFGQYDNETRYFW
FT                   AIKLFNLSLLFKQFKLSEFYDQFIGFFFIEKEPLNFLVDDLQMLLSNLLVMFGITTIFL
FT                   KPFNELTLMKLDKDDALIDLFTDVPESLEFQLYNSVMIPLAKCQFKQVIVQLQNETFVA
FT                   ELAAQLEYNLPVPFRNSSGTNSSSLINYMASIIDYKNFFVILTSSRQISRLQMLESMGH
FT                   DTTDDRSATKLTNDLIGVIVALDLQKYGIYYDANNQMFVNNETTKDSNADDVAKLQENI
FT                   DDLKNELRAESLATKMTALLLDKYYR"
FT   gene            complement(<661087..>661554)
FT                   /locus_tag="CAWG_02643"
FT   mRNA            complement(<661087..>661554)
FT                   /locus_tag="CAWG_02643"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(661087..661554)
FT                   /codon_start=1
FT                   /gene_family="HOG000213929" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEB7"
FT                   /protein_id="EEQ44376.1"
FT                   /translation="MTIFISSTNVPLGYIVPQFPSLFWPVGSTRPSYLNSYLYYSWDIW
FT                   RFTVFWSLLLSGSFYLIVGIIASMSSFTNKFRHNLKFGKRDMMACVFIVVFYVFAGLIK
FT                   GFIGGAIIGVIIAAIYQAGSLTMSTWIPLTWAMIQVLYDIVSSYSTSQIIL"
FT   gene            <662005..>662760
FT                   /locus_tag="CAWG_02644"
FT   mRNA            <662005..>662760
FT                   /locus_tag="CAWG_02644"
FT                   /product="proteasome component Y13"
FT   CDS_pept        662005..662760
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02644"
FT                   /product="proteasome component Y13"
FT                   /db_xref="GOA:Q5AEB8"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEB8"
FT                   /protein_id="EEQ44377.1"
FT                   /translation="MSRRYDSRTTIFSPEGRLYQVEYAQEAISNAGTAIGILSPEGVVL
FT                   ACEKKVTSKLLDDDGSAEKLYIINDQMICAVAGMTADASILVNNARIQAQQYLKLYDEE
FT                   IPCEMLINRVCDVKQGYTQHGGLRPFGVSFLYAGYDDRYQFQLFTSNPSGNYSGWKATS
FT                   IGANNSAAQTLLKKDYKDDLTLKDACELAIKVLSKTMDASNINSEKLEFATLSLGKDNK
FT                   VLHKIWNDKDIDILIKASGVLNEKNSDDE"
FT   gene            <663111..>665216
FT                   /locus_tag="CAWG_02645"
FT   mRNA            <663111..>665216
FT                   /locus_tag="CAWG_02645"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        663111..665216
FT                   /codon_start=1
FT                   /gene_family="HOG000093883" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013946"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ89"
FT                   /protein_id="EEQ44378.1"
FT                   /translation="MDLISLGLTPRKSKKILQIINNNRVSRDIESEFNQLNSYTKAFLV
FT                   NQLSTDSSQQEEQDYEGHQLNGEVNDNVLQVFQELYFLLDVENFKFNHVYTDIDLNKLK
FT                   LIYMKLTSIGGDGSLNDNTKTVLEIIEKYIILTTTLSLTNSLIYKTLILKNQQVYWQAL
FT                   NNSSTINKLIYFMQTSPIKLYNFGCDTFAKTRRMLFHNSNDDGSKVYQLSSQSGGKEED
FT                   NIFSRYLLVIKNVCKLAFNGLITSVRQQSSPSIGFIFLSNDRSGKKHKKKQRTLSIKWY
FT                   LHSIKSVIKFPINLVVKEAKSKLRKIDHEIALNVENIDKLIKTNPKDYLETLSVILQLD
FT                   STQDHPTSQDLNTVYQKKKNMILQAMEHVVKFDKQSYDLTSAPGFLTRYWIIIALVIFY
FT                   GPSQTKKVYANRQEIIYWVKYNGIEPVVGFFKNWVIKPVYDMLDILRNTSSDSQLSITS
FT                   KDSLNSEFDSLNSMIYQFAQDNHIDVSESQITNDIKNGDLKIIMSTYENEIKSPIKYLI
FT                   TGSLLRLILIQIQKGKVDGAMAINGIDKLLKSQQLLFAMVSISPSILILYQMYRLLTNS
FT                   GKGNGSGAASIMINGKQLNIVCLKCLNNIENLLILLQLQEKKPQQKEQNSRSTENVSNK
FT                   HHQEFYEGELLIEIINLFVFSSYLIPVDLKDDWIDDLNELNNKQFDVTTKLDLIRKIWN
FT                   MYGAYFR"
FT   gene            complement(<665611..>667767)
FT                   /locus_tag="CAWG_02646"
FT   mRNA            complement(<665611..>667767)
FT                   /locus_tag="CAWG_02646"
FT                   /product="beta-glucan synthesis-associated protein KRE6"
FT   CDS_pept        complement(665611..667767)
FT                   /codon_start=1
FT                   /gene_family="HOG000164283" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02646"
FT                   /product="beta-glucan synthesis-associated protein KRE6"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ90"
FT                   /protein_id="EEQ44379.1"
FT                   /translation="MARRNLTKNTNGNEYQNTNPFVNQANQNYNNNSTRQSYPGFTDPF
FT                   NSSNRLDDGSFDFENRSSYPSSSTSTSSIANQYGRPFTVGNGLSSSNGSSGSHLLQGQN
FT                   DYNLSSSPNLQHQQLQGAENDKSSSLLNSNINNIKVDVPYDYDRYPKIIGRVSSSNSLN
FT                   NTSNTAPYQSETPSISSNSFNKNVNNTLNGSYNNMIDFSPFGGYPASSFPLNIDEKEPD
FT                   DYLHNPDPVHDVIYEKNRFWNDLKTADRKSFGGILGFLFLIAAAVAVFVVVPALTYSGV
FT                   TTHSPPQEYEILSHYSYPLLSAIRTSLIDPDTPQDALKMKAKDGSNWSLVFSDEFNIMG
FT                   RTFYEGDDQFWTAPDLHYDATKDLEWYDPDAATTSNGTLNLQMDAFKNHDLFYRSGMVQ
FT                   SWNQLCFTQGKLVISARLANKGTVSGLWPGIWTMGNLGRPGYLASTEGIWPYSYDSCDS
FT                   GITPNQSSPDGISYLPGQRLNKCTCPGESHPNRGVGRGAPEIDVIEAEISTDATGNREN
FT                   LGVASQSLQLAPMDIWYYPDLDYLEIYNTSITTMNTYTGGPFQQALSGTTTLNKTWYEL
FT                   GGNGVHNFQTYGYEYLNDKDNGYLRWFVGDNPTLTVYPQALHPNGNVGWRPLSKEPMSI
FT                   VMNLGVSNNWAYIDWPSLSFPSTFRIDYVRLYQPPNQINVGCDPAGFPTSDYIEQHINV
FT                   YQNANLTSFEDGGYSFPKHSLIGC"
FT   gene            complement(<669507..>670349)
FT                   /locus_tag="CAWG_02647"
FT   mRNA            complement(<669507..>670349)
FT                   /locus_tag="CAWG_02647"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(669507..670349)
FT                   /codon_start=1
FT                   /gene_family="HOG000093882" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ91"
FT                   /protein_id="EEQ44380.1"
FT                   /translation="MSRHSSRKCSLAIESPIDDSCNNPLNAFLIYSGKTDTHSNNNNGA
FT                   DDEMATTDESMSPLASSTFLSPMTPPGSRNTTQLSNQQLTKPLRCHRRPSMIKCTSLPE
FT                   LTAMSTHTVTTSPPLSSLITNSTTHAILGNRRISICDLDNFTGEIDYVKQQQHEQHQQQ
FT                   LQSPDIANFMYCNLSTSDIDKTPRKFSFHHRPKTAPGMMTGGSDETPQNHDHEDNEHEY
FT                   GPKQQEQESMEIDKEKEEVATQNTQLPHHYIENLASFQFRNHKRRNSTALKFEEPKIL"
FT   gene            <672928..>674490
FT                   /locus_tag="CAWG_02648"
FT   mRNA            <672928..>674490
FT                   /locus_tag="CAWG_02648"
FT                   /product="hypothetical protein"
FT   CDS_pept        672928..674490
FT                   /codon_start=1
FT                   /gene_family="HOG000215020" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02648"
FT                   /product="hypothetical protein"
FT                   /note="similar to alanine aminotransferase"
FT                   /db_xref="GOA:Q5AEC2"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEC2"
FT                   /protein_id="EEQ44381.1"
FT                   /translation="MLRVNSRLLTTRKSQFMFTSNSLRFLATFKPADPLTTHDINPQTV
FT                   EAKYAVRGKIPIIADELNELIQKQPQSHGLPFSKIINANIGNPQQLEQRPLTWYRQVLS
FT                   LLQYPDLLKNGDPETVKSLYPEDVIERAQSILKHIGSIGAYSHSQGASYFRQSIAEFIT
FT                   NRDGGYVSHANNIFLTSGASTAVSYLLQILSVNENSGFLIPIPQYPLYTATIALNNAKP
FT                   IGYYLDESNHWSTNPQEIRELIETNQSQGINIKALVVINPGNPTGAILSSQDIIELIDI
FT                   AAEYGIVLIADEVYQENIFKGKFVSFKKILSELIEQDPQTYKHVQLASLHSTSKGVSGE
FT                   CGQRGGYMELVGFKPEVKDVVFKLASINLCSVVSGQALMELMINPPQEGDPSYPLYKSE
FT                   TESIHNDLESRAESLYQAFLQMEDIKCNKPMGAMYIFPTLDFDPARYHKLYSRAKNSNL
FT                   QIDDIYCIELLEGTGICCVPGNGFGQKPDTYHLRTTFLPPGKEWIDKWINFHKSFIKKY
FT                   KDE"
FT   gene            complement(<674628..>676103)
FT                   /locus_tag="CAWG_02649"
FT   mRNA            complement(<674628..>676103)
FT                   /locus_tag="CAWG_02649"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT   CDS_pept        complement(674628..676103)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02649"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /db_xref="GOA:Q5AEC3"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEC3"
FT                   /protein_id="EEQ44382.1"
FT                   /translation="MAPKLNNPNLFQNKPFINGQWYDSKSTSTFKVYDPATQELIIELP
FT                   DQTPEEIDEAIAITHKAFQTYQRTPVYERAKWLRRMYELMIENLQDLATLITWENGKCL
FT                   ADALGEIKYAASYFEWFSEECKRNYGHTIQPSNQNNKVITYKQPVGPVGLLCPFNFPSA
FT                   MGARKAAPALAAGCTCILKPDGQTPLSSLALAYLAQQAGFPDGCFNVVLTSVTNTPMCG
FT                   LKFCQSPKLKKISFTGSTNVGKLLMQQSSSTLKKLSMELGGNAPIIVFNDCNLDLAVDQ
FT                   SITSKFRSLGQTCVCANRIYVEKGVYDEFCNKFVEKVNQFKIGNGFEPGVTHGCLINTK
FT                   AIEKVEDHVQDAVEKGAKLIVEGGRLPQLGENFYSPSVVKDVTQDMKVVKEETFGPLAA
FT                   IIPFDSKEQVLQWCNDTPYGLASYIFSENLNTVWYMSEFLENGMVSVNTGLFTDAALPF
FT                   GGVKESGFGREGSLYGMDDYTVIKSITLGNVYN"
FT   gene            <679256..>680071
FT                   /locus_tag="CAWG_02650"
FT   mRNA            <679256..>680071
FT                   /locus_tag="CAWG_02650"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        679256..680071
FT                   /codon_start=1
FT                   /gene_family="HOG000093881" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ94"
FT                   /protein_id="EEQ44383.1"
FT                   /translation="MISKLIGVTYFKNKLSKHSSKHDDNTSNNNSSNDTSFPTTNSTAL
FT                   PSKRSSICLSHRIKSKRNSSTSSTTSSSSSSPPPTPTTLTSSSTRKVVTRSQIRRSNTI
FT                   SSASALRHSLNVSNSNTIPTSIPKKSFSLPNSPSLTSDSTLNEPIDDIPHFYNTTMDIN
FT                   GAGNKYYGLISSTNNLMGRDGLLTLDLTTGNDTNSLFTTATREKLDNDSIIIDQQEQEE
FT                   YNKGNEHMYGYGYGYELTNNTAVAAVEGTKIASLARSISKMKKKNVRFV"
FT   gene            <682738..>684693
FT                   /locus_tag="CAWG_02651"
FT   mRNA            <682738..>684693
FT                   /locus_tag="CAWG_02651"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        682738..684693
FT                   /codon_start=1
FT                   /gene_family="HOG000246745" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ95"
FT                   /protein_id="EEQ44384.1"
FT                   /translation="MKLEMSSYLHKVPNTGITNLSNSKSIVFIMFCATLLFIITSSRYL
FT                   TGSESLGQIPSEIPKSSEQLNEELSQQINSKLHKLASFDKFNSFPLLNKHMKDDIYGSM
FT                   TLETFTDPLPYLENYNEEEYSQQNYPICSEKLMFPSKIKLTKQQYLPADLQQFLGVLNN
FT                   MRPYHDMVEKAKAYFISDLREEKKWFRFAGSSIWLPQFQCHYMVSRYLYSPNGVANHAF
FT                   ASFLYIQLFDSDWKELPSHTTLDIPFEQTEANSIFKIFKPKQKYANFRNSTYPQILPIP
FT                   FDYKLPIETKKYYYGPEDPRILLRSNPLGFDEPLIVFNMKGLKLTKRVMYSYLPFSNTL
FT                   KLLKKRREPFANIEKNWTPFKSVAQPSKTQTTIHFIYSMIPLEVLACDIDSGLCDILQK
FT                   PAKHDFNYVGGLRGGTQLVSLPLNETIPSEIRAKLPIPKNRQVYIGWARTHLNNCGCGD
FT                   SMYRPNFITLVEDYDDVTDKYYYKIGDISGYFDFAAKIEPWSKQVLDEEGNLYEKAEQC
FT                   QGRNVLIPNSIAYWDVGSIKLAGTEYQKHDFKDMFSSGKVSDFNANEIVFNDYMGVTLS
FT                   SADRDVSIVHVKGLLNYILQLPSLVDDSLVINKEWTFQKKGHDLNVRCAMIASKEYCKS
FT                   YAIKQGVKIDEKSEET"
FT   gene            <685277..>687208
FT                   /locus_tag="CAWG_02652"
FT   mRNA            <685277..>687208
FT                   /locus_tag="CAWG_02652"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        685277..687208
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQ96"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ96"
FT                   /protein_id="EEQ44385.1"
FT                   /translation="MDSKKASFESNHKELSASSSNEFNEVLEFTVSNYETLQQQKELGS
FT                   RRSSVHRKSLEAIKKCITGESNYESPETKDYSVHHIYGDLDSDAIEIQRTQTRNLILTK
FT                   LESRVEDNTNNYSNDNHEHEVECQDTISVIPDTNIEIAQHGKEFDTIDPELITWNGPDD
FT                   TEDPRNWPINKKIFLLGFVSLYALVAPMSSSMLSPAMTFIAEDFHITSPIIKSMVVSIQ
FT                   ILAWAFGPLIIAPLSEHDYIGRKLVLDVSCWMSLFFNLGCAFSQTTAQMMVCRFIGGLF
FT                   GCVPMNVCAGVISDMFDAQSRNAALAGYSLVPLLGPVIAPVISGFIVDHKQWRWTFYVL
FT                   CIFNGFVAITATFLFKETYSPTLLKRKAKKLREQTGNVNLHTIYEIADGETKLGKIWLC
FT                   MVRPIKLLFTHPMIVGLGSFMAFTYGFMYLMIVTFPEIFGNQYGYSKSVTGLMYIPMGI
FT                   GFIIGVIFWTYMVGNVYERLTSRNNGVAKPEFRLPCLIASSIFIPVGLIWFGWSAQKKL
FT                   HWIMPGIGSAIFAMGLVCVFQTIQNYLIDMNVRYAASSVAAAALFRSLFGFSFPLFANK
FT                   MYSALGYGWANTMCAFIGIFLGVPFPIFCYMYGEKIRHWADKRIEKEQLKRDQKNLERL
FT                   KLKNDSVV"
FT   gene            <687411..>688010
FT                   /locus_tag="CAWG_02653"
FT   mRNA            <687411..>688010
FT                   /locus_tag="CAWG_02653"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        687411..688010
FT                   /codon_start=1
FT                   /gene_family="HOG000246746" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ97"
FT                   /protein_id="EEQ44386.1"
FT                   /translation="MTEIHLDQTSQKIPDPVKFVSIEELHAFPLPKALESLPPSVFQQF
FT                   LESKDLLQGYLKQLKAYQEKQSEIIDQLGELDNILENVIHKQLIKDYAALVDKINQQIK
FT                   SINIIYQEFLNLETYQYQLLSNNFNQDILKLKFKKLLEKTNQDSLNIVKNYHEKGESTD
FT                   DDFNNMIENFKESRKLYHSRKEKLYRWEEERVSGFV"
FT   gene            <689005..>690729
FT                   /locus_tag="CAWG_02654"
FT   mRNA            <689005..>690729
FT                   /locus_tag="CAWG_02654"
FT                   /product="hypothetical protein"
FT   CDS_pept        689005..690729
FT                   /codon_start=1
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02654"
FT                   /product="hypothetical protein"
FT                   /note="similar to mitochondrial external NADH
FT                   dehydrogenase"
FT                   /db_xref="GOA:C4YQ98"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQ98"
FT                   /protein_id="EEQ44387.1"
FT                   /translation="MFTRSLIKGGGRLATTRSLVNNSTSLVLKNKFKKYSTSTPPKVAK
FT                   SKSSTIGKIFRYTFYTAVISVIGSAGLIGYKIYEESQPVDQVKQTPLFPNGEKKKTLVI
FT                   LGSGWGAISLLKNLDTTLYNVVIVSPRNYFLFTPLLPSVPTGTVELRSIIEPVRSVTRR
FT                   CPGQVIYLEAEATNINPKTNELTLKQSTTVVSGHSGKDTSSSKSTVAEYTGVEEITTTL
FT                   NYDYLVVGVGAQPSTFGIPGVAENSTFLKEVSDASAIRRKLMDVIEAANILPKDDPERK
FT                   RLLSIVVCGGGPTGVEAAGEIQDYIDQDLKKWVPEVADELKVSLVEALPNVLNTFNKKL
FT                   IDYTKEVFKDTNINLMTNTMIKKVNDKSLIANHKNPDGSTESIEIPYGLLIWATGNAPR
FT                   DFTRDLIAKVDEQKNARRGLLVDERLKVDGTDNIFALGDCTFTKYPPTAQVAFQEGEYL
FT                   ANYFDKLHAVESLKYTIANPTPKDNVEKLSRKLARLEKNLPHFIYNYQGSLAYIGSEKA
FT                   VADLVWGDWSNISSGGNLTFLFWRSAYIYMCLSVKNQVLVVLDWAKVYFFGRDCSKE"
FT   gene            <691658..>694801
FT                   /locus_tag="CAWG_02655"
FT   mRNA            <691658..>694801
FT                   /locus_tag="CAWG_02655"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        691658..694801
FT                   /codon_start=1
FT                   /gene_family="HOG000011547" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AED0"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AED0"
FT                   /protein_id="EEQ44388.1"
FT                   /translation="MTMDGSTPEEKRLKDIKFRQWGSYVGERQWATVREDYSADGDAWS
FT                   ALTFDDSRSRAYRWGEDGLAGVSDRKQFVNVTMALWNGKDPILKEKLFGVTNSQGNHGE
FT                   DVKEQYYYLDNTPTHSYMKYLYKYPQNEYPYKQLVEENQKRSRLEKEFEITDTDIFKNN
FT                   EYFDVVMESAKGDAPDELYFRITAYNRSDKAASLHILPHCTLRNIWSWGADEYQEVKKP
FT                   HVKQIDEYTVEVETQKFGKRYLVFAPSPGFKESDPDVEPQLIFTENETNTKKLYNQDNK
FT                   SKYVKDAFHEYVVDGKQEVVNPEKQGTKAAAWFTFKDIPAGEYVTIRYKFTNDKSEVDE
FT                   FELDNIISKRQAEADEFYWHVTPYPISDELRQIQRQGFAGLLWTKQFYYFVHNYWANGD
FT                   PDTIKPPMNRANGRNKEWKHLYTDEILSLPDKWEYPFFAAWDSAFHCIPFAMIDPRFAW
FT                   MQLDHLVREWYMHPNGQIPAYEWNFSDVNPPVHAWAAYRVFKIERKMYGVESLDYLESI
FT                   FQKLLINFTWWVNRKDAEGKNVFEGGFLGLDNIGVFNRSEELPTGGSLEQADSTGWMAF
FT                   YSLQMLNIALELAKTRPVYENIASKFFEHFIIIADAMTFRGGDGDESTKDALWDDKDKF
FT                   YYDAIRYSDHHVESLHVRSLVGLIPLYASLTIEPDLLNRYPSFKKRLNWFLVHQKKMSE
FT                   RNIASMETRGVGERMLLSLVSKDRLLAILDRMLNEDEFLSEYGIRSLSKYHKDHPYVKE
FT                   VNGEKFTVAYLSGESDSGMFGGNSNWRGPIWFPTNFLLVEALQRFYLYYGPDLKVECPK
FT                   GSGDYLNLAQCAQEIQHRLIRIFLPDEEGDRACNGGVDILNRDPLFKDYVPFYEYFDGD
FT                   SGRGLGASHQTGWTSLVTKWIHDNAASNRVPRTPQTPKNRRRQSVFLHASEEANDDDEE
FT                   ELQKYVPKCGPMPGTLARRKSGKSLLNLTVNALDLGDEEGSATTKAAVCGQVGEGKSIS
FT                   EEELEKLHKVQSGASIDSNEAAQLDSDLLGQVRAAFKKFKSRTDEDEFEGDEFETRCS"
FT   gene            <695279..>695803
FT                   /locus_tag="CAWG_02656"
FT   mRNA            <695279..>695803
FT                   /locus_tag="CAWG_02656"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        695279..695803
FT                   /codon_start=1
FT                   /gene_family="HOG000116573" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQA0"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA0"
FT                   /protein_id="EEQ44389.1"
FT                   /translation="MVAFGEWDGFENFLVLEQRKNYLKSIEGANEEAREVLDQMTIEVS
FT                   NLPSNQRSSYNAKIRNYRTELDTVTVTYNKLLDAQDKVELFGSNRYTDDSGDSSEQRKQ
FT                   LLSNNSSLERSSQRLHDSQRIAMETENIGSNILNDLRSQREQINGARNTLSQADNYVDR
FT                   SVQTLKTMGRR"
FT   gene            <696259..>696768
FT                   /locus_tag="CAWG_02657"
FT   mRNA            <696259..>696768
FT                   /locus_tag="CAWG_02657"
FT                   /product="hypothetical protein"
FT   CDS_pept        696259..696768
FT                   /codon_start=1
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02657"
FT                   /product="hypothetical protein"
FT                   /note="similar to ferredoxin"
FT                   /db_xref="GOA:C4YQA1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA1"
FT                   /protein_id="EEQ44390.1"
FT                   /translation="MFRLIPRLKPIIPSINRISLSVKPQPSTSQQCHTLRAFHTSPISL
FT                   HGHLKKPNPGEELHITFITKDGKQLTYEVAEGDNILDIAQAHNLDMEGACGGSCACSTC
FT                   HVIVDPEYYDRLEEPDDDENDMLDLAFGLTETSRLGCQVKMTKELDGIRVALPAMTRNL
FT                   QSRDFN"
FT   gene            complement(<696928..>699369)
FT                   /locus_tag="CAWG_02658"
FT   mRNA            complement(<696928..>699369)
FT                   /locus_tag="CAWG_02658"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(696928..699369)
FT                   /codon_start=1
FT                   /gene_family="HOG000093880" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQA2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA2"
FT                   /protein_id="EEQ44391.1"
FT                   /translation="MSDNYLLPFDSLLPIEILYQIIQYVGIENLIQLLPIPVSPYLQSS
FT                   FIHHNPNIKRAIDNLIVDSNITFNNRLVQHSLIHIYLRTRSYLQKNNLRFLPSKQSTLQ
FT                   LLSYCQSQNIPITITISYYLSTLSDLWDFIELLKNQQQTSSSIRYNLELEIIPGFLYNF
FT                   SLNYVFDQISDSIGPLVETIMVYNYSGSFIFKNENFPYLKNLWFEDSNIKFNSNLPSTI
FT                   KLLHLYPNRFGWNNNEPIIIKHQLPYQLEELNVGNCTIKNQATITHLDNLSSITLYMVK
FT                   DSSANGGGQFIKQLVTNNLVNDKLSCLKVDFIWDSQRNLLDFQQLLLPSNDNENDREFI
FT                   GEKLMKNLQTLSITNYIPFDVSNWKNLTRLKISRINNPQIFETCGRFPDSLQSLKLTNN
FT                   NIKDLAVIDKLIGPNNNRLKYLSFSDNPIDWNLYVPNFTRFTKLKYLKLFNTQIGKHFH
FT                   KINYPDSVEVLSLEVNQISSIQGIKFPTHLKNLGIGSNWIKKIYRPNLPHTIETIHLTE
FT                   NKLSQVDLSCNNQGQELLIEILYLNFNPLSNFKQIKLPNHLKILNMDNCKFKSISNIKF
FT                   CSSLVELSFNGCELSQFENVSWNEEEEEEEDNDNSHSSSPNLKYLNLSQNDLTHLNVQF
FT                   PSTLQVLNLSMNKLTSLNNTLTSTLQNLDQLQVLNLSSNQFQKFQIHFNSINLKVLDLS
FT                   FNSLKSINLTFPRSTITNLQTLNLCSNKLTFLNDVMIGHNKNLTRHENLIEIDLTNNKI
FT                   KSVSDINDNGGISHFPQSLKCFFIGHTGQQDRFGYDMAKNIVIDKDGNDGLCKTKRIDI
FT                   P"
FT   gene            <704522..>705094
FT                   /locus_tag="CAWG_02659"
FT   mRNA            <704522..>705094
FT                   /locus_tag="CAWG_02659"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        704522..705094
FT                   /codon_start=1
FT                   /gene_family="HOG000093878" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AER9"
FT                   /protein_id="EEQ44392.1"
FT                   /translation="MAYATTSTTTNTVINNNSNSSNGSYYDDDIFEMNLEDNIPSSYID
FT                   YENVNNYTTTTTNVSALTKSRSTSIIASGNESSLPPSPLVLPQQMSTSPLQPYYSYTYN
FT                   SSSSSSPYSTFANEDQDQHDDDQFLYECCICKQKLNNSNNNSHNCTRDLFNGNTLKDND
FT                   LIIIENNKLIQNNYQKWLYNITPNIPY"
FT   gene            complement(<707858..>709438)
FT                   /locus_tag="CAWG_02660"
FT   mRNA            complement(<707858..>709438)
FT                   /locus_tag="CAWG_02660"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(707858..709438)
FT                   /codon_start=1
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQA4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA4"
FT                   /protein_id="EEQ44393.1"
FT                   /translation="MTKNYDLEQQETQAPENQVNVEKILLDKSNVDEDPITSTIEQSST
FT                   SNSSLKKPTNWVDKIGLRINAEIRGIERVPESERHDNSLLSPFLVFLSPNMVISGLSIG
FT                   SLGPVAYNLDFRTSIIIITIFCIIGSIPVGFFSAFGMRFGIRQQILSRYFTGNIMGRIF
FT                   ALFNVISCIGWNAVNVIPCAQLLNSVGPLPPWAGCLILVGCTCIFAVFGYKTVHLYEKY
FT                   SWIPNFIVFMIIIAKFSQTHAFNWGEKKSGPTEAGNVLNFISAIFGFTVGWIPSSADYT
FT                   VYMPANTNPWKVAFAMTTGLSLPAMFTAILGAAIGTSVNLKGSRFEQAYNKNSTGGLIY
FT                   EILCGDNNNQGYRFIIVVFALGAIANGIPGSYSLSLAIQCIWSQCARVPRIAWCILGNL
FT                   VALAFSISAYYKFQDTMSNFLSIIAYNVSIYLSISLTEHFIYRRGFSGYDVTDFNNYKT
FT                   MPVGIAGVVAFCFGICSTVLSMNQTWYQGVIARKIGDSGGDISFEMNIMFAFIGYNLVR
FT                   PFELKYFGR"
FT   gene            complement(710398..710491)
FT                   /locus_tag="CAWG_08062"
FT   tRNA            complement(710398..710491)
FT                   /locus_tag="CAWG_08062"
FT                   /product="tRNA-Glu"
FT   gene            <711842..>713947
FT                   /locus_tag="CAWG_02661"
FT   mRNA            <711842..>713947
FT                   /locus_tag="CAWG_02661"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        711842..713947
FT                   /codon_start=1
FT                   /gene_family="HOG000207972" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQA5"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA5"
FT                   /protein_id="EEQ44394.1"
FT                   /translation="MNETSNRDHQVTSKEILDVAFEKSKSKFTTPRQTIQDTEELQSYQ
FT                   QTKRKEFEQHINKNRLNLGQWTRYAKWEIENNHDFPRARSILERALDVNIQHVPFWIQY
FT                   IQLELSHKNINHARNLMERAINALPRVNKLWFLYVQTEEMLKNYPMVRAVFERWLDWHP
FT                   DTSAWDAYINFEARYEEKENVRTIFKKYVHEFPNAGTWYKWIKYEMENNRDDVNTVRAV
FT                   FESAVDTLLSNKSEDNDDDEEFATIISSWTSWEVSCGEASRANEIFKLLLDNKTNKLEI
FT                   SDQTKSSIYTAFVEFEKNFGNKDSIEQSVLIKRRIKYEQEIQNDPYDYDSWWKYMTLLQ
FT                   NSSNKSDLENAFKKVTGNVVHDKHKSISGRRYIMFWIWYAFWEEMTNNNPVSAREIWNN
FT                   CLKVIPHKSFTFAKVWIGYSEFELRNSEDGLAKARKILGRAIGQTSINKPKIKIFKYYI
FT                   DLEKKLGDWNRVRLLFQKWLEVSLLTTSSSELVIEKYVEFESSIEEYDRCDSILSSARQ
FT                   LSENPEYSSSFNLQRLLEITVEFYKEEMQYDKIREIYRALLDKDPNAHNWISFALFESS
FT                   IPSAEQLEEYLQGDNEEFEATVDESQIESTRNIFEEAMTYFKDKDDKESRLVIIEAWRD
FT                   FEEVNGSDESLSKVTKRLPVIVRKRRTVGSIEEEYIDYIFPDDESKKLPGKMSKFLANA
FT                   KKWAQQN"
FT   gene            complement(<714015..>714248)
FT                   /locus_tag="CAWG_02662"
FT   mRNA            complement(<714015..>714248)
FT                   /locus_tag="CAWG_02662"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(714015..714248)
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02662"
FT                   /product="hypothetical protein"
FT                   /note="similar to GLP_49_81391_81639"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA6"
FT                   /protein_id="EEQ44395.1"
FT                   /translation="MQIKVKTLTGRDMPLDVEPQDKIIRIKEMMEEKEGISPAQQRLIF
FT                   NGSQLNDDQTVQEAGIQAGASLHLVLTLRGGN"
FT   gene            <714450..>715115
FT                   /locus_tag="CAWG_02663"
FT   mRNA            <714450..>715115
FT                   /locus_tag="CAWG_02663"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        714450..715115
FT                   /codon_start=1
FT                   /gene_family="HOG000219949" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQA7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA7"
FT                   /protein_id="EEQ44396.1"
FT                   /translation="MLPTPTVKNIDYDEVYEPSEDSFLLLDCFEKEKDYLQSKFKTVVP
FT                   LVTEIGTGSGIVTTFVAKHIVPNGIFLTTDINPHACETVLQTVKHNNDIGSSNCLLDST
FT                   QMDLTSAIKEREVDLLIFNPPYVPSSEIPEIPRTNNDPVWLDLALVGGEDGMVITWKVL
FT                   NNLTNVLSKSGVAYILFCARNKPETVTSIMQSKGWNVEVVINRKAGWEVLSVLKFTRI"
FT   gene            <715301..>716551
FT                   /locus_tag="CAWG_02664"
FT   mRNA            <715301..>716551
FT                   /locus_tag="CAWG_02664"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        715301..716551
FT                   /codon_start=1
FT                   /gene_family="HOG000093877" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQA8"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA8"
FT                   /protein_id="EEQ44397.1"
FT                   /translation="MSNRGRQPSGPPPSRKRETKWSGKPKRYANFGAQSFDTVITGHLT
FT                   QEQLDAYQRYFRIEEISNFLSVAKQQHKSIVDVLPSAKVDETDHYKRDPSPPPKYDKNG
FT                   NRTNTRERRVTEALEKERHELVELAASSIKNYMIPSNYRRPSRTVERLYVPVKDYPDIN
FT                   FVGFLIGPRGNTLKKLQEDSGARLQIRGKGSVKEGKSSDGFGSSQTGTDIQDDLHVLIT
FT                   ADSPLKISKAVKLVNEIIDKLIFSPQGMNFMKRDQLKELAVLNGTLRETKPFDPEAHEK
FT                   KQQQQMDITKIVCKICGNIGHIARDCKQNNGKRPLDDNAENEPTTINKKARTDVPPPPP
FT                   PPPPPAPPSSSTEISKQVPPPPPPPPPPAPSAAASGFATTENYKQGLVPPLTPPPPPPP
FT                   PPVRSALVNLKTIQKFY"
FT   gene            <717143..>719011
FT                   /locus_tag="CAWG_02665"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            <719367..>719768
FT                   /locus_tag="CAWG_02666"
FT   mRNA            <719367..>719768
FT                   /locus_tag="CAWG_02666"
FT                   /product="histone H2A variant"
FT   CDS_pept        719367..719768
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02666"
FT                   /product="histone H2A variant"
FT                   /db_xref="GOA:C4YQA9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQA9"
FT                   /protein_id="EEQ44398.1"
FT                   /translation="MSGKGKVHGGKGKSSEIAKSSTSHSARAGLQFPVGRVKRYLKRNA
FT                   QNKIRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELDNL
FT                   IKATIAYGGVLPHINKALLLKVEKKKGQK"
FT   gene            complement(<720056..>720511)
FT                   /locus_tag="CAWG_02667"
FT   mRNA            complement(<720056..>720511)
FT                   /locus_tag="CAWG_02667"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(720056..720511)
FT                   /codon_start=1
FT                   /gene_family="HOG000093876" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEE2"
FT                   /protein_id="EEQ44399.1"
FT                   /translation="MSGLALKFTSLLVRTIAKPIGNAIKRQAKDHERFRRLCINFAQKM
FT                   HSSEIKLRMSLLGENKIKVKPLNDNKAIEQGATFISEFFIFSVAGSLIFYESYRSRKKA
FT                   TSERDALADDITLLQSEMEKIKNKLEDINVKLVDYKVSESPSETATK"
FT   gene            complement(<720818..>723613)
FT                   /locus_tag="CAWG_02668"
FT   mRNA            complement(<720818..>723613)
FT                   /locus_tag="CAWG_02668"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(720818..723613)
FT                   /codon_start=1
FT                   /gene_family="HOG000246739" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB1"
FT                   /protein_id="EEQ44400.1"
FT                   /translation="MFGFSLLTPGDNDHSFKAALLEFDNEFKLIADPSWNGVDVNAAMF
FT                   MEEHLKETNAILLSHSTAEFISGFILLCIKFPILMSSVPVYSTLPVNQLGRVSTVEYYR
FT                   AMGFLGPVDSAILELDEVDNWFDKVNLLKYQQSLNLFDNKVVVTPYNAGHSLGGTFWLI
FT                   TKRIDRVIYAPAWNHSKDSFLNSASFISPSTGNPHLSLLRPTAFITATDMGSVMSHRKR
FT                   TEKFLQLVDATLANGGAAVLPTSLSGRFLELFHLIDEHLKGAPIPVYFLSYSGTKILTY
FT                   ASNLLDWMSKSFTKEWEELSSVPFNPSKVDLLLDPSELLKLSGPKIVFCSGIDLRSGDI
FT                   SAEAFQYLCNDERTTIILTEKTTMNFASSLSSVLYTEWDSLAKKRGGGESEDGIAVPID
FT                   KNISLKNWTKEVELTGTELTEFQEKVAQKRKEKLLAKVRDQKNQNILSADTVDSEDSSD
FT                   DDDEGDNEAEKQKGNTSSNLLIKQYQNINVADSNVAPNEVNPLATHEAFITDHIKQSLE
FT                   KNLPIDLKITHKLRPRQATFPYFATAHKQKFDDYGEVIKIEDYQRHDEVSHSKIIMEGK
FT                   RKFDEKRTANNRRNKNQNKQQANKLTPQEQVNRKLLQKYLDTLSNPKKRVGLNYGTKKK
FT                   SETQKLKVRCGLSFVDLSGLVDLRSLGIIVQALKPYNLILLPDYTPSQNLTRVQEFFAN
FT                   QQNEQLQEQTKKNLAQSSRYLSLVSIRDGLSSAMSPYSSGNMNVMVVHDNESVKIGAES
FT                   ESGSIGINNFEVNLDDSIVKDLKWQKIGDDYKVAKLYGELELQNQFPAAKKTRTLQDYI
FT                   NSNTHFSLRKLDGTTAVKRQETIANQVQDPKIRALITNGPKLAIGNIRLPDLKKKLQNL
FT                   NMTAEFKSEGTLVVNDILAVRKIAYGLVESDESGDIVIDGNVGPLYYKVKECIREMLAY
FT                   V"
FT   gene            complement(<724010..>728449)
FT                   /locus_tag="CAWG_02669"
FT   mRNA            complement(<724010..>728449)
FT                   /locus_tag="CAWG_02669"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(724010..728449)
FT                   /codon_start=1
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02669"
FT                   /product="hypothetical protein"
FT                   /note="similar to ATPase/transporter"
FT                   /db_xref="GOA:C4YQB2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB2"
FT                   /protein_id="EEQ44401.1"
FT                   /translation="MSESKDQSTDSTGSPGLQSRGEPQPPSFKEKIHRFFFLKGLADRP
FT                   PYLQEIYDNTPRTVFYNYDLPDYMIDSQGRPITQYPRNKIRTTKYTPITFLPKNLLLQF
FT                   TNVANSYFLLIVILGAFQIFGVPSPGLAAVPLIVIVCITAIKDAVEDYSRAASDAELNN
FT                   SPIHLLTGVHNPNVLVDQVGPWRRFKKACSRGTARVFKFIKKCCIFICGSKRVKQEYAR
FT                   EQVQEDNLALHRVSTVVSDYTYRSQEPRYSVSSPRRSMNTNRRSIQSSHHRPTVALPNS
FT                   LLNPILKKENAQNPSSIRANFKNRCWKDVNIGDIIRIRANEEVPADVIIISTSDSEGNC
FT                   YIETKNLDGESNLKTRTALKCGGNNNLKHSDDLSDTKFWVECDAPNANLYSFKGTIHYE
FT                   NFDSKGNLVNEDEKEAITPENVLLRGCTLRNTKWVIGFCIYTGPETKIMLNSGITPTKT
FT                   SRISRELNLSVIINFILLFVLCFVSGLINGLFYRNENNSRVFFDFHPYGKTPAINGVIA
FT                   FWVALIIYQSLVPISLYISIEIIKTIQAYFIYADVKMYYDRLDFPCIAKAWNISDDLGQ
FT                   IEYVFSDKTGTLTQNVMEFRKCTINGKSYGLAYTEAQQGLDKRAGIDVIENANKWKNKI
FT                   AADKEVMMDDLTKYSNNDQLREENITFVSSQYVRDTFLGDSGDDQKQANERFMFALALC
FT                   HTVMTEENESDSTLRDFKAESPDEAALVSVARDMGIVFKKRLRSSLLLEIYGEEQEFHL
FT                   LDIIPFTSARKRMSCVIKTPDNKIILYTKGADSVIFQRLNPRENPNELVSKTALYLEDY
FT                   ANEGLRTLCIASKVLDPQVYDNWNKRYREASSSISDDREVLMGQLEEEIEQDLVLLGGT
FT                   AIEDRLQHGVPQSISILSEAGIKLWVLTGDRVETAINIGFSCNLLENDMKLLVVRPESN
FT                   DTQDCEQIDDLITKYLQEEFHIDASSPSLVADAIKQARKDHSIPQAKVALVIDGAALSL
FT                   IFQDLKDCPNDTIRVLQDKFLLLGKQCRSVLCCRVSPSQKAQVVKLVRTGLQVMTLAIG
FT                   DGANDVAMIQAANVGVGIAGEEGRQAVMSSDYAIGQFRFLTRLLLVHGRWSYKRLAEMI
FT                   PCFFYKNVVFTLTCFWYGIYNNFDGSYLYEYTYLMFYNLAFTSLPVIVLAVFDQDVSDT
FT                   ISLLVPQLYTSGILGKDWSQYKFVWYMFDGLYQSVISFFFPYLLFYLAFQNPQGMTIDH
FT                   RFYMGVVAACIAVTACDIYVLMQQYRWDWLSVLIDCISILLVYFWTGVWSVNATYSGEF
FT                   YRAGAQTLGTLGVWCCIFIGVIGCLLPRFTFDFFTSNFKPADVDIIRERVRQGAYDDYP
FT                   LGYDPTDAEDVERHRLLTEIINKDPQLFEKMENEYKEEEHDKETPLERTFKSIKRRTTI
FT                   SRSKKGTAQRLRRDTINDQFQKHIPLDELRQQMIKEGEYTSARYSLDRINTTHEIPGVT
FT                   QADTLLKYHTRNSVALNS"
FT   gene            <728618..>728974
FT                   /locus_tag="CAWG_02670"
FT   mRNA            <728618..>728974
FT                   /locus_tag="CAWG_02670"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        728618..728974
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB3"
FT                   /protein_id="EEQ44402.1"
FT                   /translation="MCVKQTIKNKYRNKENERRNLFIVFFSRSFLLRIKLVLMSLYHFR
FT                   WIFPFGFFLLLLLLLLYSGLLSHVIGIFKSFSFIVFLFFSPLVPFDIANSTQLLQYSFG
FT                   YNEKKKTPRSLTTT"
FT   gene            <730493..>732142
FT                   /locus_tag="CAWG_02671"
FT   mRNA            <730493..>732142
FT                   /locus_tag="CAWG_02671"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        730493..732142
FT                   /codon_start=1
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQB4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB4"
FT                   /protein_id="EEQ44403.1"
FT                   /translation="MQPLDKSEYTKIPDVLVDDDDLIKAGNDTSSDTSNPYLRPSVELN
FT                   GRISYLQDLEDLPQGRHLGLFSTVILFVSRILGSGIFSITSGIYQDCGQSVALFFAAWV
FT                   IAAIASFGGLYVFLEMGSLVPRSGGAKVFLEFIYPRPKLLATVAFSVYSVMFGFTISNV
FT                   LVFGEYLIHALGLEPSDFKTRFTGLIFLYFAAILHGVSVSHGVRIQNVLGGLKLVLVVV
FT                   IVVAGIYVTAFPQSITGIENQLEWDRVFEVRSSASVSTFASAIIKASFAFSGWNSVHTV
FT                   ANEIKDPVRTLKIAGPVSLTIMAVTYFIANLAYLIVIPSDELANGSTLAGSILFTKIFG
FT                   QFLGKKLLTLAVSLSAGGNIFVVIYTISRVDQEVFREGYLPFSRFMSSNWPYGAPLRTL
FT                   LLSVAITTTVIVLFPGGDIYSYMVSLEGYPQQLAIALIAIGIFIIRKRYPELHSPIKAG
FT                   VVGTIAVFLISLYLLIGPFVSSKSPNPKGLENWPNYGVVAIICILACIGFWYIKFRLLP
FT                   WLGGYELVSEEVQLSDGLPVKKWKKLHSYNTL"
FT   gene            732284..732373
FT                   /locus_tag="CAWG_08063"
FT   tRNA            732284..732373
FT                   /locus_tag="CAWG_08063"
FT                   /product="tRNA-Lys"
FT   gene            complement(<732519..>733520)
FT                   /locus_tag="CAWG_02672"
FT   mRNA            complement(<732519..>733520)
FT                   /locus_tag="CAWG_02672"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(732519..733520)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5AEE8"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEE8"
FT                   /protein_id="EEQ44404.1"
FT                   /translation="MSYPTIPWPTFADLKQMLHGFWASKPTYTESQYPDLQDKVVIVTG
FT                   GNTGLGYETVKSLAGSTKARIYVFSRNKEKTLAAIKQIQLEIAEEYNVSNSDIRFIQVD
FT                   LSDLTTIKPAVEEFLKQEQRIDIIIHNAGIMGPPVGSKSKQGYELQWGTNVVGPHLLQR
FT                   LLDPLFIKTSETNPPGFSRIVWVSSTAHLFAPQGGVFWDNVNYENLKLSQTQVRTTLYA
FT                   QSKAGNLIQARTWSRKHNYPNVISSSLCPGYLYTDLIRNLNSFEQCFVKRLIYPRRYGA
FT                   YTELYAAFSPDVKDGAHTIGFGVPSHARTDLTSEAVGDKTWAYLDKETDAYL"
FT   gene            <734558..>734794
FT                   /locus_tag="CAWG_02673"
FT   mRNA            <734558..>734794
FT                   /locus_tag="CAWG_02673"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        734558..734794
FT                   /codon_start=1
FT                   /gene_family="HOG000248816" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02673"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB6"
FT                   /protein_id="EEQ44405.1"
FT                   /translation="MLCSNAKFILYDALKSPKLKNMPIKLTTIDIMDPKNQEAFDKYCY
FT                   DVPVLHVDRPNQAKPVKFMHYFYEDKLLEEFTK"
FT   gene            <735201..>736610
FT                   /locus_tag="CAWG_02674"
FT   mRNA            <735201..>736610
FT                   /locus_tag="CAWG_02674"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        735201..736610
FT                   /codon_start=1
FT                   /gene_family="HOG000093875" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB7"
FT                   /protein_id="EEQ44406.1"
FT                   /translation="MRFPNVGLAELSKSIIKIRGPDATKFLNGLVTSRLLPNVVKKKQH
FT                   TISESENRHSNLSEIIDVSKNYGLMHEDIYDPDYNINISRDGINSMILNSKGRVVTDCF
FT                   LYPDPFHNVDGVFQESMNEPGYLLEVDTSISQQLMMILKLHKLSAKVDIVPDKKLYSYY
FT                   YYDDTATFDAWLENIQFKYFKSLDPTTALQNANSFIKDNVFFNQQIAKNILGFAVDNRI
FT                   PNFGIKFISNKPISTNNDNDGQQDVIPVESLFSESFSQEFDTPTINESGVVQRRFQNGL
FT                   FEIQDASKGSSLLPFECNLDYTNGLSLDKGCYVGQELTIRTFNNGVIRKRIFPVQFFQL
FT                   TEYNISYLQDHPIDLNMSDPVVENLSNIPNSSLGKLEITPLDDSEPQQQQPPTNESPFA
FT                   SSPFGSSKVVRKRKTSLGKIVSVKDNLGLVMLAVSDVEKCQIYKLELPSFEGGTQFIGV
FT                   KVGIPDWWPVN"
FT   gene            <737012..>737935
FT                   /locus_tag="CAWG_02675"
FT   mRNA            <737012..>737935
FT                   /locus_tag="CAWG_02675"
FT                   /product="purine nucleoside phosphorylase"
FT   CDS_pept        737012..737935
FT                   /codon_start=1
FT                   /gene_family="HOG000045183" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02675"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="GOA:Q5AET6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AET6"
FT                   /protein_id="EEQ44407.1"
FT                   /translation="MAENIPPEEYIKQLNHASDTIKHKIDQFPELTQPRVMIICGSGLG
FT                   GIADVLQAEPKLEIPYSKIPGFKISTVPGHAGKLVFGLIGKKKVPVMCMVGRLHFYEGY
FT                   SFQETTFPVRVAQLLGISSVVVTNAAGGINPKFKPGDLMVIEDHINFPGLAGYHPLRGP
FT                   NLSEFGPRFQPLSDAYDYELRKLFLTTARDKLGITRNIYEGTYFFAAGPTFESRAEVRM
FT                   IKTMGGDAVGMSTVPEVIVARHSGLRVLALSLITNAGVGDKPPSAFDENPPALDEGMAS
FT                   HAEVLEAADEASKDVQRIIEEVINQL"
FT   gene            complement(<738063..>738959)
FT                   /locus_tag="CAWG_02676"
FT   mRNA            complement(<738063..>738959)
FT                   /locus_tag="CAWG_02676"
FT                   /product="protein transport protein SEC13"
FT   CDS_pept        complement(738063..738959)
FT                   /codon_start=1
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02676"
FT                   /product="protein transport protein SEC13"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQB9"
FT                   /protein_id="EEQ44408.1"
FT                   /translation="MVTIGNAHDDLIHDAVLDYYGKRLATCSSDKTIKIFDLDGTDNYK
FT                   LITTLTGHEGPVWQVSWAHPKFGSILASCSYDGKALIWKEQPETQQWSIIAEHTVHQAS
FT                   VNSVSWAPHELGAVLLCTSSDGKVSVVDFNDDGTTSHVIFDAHAIGANSATWAPVSTSS
FT                   KDSAALKQQRRIVSCGSDNLAKIWKYDAANNTYVEEAKLEGHTDWVRDVAWSPSNLIRS
FT                   YIATASQDRTVLIWTQDRDGKWQKQLLTEEKFPDVCWRCSWSLSGNILAVSGGDNKVSL
FT                   WKENLQGKWESAGEVDQ"
FT   gene            <739224..>739838
FT                   /locus_tag="CAWG_02677"
FT   mRNA            <739224..>739838
FT                   /locus_tag="CAWG_02677"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        739224..739838
FT                   /codon_start=1
FT                   /gene_family="HOG000093874" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02677"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AEF3"
FT                   /protein_id="EEQ44409.1"
FT                   /translation="MDNSYDDLSAISTLVSSLSQNVSDSEEYITKLQSLSKNLVSKDQY
FT                   EQLSKEADVLTESNNNANDNDEMSIIRKLEEERLSLIMDIQREDFVSSKLIELIDQNQE
FT                   IIESVKEYLEARESIQEEEAAYTKKQLDIFVNDIVLPILAQLNENLTGLSARMKNVARK
FT                   LLRIQLRAKENPDLAMSENYRKEFTELVQCFCSLCKEYKTT"
FT   gene            complement(<739831..>742830)
FT                   /locus_tag="CAWG_02678"
FT   mRNA            complement(<739831..>742830)
FT                   /locus_tag="CAWG_02678"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(739831..742830)
FT                   /codon_start=1
FT                   /gene_family="HOG000093873" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC1"
FT                   /protein_id="EEQ44410.1"
FT                   /translation="MSSPLNSPYSRFNQGLNYNSRSSNQLVYGESSSLNGSVDSNVLRV
FT                   NSGSNSNPNDFITYIIPDFDAVTYFQKDFQALNEFHLCEESEASGFEIYLVEQWMNDRN
FT                   ISSVVTTFTGNESSKISVVRFTILKKPAKYYPLRFQEYLNELIQNHSRMKRIEKEKPTY
FT                   QHSRTNSNSEMLTLSKLSTTSIPKRESSSDYTSEVCFVANLTSLPSNLNLIPVPGGDSR
FT                   KVSTAFMINSNLKKLQCTGRSVSMITSKISDASDDKFRQMYKIQSTKVPIVFAAKELVN
FT                   IVQTCLFYFDLLDAKYCNGLLCTKTEEAITNWWNLIGLPHFSVKPNPVNGILPSRTVAA
FT                   IVSLILSVRMRIQLVGSSDVPKDPFDFENFMIAIGQFQRQYKLDKTRKLDMETLNKLFT
FT                   VTNARLLPQKNTNYFYSQVSTGSDLDPQSFDIISQSGNPKGLDSTSQKRRYGKELKKLT
FT                   NVMKSSVSDRINAASVRDIDDMSAPSKASSGRIRNKIAKLADTVSPLDVETLDLEFLVK
FT                   KHLNGKTLIRLFYGTQSSNTFLSVEKSSDPQNKGHRHNLVNTHNSHLAFPKRRGRTMVE
FT                   NSSTLQYKFESLRDKIAQTQELVMINDPSRYSRGLNRMKLGLQSKKNPLTGGEKNSMLL
FT                   TPGGNYYSSPMQTASLVDSFLQISNDDASGVESVCSKPNSINRRCVNSVFDFKHPLASF
FT                   KHNLNRRNSFPYLENQHEQNLNTLVIAKNQSGINFEEIDLLKRKRSISFSCVEDAVLSG
FT                   KVQAIGSMTKFSQSFLDSIRVLMKYESLKSYYLEGEKKEKHVTNQQLNKSYQLMNLELI
FT                   KMKNLRNQMDAHQSRIMEGGIEEELHYSMKTLNTTIDRLVYETRIVAKRIDELEQDFKL
FT                   YEMKLNDECKSKLTEIIDKVLHSKQFKEVFTSPEERKQIAYKLTGDENYINFDDEKESI
FT                   GLLRMIVMFFYGIISSIFRFFHFNRDNMNLERIRQAWVILDPNRSIIKHAYSYIGREPS
FT                   KDSIASTDSK"
FT   gene            <744321..>746033
FT                   /locus_tag="CAWG_02679"
FT   mRNA            <744321..>746033
FT                   /locus_tag="CAWG_02679"
FT                   /product="uracil permease"
FT   CDS_pept        744321..746033
FT                   /codon_start=1
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02679"
FT                   /product="uracil permease"
FT                   /db_xref="GOA:C4YQC2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC2"
FT                   /protein_id="EEQ44411.1"
FT                   /translation="MNKPKSFWKKLVVSMEVQPKGDLSTAQMFLYNHDLRPVEEARREW
FT                   AWYNYVFFWIADSFNINTWQIAATGIQAGGMNWWQTWISVWLGYALCGIFVSIGARVGT
FT                   LYHISFPVAARSSFGIYGSLWPVLNRVFMSCIWYSVQTAIAGPTFELMLHSIFGKNLPQ
FT                   RIHDTIPDKDLTTFQFLGIFLFWLFQLPFLWFPPHKIRHLFTVKAYVAPIAGIAFLVWT
FT                   IVKAGGIGPVVHQKSKVHGSELAWVFVESTMNSLGNFATLIVNAPDFSRFASQPSFGMK
FT                   YLVYTLSIPICFSITSLIGILVTSASEAMYGKPFWSPLDVLGTFLNDYTPGNRAGVFFI
FT                   SAAFALAQLGTNISANSLSFGTDCSALLPRFLNIRRGGYICAFLALAICPWKLISTSSK
FT                   FTTYLSAYSVFLSSVAGVVACDYFYVRRGFISLIDLYSLTNPDNKHQDSIYRYNKIGVN
FT                   WRAYVAYICGILPNIVGFVGATETHKVPIGATQVYRLNFFMGFFTAWIIYSVLCYFFPV
FT                   PTGTVKVGPFEKGWFEEWQDVETFDEELVGHEVHDGIEKVEYLEESVSSKKKI"
FT   gene            <746361..>747881
FT                   /locus_tag="CAWG_02680"
FT   mRNA            <746361..>747881
FT                   /locus_tag="CAWG_02680"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        746361..747881
FT                   /codon_start=1
FT                   /gene_family="HOG000093872" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC3"
FT                   /protein_id="EEQ44412.1"
FT                   /translation="MGVFGRGAVSRISIRSIHLRNTTNFVVPENYKPNRSLLKQLPWKA
FT                   GLDIWWKSLSPNRLSDLQKALVEFMLPSHLQENQRIIKEFKKTTIDDKGNYINEVGFKI
FT                   INNKDKPTKHLVFIHGYGASLGCFARNFQIINKFKDTDYNYHVHFLDNLTFGLSSNPRV
FT                   NNDTINYWRIPATAIVKLFDKTPTDSKKLYRKYYKLIEGYQLDPENFEKYRSYFTPILK
FT                   DLENFYCSAIDKWRLNSDIESIDYLVGHSFGGYWCGSYALKYPENVNNLVLLSPVGIER
FT                   HVQAVTNTDPISDRIEVPTLDPTSYKFLSRLPILSKKHILSWYYKLPHLPRLLPFLGPW
FT                   GAQLYFKMWMGKLYKINKLIDKHGGAQAIFNSNNDLVYGSQKELTLIIEYLYNSITSGT
FT                   NSDIYSRYLLTTATTSKWPLYDKFYQAVKEDPAKLKFKFHIMYGQFDFMNSEAGEKLVK
FT                   LLNENKVGAKYYEINEGGHNLYIDNPFDTNQKIFEIVSQDATKAYNND"
FT   gene            <748756..>750333
FT                   /locus_tag="CAWG_02681"
FT   mRNA            <748756..>750333
FT                   /locus_tag="CAWG_02681"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        748756..750333
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC4"
FT                   /protein_id="EEQ44413.1"
FT                   /translation="MSEKKELENQTNIQPIISFTKEDIEDNKPHVLTTIISSSGKEIAI
FT                   TNDVDQAMKLALEHKGETIELDSVQASKLLRKIDLYLLPVMCLLYCFQFMDKLTTSYAS
FT                   VLGLRKELKMQGDMYSWTATAFYLGYLVFEFPASMLLQRFPVAKTVSVFIILWGMILAL
FT                   HSVPQYPGFVALRTILGMLESSVTPAFTIITSQWYRKEEQFLRTSWWFASNGIGTIVGS
FT                   AIAYGLFENDGNYSLPAWKLVFIVTGCLTIFLGFIVMVHIPDTPAGAWFLTDEEKLMVV
FT                   ERIRTNQQGFGNTHFKKHQFIEALTDHRTWLFLLFALSNNIPNGGLTSFGTILLNEDFG
FT                   YTPSKSLLMQMPQGAVEIVGCVLLAWLCKFLPSRMLMGITATSITVLAECLLAFCKSNS
FT                   ARLAGFYLYLLGPLGFICCLSCVSSNVAGHTKKVTTNAMYLIAYCVGNLIGPQTFISTQ
FT                   APGYTGAKVAIVVCGFVSLFTLIAIYISYYIENKKRNSRPPVDMSHIENYEFADLTDKE
FT                   NPNFRYSI"
FT   gene            <750822..>752222
FT                   /locus_tag="CAWG_02682"
FT   mRNA            <750822..>752222
FT                   /locus_tag="CAWG_02682"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        750822..752222
FT                   /codon_start=1
FT                   /gene_family="HOG000159692" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC5"
FT                   /protein_id="EEQ44414.1"
FT                   /translation="MSETKNIESLILDAGPLITQPATTLQQYATAYYTTPGVHSELKDE
FT                   YARQQLAIWGDSLKIKQPKQEYIDRVVKFAKLTGDYSVLSVNDLHIVALAYELECLNNG
FT                   EDNLRSFPGEVLKNQQAENENGSNKMSNIIGDDDGFVVATKRRGGRRQREKAELRKKGL
FT                   SPTFSPKPKGGSETEEPNESSNDKTIDETPQTDLIKGVDVQEQESQEEPASESNTVGLD
FT                   EITEEYNEDDDDGEWITPENLQEEIIKDKNEQVQESNTNGPLIKVALATGDFACQNVAM
FT                   QIGIKLLNAMSGKQITRVRNYMYRCHACFRLTPMSKDGRPKHFCPKCGGNTLLRCAVSV
FT                   DNKTGKITPHLKQNFQWIRRGERYSLPSPLSKNQKKLQGNGGYQHNKENRHKSLQTPLI
FT                   LNEDQKEYQRALKNDEWERKQQDKMLQDWIGGGSADNFVSPFGNTIRNSGVKVGRGRYA
FT                   NSSKKKRK"
FT   gene            <752477..>754393
FT                   /locus_tag="CAWG_02683"
FT   mRNA            <752477..>754393
FT                   /locus_tag="CAWG_02683"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        752477..754393
FT                   /codon_start=1
FT                   /gene_family="HOG000093886" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQC6"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC6"
FT                   /protein_id="EEQ44415.1"
FT                   /translation="MSGNSAANAAALAAFNGIGKKKKESTTKLNGTDNNTNHLGVIGST
FT                   SNQTKQHQQQQQQPQALRTPLPAHPSRKKSNKFSQLKRLNTAPAMASLQPALQIASPSI
FT                   SPTQPSAPASALDSDPDYFTLSPHTIPSKNEIAKSPQTPQDMIRNVRQSIELKAIPNNA
FT                   QAKRLSVDYSPQEMLKNLRHSLHSRTKTSPMLTTSDKMGQTMLAEMRDRLENTRRIASN
FT                   SVASLSLSPNLDFNKSTSDVSNLSHHYDVDTVSTDSFASFNSSINDRHLPHGISIDVTN
FT                   HDSDEDEIDDREREEDHEPLDNGELKSTNNKVTVSSRLRRKPPPGEDFQMQLNDKSRDT
FT                   ISSGSYSLNPDEVYSFTDPDSYENLVSEVEVGETTRLFPQFPDANHYHQHSSKFRKKHQ
FT                   KVKPINGIYYRDMDSSNTSDTEESTSNLPSRSTTPLLGQPQQQVHFRSTMRKANTKKDK
FT                   KSRFNELKPWKNHNDLNYLTDQEKKRYEGIWASNKGNYMSQVVIKLHGVNYETQKDPKE
FT                   EAKMEHSRTAALLSAAAVEDSNYNGNNSLHNLDSVEINQLICGPVVKRIWKRSRLPSDT
FT                   LEKIWNLIDFRRDGTLNKNEFLVGMWLVDQCLYGRKLPKKVDNVVWDSLGGIGVNVTVK
FT                   KKK"
FT   gene            <754919..>756925
FT                   /locus_tag="CAWG_02684"
FT   mRNA            <754919..>756925
FT                   /locus_tag="CAWG_02684"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        754919..756925
FT                   /codon_start=1
FT                   /gene_family="HOG000093887" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC7"
FT                   /protein_id="EEQ44416.1"
FT                   /translation="MNLIDMLSKDPPSSLYNPELEENIQNNEISNGISISESQDNIILD
FT                   NNSNGNINNNNNDINININNSNPPSIIYLPTPLTELQKSFVEMTLHLFSSELLNEVRSK
FT                   RLKTSIDNLLDSSTTIEESDIIVNQNKISLCFEQLSIICDHPSLLIEHFIPKKMLLSET
FT                   NERQLNLSGKLELFNRIIDTLIEQKPPNGYRIIVVSDNVKELELVEGIIVGKTLYYINS
FT                   TNAKLFESTHFVPDLKDKSSDKVFINLLTTQQLSSNYVSDKDGECYDLIFSFDPNLDVQ
FT                   TPSIEILQRENGNQCPILVPIPVFTLEHITLQLPQPQQVDLTESIDAALNKWRVKCINT
FT                   LVVNFFNLDEMSNDFFTENYGLNMKEFWNMMHNNRQGLNKLLDNYNGQLVLSFSEEKLI
FT                   KKLNSFYNRGGNGGFDQVRDANCQLFKSKLAEAVYQKFMDLDKGVDEIELNLNGKREYE
FT                   TARELQYDDDEDYIANNYKKFRRLNDDANMSERKLARVDTDLLKQKQKLVFLKNKLEHL
FT                   VDIADKEITDAEATSQTQSSKTLQQEVENLKKEFNRINEECEGTREKYQSSSSVALQLS
FT                   HRLTQLKQQNEKIERKLFGPGMAQLPELIKKDALLSYELKLKHLEKKNEFMQQFFSSKI
FT                   EMTYQERQQLLENSGSGANNRQNNRISRGATPL"
FT   gene            <757732..>759501
FT                   /locus_tag="CAWG_02685"
FT   mRNA            <757732..>759501
FT                   /locus_tag="CAWG_02685"
FT                   /product="sphingosine-1-phosphate lyase"
FT   CDS_pept        757732..759501
FT                   /codon_start=1
FT                   /gene_family="HOG000190693" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02685"
FT                   /product="sphingosine-1-phosphate lyase"
FT                   /db_xref="GOA:C4YQC8"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC8"
FT                   /protein_id="EEQ44417.1"
FT                   /translation="MLELNSITIPRNFTEFQLTALKIYYQLKILFLATYCAQGSFGLNG
FT                   SVCLARDIFVGYVVYTQLLKLYRVLRGYGIIDSIRRLYLYVSSTVSSQIFSLPFIKSKI
FT                   DKELQATIGKVEEEIMKNDPQLLQFPELPEQGIDADNVSLELDKLQNLKHSDWINGRVS
FT                   GAVYHGGENLLSLQVEAYKKYSVANQLHPDVFPGVRKMEAEVVHMVLGIFNAPSDGCGS
FT                   TTSGGTESLLLAGLSAREYGKKYRGITEPEVIAPVTIHAGIEKACFYFGMKLHKVDLDP
FT                   VTFQVDVKKVERLINSNTVLICGSAPNYPHGIIDDIESLSKLAVKYNIPLHVDACLGSF
FT                   IVSFLEKSKVHGDRKLPIFDFRLPGVTSISCDTHKYGFAPKGSSIIMYRSPKLRECQYY
FT                   IASDWTGGMYGSPTLAGSRPGALVVGCWATLINIGKQGYTKFCYDIVSASMKVKRAIET
FT                   DPILSKHLQIIGDPIGSVISFQLAPQQSGNLSIYEISDLLTKKGWHFATLQNPSALHFA
FT                   FTRLTVPVVDELIADLVEATKEAVAIAEEHKKNGVTKAPGDTAALYGIAGSVHTAGLAD
FT                   RLIVAFLDTLYKI"
FT   gene            <760332..>761192
FT                   /locus_tag="CAWG_02686"
FT   mRNA            <760332..>761192
FT                   /locus_tag="CAWG_02686"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        760332..761192
FT                   /codon_start=1
FT                   /gene_family="HOG000093888" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQC9"
FT                   /protein_id="EEQ44418.1"
FT                   /translation="MGDFLSFTSCLVNIDIVLDFQLYLSVFFLCNDVTLCFQYYYYNSV
FT                   YPRLQQQQQQQQRQQSYVPLSTDTSDSSRLTMTNNEDRDISIYQAQDIQQIKHANSNQS
FT                   TSEDFVNSTPSSYDSINDNDNGSIIKKSIVGAILNTGHAVALPISTETFCKRDTEDKST
FT                   SSVGLYLAWGCTLVYCLSRCPQLYKNYKRKSVDGISPLLFASALMGNLTYTLSILTCCE
FT                   FAFGSNRQDFILKELPYILGSAGTIVFDIGYFYQKYLYRNSGRNTSAMTLESWSDIETR
FT                   RTNDN"
FT   gene            complement(<762404..>762730)
FT                   /locus_tag="CAWG_02687"
FT   mRNA            complement(<762404..>762730)
FT                   /locus_tag="CAWG_02687"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(762404..762730)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD0"
FT                   /protein_id="EEQ44419.1"
FT                   /translation="MGFYFSFLSQFDKFNNFCFALVNFQSFSFLFCKLCFFFFISILLI
FT                   SGLFVVYFPPIIAVHQCIITLYILYNVLYVSTCPDQPRIVSLFIFALLSHAFAFRVVDF
FT                   IFIQ"
FT   gene            <763115..>764053
FT                   /locus_tag="CAWG_02688"
FT   mRNA            <763115..>764053
FT                   /locus_tag="CAWG_02688"
FT                   /product="protein CCC1"
FT   CDS_pept        763115..764053
FT                   /codon_start=1
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02688"
FT                   /product="protein CCC1"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q59SS1"
FT                   /protein_id="EEQ44420.1"
FT                   /translation="MSLVAIKNGISKLVSSKDASDAELERVERLIDSNQIPYGSTDSND
FT                   ERAQQLAREEAIIQAAASISAASSSENKEEEGVDSITAFFNTFDPRVMSDIIIGLSDGL
FT                   TVPFALTAGLSSLGDSKLVITGGMAELVSGAISMGLGGYLAAKSESEYYFSQVKKEKLE
FT                   FFKKPEAINQDAAEIMFELGASEQTIISFLKDLDAKPKNLIDFVIRYGKGLEEPAAGRE
FT                   LTSALTIGASYFLGGFVPLLPYFFTKEVGTGLIISVVAMLVVLMLFGYFKCSISMGEGC
FT                   PNHKKFAAGFEMVVVGSIAAGAAWGLVFLIE"
FT   gene            <765186..>766012
FT                   /locus_tag="CAWG_02689"
FT   mRNA            join(<765186..765214,765292..>766012)
FT                   /locus_tag="CAWG_02689"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(765186..765214,765292..766012)
FT                   /codon_start=1
FT                   /gene_family="HOG000125753" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02689"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD2"
FT                   /protein_id="EEQ44421.1"
FT                   /translation="MSDTKIIVHWLNYSRSQRVIWLLEELNIPFELKVYLRNKQFRAPK
FT                   ELENVHPLGKSPVIEVIDTKTGESEVIAETGHIFNYILSNYDTTNILTPANRKLQNQVD
FT                   YFLHYAEGTLQPNLVALLVHGFAKQQAPFGTKFLMGLLVNGIDSMFYIPELKKNLNYLE
FT                   DIMRKQHENGSNYFVGDKLSGADIILEFPVITNIFQNKRGAEQLGAGDVEKEYPHLNQW
FT                   AEDIKKEPKYIKAQELVAKHETVKPNI"
FT   gene            complement(<766080..>766931)
FT                   /locus_tag="CAWG_02690"
FT   mRNA            complement(<766080..>766931)
FT                   /locus_tag="CAWG_02690"
FT                   /product="prohibitin"
FT   CDS_pept        complement(766080..766931)
FT                   /codon_start=1
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02690"
FT                   /product="prohibitin"
FT                   /db_xref="GOA:C4YQD3"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD3"
FT                   /protein_id="EEQ44422.1"
FT                   /translation="MSQRIADFVSKIALPVGITIALAQSALYDVPGGKRAVIFDRLKGV
FT                   KQGVIGEGTHFLVPWLQKAVIFDVRVEPRVITTTTGSKDLQNVSLTLRVLSRPEVRKLP
FT                   TIYQTLGLDYGERVLPAIGNEILKSIVAQFDAAELITQREVVSARIRQELSRRAAEFNI
FT                   ELEDVSITHMTFGREFTKAVEKKQIAQQDAERSKYLVERAEQEKKAAIIRAEGEAESAD
FT                   VVSKALAKAGDGLLMIRRLEASKDIASTLANSPNITYLPNGGAGGSDSDGSKNSLLLNI
FT                   GR"
FT   gene            <767559..>767888
FT                   /locus_tag="CAWG_02691"
FT   mRNA            <767559..>767888
FT                   /locus_tag="CAWG_02691"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        767559..767888
FT                   /codon_start=1
FT                   /gene_family="HOG000093889" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD4"
FT                   /protein_id="EEQ44423.1"
FT                   /translation="MIANLTNISNRMFRSQRIIILSILAAFLVLLGITSLSGHHQVVVN
FT                   SVKSMSNKASDSISEFYNKVDSSLSSDEKELIEEGKADAEKLAELADEKSKEIKEEENS
FT                   NPQQK"
FT   gene            complement(<767991..>770039)
FT                   /locus_tag="CAWG_02692"
FT   mRNA            complement(<767991..>770039)
FT                   /locus_tag="CAWG_02692"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(767991..770039)
FT                   /codon_start=1
FT                   /gene_family="HOG000093891" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQD5"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD5"
FT                   /protein_id="EEQ44424.1"
FT                   /translation="MTQRKRSSPEDDLSNSSDSELESPQLENDDDLKTHYYITPKTNST
FT                   DSSFENVYCRVTSQPKQPQKNTTPFLSLLDGNESSENVSRRFELYNQVWANQSDKIQSI
FT                   LNNANDELFKDLIQFVNLENLQQLSVGYVQLTTNTANNLRILQEFYQYIQRKSDYDYKL
FT                   ITLNSKHFTYNIKATLREVVKQFHDTCQIVEEMHRLNYDLDAIDDWFDEERLYNSRLVL
FT                   VLEDTNLINNQLLNQLLKILSSYVGKWPLKIVMGLSCETVSSWINGNLTNELRIGIEGH
FT                   KFKSNDNKSLGYIILNNLFLTPELTPENPLLINSTLSTIILNRFENSNNSIDALIAEIK
FT                   LCYMIYFYRSPLSILIAEENPQPQELYADGLRKLSSFKKYIELKLHQGDRSVKDLLNND
FT                   KSVIKLFNESRSNFRKFKLAVMNAINIIYQLHPNKPKQKFELYKLLINHKLLNSKYLYE
FT                   SVKNLSKLSDSVLGKVLIGLTDNCTEILDGISDNHLIQLIKGLGELSDLRGVSDKLQNY
FT                   FDNSILTTPLEYMVFHEVFSMDGGLIQEKFTKPPLFEENYENLMINLLRPNLRATIERG
FT                   LDNYETYLGNPLIENSVEQPLMPPTLTHLFKLYKEAPTTINLYDFYQAFKSTLDEKELS
FT                   LQLSTNEDWEKLTYAWFVQNCHELMLMGILQQKPKGDFLEKAIWKGI"
FT   gene            <772119..>773849
FT                   /locus_tag="CAWG_02693"
FT   mRNA            <772119..>773849
FT                   /locus_tag="CAWG_02693"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        772119..773849
FT                   /codon_start=1
FT                   /gene_family="HOG000179738" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQD6"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD6"
FT                   /protein_id="EEQ44425.1"
FT                   /translation="MTDTSDLKPEHTEKATGLSTSKEVPESTLTQRKQSSTPATQTSKR
FT                   PTPAKKKRAFINVAPLNTPLSHRLETLGVVWHCISIPFFICLFFFMISLGLFGWIVIVL
FT                   PYFIWWYGFDLHTPTNGKVAYRYRNSMKNFIIWDWFVRYFPIKVYKSVELEPTFKEVLV
FT                   EETESSEDDDEQDLVSERSRTLVDKVFKFFGLKKRLNDTSSGKSETYKTVSTGPRYIFG
FT                   YHPHGVISMGGVGLFATNSLRNEPYTPFLKFLKPFFHDSSKGERLFPGLGNIFLLTITT
FT                   QFAIPFYRDYLMGLGVTSASAKNIRSLISNGDNSVCIVVGGAEESLLNNMVAKHARVGY
FT                   GYKENQDINGSDAEDDQPEEEEEQQQQPNGNVEVDKKTTKEVGEKTSSQPSKREVKLIL
FT                   NKRKGFVKLAIELGNVALVPTFAFGEADVYRLVQPSPTSMMYKFQKWMKGIFSFTIPLF
FT                   SARGVFIYDYGLLPFRNPINICVGKPIYIPAGALQEYKQQHPEEFTEEETKPPMKKSGS
FT                   FTDIFKMNGETPKVSTIKTKIPPALLDKYHKLYVDELRNVYEENKHKFGYGDVEFSIVE
FT                   "
FT   gene            complement(<773951..>774817)
FT                   /locus_tag="CAWG_02694"
FT   mRNA            complement(<773951..>774817)
FT                   /locus_tag="CAWG_02694"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(773951..774817)
FT                   /codon_start=1
FT                   /gene_family="HOG000093892" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD7"
FT                   /protein_id="EEQ44427.1"
FT                   /translation="MLCNQALIRNTPRFVRCLSRGATGAPIITSKKEILDKQKTKPSPS
FT                   EVKPVSRRLKSASKKKQEKTKTTSKYLPLSALPHFPNPEEARMGRPRGIDFQIPKESLK
FT                   SSEVKISKEFDKEAHDLAGKIESFSQKEADDQALIAISKEIGKYLEPELNRMYPTKEHP
FT                   MRKSLSGMSKINPTLDKIEDSYLWEILPPKKSFGIPPYQRGDPLGFKEWENKLIEKEEK
FT                   KQLEDEAYKKKYGKMMAEVSDADSFITSKRGARKRINRKLLKNYKKLEKDAKLPAKDKL
FT                   VIEVIKL"
FT   gene            <774396..>774836
FT                   /locus_tag="CAWG_02695"
FT   mRNA            <774396..>774836
FT                   /locus_tag="CAWG_02695"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        774396..774836
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD8"
FT                   /protein_id="EEQ44426.1"
FT                   /translation="MAINAWSSASFWEKLSILPARSCASLSNSFEIFTSDSLRDSFGIW
FT                   KSIPRGLPILASSGLGKCGNADNGRYLLVVFVFSCFFLEALFNRRETGFTSDGLGLVFC
FT                   LSKISFFDVIIGAPVAPRDKHLTKRGVFLIKAWLQSILDSLI"
FT   gene            <775256..>776290
FT                   /locus_tag="CAWG_02696"
FT   mRNA            <775256..>776290
FT                   /locus_tag="CAWG_02696"
FT                   /product="multicopy enhancer of UAS2"
FT   CDS_pept        775256..776290
FT                   /codon_start=1
FT                   /gene_family="HOG000228986" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02696"
FT                   /product="multicopy enhancer of UAS2"
FT                   /db_xref="GOA:C4YQD9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQD9"
FT                   /protein_id="EEQ44428.1"
FT                   /translation="MAKLVLKGNNLSKLIKMSVHREKIDLAKLPHHYDGPVTLAVIGGT
FT                   GLYDLPNLHPVARLTISTSWGFPSGSITISKTDSGFPVAFLARHGAHHDLLPSDVPSRA
FT                   NIAALKKLGVKAIIAFSAVGSLQQEIKPRDFVLPTQIIDRTKGIRPSTFFEKGFVAHAM
FT                   FGEPFDLKLNKLISDAIPSKGFLEGFDTDGTPVLHTKENTNNGEDLTIICMEGPQFSTR
FT                   AESRLYRSWGGSVINMSVLPEAKLAREAEIAYQMICMSTDYDSWNESEEPVTVETVVGN
FT                   LKANSANACKLAAKLIDEFAAKGGEIGKDLQGSMKYAVSTSPHGVKKELLEKMHFLFPG
FT                   YWEV"
FT   gene            <778208..>779938
FT                   /locus_tag="CAWG_02697"
FT   mRNA            <778208..>779938
FT                   /locus_tag="CAWG_02697"
FT                   /product="peptide transporter PTR2"
FT   CDS_pept        778208..779938
FT                   /codon_start=1
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02697"
FT                   /product="peptide transporter PTR2"
FT                   /db_xref="GOA:C4YQE0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE0"
FT                   /protein_id="EEQ44429.1"
FT                   /translation="MSTEEKHSQTDVINSSTQGSHSVEKSSRDDEYAGDNLGSDIQIDD
FT                   EGREPTDHEMETLRHVSESIPISCWLVAIVELAERFSYYGLSAPFQNYMQFTPEHSPKG
FT                   MLGLKQQGATALSYFFQFWCYVTPILGGWISDIYWGKYKTIFVFCVIYIVGIFLLFITS
FT                   VPSITSKSTATGGYIAAIIIIGLGTGGVKSNVSPLIADQIPKKKPYIKVTKKGERVIVD
FT                   PNITVQNVFMFFYLMINIGSLSVIATTQMEAHIGFWSSYLLTFCFFFIAIAALIVGRNK
FT                   YVKVPVGDKIVNKTFKCVWVGIINGFNFDAAKPSVKPEKSYPWDDHFVDEVKRTISACK
FT                   VFVWYPIYWVQYNGMMNMFVSSAAGMSRDIPNDFLTVFDSVAIIVFIPIFERFLYPFVR
FT                   HFTPFKPITKIFWGFMFGSGAMVYAAVLQHYIYKAGPCYDHPLDCPNGNHINIGLQTPA
FT                   YVLIAISEILASITGLEYAYTKAPVQMKSLVMAMFLLTNAVGAAIGIALSSVSVDPKMV
FT                   WTYSGLAVSCFIAGCLFLTLFKHYNKKEDEWNNLEYEANIEEAALMPVSSLTPSRKSIA
FT                   "
FT   gene            <780438..>782537
FT                   /locus_tag="CAWG_02698"
FT   mRNA            <780438..>782537
FT                   /locus_tag="CAWG_02698"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        780438..782537
FT                   /codon_start=1
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQE1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE1"
FT                   /protein_id="EEQ44430.1"
FT                   /translation="MEVTQRTQSQTQPTQQSPTTQTQTQSKEDQNRICQLICSTGQFGN
FT                   YDLNINDKTIVQGKMTWYFGRDPNSDLQVASSSRISNKHFQIWFNFNDKSLWIKDTSTN
FT                   GTHLNNSRLVKGSNYLLNQGDEIAVGVGRDEDVVRFVVVFGDKYNPAKLPDSTNTIKDE
FT                   GIYKDFIVKNETIGQGAFATVKKAIERSTGESYAVKIINRRKALNTGGGSAMAGVDREL
FT                   SILERLNHPNIVALKAFYEDMDNYYIVMELVPGGDLMDFVAANGAIGEDATQVITKQIL
FT                   EGIAYVHNLGISHRDLKPDNILIMQDDPILVKITDFGLAKFSDNSTFMKTFCGTLAYVA
FT                   PEVITGKYGSSQMESQQKDNYSSLVDIWSLGCLVYVLLTSHLPFNGKNQQQMFAKIKRG
FT                   EFHEAPLNSYDISEDGRDFLQCCLQVNPKLRMTAAEALKHKWLQDLYEEDSVKSLSLSQ
FT                   SQSQQSRKIDNGIHIESLSKIDEDVMLRPLDSERNRKSSKQQDFKVPKRVIPLSQHPAT
FT                   PLPMSQPKKRPYQIDPRTNKKVDLEEPSTSKKVKLSDSVVAEDYLKLEPLANSLFQETI
FT                   NISKSPFSFGRNDTCDCEIDDDRLSKLHCVITKENDSIWLLDKSTNSCLVNNTSVGKGN
FT                   KVLLRGGEILHLFFDPLSSQHIGFKVVLVDQSSGEHKSQVEVLKQTSEEMNIIPLISGL
FT                   SSISS"
FT   gene            complement(<782594..>783793)
FT                   /locus_tag="CAWG_02699"
FT   mRNA            complement(<782594..>783793)
FT                   /locus_tag="CAWG_02699"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(782594..783793)
FT                   /codon_start=1
FT                   /gene_family="HOG000093893" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02699"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE2"
FT                   /protein_id="EEQ44431.1"
FT                   /translation="MNKSPRFYRLPSKKSVFLNELSKSPRLSLIWQSVDSRCMNATKTL
FT                   PIVIQTKQEIFNQVVQSNPEKQGVSLKFKQFIAYGKAIINFYKSGIKNVWQNQSILKKL
FT                   KQDFYLTHVAPSGQEIKIRIPSFKKLTEEMSQRIYMNKVESETLEKMTKGDIKRSNDMK
FT                   THSIFNLTREQFQLYKRTPNDYYKIPLFALVCLIFEELTPVLCYMIPEITPSTCILPNI
FT                   LPRVWNPNAIGKMKSLNQNLDENSMIDLSLKTSYNLDIEHVRLLSQSLRLVSRYIPPQF
FT                   YPDGYLRDKLQDYYNYIVIDNFYLSGLNGDGNMWNLNDQELVLACLERNLIQNIVYDTK
FT                   LFNQISDPIQKQMFQDKYMGKLRVKLFQYLVDFDSFNIGYLAVNHAIPREEEVNVIAWR
FT                   "
FT   gene            <783916..>784992
FT                   /locus_tag="CAWG_02700"
FT   mRNA            <783916..>784992
FT                   /locus_tag="CAWG_02700"
FT                   /product="hypothetical protein"
FT   CDS_pept        783916..784992
FT                   /codon_start=1
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02700"
FT                   /product="hypothetical protein"
FT                   /note="similar to activator of the phosphotyrosyl
FT                   phosphatase activity of PP2A"
FT                   /db_xref="GOA:C4YQE3"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE3"
FT                   /protein_id="EEQ44432.1"
FT                   /translation="MSYITPTKRIFTPEDLSKWVGSPTYNTVLDFIMELQSSVTGKSND
FT                   SSYETSSIIDKLSKLLSKVDNLITLHPAHDSVSRFGKIEFRDFYSDLSSKAEEYISEIT
FT                   ATAIQETSAYFIESWGNSTRIDYGSGHELNFICFLLCLKELGQITSADYEGLVLKVFTQ
FT                   YMSIMRKLQKEYWLEPAGSHGVWGLDDYHFLPFLFGAAQLSTHPHMKPKSIHNDELVEM
FT                   YSTKYMYFECINFINKIKTIPNHQGKLSLRWHSPMLDDISAAKNWDKIREGMVKMYKVE
FT                   VLGKLPIMQHFMFGSLLKCPEGIPEHTDENGHGENPEDHCGHAHVNTWGDCCGIKIPSG
FT                   IAASESLKHERKGNIPFD"
FT   gene            complement(<784998..>786467)
FT                   /locus_tag="CAWG_02701"
FT   mRNA            complement(<784998..>786467)
FT                   /locus_tag="CAWG_02701"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(784998..786467)
FT                   /codon_start=1
FT                   /gene_family="HOG000231935" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE4"
FT                   /protein_id="EEQ44433.1"
FT                   /translation="MSIPGFGSAEKVNHTASSVTLTIPQSYEWRIEVPFNRILKFKVLT
FT                   GIVEINGTELANNTEIQLSGTKTYLYSPVTDAVIEYVLVENKDDLSLVSASDEGFVEYL
FT                   SDESNMDSILNLHMYLESKRQYTKDYNFSSSIDQQQSGPKVLIIGSKYSGKTTVSKILS
FT                   AYANKMNNTPVLVNLQPRDGVFALPGSLTATPISDSFDVESCNGYGLTTTSGTLVHNPK
FT                   QPIVKNFGMADFNDNVDFYKLLIEKLGIAVLSRLDQDLNIKNSGVIIDTPALTSKNFDI
FT                   VESMVSNFLIDNIIVIGNERLAIELTKKFAYKSTQLNIIKLNKSSGCIEVEDRFIRLQQ
FT                   EQTIKEYFNGNFKTRLSPFKTDIELSGLKIYKNVLTKDLLSQMAFLPGGDDFEKDETNP
FT                   EEDPEEKQLEKYYQAIEDPNSSNLENSIVAITHLPNNDKKLGKDLLNTSVLGYIHVSKF
FT                   DDQKKRLKVLFPFPGVFPKNVLISTNIGYNE"
FT   gene            complement(<786691..>787407)
FT                   /locus_tag="CAWG_02702"
FT   mRNA            complement(<786691..>787407)
FT                   /locus_tag="CAWG_02702"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(786691..787407)
FT                   /codon_start=1
FT                   /gene_family="HOG000093894" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE5"
FT                   /protein_id="EEQ44434.1"
FT                   /translation="MSSSNDTPSSFVTPQTPPRQQQRRKSNTGAISTPVASSVLLTPST
FT                   TTKKPTRTPVSQKRKQGVQLSPPQANKFPFTPITPQKSPCKTRKNLDLFTSNEKFGLLL
FT                   PSPSTIGSGRCHNSFTQAPPPLFDLKKVNEFKVPKTPAKQIIDNSRTKESENEDDWEVM
FT                   DIDEVAKIPRAKLRNPFIDTFEPTSPVTPEESTGDRINYDTHMELINSKTGKKRVVKLT
FT                   KNQMKIKPKRLSFDNI"
FT   gene            <788251..>788778
FT                   /locus_tag="CAWG_02703"
FT   mRNA            <788251..>788778
FT                   /locus_tag="CAWG_02703"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        788251..788778
FT                   /codon_start=1
FT                   /gene_family="HOG000216653" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="UniProtKB/TrEMBL:Q59SU0"
FT                   /protein_id="EEQ44435.1"
FT                   /translation="MTLARYPKAVVFDLDYTLWPCWCDTHIMTPLKSVSPTTVVDRYDF
FT                   QLSFYKDVESIIRELVENDVKIIAASRTATPHIAKQLLSMLHIQGRPAIEYFHSLQWGT
FT                   GSKTKHIKAAAKNLKMTTELTDGEFILFDDEWRNRDVESINCHFAHVPDESVGLTRHIF
FT                   VQELRQWNKRNL"
FT   gene            complement(<789103..>790737)
FT                   /locus_tag="CAWG_02704"
FT   mRNA            complement(<789103..>790737)
FT                   /locus_tag="CAWG_02704"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(789103..790737)
FT                   /codon_start=1
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02704"
FT                   /product="hypothetical protein"
FT                   /note="similar to secretory aspartyl proteinase SAP9p"
FT                   /db_xref="GOA:C4YQE7"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE7"
FT                   /protein_id="EEQ44436.1"
FT                   /translation="MRLNSVALLSLVATALAAKAPFKIDFEVRRGESKDDLSPEDDSNP
FT                   RFVKRDGSLDMTLTNKQTFYMATLKIGSNEDENRVLVDTGSSDLWVMSHDLKCVSAPNS
FT                   KRNERSFGHGTGVKLNERELLQKRKNLYQPSRTIETDEEKEASEKIHNKLFGFGSIYST
FT                   VYITEGPGAYSTFSPFVGTEGGSGGSGGSNTCTSYGSFNTENSDTFKKNNTNDFEIQYA
FT                   DDTSAIGIWGYDDVTISNVTVKDLSFAIANETSSDVGVLGIGLPGLEVTTQYGYTYQNL
FT                   PLKLKADGIIAKSLYSLYLNTADAKAGSILFGAIDHAKYQGDLVTVKMMRTYSQISYPV
FT                   RIQVPVSKIDVESSSGSTTNILSSTTGVVLDTGSTLSYVFSDTLQSLGKALNGQYSNSV
FT                   GAYVVNCNLADSSRTIDIEFGGNKTIKVPISDLVLQASKSTCILGVMQQSSSSSYMLFG
FT                   DNILRSAYIVYDLDDYEVSLAQVSYTNKESIEVIGASGITNSSGSGTTSSSGTSTSTST
FT                   RHSAGSIISKPVYGLLLSLLISYYVLV"
FT   gene            complement(<792291..>793334)
FT                   /locus_tag="CAWG_02705"
FT   mRNA            complement(<792291..>793334)
FT                   /locus_tag="CAWG_02705"
FT                   /product="vacuolar protein sorting 26"
FT   CDS_pept        complement(792291..793334)
FT                   /codon_start=1
FT                   /gene_family="HOG000191799" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02705"
FT                   /product="vacuolar protein sorting 26"
FT                   /db_xref="GOA:C4YQE8"
FT                   /db_xref="InterPro:IPR005377"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE8"
FT                   /protein_id="EEQ44437.1"
FT                   /translation="MSIFFKAPLDIEIRLDNEDTRKHVEVKTPQGRVEKLPIYKDGESV
FT                   KGVVTLRTKEGRKLEHLGVRVQLLGSIETNTDGISSSEFLTLATELAAPAQLSHPESYP
FT                   FEFKNVEKQYESYRGKNVRLRYYIKVTVLRKSSSEIIREKELWVYHYTTAVPKPVTGVS
FT                   SSSTADSKLGAKKANEDTLQKPATPSSNDDASANTSKGSTISKRNESHSVKMDVGIENC
FT                   LHIEFEYSRSRFSLKDAIIGKIYFLLVRLKIKHMELSLIRRETVGAPPNQVTDSETVVR
FT                   FEIMDGAPVKGETIPIRLFLSGFDLVPTYRDVNKKFSTRTYLSLVLIDEDARRYFKQSE
FT                   IILYRDQ"
FT   gene            <794066..>796264
FT                   /locus_tag="CAWG_02706"
FT   mRNA            <794066..>796264
FT                   /locus_tag="CAWG_02706"
FT                   /product="predicted protein"
FT   CDS_pept        794066..796264
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02706"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR020473"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQE9"
FT                   /protein_id="EEQ44438.1"
FT                   /translation="MSSANYISDEVPPDMVSPHDHRPSKDEPLKHLDTVIALYDFPGTQ
FT                   SSHLPLNLGDTIHVLSKSATGWWDGVVMGNSGELQRGWFPHNYVRSVNYVQPVLKKLKD
FT                   NKDLDSITAANTAANVVMPSLTNLIQKSLQESERNSPANSTRKNSVVSFASSETSMPSD
FT                   SKYTQQQTNTNQNSPEYQSISLPSTRDHSTVEMQPPSQQSSISHTLTGFGIGDDEIIPM
FT                   EVEEAEKLVEEYRLKYNKTVTWIPRTSTKGDIIFYCEQLDVYCESLPLILFDGEASSPN
FT                   LEYPGSDVIMDPTPISVQGSQSMENVLDTREGSAAGSFDSTKRDSNVSMSTQSSGSSYH
FT                   RFSRPFFSVDNLFYKHSSDICTWNELKEQCNYILDLMLKAIKDQNRQFFSTHFSRLNKL
FT                   VVALCAAVRLNQEDYIDTKYENTTRRKLKRVCASFAQIYINGILHLSVLHYSLEGFNEG
FT                   RLFGYDMGKLNRSSSSSAFQSPASSLSTIRQGSDDSTRFAQKLSQDRNSEGNGDMNYIN
FT                   QLVYEIDNLRENVNSIVKIFLKLSANKKIKNSDYDSSDASDDEGEDRFDILPQVYPRFL
FT                   VDEFNGGNWCNPFFSTKNTVLNVSGDDLKNRYHTKIIIDHSAYDSLSQYVDKIVDACEN
FT                   ILEALDPKVQNTFYYNEMLRNERNTQILRLTYKSLYHCSAMVDLIESFDFTVFCSVKRH
FT                   TGKCIDTEDESYENPSVWGDHYDSNLSFDYPVVLEFFR"
FT   gene            <796273..>798060
FT                   /locus_tag="CAWG_02707"
FT   mRNA            <796273..>798060
FT                   /locus_tag="CAWG_02707"
FT                   /product="predicted protein"
FT   CDS_pept        796273..798060
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02707"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C4YQF0"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF0"
FT                   /protein_id="EEQ44439.1"
FT                   /translation="MHDLVAKIIMATQSLTLEDPEVFKGLKEEDPLFYNREISKIPKEK
FT                   AALLLSSILKEQLSFKDGGAISLNPDTLLSGYLVEIAKTTKTVLLITQQLIEERETIIN
FT                   YATRVMQDNFDVQLLLVERNNTSSSEKADDNSYYVGGHKKSTDVPWYLEGDDEYELLLD
FT                   VKGNIKGGSKEALVSHLTHHLSLDSNFNAVFLLMFSSMMSLGELISLLIARFNIEPPEG
FT                   LSYEEYNLWVSKKRNPIRLRVINIMKLLLEKNWSMSYYNEPVLRRWLTFAHSDQVQTYS
FT                   LGNLLVNYLERLLRGERIYVERDPVIPNTKPPAPLTKGSSLSKKPRVMDIDYVELARQL
FT                   TLREFKLYCKITKFACLAKVWGKKSGLSESIDSITQFIKASNQLTNFVGYMILRKADPK
FT                   KRVQIIRYFIQVADKCRQYNNFSSMTAIISALYSSPIHRLKKTWEYMNADALSNLKNMN
FT                   KLMNSSRNFNEYRDVLKFIGSEPCVPFFGVYLSDLTFVYHGNPDYLYNRTRQVNFAKRA
FT                   KTSEIVSGIDRFKTTGYNFQEVPEIQKFLDAWFEKCPTIDEQYQISLNLEPREHQSVPV
FT                   TVIVLQTPPLISRVSNRFH"
FT   gene            complement(<798317..>798709)
FT                   /locus_tag="CAWG_02708"
FT   mRNA            complement(<798317..>798709)
FT                   /locus_tag="CAWG_02708"
FT                   /product="histone H2B.2"
FT   CDS_pept        complement(798317..798709)
FT                   /codon_start=1
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02708"
FT                   /product="histone H2B.2"
FT                   /db_xref="GOA:C4YQF1"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF1"
FT                   /protein_id="EEQ44440.1"
FT                   /translation="MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKARKETYSSYI
FT                   YKVLKQTHPDTGISQKAMSIMNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRL
FT                   ILPGELAKHAVSEGTRAVTKYSSASS"
FT   gene            <799253..>799651
FT                   /locus_tag="CAWG_02709"
FT   mRNA            <799253..>799651
FT                   /locus_tag="CAWG_02709"
FT                   /product="histone H2A.2"
FT   CDS_pept        799253..799651
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02709"
FT                   /product="histone H2A.2"
FT                   /db_xref="GOA:C4YQF2"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF2"
FT                   /protein_id="EEQ44441.1"
FT                   /translation="MSGGKGKAGTSEKASTSRSAKAGLTFPVGRVHRLLRKGNYAQRIG
FT                   SGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGDVTIA
FT                   QGGVLPNIHQNLLPKKSGKGGVKASQEL"
FT   gene            <800188..>801219
FT                   /locus_tag="CAWG_02710"
FT   mRNA            <800188..>801219
FT                   /locus_tag="CAWG_02710"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        800188..801219
FT                   /codon_start=1
FT                   /gene_family="HOG000246714" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q59SU6"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q59SU6"
FT                   /protein_id="EEQ44442.1"
FT                   /translation="MIYNLYNTVETSLDDFWKLVVARYNSLVYLLVSKVALTRKSFTRI
FT                   RMSTENVSISNNCCLRYFVSNMSSAPEQDTTIPPGTESPHTEHVVENEYQDDDYVSLDE
FT                   EDEELIWRVFFQKLEKHNKKSNNNDSESDESEESEDTSEEEEEETGDEDFDEDDLSDLS
FT                   DIDDPALVATYKALMSEKVNKNLGEEEQRRLLISNFTDDQMERFEAYRRMTVNKPGVKK
FT                   ICNGIVGHTIPQIIAVVMAGVSKSFLGEIISKAFEIQERNSKGRLLMDIETKKKQKREI
FT                   ISSLQRGEEIEVDERALKFEGDEIHPLQPEHIREAWRLYQLENSVFSGSRKRKMGDDGP
FT                   FYV"
FT   gene            complement(<802599..>802727)
FT                   /locus_tag="CAWG_02711"
FT   mRNA            complement(<802599..>802727)
FT                   /locus_tag="CAWG_02711"
FT                   /product="predicted protein"
FT   CDS_pept        complement(802599..802727)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02711"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF4"
FT                   /protein_id="EEQ44443.1"
FT                   /translation="MSESDQLNSTNKRENTFLSQNQAKTIMADQAQGVNPLHGVGL"
FT   gene            <806521..>806670
FT                   /locus_tag="CAWG_02712"
FT   mRNA            <806521..>806670
FT                   /locus_tag="CAWG_02712"
FT                   /product="predicted protein"
FT   CDS_pept        806521..806670
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02712"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF5"
FT                   /protein_id="EEQ44444.1"
FT                   /translation="MKESFMYKSVDARECRFSIWYCCVNDMVFWLLRYCNYVCDIIDCF
FT                   WRRH"
FT   gene            complement(<806938..>808449)
FT                   /locus_tag="CAWG_02713"
FT   mRNA            complement(<806938..>808449)
FT                   /locus_tag="CAWG_02713"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(806938..808449)
FT                   /codon_start=1
FT                   /gene_family="HOG000093871" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02713"
FT                   /product="hypothetical protein"
FT                   /note="similar to MNNG and nitrosoguanidine resistance
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF6"
FT                   /protein_id="EEQ44445.1"
FT                   /translation="MSEPAANSQYDTHLSPQQQQQQKHKYLSSSDSEASPPTRNMVKKV
FT                   NKGFSLFSRKLQTERRKIALKYFLNYLIMGVGVLAIFSIYWGSFYGINGRIKNLKMLVV
FT                   IEDDSIINGLNPVFGDNLKEILQTPEAKTKGNWKIYNSTEFAQIASKSNRTAEQEIMHQ
FT                   IHHQKYWASLHVMPNASYNYFNAMSQGDANYDPVKNTVHSIYETGRDFNGMTQFVIPSI
FT                   NGVENIWLSRQPNMTFDIVRNVTIDSAAKSKLLAQPIRFEIVDPVPWNDPILIGPFHDL
FT                   QIYMTILTLLQFEFFSPIHKEVSKLGLKRGHYMIYRFTASILSFFILSLFCCLVTLAFQ
FT                   VDLTVTYGRAGFVVYWMIAFMTMWALGSVNEIVAMLLITFYPPLVQFWLLFWIICNITP
FT                   TFTPMAVIPKFFRYGYALPIHNSYEATKTVFFRTYKAQLRRNFGILAAWFAVLSVIFPI
FT                   IVYYFITTTNKTFEQQVCAVVHERNQLETEDYQEYDRNEKRTNNY"
FT   gene            complement(<809017..>810930)
FT                   /locus_tag="CAWG_02714"
FT   mRNA            complement(<809017..>810930)
FT                   /locus_tag="CAWG_02714"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(809017..810930)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02714"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQF7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF7"
FT                   /protein_id="EEQ44446.1"
FT                   /translation="MISIDNANTGRRSTLSSTISSFDADRSLYYSTTSSTGSTSSSPYP
FT                   RSYHPRDLLNSFIDSFKEFDYSTLPPVYNNITDQESQLQLNPANPNFDYSHFTQLERDA
FT                   LITASSPLSKRLKTRHLTWISLGASIGSGLLISSGSSLAHAGPLGLLIVWIFVGSVIFA
FT                   TMSSLAELATAFPVSGSFTTYVTLFVDKSISFAIAWNYALQWLVTFPLQLVAASLAIEY
FT                   WTIKIHPAIFVTIFYVCIVFINLFGVYGYAEIEMVVSIIKVIAVIGFNILAIIIVTGGV
FT                   PGQPYIDAKNWQGPQGGLFNTIEPFKQMCYIVSNVAFAYGGVELFGLTAVETASPKKSI
FT                   NRARKQIFYRLMVFYILSIVMIGFAVSYKTPELQDSGAFGTDINASPFVIAIKQAKIKA
FT                   LPSIMNGAVILTVLSVGNASVYASTRVLCAIGALQQGPKFLSFIDRSGRPMGCLIVQFA
FT                   FGLLAYLICIPGKNVPAQIFDWLLSLSGLSALFTYISINVCQLRFNCALKHRARIPKDE
FT                   LLYVSPLWCSWYGIFAIIAILALQFWAALFPPGAGKADVESFFKIYLGGPILFLCWLGH
FT                   KLYSYWYLTVPLTKFWLTVDEIDIDTGRRQIDLETIKQEIAEEKIVMESKPWWYRLYKT
FT                   FC"
FT   gene            complement(<812850..>815528)
FT                   /locus_tag="CAWG_02715"
FT   mRNA            complement(<812850..>815528)
FT                   /locus_tag="CAWG_02715"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(812850..815528)
FT                   /codon_start=1
FT                   /gene_family="HOG000206461" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQF8"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF8"
FT                   /protein_id="EEQ44447.1"
FT                   /translation="MTQEQFYTFENEASLPKLPVPSLVSTTQQLLASLKPLLPQNEYAT
FT                   VVDEATEFVGNDIINLIQKHLVAISENENYTNYLNFVNDDKTPSIYGEIRGDILPRNPY
FT                   LVLEEDPYSKTINPPNQAQRAANLVNSSLKFAITLRNETLKPDVTPKNGNALTMKCYMD
FT                   LFGTTREPEQDDRGFDIRIKKYQHINDSRHILIISNNQFYTLEVLTEFDENEYQQTNSK
FT                   HNIWFNDSELSKILQHIIDESSKVDAVNAIRNSVGSITTQTLKYWKFARLELEQSNTEN
FT                   LKLIDDALFVLILDSNTPVTDGEKTQVISHGTSVLSSDNVQIGTCTSRWYDKLQIVVTK
FT                   NSVAGIVWESMTMDSTAILRFISDIYTDSVLKMAKNINGSEYTLFDPNITFASIGKDGN
FT                   GVVKPEPKLLEFNKTKALQHVIHLSETRLADLLDQHEYMTHTIKLDSYLTTKFNLSVDS
FT                   IMQVCFQIAYYSLYGRIVNTLEPITTRKFRDARTELVAVQNQSLANLVKLYITNASPSE
FT                   KFEAFKKCCALHKTQYHDAMSGKGFERHLMTIVQVVKKPKVIARLNQVNTHLPPIPEDL
FT                   CQAGINLPLLLNPSIDKLSSPELLVSNCGNPALRLFGITPAIDQGFGIGYIIHRDKVLI
FT                   TVCSKHRQTARYLDTFHRVVHDIKIRLRASSNFLLSISDSERRKNELQRLRIEHELSNV
FT                   SLDIPTMKHPIPLTVGKSEISIDNIALETARTGRATRSEEKSLGNNATDDSNVGVGGDE
FT                   DEDEDDSKFELMGGYGYFDFGELELRSDEVSRNESYLNSQVQSNLSSAMSSRRHSFTNL
FT                   QKIASRSHDSHLPQQLQQQQQQQKYDIKEKQSLSERIRDKLSHSQDTLSSVQSVLEEDV
FT                   QKNEPTKKSSIGRSLDMSKLS"
FT   gene            complement(816152..816248)
FT                   /locus_tag="CAWG_08064"
FT   tRNA            complement(816152..816248)
FT                   /locus_tag="CAWG_08064"
FT                   /product="tRNA-Glu"
FT   gene            complement(<816631..>819868)
FT                   /locus_tag="CAWG_02716"
FT                   /note="predicted protein; frameshift"
FT   gene            complement(<821536..>824019)
FT                   /locus_tag="CAWG_02717"
FT   mRNA            complement(join(<821536..822993,822997..>824019))
FT                   /locus_tag="CAWG_02717"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(821536..822993,822997..824019))
FT                   /codon_start=1
FT                   /gene_family="HOG000248806" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQF9"
FT                   /protein_id="EEQ44448.1"
FT                   /translation="MSNLYQSLGPQGRALLSQNGPGIPSTLSGTPNTNSSPQELDFLIN
FT                   ELRNPKPDTTINKVLGYLYNYIPYIRHEHNLRLVIASFLNCPVCFGGSGTSISSSFEFE
FT                   KNYLIIEVFKLIIDKKLKISMPVISIKQFYTIILKELQNFQHYNPIMNSWKILPIITGI
FT                   LLSNELRDQLYTEVNFVEYKWFFANLDKEIYQLFNNALPYSLSQSLDNNINYLSLMSLA
FT                   LVFKNSERHHKDSSDTVVHTKNISNIFMIQKLTEMIFLDRKVSMLVYQKFFQLNPHNEN
FT                   IESVISNDIMNKPVVKHLNKLSFLLEHYFSALDFTQLEDQVVGQSLIIITNFNKHLNHE
FT                   TNYTLFNNFNNTPDARTGNNPLTQNFWFTMKNLLFSQIIIFQGILSRFLTANSRLLTNK
FT                   TFFWFSPKKYSGNRIDTTNNNNNIEYQYKDISLQIMTNLYYINFILLSIGQGGFDNYNF
FT                   VYYLTIELALTTGVRFEKLTLCLMNNYQEINMYPDVLNSNYIDTSKILFVLGVWENYFQ
FT                   QMNRLTQHRQQEIFNKEIYNIVINLVDAKKYANNDLLEASHSVLLFYFANNSKVNLDDV
FT                   MRYVELVLEQFPQRISATQLSIAIETIGKKILSNPISYNNYNSRGNTIFINSAEKFFIF
FT                   LLNKYSRIEPGVPIKPKSITSVLSSGSGEANVSFTSAQPVNEIEAHATLNTLEQEGKLA
FT                   NDVIDENKAKAPSKKIIKKYLPDLVGKTKTNSDNHPFEFFDTRLTPETAREATIVSLIN
FT                   LVPYFPLSVFIPWLNQVWDLIVRSDSKEQQFLFNMLWKVISESLDINRGDLAIRWWYEE
FT                   KQFTAKQQKFVGKF"
FT   gene            <825271..>825804
FT                   /locus_tag="CAWG_02718"
FT   mRNA            <825271..>825804
FT                   /locus_tag="CAWG_02718"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        825271..825804
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG0"
FT                   /protein_id="EEQ44449.1"
FT                   /translation="MLRGFNFQIKIKDNMNETKAQSQQNNGNIQSNDSQIVQPIQSISD
FT                   TQMYPLIQPASQIPIQLPSQNMASCFSSFSTQPSQPPSQIIEPQIYQLFSQPGHVMHQG
FT                   KIPETTNKVVSTNLTIDATTQTLPRKLQSVFLDDINELKKISNSSLRSVIRTSLHSKDF
FT                   LDLIDRLDKIITDI"
FT   gene            826108..826180
FT                   /locus_tag="CAWG_08065"
FT   tRNA            826108..826180
FT                   /locus_tag="CAWG_08065"
FT                   /product="tRNA-Ala"
FT   gene            complement(<826676..>827647)
FT                   /locus_tag="CAWG_02719"
FT   mRNA            complement(<826676..>827647)
FT                   /locus_tag="CAWG_02719"
FT                   /product="coproporphyrinogen III oxidase"
FT   CDS_pept        complement(826676..827647)
FT                   /codon_start=1
FT                   /gene_family="HOG000262768" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02719"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="GOA:Q59MR4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="UniProtKB/TrEMBL:Q59MR4"
FT                   /protein_id="EEQ44450.1"
FT                   /translation="MVTTEQIHDTSFPIRERMEALIRLKQQQITDAIAELDTVKFHTDT
FT                   WLRGDNGGGGQSMVLQNGTTFEKGGVNISIVHGKLPPQAVERMRADHSNLKGSSKDGSV
FT                   NFFACGLSLVIHPINPHAPTTHANYRYFETSDPETNEIQTWWFGGGADLTPSYLYEEDA
FT                   KWFHQQHKDALDKFDPELYPKYKKWCDEYFFIKHRGETRGIGGIFFDDFDSKPADEILK
FT                   IVESCFDAFIPAYAPIVAKRKDTPYTPEQKNWQQIRRGRYVEFNLVLDRGTQFGLQTPG
FT                   SRVESILMSLPATASWVYDHHPEPGSEEDKLLQVLKKPIEWV"
FT   gene            complement(<829143..>832349)
FT                   /locus_tag="CAWG_02720"
FT   mRNA            complement(<829143..>832349)
FT                   /locus_tag="CAWG_02720"
FT                   /product="suppressor of toxicity of sporidesmin"
FT   CDS_pept        complement(829143..832349)
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02720"
FT                   /product="suppressor of toxicity of sporidesmin"
FT                   /db_xref="GOA:C4YQG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG2"
FT                   /protein_id="EEQ44451.1"
FT                   /translation="MGQIDGYFVDCETLNTKEVFHQAHVAKQSNHIRPSSPYRVSFFMQ
FT                   IKYLVGRNFKRLKGDPSLAIFRVCGQIIMGLILSSVFYNLQSTTESFYYRGAALFYAVL
FT                   FNAFSSLLEVMTMYEARPVVEKHRKFALYCPSADALASIISELPVKLASSISFNLVFYF
FT                   MVNLRRDPGRFFFYWLMNIWATLVMSHFFRTIGAVTTSLAGAMTPSTILLLAMVIYTGF
FT                   VIPKPSMLGWAKWITYINPVSYIFESIMVNEFYDRQFECSQYIPSGPGYENVDSKNKVC
FT                   TAVGSVPGEPFVNGTNYLKYAYEYYNSHKWRNLGIAIAFAVVFLGVYIWLTEYNKGAMQ
FT                   KGEIVLFLKSGLKKHKRKNQKATGTALEDIETGKFSNDKLIYPSDIEEEEGGATDKRLN
FT                   LSGTDNRPEIFFWKDLTYQIRIKKEDRIILDHVDGWVVPGQITALMGATGAGKTTLLNC
FT                   LSGRLTVGVVTEGARLVNGHSLDSSFPRSIGYVQQQDLHLPTSTVREAFRFSAYLRQPN
FT                   YVSKQEKDEYVEYIIDLLDMKTYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFL
FT                   DEPTSGLDSQTAWSICKLMRKLADHGQAILCTIHQPSALIMAEFDRLLFLQKGGQTVYF
FT                   GELGQNCQTMINYFERNGADPCPKEANPAEWMLEVVGAAPGSHAKQDYFDVWRNSNEYQ
FT                   VVKDEISRMEIELSKLSPLPSSSNGRDEKESRLTYACPLWKQYLLVTWRTIVEDWRTPG
FT                   YIYSKLFLVVSSSLFNGFSFFKADKTIQGLQNQMFAIFMSFIPFNTLLQQMLPFYVKQR
FT                   DLFEVRESPARTFSWFAFIAAQITSEIPFQIVLGTIAYFCWYYPVGLYVNAEPTNQVVS
FT                   RGVLTWLLQVSFYVYVSTMGHLCNSFLELPDAAANLANLLFSLCLMFCGVLAGPSQLPR
FT                   FWIFMYRCNPFTYLIQAILSTGLANTRVVCSEHEYVVIEPPAGQTCQEYMSVFITMHGG
FT                   YLLQSNNGAAESGTCSYCTMDETNTFLKSVNALFSQRWRNYGIFNAFIVINVALAIFFY
FT                   WLARVPKGNRESRIKHRKEE"
FT   gene            complement(<832512..>832967)
FT                   /locus_tag="CAWG_02721"
FT   mRNA            complement(<832512..>832967)
FT                   /locus_tag="CAWG_02721"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(832512..832967)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG3"
FT                   /protein_id="EEQ44452.1"
FT                   /translation="MTVGDTLEFAARLRTPQNRGDNIDRETYAKRMADAYMATYGISHT
FT                   RNTKVGNDIVRGVSGGERKRVSIAEVSLSGAKIQCWDNSTRGLDSATALEFIRALRTSA
FT                   KILDCTPVVAIYQCSQDAYDLFDNVSVLYEGYQIFFGKASKAKEYSE"
FT   gap             833152..833251
FT                   /estimated_length=unknown
FT   gene            complement(<833272..>833574)
FT                   /locus_tag="CAWG_02722"
FT   mRNA            complement(<833272..>833574)
FT                   /locus_tag="CAWG_02722"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(833272..833574)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02722"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG4"
FT                   /protein_id="EEQ44453.1"
FT                   /translation="MVNIQPQNATESAVNQSCEPITTPASSEYEGFDHNEVRQLAKILT
FT                   NDNDDSAKSSLVRQLSNMNNVPGVNPCDAVSLPPQKDPICGSFGSLSPYGICETL"
FT   gene            <835324..>835855
FT                   /locus_tag="CAWG_02723"
FT   mRNA            join(<835324..835384,835503..>835855)
FT                   /locus_tag="CAWG_02723"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(835324..835384,835503..835855)
FT                   /codon_start=1
FT                   /gene_family="HOG000191310" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02723"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQG5"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG5"
FT                   /protein_id="EEQ44454.1"
FT                   /translation="MSFFRDLLESVVPTAYAEEVFEDVEVEQPEDAPEEEVSEETVEEE
FT                   EDDDEEDDEDDEDEEEEETADPLDTLREECTKTAACKPFDHHFHECIERVTKEQEEPDY
FT                   EHKHYKEDCIEEFFHLQHCVNDCVAPRLFNRLK"
FT   gene            <837224..>838072
FT                   /locus_tag="CAWG_02724"
FT   mRNA            <837224..>838072
FT                   /locus_tag="CAWG_02724"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        837224..838072
FT                   /codon_start=1
FT                   /gene_family="HOG000093896" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02724"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQG6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG6"
FT                   /protein_id="EEQ44455.1"
FT                   /translation="MSTSEETKVTKPVIEDRIYVGNVDFKATEDELKELFQDLKVTEVE
FT                   IPFKENTRGDKVFKRHLGFAFVQFENKDDADKAIATYNGQKFQRRNIFIKKAVPPPTEE
FT                   EKKERVEAFKAKREEIKKAKEQKKAEAKKKREEATADAATTANGESATTDSTPAIPDGT
FT                   PSKDTIFITNLDYKVNVKTLNSLFKELKPKWIHVPSRRVPYNRRGRGGKFRKPFNKGIA
FT                   FVKFSNEETQKQAVAEFNGKEVNGREIIVDIAIDSRIPKEGSTEEDVDDEENAEANSNG
FT                   N"
FT   gene            <839011..>839520
FT                   /locus_tag="CAWG_02725"
FT   mRNA            join(<839011..839289,839293..>839520)
FT                   /locus_tag="CAWG_02725"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(<839011..839289,839293..839520)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02725"
FT                   /product="hypothetical protein"
FT                   /note="similar to ATP-binding cassette protein"
FT                   /db_xref="GOA:C4YQG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG7"
FT                   /protein_id="EEQ44456.1"
FT                   /translation="VLFSGSIRTNMDIQNQYSDTEILDSLKKVHLITGKENQSKFSNLD
FT                   TVITEGGGNLSHGERQLVCLARSFLRNTKIILLDETTSSIDYNTDYILQSLREHFNNSN
FT                   ILTIAHRLRTIIDYDKILVLDAGKVVEYDNPYVLITNTDSLFYRMCENSSELESLIKLA
FT                   KEAYV"
FT   gene            complement(<839576..>842134)
FT                   /locus_tag="CAWG_02726"
FT   mRNA            complement(<839576..>842134)
FT                   /locus_tag="CAWG_02726"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(839576..842134)
FT                   /codon_start=1
FT                   /gene_family="HOG000246744" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQG8"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQG8"
FT                   /protein_id="EEQ44457.1"
FT                   /translation="MSDSQIYSATYSNVPVFEFVTSEGPIMRRKKDSWINATHILKIAK
FT                   FPKAKRTRILEKDVQTGIHEKVQGGYGKYQGTYVPLDLGAAIARNFGVYDVLKPIFEFQ
FT                   YIEGQTEVPPPAPKHNHASALNVAKRQASLLKKQKEKQVQPTLSDTSFGSSTSVPPTTV
FT                   PKKRGRPKRATLSATPSLQRSDTTPINKSLIDFNANDHSAKSSFIGVVPSFARNDTEQD
FT                   ALQIMTNNMNLRQEDLASVETDDDEEYHNGSRGDGLQNGSFTTKRRKYPGGMTNGNGLE
FT                   SQADLLTSKELFGVSRTSFEKRANQQHNHYSPLQPYHQPSISLSQENQIYSDYFQSLLS
FT                   YFLDDNNKIRSPIPDSLLSPPLPLSKIHIYQTIDSDGNTIFHWACSMGNLNMVEFLLKT
FT                   FTHSLNPDVRNNNGETPLMFMVKFNNSFQLRNFPLILDLLKESVLLVDSNGKTVLHHIV
FT                   DTDSKHKREKFAQYYLESLLEKIVDERQEQGDSNGHAMEDDLTKDELVTKFINHQDSDG
FT                   NTAFHIAAHNLNKKCIKVFINYHRFINFGLRNLVSCTVEDYLASHNYVLRLDPVEHDQS
FT                   NNSDGDEDIMEDYTNENQSFETQLHNSKMAINLQNTTANLLTEKMTQLAYAIDSELSEK
FT                   DEVILTYFKVLSQINQIKLESQRKILSFFKLDHLIEELEQNKDDSQQQQQQVTDDDDPT
FT                   SVHGNYLHLDFKRDHILQEEIYRLMNDLTYQELHQQDELDKVEHSYRMTKERLHEKVLD
FT                   ASSFVIDQTHQQGNVHEQLELAKQLQVEIIKRKKLVDEISKLTKNVPLPENPNSKTIID
FT                   TYPSTDKLYKYCKLISLSCGIPMDEIETSIDAMEESLVKK"
FT   gene            complement(<842812..>843774)
FT                   /locus_tag="CAWG_02727"
FT   mRNA            complement(<842812..>843774)
FT                   /locus_tag="CAWG_02727"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(842812..843774)
FT                   /codon_start=1
FT                   /gene_family="HOG000246741" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02727"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANP4"
FT                   /protein_id="EEQ44458.1"
FT                   /translation="MPYTIGDRRITLDSNLLESDKQLLITHPEIFKYCLNNAVFRSIIN
FT                   LKNLVHLYSDIITIYATFLRKIPHYDDVTLMANKSKLNLLKLEHDFNDIFGQYTTMHEY
FT                   KKFNSNWEDKTYEGDIVPSALLIIDVATQAFETVYKSLSCIELFFNHYDNLKKLLIPSL
FT                   VVRTKSILDSFAKIEQFLKLTFPVDKMARGEIVTFDESTFENVRRVEKVTSGIERESIF
FT                   LETFFLAFDASLTSYTSILLGKGILKRDVPPRDCEIISRRRICYQAAEHVVTIPLSEDS
FT                   PNKSKSAMEYLGKYIAYIGVSLLILISVVFYRLFKVLFG"
FT   gene            <844307..>845341
FT                   /locus_tag="CAWG_02728"
FT   mRNA            <844307..>845341
FT                   /locus_tag="CAWG_02728"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        844307..845341
FT                   /codon_start=1
FT                   /gene_family="HOG000246740" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02728"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANP3"
FT                   /protein_id="EEQ44459.1"
FT                   /translation="MGVFSIFGSKESFDPNVFEKELTSITEKINTNKQQISKLQQRQKY
FT                   VRRSLSRYFIIIYLCIFGYCYATIPSSTIGKNRVQWFIRGQTRQHLLVLIGYPLFSVLT
FT                   LRAVSYIFQFFINNKQSYLKSLQNKHKEKIEELKKITNFNKTNELINKYGNEKQPQVSL
FT                   QKQEPQPISNQKQQDHLRNRHNKSGNLRDQAMKELNLPEDKQLSSQQKGQLPNTKQAPI
FT                   PAIPQQPAQRTIQDRLLDILIGSDNSESVENRYALICFHCFAHNGLAPPHTEDPADVKF
FT                   QCWKCGAMNGKGMLFEQPDMKFDSSKNSSSELINLEVKEKESGNLDHPGTENEEKEEST
FT                   KKLQ"
FT   gene            complement(<845404..>845940)
FT                   /locus_tag="CAWG_02729"
FT   mRNA            complement(<845404..>845940)
FT                   /locus_tag="CAWG_02729"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(845404..845940)
FT                   /codon_start=1
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02729"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH1"
FT                   /protein_id="EEQ44460.1"
FT                   /translation="MSIEEIPQGADVNVIPKNEKKARELIKKLNLKQIKGISRVTFKQR
FT                   GNLIYAIDSPDVYRSAAGTYVVFGEAKVDDMNQRIAEAQAQQAQQEALQKAAADAGKTE
FT                   DKSPEAITADLEKASLGDKKAEDEEEDEGEIDETGLDPKDIEIVVEQTQVSRAKAVKAL
FT                   RNHDGDMVNAIMDLS"
FT   gene            <847415..>848995
FT                   /locus_tag="CAWG_02730"
FT   mRNA            <847415..>848995
FT                   /locus_tag="CAWG_02730"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        847415..848995
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH2"
FT                   /protein_id="EEQ44461.1"
FT                   /translation="MKSEKDSEIQGINIEPIVSFTKEDLQLDKSHVLTTVISPSGKEVA
FT                   ITNDVDQVMQFVLDHQNTKVVLDEATDKKLLRKIDMYMLPVMCLLYCFQFMDKSSTSYA
FT                   SILGLREDLNMVGDMYSWTATAFYLGYLAFEFPASMLLQRFPVAKTVSVFIIVWGIILC
FT                   LHSVPQYPGFIALRTILGMLESSVTPAFTIITSQWYKKEEQFLRTSWWFAFNGIGTILG
FT                   SAIAYGLYQNDGNYSLPTWKLVFIVTGCLTIFLGFVVLIHIPDTPTQAWFLTDEEKLLV
FT                   VERIRTNQQGFGNTHFKKNQFIEALTDYRSWLLVIYALSSNIPNGGLTNFSGILLYEDF
FT                   QYSEAKSLLMQMPQGAVEIVGCVLLAWCSRFISSRLLMTVFTTSLTIMSECLLAFYPEK
FT                   SGRLVGLYLPMLDPLGFICCLSCVSSNFAGHTKKITTNAMYLIAYCTGNLIGPQTFVSS
FT                   QAPQYIGAKVGMIAGSSVALLSLICLYFSYVWENKKRDSRTMVDMSHIENYEFADLTDK
FT                   QNPNFRYSK"
FT   gene            <849940..>850344
FT                   /locus_tag="CAWG_02731"
FT   mRNA            <849940..>850344
FT                   /locus_tag="CAWG_02731"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        849940..850344
FT                   /codon_start=1
FT                   /gene_family="HOG000093897" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02731"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH3"
FT                   /protein_id="EEQ44462.1"
FT                   /translation="MITTSLKRSRSLLNKVLPIDIEGDKHSSPSVVTRSSPILNHDSES
FT                   LHSNKSPISKNSNKKTSKSPSRQGSNNKNTKKTNGHKKRRNSSHQKERTEKSELSQSKR
FT                   GSDILDQRSKLDWILIVAIGSLILLIYILN"
FT   gene            <850926..>851741
FT                   /locus_tag="CAWG_02732"
FT   mRNA            <850926..>851741
FT                   /locus_tag="CAWG_02732"
FT                   /product="hypothetical protein"
FT   CDS_pept        850926..851741
FT                   /codon_start=1
FT                   /gene_family="HOG000001022" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02732"
FT                   /product="hypothetical protein"
FT                   /note="similar to cell wall synthesis protein"
FT                   /db_xref="GOA:C4YQH4"
FT                   /db_xref="InterPro:IPR008659"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH4"
FT                   /protein_id="EEQ44463.1"
FT                   /translation="MRQFQIILISLVVSIIRCVVADVDITSPKSGETFSGSSGSASIKI
FT                   TWDDSDDSDSPKSLDNAKGYTISLCTGPTSDGDIQCLDPLVKNEAIAGKSKTVSIPQNS
FT                   VPNGYYYFQIYVTFTNGGTTIHYSPRFKLTGMSGPTATLDVTETGSVPADQASGFDTAT
FT                   TADSKSFTVPYTLQTGKTRYAPMQMQPGTKVTATTWSMKFPTSAVTYYSTKAGTPNVAS
FT                   TITPGWSYTAESAVNYASVAPYPTYWYPASERVSKATISAATKRRRWLD"
FT   gene            <853013..>854269
FT                   /locus_tag="CAWG_02733"
FT   mRNA            <853013..>854269
FT                   /locus_tag="CAWG_02733"
FT                   /product="hypothetical protein"
FT   CDS_pept        853013..854269
FT                   /codon_start=1
FT                   /gene_family="HOG000204320" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02733"
FT                   /product="hypothetical protein"
FT                   /note="similar to arginase family protein"
FT                   /db_xref="GOA:C4YQH5"
FT                   /db_xref="InterPro:IPR005924"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH5"
FT                   /protein_id="EEQ44464.1"
FT                   /translation="MKLYIFALVACVSSQTIFRSPSLLDQLYGELHGRTNTAPNLQVQA
FT                   EDPNQMVTQKVLAMRSKLTLPDKDDTSDIAIDQNMFGGILTYAHFNHFNCFISDDFDKH
FT                   STTDQQTTKNIDIAIVGAPFDTGTSYRPGARFGPESIRSNSRRLGSAWKSTKKRFNYPV
FT                   DPYDETTHNYSIIDCGDVAMTPFDNRIALNQLYRGHRSISKHPGNVNQHPKIITLGGDH
FT                   TITLMAIKNAHEQLRTKIRVFHFDSHIDTWDPRKLGGGITDYMSLNHGTFLHYATELGY
FT                   IETKGNYHVGIRAPYIDANYDKQHDANCGFHIIQANDIDMIGVQGIIDELAKDPNIPTY
FT                   ISVDIDVLDPAYAPGTGTMEAGGFTTRELLSILDGLKNKVNVIGGDVVEVSPPYDTNSE
FT                   ITSLAATSVVDSLLKLMIV"
FT   gene            <855151..>855669
FT                   /locus_tag="CAWG_02734"
FT   mRNA            <855151..>855669
FT                   /locus_tag="CAWG_02734"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        855151..855669
FT                   /codon_start=1
FT                   /gene_family="HOG000093898" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02734"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH6"
FT                   /protein_id="EEQ44465.1"
FT                   /translation="MTCQTGRKCSLGIEEPIDISSKNVPLNAFLIYTMSSTLPDHNSTN
FT                   SWNEYHNNLSITNNTQVTTSCADNVKTTSNVPRCATDINSKMTTSELETLHRCRFSVCD
FT                   FNNLENYLYQSEREECSRVIEQLETHNGKSISTCCNSNTDINAQCNQMKNHKRRKSIAL
FT                   KFKKPQTLL"
FT   gene            complement(<855939..>857576)
FT                   /locus_tag="CAWG_02735"
FT   mRNA            complement(<855939..>857576)
FT                   /locus_tag="CAWG_02735"
FT                   /product="uridine kinase"
FT   CDS_pept        complement(855939..857576)
FT                   /codon_start=1
FT                   /gene_family="HOG000262757" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02735"
FT                   /product="uridine kinase"
FT                   /db_xref="GOA:C4YQH7"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH7"
FT                   /protein_id="EEQ44466.1"
FT                   /translation="MPLHPKSRRRSSRISPLPDEDSLSFINSSVENLDQSPFESIDDLV
FT                   EDVNKYDLKSPSDEQRQQSQQESQTQNLKHKPSFTSTPKASYIPPWTEPYIIGIAGNSG
FT                   SGKTSISQKIIQDINQPWTVLLSFDNFYQPLTSEQSKLAFANNYDFDCPDSLDFDLLVE
FT                   TIGNLKKGGKTTIPVYSFTSHNRTSKTNTIYGANVIIVEGLYALHDQRLLDMMDLKIYV
FT                   DTDLDICLARRLTRDILYRGRDLGGAMQQWEKFVKPNAVKFINPTVQNADLVIPRGLDN
FT                   SIAINLMIKHIKNQLALKSRNHLQRLKKLGVNIKFDIEKFNIKLLQNTNQVKGINSILF
FT                   DTSTSRNDFIFYFNRMCGLLIELAQEFMTNYTNVDIDTGKGIYHGKKLLQNQYNAVNII
FT                   RSGDCFMASIKKSFPEISIGKLLIQSDSTTGEPQLHFERLPHKLSDKIMLFDSQIISGA
FT                   GAIMAIQVLLDHHVKEQDIILITYLSTEIGIRRIVNVFPKVKIVVGKLSSMEDSNSNNK
FT                   VWYNNEGFLDSHWHFRNRFIDSLYFGTE"
FT   gene            <857867..>860452
FT                   /locus_tag="CAWG_02736"
FT   mRNA            <857867..>860452
FT                   /locus_tag="CAWG_02736"
FT                   /product="hypothetical protein"
FT   CDS_pept        857867..860452
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02736"
FT                   /product="hypothetical protein"
FT                   /note="similar to Cdc28p"
FT                   /db_xref="GOA:C4YQH8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQH8"
FT                   /protein_id="EEQ44467.1"
FT                   /translation="MDTQTGRGVRRRRQELIDVDDNEEEEKEQITQQEPLGAISTIETT
FT                   KPTPESNTPPLPPPPAPAQHYKRPKSKYYQFKQELEELEIQEDLSPRQQSRLEYLTNKL
FT                   NNWNRNNNNNNNASQNEYYNLPSLQQSKNDVLHQKQQSFQPPRMNWEDEQFKRADQLIL
FT                   QNDDKIHINDDKEYEFVFDQTQFVNYDDIEELPGDGKEEEESGIRDSDSTIGNKYDEVR
FT                   KSLPVYSYREEFLKIINENQTLIVVGETGSGKTTQLPQYLHEAGYSRNNRVIACTQPRR
FT                   VAATSVANRVANEMQVKLGEQVGYNIRFDDNCKDGVTVIKYVTDGMLLREFLQDPTLGK
FT                   YSAIMIDEAHERTLSTEILLSLLKDVMMTTRKDDLKIIIASATINAEKFSQFFNNAPIL
FT                   NIPGRRFPVKIHYTKQPEANYIQAAITTIFQIHMTQPLPGDILVFLTGQDEIDTMEEIL
FT                   RDSILKLGDQIDPMIVCSIYANLPQELQQKIFQPTPSNTRKIVLATNIAETSITIDGIS
FT                   YVIDPGYVKQNVYNPTTGMESLVVVPCSRASADQRAGRAGRVGPGKCFRLFTKWSFYNE
FT                   LDSNQQPEIQRVNLTSVILLLLSLGINDLLGFEFMDPPSKEAIIKALNLLYALGALNTQ
FT                   GKLTKTGKKMSEFPLDPVFTKCILTSDKFDNTKQIISIIAMLNESSNLFYRPKDKKELA
FT                   DKRKQEFNDSQGDQFMLLKIWQQWVDSGYSVQWCQDYFIQYKTMKRIKNIYEQLIRLSK
FT                   KIGIEVNSRHQHRDHLQENTDNNTLLTKCLISGFFNNIVKLSPMGDCYQKLTNGKGGNN
FT                   TPCYIHPSSCIYKLKPKPKYLLYYELVLTSKEYMRNCIILDEKLIKEYL"
FT   gene            complement(<861665..>861988)
FT                   /locus_tag="CAWG_02737"
FT   mRNA            complement(<861665..>861988)
FT                   /locus_tag="CAWG_02737"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(861665..861988)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02737"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AP37"
FT                   /protein_id="EEQ44468.1"
FT                   /translation="MESTNNSNRSNIFSFLQDIRIRLGVYVNIDLDHDVAWRYICYNYW
FT                   SIDDINADFLSFLFRLIVVCNRYDHQKNTSNSAQFQFQLQFLLPSFFLRLLYLGCCCSN
FT                   FDK"
FT   gene            <863356..>864432
FT                   /locus_tag="CAWG_02738"
FT   mRNA            <863356..>864432
FT                   /locus_tag="CAWG_02738"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        863356..864432
FT                   /codon_start=1
FT                   /gene_family="HOG000093899" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02738"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI0"
FT                   /protein_id="EEQ44469.1"
FT                   /translation="MVKLPFFTIVVSIFYTSSLLVSAADYTAPASNLGCYSSISGGDSK
FT                   GDYTYQTSGYCVNNECPNSPYVAVKGKECICLNSLPQSSSKVSSSQCDQPCPGYQSDMC
FT                   GGSNAYNVYKGLASASSSSSSNSGSASSSSPSSSGSPSSSQSSSITGSPNNSDDSDQST
FT                   ATVVSTISNSNGNVIYKTITQEASATTSSGSSSHASTTSSSSSTSTSSSHSSDSPDGKS
FT                   EKKSSSVGAIVGGVVGGIGGLILLVAGGFFYMRYRNNDEDEDEEEEFYDNKPLKRSNGS
FT                   KIGSRRSPNALEMPMANPFQHPADDLVRNNSVQKNGFVDPRLNPIMMGRRRLSEGSLVD
FT                   EADYSRKVLQVANPDDTK"
FT   gene            <865546..>867109
FT                   /locus_tag="CAWG_02739"
FT   mRNA            join(<865546..865563,865856..>867109)
FT                   /locus_tag="CAWG_02739"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(865546..865563,865856..867109)
FT                   /codon_start=1
FT                   /gene_family="HOG000093900" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI1"
FT                   /protein_id="EEQ44470.1"
FT                   /translation="MRSYERLSSSSSEETNKKSFNSDKDNILEPFVSEEGTSLVDQQHH
FT                   HQQGNTDTTTTMETTPHSTSRIPSLNEDTRLSSSSESMPIQSSSSATAPSSNRSEQRDL
FT                   EDLESQTPPRLTTKQRIQRVLHHFFPVRQTYERINNGLTTGRMQTNNGRFIGQGTDGVF
FT                   RNLMAKPDTEEMRQQQELNPPSYEEAAADASPEYWESTMISPMYEDEVFVQGLPVGNIA
FT                   NFVWNALVSVAFQFVGFILCYLLHTSHAAKQGSRAGLGINLIMYGWNLVPQNFGHPDKL
FT                   PKKYQPENPNDFDINKSTKISGKVDGYNSGIFIQNSNADTKDSNGGDWLGGSGSAPYVA
FT                   YGLIAFGLFIILKSLVDYYRVKQLERAILNPPSNMPVNTNSITGVVDEIDEENRHREHQ
FT                   QQQQHQHQEEEELYSHQHRNHDDH"
FT   gene            complement(<867330..>868285)
FT                   /locus_tag="CAWG_02740"
FT   mRNA            complement(join(<867330..868199,868271..>868285))
FT                   /locus_tag="CAWG_02740"
FT                   /product="tricarboxylate transport protein"
FT   CDS_pept        complement(join(867330..868199,868271..868285))
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02740"
FT                   /product="tricarboxylate transport protein"
FT                   /db_xref="GOA:C4YQI2"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI2"
FT                   /protein_id="EEQ44471.1"
FT                   /translation="MSKDKKQVDPLKSFIAGGTAGAVEGIITYPFEFAKTRLQLISKSS
FT                   TASRNPLVLIYNVAKTQGVSSLYVGCPAFVVGNTLKASVRFLGFDSIKNLLSDKNGKLS
FT                   GPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSIKPKYQNGVISGSFKLVRDMGFK
FT                   GIYAGVVPVSLRQAANQAVRLGSYNAMKTMIQQASGQKPNEPLSGTTTFAVGALAGIIT
FT                   VYTTMPIDTVKTRMQALGADKLYSSTLNCFVKIFKDEGLLTFWKGATPRLGRLVLSGGI
FT                   VFLCYEKIMILLN"
FT   gene            complement(<871203..>873458)
FT                   /locus_tag="CAWG_02741"
FT   mRNA            complement(<871203..>873458)
FT                   /locus_tag="CAWG_02741"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(871203..873458)
FT                   /codon_start=1
FT                   /gene_family="HOG000093902" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQI3"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI3"
FT                   /protein_id="EEQ44472.1"
FT                   /translation="MSFNQQSPNFSSSSGMNANTPQQQQQQRGGNLPALTPQMLQSLTP
FT                   QQFQLFRSNPQFQEVMNQYMQKQQLLQQQQQQQQQQQQQQQPIQGTTGGMIGGIAQQPP
FT                   QSMQLSREQFLKQQQQQMMLNQQQQQQQQQQQQQQGSPHLMNGIPNQPQANPQFRQQVV
FT                   ANQMPPNMVNVPGSQTIINQPIHGANIPINKVPSRRMSSIPGIPGGQNPPVGVPGGAGP
FT                   PLAGVPGATPLVPGQGPARSVGGVLATGVPNPGGVPSTGTLNGAHGNAGLNTNLPPGVT
FT                   PEILNKVPMKPMQNVKEWSEKLKQEGKDVPLDLKVYEDLIRKDTEFVGKLNKQLHDNKF
FT                   IMENINRDIKSYNQIKQLRMNSISLSNKGQYNNSIWGEGYQGYGNGITNSSTKLFIPNR
FT                   DLTDRIINERVMKNKNKPKHYVPIRLEFDQERDQFKLRDTFLWDLNEEIIKVEDFTAQL
FT                   LEDYKFISKVHYETILSSIKEQIADYSQKPSKTMGELRIPIKIDITINNTQLTDQFEWD
FT                   ILNSQEGDAEEFSSYMCDELCLPGEFCTAIAHSIREQSQMYYKALNMVGYGFDGSPVHE
FT                   DEIRNHLLPPLRLVSSDSGIVDDFFSILRNPSSLPDFSPTLGKLSQLEVERLDKEMERE
FT                   SRRKRRHNYNEDQQQGSGRGFTSRRIAAHAGRGNTIPDLSDIPKTFRTPAPSSILPGAV
FT                   DMGVPEVYEYNEVLINRTQVRNPDYRPPTPIRVENELVDYNHDPIEGTFMVTIKLPV"
FT   gene            complement(<873750..>878162)
FT                   /locus_tag="CAWG_02742"
FT   mRNA            complement(<873750..>878162)
FT                   /locus_tag="CAWG_02742"
FT                   /product="DNA polymerase alpha catalytic subunit"
FT   CDS_pept        complement(873750..878162)
FT                   /codon_start=1
FT                   /gene_family="HOG000163524" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02742"
FT                   /product="DNA polymerase alpha catalytic subunit"
FT                   /db_xref="GOA:C4YQI4"
FT                   /db_xref="InterPro:IPR004578"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015088"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR017966"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI4"
FT                   /protein_id="EEQ44473.1"
FT                   /translation="MSSRSARRKTLQQLKEARKTGRNVNVVESDTDDYNEIYDEVDEDT
FT                   YRQHKRNQLMNDDFIVDDNGEGYVDNGADDWDDASRPNYYSDEENESMGSRKRRKKEDK
FT                   TTKVAKTSQIRNFFKPMSGVSDSKKKLETNIDDILNDFGDDLDKKKNIPKAFSNSINKE
FT                   VNNHNINKKKLKNTFSFSTSTRKTDKTTPKLDAFNASSDYTMDIDNFEDQPSSPFKLKS
FT                   EVTPEAETEKENIDPEPTKNVFENPSESLKNQEKVNDNDDEDDSDDDIVYSRKPRAAVV
FT                   KKNQVDTVSAVKANQLPSSPISKPVYTKFSNHTEKVSKDNIKDTSDSFKMFWFDYAEAE
FT                   NSLLLFGKIMTKEGKLVSGVVKVDGICRELFFLPREYRIVDDEEDKSKKLTAIDVLEEI
FT                   QPLLLANYNLEELRAKPEVKKYAFELADIPKEAEYLKVLLPFNNETNRNIMPANIEGST
FT                   FRHVFGTNANMFESFVMQRNIMGPCWLEIRGGDFDAMQNASHCQVEVVVDRPSQISTID
FT                   KDAPSSPNLTVTAISMQTMLNAKTNKQEVVSVSLATYFDLPQDAPISEDIKPDDVFTLA
FT                   RPVGSVSFPPRLQQLAEKGGFQLRTCPSEKVLLNALAAKIKSLDPDVFIGHRLENISLD
FT                   VLVHRMNDNNVVTWSALGRRNRRQWPYMINKSNSSYNNSLLIRDVFQGRLLCDIANEMG
FT                   QSLTMKCQSWDLHEMYDVVCHKKHSPVEINYQNLKYAEDAHLFLMALKENELNVKQTAE
FT                   IAFATQILSLSKQLTNIAGNAWSHTLSGTRAGRNEYILLHEFKRNNYIVPDKEDKTHKN
FT                   TSYQQEARVENAEEDATTATSNKKPKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQE
FT                   FNICFTTVNRDRFNVTHDENKDMPILPERDTESGVLPRLLNTLVSRRREVKKLLKDPKN
FT                   TPFQKAQYDIKQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMDTRQLAES
FT                   SSLRVVYGDTDSVMIDTGASSYQEAIKIGEQFKVQVNERYRLLEIDIDNVFKRLLLHAK
FT                   KKYAAMNASINKATNEETATLEVKGLDMRRREYCQLSKDISTFVLTKILSDSDPETALL
FT                   EVYDYLDDMKGKIQNNEIPIDKYKINTKLSKDPKSYPNGKSMPQVQVALRLREEGKVIK
FT                   AGSVITYVITAAKDDGDNSTVAERARAIQELLSKKDPDLKPDANYYLEKQIFAPVERLL
FT                   ERIEGIDMVRVATSLGIDTKRYILRVKNSDANGEILPIESNISDKERFRATSYLVLHCK
FT                   CGSSFRFGGIMAAETYKVTFNGVCCTKCNYTFPAIKLTSQLESMIRKHIALYYAGWLVC
FT                   DDPACGITTRQISVYGKRCIGNSGRAMDCKGVMRYRYNDKQLYNQLLYFQSIFDVDKTK
FT                   RGELRPLVDALEESKDKQLPKLPSGQVEALAEQNRELFGICQEVVQKYLGECGRRYVNM
FT                   GSIFDFIRN"
FT   gene            complement(<878605..>879495)
FT                   /locus_tag="CAWG_02743"
FT   mRNA            complement(<878605..>879495)
FT                   /locus_tag="CAWG_02743"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(878605..879495)
FT                   /codon_start=1
FT                   /gene_family="HOG000246770" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02743"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI5"
FT                   /protein_id="EEQ44474.1"
FT                   /translation="MKLLTILTIVELILVGGVDATPAAPPQPGLKIDESNRKQLDELVH
FT                   QLEILNAQNSKLENDFTEDYNLISRDLDYEDLSARSDLPILDTVFRLVNSSGVAILATD
FT                   FLLTREPLLDTAIDTLIRAIDEQWVNITTIFIALDQSGLLLDTLMHSIKDPDVLPGLLR
FT                   ITKEVINQSGFRIFNVRETKDLADQSPEDSTSIDVFKRENSLLVLLFTSLKDSGLVVSL
FT                   TNHILTTPELAPGAAHFVWRTLKLRSSTLYKIFNALKRSNLIWNLLREIINVPAILSNF
FT                   STIITQTISSKLNLQ"
FT   gene            <880011..>880871
FT                   /locus_tag="CAWG_02744"
FT   mRNA            <880011..>880871
FT                   /locus_tag="CAWG_02744"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        880011..880871
FT                   /codon_start=1
FT                   /gene_family="HOG000246769" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02744"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQI6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI6"
FT                   /protein_id="EEQ44475.1"
FT                   /translation="MSFANIDLEAQKEPLLKGKDNDANYTSPDELDTIIGKTSRQLSVF
FT                   GNLISQFETQRKQIGTRRDTQELRNTIDVLTGKIQEMDRAISALIANLSTLINSKNSTT
FT                   TSASISNKHIVIEERLSRQYSELSKAFNKSTKVYQEKKRTTPLLTRPSKETEEQTKSED
FT                   TLATSQQEQEQVQTQVDQDLIDQTELQYHILLTEERNREIEQVTEGIMEVNSIFKDLSQ
FT                   LVHQQGEQVNTIEDNILQLHGNTQQASNELNKANEYQKQKGKWSCILLVALCIFLLVIV
FT                   LIVVS"
FT   gene            complement(<881021..>881476)
FT                   /locus_tag="CAWG_02745"
FT   mRNA            complement(<881021..>881476)
FT                   /locus_tag="CAWG_02745"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(881021..881476)
FT                   /codon_start=1
FT                   /gene_family="HOG000093903" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02745"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANM5"
FT                   /protein_id="EEQ44476.1"
FT                   /translation="MTPFSMYPASSKKNRFEEGTNSSKSVPLSVKVALGLGTLVGATIA
FT                   VINNKEAIYETAEAFFTRGAEYCREKIEEAKIANETNFADHYQDEEFKDVSTGKSTGSN
FT                   LRDESDYEDVSTPETSDFSEIDTDFQDDDDLSDEKEQADDFDTASLD"
FT   gene            <882278..>883318
FT                   /locus_tag="CAWG_02746"
FT   mRNA            <882278..>883318
FT                   /locus_tag="CAWG_02746"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        882278..883318
FT                   /codon_start=1
FT                   /gene_family="HOG000246767" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02746"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQI8"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI8"
FT                   /protein_id="EEQ44477.1"
FT                   /translation="MTLDNSIVYSRPLSVSENFFRCRTASGNYRNFVVTATYNQSLKKK
FT                   LYVLVKALRKTILEYPILATTVKFDKTVNAFAYVPLKTINLSDILFFEGDEKWLTNGVI
FT                   NENYMKYCNETQFKLYEENVLFKLILVGDFHLSAIFEHTIGDGLVANYFHEVLLKNLAE
FT                   CESIEDAAFETQFGPLVFENIKAEDEIFNFSKDKLYIKNSLPPPIDPFLEDIDLDYSFG
FT                   DPHFQDKIIPEGFPNKWKGRFDTVDTHDISFKLINFSKQETKIILSKCKEHKVGITSYI
FT                   EVVHALTLQPIFGDNSFTTHRTAMTLRRHYTPDLAEPPYKKILSDSEYKIFGTSAHMGF
FT                   VRIFHQ"
FT   gene            complement(<883959..>884852)
FT                   /locus_tag="CAWG_02747"
FT   mRNA            complement(<883959..>884852)
FT                   /locus_tag="CAWG_02747"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(883959..884852)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02747"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQI9"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQI9"
FT                   /protein_id="EEQ44478.1"
FT                   /translation="MSQQKYALITGASSGIGYALAKEFSLRGYKVIGCSPKSVLHLQKP
FT                   LEDEYGLISIACDITNLEDIKRVKELVVKETGGYLDVLYNNAGIAIGQPAIEIPEDKLN
FT                   WIFQVNVIGHINMTKHFAPLVIKSKGSIIFTSSVAARVPLSWISAYSATKAAIDAYAKT
FT                   LHGEMEPFGVKVHSVITGGVQTQIGAEDNNIEEMKNQFADSPYNVDGIVESGIASQKMA
FT                   ADLGIPPQKYAKNMVGQITKKSSKFNLYGGSNSYLLHILGLFYPFWLVEYIMQFTFKQL
FT                   KPFALIRKKYAGKKNR"
FT   gene            <885615..>887921
FT                   /locus_tag="CAWG_02748"
FT   mRNA            <885615..>887921
FT                   /locus_tag="CAWG_02748"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        885615..887921
FT                   /codon_start=1
FT                   /gene_family="HOG000164493" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02748"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQJ0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ0"
FT                   /protein_id="EEQ44479.1"
FT                   /translation="MTTYQPVEQSLVEEESDLTLFSDLVRSRSTGSWINQDNIREVQRF
FT                   NDFRTIDWVEDELDAQKKRVLKARHITSRGNNMKDKIISQAQNWVVLGIMGCSIGLIAG
FT                   SLNIITSFLSNIRTGHCKRNFYLNESFCCWGEESDHCDNWVKWTSIEFINYILYVLISL
FT                   LFAYSAAKLVKFYAPSAAGSGISEIKCIVSGFVMDGFLGWPTLFIKSLGLPLAIGSGLS
FT                   VGKEGPSVHYAVCVGNSIAKLITKYRKSASRAREFLTATAAAGVAVAFGSPMGGVLFSV
FT                   EEISTVFQLNTIWKSYFCALIAVTTLAALNPFRTGQMVLFEVTYDTNWHYFEIPIYIIL
FT                   GIFGGLYGIIVSKFNIRVVAFRKKYLGNFAVREVLILTLFTASFSYFNQFLRLDMTETM
FT                   QILFHECDKNFHHPICDSSNKKTGIIVSLLFATLARMLLTIVTYGCKVPAGIFVPSMAA
FT                   GATFGRALGIIVDLVYANHKDSFVFRNCPKDGKCIIPGTYAFLGAAAGLCGITDLTVTV
FT                   VIIMFELTGALRYIIPTMIVVAITKSINDKWGKGGIADQMIKFNGLPLIDSKEVFTFGT
FT                   TVESAMSTVIVSLSTDLNDSITLKQLRTTLQKTRYRGFPIIKSSKDPKIIGYVSRHDLE
FT                   CILKTHENVNEDILCNFNEAESGGVDKVDFDAVINKSPLTVNFNTSLEYVLDIFAKLGA
FT                   RYLLVEKEGCLVGIITRKDVLRYEYTVHEHNRDNVQQANHDAFDEKVWEFINLIGTSAK
FT                   KNIGKILHNDANRYL"
FT   gene            complement(<887970..>891332)
FT                   /locus_tag="CAWG_02749"
FT   mRNA            complement(<887970..>891332)
FT                   /locus_tag="CAWG_02749"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(887970..891332)
FT                   /codon_start=1
FT                   /gene_family="HOG000246766" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02749"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018849"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ1"
FT                   /protein_id="EEQ44480.1"
FT                   /translation="MGKGLLTAEAVTKLLRSKDTSITEIVNTANSLLNNTLDIYLPGKE
FT                   VFVLNLLCDRLNDKSNGKFGKWKFNKDVWNLLLSVWSKLNHQKVDRQRVIQRLKIIEII
FT                   ILVLQQNNDNEVFSSLFEFLGIMFQESYIIADENSATQLLKCFVEHMDVLQASDSIVSW
FT                   TELVRDIYTRACSKISLEGSKKFYNKFFEDCCFPLIEYLAISEGSSVSPILKELLIQGV
FT                   FNADSTKYYQSSLERELKKKDIKEVSVIYLYTLTVQLFSAKHMEICEGVYSIMASKCPD
FT                   LAEKLLSILASCRKTISKTFIESIYKVEVADKPFKQLNWDMVKHIFAIDSELAISKSGF
FT                   LFKTYKSEFQLDDKVVPVAEVIVDGFARNRELSDFFTKVWPKAIKRDEIWESDEFIHTV
FT                   SQHVKTFSGKQLIDVIESSFYADKGSQRAIFTAITKGLTSSSANLIDAVKQTLLDRSNY
FT                   FNATENFWCIRYYLLCLYGTDFTIAEQNMKQNIDLYYHFSIFRLLELQVIKEYSKSDQK
FT                   YFIACIEGEKEMISPIFKRWLVIFNKFFDSDLLIKLISLGYPDIEFDDVFFEQPKLTTS
FT                   LIRFITENLPARMDLIASIPIVCFNKAFKKELLNGLFVLFVSNPTKETLENIQYLLGQP
FT                   TYSSILETNFDNMLKLLTVSTEESKLIAYNVIEIVWKNNVRQIKNEENQKYVNDAISKL
FT                   NSYLDSMSQQIISPELEAILIILTNTKEVGLFENTEKGLNELNEKFTNYCINTLNNCNT
FT                   QNFITVRWLLQALVMLPPKSLSFENVISCTKRLDPNILKDNSIQSTLFQLICKTIDFNY
FT                   KSLVYVLSLFVSLSSGRNTELYTVLKSLFQKFSKHSQLYFEVFDFFTRSIDAVPVEFNL
FT                   SFAQIASIFLSTVPKDADANRYNSKCFTFYVNASQSGNECVAMQILTSLKDLLTNQSWI
FT                   FKQNLLEITLVIVKTGLQKLNSFANQEQIYILSTQIVSHILLYHRFKIATRHHLVLNVM
FT                   SSLLKYLADGTSKLSSNTEAASAYARLLSNLCEPSERVGDKMSHLTTSASYFKKLLRKH
FT                   LSVLLSNYIYFNLKYTFTRTVNDAIMPGIYSMFTVLSQNELRVVNDSLDYGGKAFYKTL
FT                   YNDYKDHGKWKDQ"
FT   gene            complement(<891655..>892035)
FT                   /locus_tag="CAWG_02750"
FT   mRNA            complement(<891655..>892035)
FT                   /locus_tag="CAWG_02750"
FT                   /product="NHP2/L7aE family protein"
FT   CDS_pept        complement(891655..892035)
FT                   /codon_start=1
FT                   /gene_family="HOG000055226" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02750"
FT                   /product="NHP2/L7aE family protein"
FT                   /db_xref="GOA:C4YQJ2"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ2"
FT                   /protein_id="EEQ44481.1"
FT                   /translation="MSAPNPKAFPLADSALTQQILDVVQQSQNLRQLKKGANEATKTLN
FT                   RGISEFIIMAADTEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVIAASVTS
FT                   NDASSIKNQIYGIKDKIETLLI"
FT   gene            <892523..>893303
FT                   /locus_tag="CAWG_02751"
FT   mRNA            join(<892523..892536,892835..>893303)
FT                   /locus_tag="CAWG_02751"
FT                   /product="vacuolar ATP synthase 16 kDa proteolipid subunit"
FT   CDS_pept        join(892523..892536,892835..893303)
FT                   /codon_start=1
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02751"
FT                   /product="vacuolar ATP synthase 16 kDa proteolipid subunit"
FT                   /db_xref="GOA:C4YQJ3"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ3"
FT                   /protein_id="EEQ44482.1"
FT                   /translation="MSDLCPVYAPFFGSIGCAAAIVFTCFGASYGTAKSGVGICATSVT
FT                   RPDLLVKNVVPVVMAGIIAIYGLVVSVLVSDSLSQKQALYTGFIQLGAGLSVGLSGLAA
FT                   GFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRASQDVTC"
FT   gene            complement(<893606..>895927)
FT                   /locus_tag="CAWG_02752"
FT   mRNA            complement(<893606..>895927)
FT                   /locus_tag="CAWG_02752"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(893606..895927)
FT                   /codon_start=1
FT                   /gene_family="HOG000246764" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02752"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011502"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ4"
FT                   /protein_id="EEQ44483.1"
FT                   /translation="MPEYTNFESKFDDIDMLEIPEDDDGENSIDNSISSETEGISDSSD
FT                   SSKSSYDQWSPVAIFKSDKEYIDLSDWLNTQKSLEFKFDVQKYRKGIEKSRPFDEKYIL
FT                   YVNNMFKIIQKLTEDDITRFDLEEDDSPIGLVMDSMGSKAKQVRKFKKIDEALREIIDY
FT                   LQDLVNSIPKEEQESYDSQCLQHVLYILECFEANNFYFDIQQKPELIIKWVNTFDPKPD
FT                   PELLNDVIVNTPQPYLHPQFWNTCISQLLTRGLFTQIHEVIEHSQYQELKEKCPELYAV
FT                   IGDMDTLLSNYTSYSSKGQFTAWKLLACEFRDSLSSVRNESITETKHKLIIDQIYDLAC
FT                   IFTGLPKTISSYCDTWYEVYLALSLYQVRDSNEVYIDYFKTAVSEKPPSDIFDDENENL
FT                   DGLTEACFLNILENNFLKVLETLHELDPPTTAYLAELMELRFLLRGYYFDVTVTSSASF
FT                   EDLLNRRTVSEYFLTRHAYDCLNIHELVPVGIGLLLNNVVCTSNNAVSANRKVIATFLP
FT                   NYICNTNDDLEWALTICANLNLVSTARQLYYQAGLKSLEEGYMYEALNNFVNCYDPTLL
FT                   SGENHSEGMKKVHYIVWDLIFANCLVHNRPIKDELINNIVDKKVDLNFKIHPVIQQCLA
FT                   PYAVLKEFYETLPQRDIKLSNKLSKLIHLLKFNYLPKKFVPLLLAQFIPFLSEPNTTFQ
FT                   LPDLVIIIELLDNYESDRNEKELKEGADLYLYSINNIESDADENDWRKLVGKDNLPKDI
FT                   DSFTRLLRNLIAAKVGKVFI"
FT   gene            complement(<896093..>899350)
FT                   /locus_tag="CAWG_02753"
FT   mRNA            complement(<896093..>899350)
FT                   /locus_tag="CAWG_02753"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(896093..899350)
FT                   /codon_start=1
FT                   /gene_family="HOG000093904" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02753"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ5"
FT                   /protein_id="EEQ44484.1"
FT                   /translation="MCGSLNSFWTKFILFLVEYNELIYLESIDFDEKVLAITKIKIDGQ
FT                   EAVVYLDDQSQIGILFIDNEFCTTIKILAKLSSTGQSKIIDSPVYMVADPAANTRFIAF
FT                   HIFCEVVHVFHFNSISSVDDILGKTPNNSVSSTRRKNRRSDLGKWWSLESISVGRINVK
FT                   QIAILEKPTNTMAISYRDSNSNFFTRCLPVKGIDPVHAKQPIIEFEQEYLCLIIPIQVG
FT                   GYIVLSTFSIFYFPDDQIQYMSTSSEINDIAIIQSHVKLHCIKELTKPGNGISEENYVS
FT                   FEIIDKSRFLIIAESGRSYLLFTDMEISSKTTIIINQMTMISLGEVTIPYYNGLSHIAG
FT                   DLFFQSSRFSRSVLFSVLPEKPHIHIRAYIESSPPVLDIKDGCGQGVEELYTCQGSWEG
FT                   SELRKYGAVQHTPELLETKTIDMQIERLRIVNSTVMVYNIDGDSVALETHNLMSKIAHL
FT                   KIESNVLDYYEDSGFQCCVTRSSLLVNGKTMVNESFIYSSVVPEISTVVAVSDTKSIHV
FT                   QSKNYEFAFESEKLKEITSIDAIHVGNGALLILATDWSGDYRIWKVVNKKAKLIYSGEM
FT                   KDQTFVLDSAVVQSGENDIIAFMSTNNGSLHQLLIHLTEKRVDNVNFTEQYVSDVPCFL
FT                   RKYKNNVLVFNFKHLVALKKDELSGFFFKKYIHVPKLPLADVCFATEEEVLIGYQNGRI
FT                   DKVRIVLPSQVVSHQSLFSNKLYLKCLPVPLSKFLVGVVLDCSKDSINTQLHLVNTDSF
FT                   ENLSIFEFDEPSGVQVVDICLIQDWQNEKAHKDGLFVCLTSSTEFPLYVFGIEESRIVC
FT                   LNRGAILGIDLSPDVKLNSISLFDQEEQTYLCSGNIVVLVQLDIDENFQWTLVPRSAVH
FT                   SPAFVVSQWSNENVAYLADAIYGAFSSNVNKSEKHNAMKLVKIDTDSMGNQITAITAVR
FT                   SKNYTYTIIGDALGNVNLIQTDSNDSSICRVHKFNIGDQINCIFALGRKKSWGAQICVV
FT                   GTVSGGLFVLNNTDLNGCNDSLVEFAARNHLELLDCDGESVNNNEKSQCKEIVSDTVIA
FT                   RVLSHIIANSSEFSQTYSNLYSNRNLLQSVHFECNSL"
FT   gene            <899426..>902796
FT                   /locus_tag="CAWG_02754"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gap             901674..901773
FT                   /estimated_length=unknown
FT   gene            <903123..>903933
FT                   /locus_tag="CAWG_02755"
FT   mRNA            join(<903123..903171,903341..>903933)
FT                   /locus_tag="CAWG_02755"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT   CDS_pept        join(903123..903171,903341..903933)
FT                   /codon_start=1
FT                   /gene_family="HOG000255193" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02755"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="GOA:C4YQJ6"
FT                   /db_xref="InterPro:IPR004192"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ6"
FT                   /protein_id="EEQ44485.1"
FT                   /translation="MSSLAFRTLRNGLGLKSSVRALSTTTTTLSNYQQPDYSSYLNNKS
FT                   GQGSRNFTYFMVGSMGLLSAAGAKSTVEAFLSSFAASADVLAMAKVEVKLGAIPEGKNV
FT                   IIKWQGKPVFIRHRTADEIEEANQVDIKTLRDPQNDADRVKKPEWLIMLGICTHLGCVP
FT                   IGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPEYDFTDDETLLVG"
FT   gene            complement(<904231..>905412)
FT                   /locus_tag="CAWG_02756"
FT   mRNA            complement(<904231..>905412)
FT                   /locus_tag="CAWG_02756"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(904231..905412)
FT                   /codon_start=1
FT                   /gene_family="HOG000066107" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02756"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ7"
FT                   /protein_id="EEQ44486.1"
FT                   /translation="MIELLGLVNSGLEDMAPLAWRIYTSWEYAGQPVIHSENKTSTMAK
FT                   EFKEIFFSYRCKSAFYGGCGDSVNSVGILWDRMFPYTIKTANVDHIRHAISIDEKRSKY
FT                   KQQLFSPIESSDVGSKGSNTYSSPISYGSFTSVRSLVDILKRFVERFNRRKSRPLPAIN
FT                   DLIEVYFPGNHGDIGGGWKASSDNQVLSSVSLRWMLAHAIKYGVRFQPQSISQWSSDHP
FT                   PISSFLSPNHDILSFSSKSPDSRSDIVLPEFPIKLFAGRGEESFLYVLFWWILELIPFL
FT                   RITEIQEDGYWKRAFVPNLGKHRVLPSTSLFHWSVFYRLHYAADYNPKNLHNLSLGEKF
FT                   IESLMQFKIFKFNEIYSYSENLTVKKIKNDWTPRFWKKVPDELSEYLEKDANL"
FT   gene            complement(<905502..>905939)
FT                   /locus_tag="CAWG_02757"
FT   mRNA            complement(<905502..>905939)
FT                   /locus_tag="CAWG_02757"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(905502..905939)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02757"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ8"
FT                   /protein_id="EEQ44487.1"
FT                   /translation="MSLVEEPMIVNNGKNHPTDHNASKSIQKTNHSKSIVLCFDGTENE
FT                   FGPKPFTNVLKLFQMLDRNNSSQICYYQPGIGSKFNADINNVFEKNFTSTVLSKITNRA
FT                   DSLVAFTLEKHVIAAYSFLTSVYKTNDKIYLFGFRYVLKST"
FT   gene            complement(<906665..>907504)
FT                   /locus_tag="CAWG_02758"
FT   mRNA            complement(<906665..>907504)
FT                   /locus_tag="CAWG_02758"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(906665..907504)
FT                   /codon_start=1
FT                   /gene_family="HOG000205347" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02758"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQJ9"
FT                   /protein_id="EEQ44488.1"
FT                   /translation="MYFHSFIISSLIASAFANPIKKCGFPQDEDITNVGANGWAMSPDE
FT                   PCTPGKFCPFACPPGKLMNQWDPEAVSYTFPKSMNGGLYCNEDGTTSKPFIGRSLCIDG
FT                   VGTVSVVNKASDVVSFCQTVLPGNEAMLIPTEVGDGNEQVLAVPGPGYWAGTAAHYYVN
FT                   PPGVSSKDACVWGTPEKAIGNWSPYVAGMNQDSNGNTFVTIGYNPKYIDDFSGNIPNFG
FT                   IRIVCDNPDECNGLECEINPRQGFNKAMGPASGNSLGADYCIVTAKNHAHARIEVFQ"
FT   gene            <908379..>911372
FT                   /locus_tag="CAWG_02759"
FT   mRNA            <908379..>911372
FT                   /locus_tag="CAWG_02759"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        908379..911372
FT                   /codon_start=1
FT                   /gene_family="HOG000246762" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02759"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK0"
FT                   /protein_id="EEQ44489.1"
FT                   /translation="MTGTITRALNWDNVYEQQFIAVTPMGDEVLLYQTNHEDPSIESNS
FT                   MLKLYSRSGFENIQCSSYSDINKGIVGVGSINGNISIFDIYSPNSSILSLRPKQNRPCN
FT                   SVSFGNQNLVVAGFDKGRQDNSLQIWNIETYSSSGNHGSSLKRPLATYLPNEAILSTVF
FT                   YPDQNSNIICGSYKFLREIDLRLDQPVFQMATKCTLGLQIDYFQNHLFQSFSEDGSLAI
FT                   WDRRKLTSTKHRSTGTNNVITETPILQFTKLLSDASSRKVQHPCVRYSTVRRGEFASVF
FT                   NGDLIRRWQTDIVPESNDMRDSFKAKDSSTLQRLKQQAVQLYNPREESVFVSLVLDTKT
FT                   DYEKVVSFDYSPDIASHTSTNFVCMRQSGTVFRMPVVESIEALDFNPINEFSIAGPEGT
FT                   VTNFLNKQFLETDQSTNSQVPGPRDRNGSSFMKLGDLTLNDNLKNRHTETATTSTVDDE
FT                   SLAQSNIPEDKRYSYDNVFEEDIPLNKFWDSSDIVGNDICVTIRKRAQMGYSVDCDKNI
FT                   SILEKLDVADSTLFLKNTWKWLALAKKSLDKKTMISEGIDLGYQGVLGIWKGIEELNKQ
FT                   KCTVTGELISDNWLSQAVKSIVSSKGKKTSGITIPHDSEKKAQRKLCLIVCGWYFTDSE
FT                   FEEKLQLLISLGYYEKAAGWAVFHGDVPKAISILSHAKTERLRLIATAVAGYLAYKNSH
FT                   VNSPWKDQCRKMALELDDPYLRAIFAFIADDDWWDVLDESSLSLRERLGIALCFLSDKD
FT                   LGVYLNRIADTVVNRGELEGLILTGITPRGIDLLQSYVDRTTDVQTASLIASFACPRYF
FT                   VDSRVTHWTDCYRTMLNSWGFFGVRAKFDVARTKLSKTFGGQTTIRATPKQVYLQCNRC
FT                   NKNISKAKSNPSNNQVLLKQQFNKFNSLNKFNDIINACPHCGVPLPRCSICLLSLGSEL
FT                   PLEPSDKIEIANNPSSGIVPRIENKFNSWFSFCLTCNHGSHAYHAEEWFSKHYVCPVPD
FT                   CNCRCNSK"
FT   gene            <912048..>915341
FT                   /locus_tag="CAWG_02760"
FT   mRNA            <912048..>915341
FT                   /locus_tag="CAWG_02760"
FT                   /product="hypothetical protein"
FT   CDS_pept        912048..915341
FT                   /codon_start=1
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02760"
FT                   /product="hypothetical protein"
FT                   /note="similar to protein kinase C"
FT                   /db_xref="GOA:C4YQK1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK1"
FT                   /protein_id="EEQ44490.1"
FT                   /translation="MSTSQPSQQQNPEQVVNDIRQKIEKERKIIQGFNDVKRNTNNPEV
FT                   IQKCKSKIIESQSMIDYYQETMNKLTRQMQRLNTNSSSRTASRSSVISEYKPSYSNFDL
FT                   IKYECPSLGNKIQFMLQYLEFKLQVENKYSEANKKLSHLYLMDGDKSSSNAAEGGRAES
FT                   DQRIQLLEKALKKYQKFSINDHEFDRDYEIMDSTKHSRKLLTGRLTVSITCIRDVDHIA
FT                   TALAKKRETVVVIKVDDLEKARTKPSKNDNWNEEMVIDVDKSHEIELAVMDKQNGIYVP
FT                   VAVNWFSLFDLAEEIRKKKVAKDQGSSGWLPAANLPQTGGSGAGTGSSMTGGASYGATS
FT                   PLPAHNDLRPSVSPSSDAKENKVSVSTWLSLEPGGQMLINLNFEKSITNGKQFRGPLGR
FT                   HGAIRQKKEEVFEKHGHQFVQKQFYNIMSCALCGEFLRYTGYQCQDCKFLCHKKCYQKV
FT                   VTKCISKSGSDYDAAQLNHRIPHRFEPITNHGTKWCCHCGYILPWGKKNVRKCTECGVM
FT                   CHAQCTHLVPDFCGMSLQMANEILATIESTKVSPKKAQHQQSHAKPLPPKPPIESKPSM
FT                   DSEETLHNESSYKSLRPASVVHQDTNFVSKLPTTVQNKYQEPVELPPQQQNQVVPSTRR
FT                   RGHGSTDLSFETGYGQQQHQHHRDVPQIVVEDHQHYNSNDNRDVEMEESKDEFDNFDYN
FT                   NKYTENEILTDVQQDQVRSPFADQIQGVPETSHAKQQNQQVQQVQQQEELGHQRTHSSG
FT                   KSGKSKRRKRKVGLDDFQFLAVLGKGNFGKVMLAESRHTSKLCAIKVLKKDFIVENDEA
FT                   ESVKSEKRVFLTANKEMHPFLLNLHCCFQTENRIYFVMEYISGGDLMWHIQKNRFTAKR
FT                   AKFYACEVLLGLKYFHDNGIVYRDLKLDNILLTTKGHIKIGDYGLCKEDMWHKSTTSTF
FT                   CGTPEFMAPEIVAGKAYDRSVDWWAFGVLLFQMLLCQSPFKGDDEDDIFNAIENDEVKY
FT                   PINLSRQTVLVLQALLTKDPSQRLGSGPRDAEEIMEHPYFHDVNFDDVLNCRIPAPYIP
FT                   EVQSEHDYSNFDKEFTSETPRLTPVETVLTSEMQEQFRGFSHISDNATI"
FT   gene            complement(<915475..>916437)
FT                   /locus_tag="CAWG_02761"
FT   mRNA            complement(<915475..>916437)
FT                   /locus_tag="CAWG_02761"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(915475..916437)
FT                   /codon_start=1
FT                   /gene_family="HOG000093905" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQK2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK2"
FT                   /protein_id="EEQ44491.1"
FT                   /translation="MSLLLDSLHALTKNYDMCVIGSSNVGKSTLVLHYVYHHFDESLYD
FT                   LDAVYTKRIITPDTNGKFREITIFESDFHIDMYTLTRERHVLNANTIVLVYAIDDYQSF
FT                   TALEDYYERINQLRPSIPISVIASKLDLDTNREVSYYEGAEFAKRIGAVSFNECTRANV
FT                   MGVNQAFESIANVAVKIQLDKDNTVPTVDNEIQQKENDQDSNITTTPTSTTTQSQTSNY
FT                   SPQRSLQESIPVNNFTQYDNNPHQVNSNKNQFDVEQNTPLSTLTRESTMLTSDLNGSTP
FT                   IAQTPSTSSRQRKTRLKQSSGPSAKSSQIHAENKCCIIT"
FT   gene            <920189..>921841
FT                   /locus_tag="CAWG_02762"
FT   mRNA            <920189..>921841
FT                   /locus_tag="CAWG_02762"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        920189..921841
FT                   /codon_start=1
FT                   /gene_family="HOG000192236" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02762"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQK3"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK3"
FT                   /protein_id="EEQ44492.1"
FT                   /translation="MYNEKYASDFPNSHYLSNLNNLNGTNQSIHLNRLPTLGEILANKS
FT                   KSPVDLFTFYQFMKDVEGKIDYLDFWFDLINHLNLCKHYVKGLRDSIIRQSSTFHQQQQ
FT                   QSQSQQQQQGHRIISSSQPQPQSQDLSYESPATATGFRNSMAVSEKSNRKSLSSSILLD
FT                   LIINDNILEENDSHRLSAFLRGDINLDNLDPKLKDLIEQYNAEIEPNSKHSSRVDSVAR
FT                   SSPSYVSNPIMGSAPIANPQQPYLHQDRKTSSHLLLLHDDDENNHSYYENQLDIGRADK
FT                   AVSASKYISLQSENKDVFGKEQENERFQHPTNPFADTSAINNQKKRASTINPSLLEKLI
FT                   KDSPASNGTHSFITRENLRESSHQLLLKYFVEDSEKNLNLPSNLNSQIIKAIEVDGRDD
FT                   PDVFNYVKNFVFNKLENEHLPKFLDFMATRNINHSNFWRIILGFFFLFIGFWVSFIMVF
FT                   LNYRKGLRPVIIIPYFLAFYFLISSIYLIDPVMAWMGISETFSKSNGRSLMKIREKFIY
FT                   RFIVKRSLWVLFLVLIFTAIFTVLFSLVPGHRL"
FT   gene            complement(<922319..>923270)
FT                   /locus_tag="CAWG_02763"
FT   mRNA            complement(join(<922319..922877,923263..>923270))
FT                   /locus_tag="CAWG_02763"
FT                   /product="60S ribosomal protein L19"
FT   CDS_pept        complement(join(922319..922877,923263..923270))
FT                   /codon_start=1
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02763"
FT                   /product="60S ribosomal protein L19"
FT                   /db_xref="GOA:C4YQK4"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK4"
FT                   /protein_id="EEQ44493.1"
FT                   /translation="METTQKRLAASVIGVGKRKVWLDPNETTEIANANSRSAIRKLYKN
FT                   GTIVKKPETVHSRSRARALKESKRAGRHMGYGKRKGTKDARMPSQVLWMRRLRVLRKLL
FT                   AKYRDAGKIDKHLYHNLYKAAKGNTFKHKRSLVEHIIAAKAEALREKALKEEAEARRVR
FT                   NRAARERRQQRLAEKKEALFAEAAN"
FT   gene            <923886..>924188
FT                   /locus_tag="CAWG_02764"
FT   mRNA            <923886..>924188
FT                   /locus_tag="CAWG_02764"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        923886..924188
FT                   /codon_start=1
FT                   /gene_family="HOG000000714" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019434"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK5"
FT                   /protein_id="EEQ44494.1"
FT                   /translation="MAKSLRSKSKLQAKSTKRKGEFSKYVEERSKRIANRLAEETKKQE
FT                   EAKKQQDPTQTQTEAMDIEDNKDKKVSTSGWRDSRSQVYKQRKLKNKNKKKTLKF"
FT   gene            complement(<924451..>926157)
FT                   /locus_tag="CAWG_02765"
FT   mRNA            complement(<924451..>926157)
FT                   /locus_tag="CAWG_02765"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT   CDS_pept        complement(924451..926157)
FT                   /codon_start=1
FT                   /gene_family="HOG000034027" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02765"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="GOA:C4YQK6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK6"
FT                   /protein_id="EEQ44495.1"
FT                   /translation="MDNKTVGILGGGQLGRMIVEAAHRLNIKTVILDAAKSPAKQINAL
FT                   DDHVDGSFTNYDSIVKLAEKADVLTVEIEHVDVDALIKVQEKFPKVEIYPLPETIRLIQ
FT                   DKYLQKNHLIKHDVAVTESVAVETNTVDDLLHIGEKFGYPYMLKSRTLAYDGRGNFVVK
FT                   DKSYCEKALEFLKNRPLYAEKWCPFTKELAVMVVRSLEGEVFAYPTVETIHENNICHLV
FT                   YAPARIPDTLAKKASILAKNAVKSFPGCGIFGVEMFLLENNELLINEIAPRPHNSGHYT
FT                   IDACVTSQFEAHVRAVTGLPMPKGFTEFSTSITNAIMLNVLGDKGTPNKELEICRRALE
FT                   TPHASVYLYGKTTRPERKMGHINVVTSSMEDAESRLSYILGDATEIPKSLATDKESPLV
FT                   GIIMGSDSDLPVMAVGARILKQFGVPFELTIVSAHRTPHRMSEYAIEAPKRGLKCIIAG
FT                   AGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPVATVAINNSTNAA
FT                   LLAIRILGAYDSKWLTEMNQYMLNMETEVLGKAETLEEIGYEDYLTDKLKK"
FT   gene            complement(<930788..>933007)
FT                   /locus_tag="CAWG_02766"
FT   mRNA            complement(<930788..>933007)
FT                   /locus_tag="CAWG_02766"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(930788..933007)
FT                   /codon_start=1
FT                   /gene_family="HOG000093906" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02766"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQK7"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK7"
FT                   /protein_id="EEQ44496.1"
FT                   /translation="MMSQATPSATPVRNADGQKKGKKLPLIVDVAIGNNGKQLYQVHES
FT                   SKMVRKEMPRSTNFALNDDISDEGFFISQINEQRTPIRKTLGTLSPSSLNQKRIRHDVY
FT                   DQGDDNSNDDNCQNDVYEQQQQQPQQQQQQQLHQPNMYENGNVGVISNDPVSAVGHYDN
FT                   NPVSHVPTGAYSRVQDTDIWSDDVEEAFEEVLRLIPKSGLNKIKIAGRSCGRNELISDY
FT                   IFAKTGKFRTRKQVSSHIQVIKNLGQKLDIIQLINDGPIFNSHEEQLESTKKFEDVFSK
FT                   INLNKSLGFSDSMKRKSDSMPMHLPATKRIRRKHSGNPLNKIKFSNFFMSVNDQYGMNP
FT                   IVLTIQQNGNDVKSLKLKDNANISSRFPGLSDFKSCPHIPIIHNMVKILLPQLPESYSI
FT                   DDGFSSSYALKYEEPENASPTHTSIISSSRTYSLFTCVYSYGKEIVKFDEDGIQLNQDR
FT                   EFIPGFWKFFFSTFGDQSEGGLSAAFKGVTIKQILYESSPDSVKKEQDASKVNKSKVKL
FT                   VLLWEFAKVSECKDALTTTTKLVLPPRASASSSKTTEEVFEYSEPALNSIGGTPTDTTS
FT                   PNMDLNNQNLSGAATTIPGIRDTIHSASMPDINELPSSVKPQVRLQKTFQSMQHLQPHQ
FT                   MWQQQQQPSQGAYTSSVASQSLNTSLSSPYAQYGMPLPQQTIGTFAPPTSQTFGVSYTH
FT                   NSQHPSANMDLMMLSSMNTGYGNITNNQDYQFGNIGYTEGFTSEF"
FT   gene            complement(<939077..>941356)
FT                   /locus_tag="CAWG_02767"
FT   mRNA            complement(<939077..>941356)
FT                   /locus_tag="CAWG_02767"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(939077..941356)
FT                   /codon_start=1
FT                   /gene_family="HOG000246761" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02767"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQK8"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK8"
FT                   /protein_id="EEQ44497.1"
FT                   /translation="MNSVSANSYDFSLKPREETDFKEIYPDLDETCQLPVFVIDRNTNS
FT                   EESSNLRHAVNLSELKAPTYRRVPQLSLTPTNLRFSKQLSEYGFQNPSKLTNKPNPDTY
FT                   IRPFQLNASLRETTASIEKFIEKKKNLVEYDMDEQDYLFLQDRNNQPENVIKITPEVFE
FT                   IMMTSLENQWCALELKMNSITTNVGSSTSDPGSNHKLLTIGHNNAKYGNDDGIVPGSIY
FT                   DQKCAICNDSDCDNANAIVFCDGCDIAVHQECYGVAFIPEGQWLCRKCMINKNRTTECV
FT                   FCPSTTGAFKQLDNSLWSHVICGLWINELYFANPIYMEPIEGMEGIPKSRWKLTCYICK
FT                   QRVGACIQCCNRSCFQAYHVTCAKRAGLYMSMTQGIKGAISNKLTLKSYCERHSPAEFD
FT                   ETKVLDGIRRTRLYYRDTKLLNEENARLSKDRETANKLNIFKWNTEANTPIAPKLFSDV
FT                   LVQILYQLKVENQISLPEESTNEVLHLKVLPNRTKMEILQDLRSIADEVCRYWCLKRKS
FT                   KRGASLIRKNNNLIATSSILYDSNSLENNNACESTKKIEFAESLVSDIDRLISMGEMLT
FT                   DEQEANHEINSVSFDVVDSVYFPLKQLIELTIMRLNNKFDSNETLRTYKPKSDAVISLN
FT                   SISGKNSQYGYQSIDQLEQDVENLREYIFQENKPSSAVYKKMKNWIAGFRKELPSLQVF
FT                   EKDVINDGNQKSSLSFPNVRSAGTNTDLKLVDYRTILEENDLSEIDDDEIESVQNQKEL
FT                   EKFLQD"
FT   gene            complement(<941581..>942828)
FT                   /locus_tag="CAWG_02768"
FT   mRNA            complement(<941581..>942828)
FT                   /locus_tag="CAWG_02768"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(941581..942828)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02768"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQK9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQK9"
FT                   /protein_id="EEQ44498.1"
FT                   /translation="MTKTGKFTPWDETTGNKTTTANNTSYILSKKPLGDGSYSVVFECK
FT                   NTSTGRHYAAKKYTKRLMYGFENMLKNEFKVLNRISLSHSHLLSLIDFFETEESFYLVT
FT                   DLARGGDLWNKIAEEEKLNEQTTRTITRQLVESVEFLHKHQILHHDIKAENVFFQSKHQ
FT                   DTILLGDFGLAKILQPQEKLHEVAGTLSYMAPEMLDYKIGYDFPIDVWALGVCVYFMLC
FT                   GYMPFDCDDDEETKDAIRNRKYLFEPSEYWVDVSSEAKDFILACLQVDPQKRLTASQLL
FT                   QHSFLKINSTKPAITISSPLKRSFSNLSALQRDQIKNILQKVGGVSAPALSHSSSINEK
FT                   LERGRFDSLNKDATLNGAICPSPECVSIFSSPANSTSVSRDGSGLNIFEESLKWDSSQK
FT                   KALPLNTLRQGASFAL"
FT   gene            <943475..>946195
FT                   /locus_tag="CAWG_02769"
FT   mRNA            <943475..>946195
FT                   /locus_tag="CAWG_02769"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        943475..946195
FT                   /codon_start=1
FT                   /gene_family="HOG000207540" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02769"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQL0"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL0"
FT                   /protein_id="EEQ44499.1"
FT                   /translation="MSSGLNLSSLKDKIFSKLNLQKDNQTKSQQKSKKASSNDKEIQKD
FT                   KKKPATPAKANAKKTKGVDEILRREALALGATDEDLKLVEGIESDDDKSEQEFDDDSKL
FT                   DKNFSADLSKFMKGIGLGEEEAMVVSEEEEEEVPELVEGEEEEEEKVSEDDVVEEEEES
FT                   ISEKESESEDTSDSESEKEVVVKEAKIDNKKSNQDPDKVTDLSSVSSSKLIVPNRTDWF
FT                   NIVEVPAETPEKLDRFARERLLERAQKTIEKDNKTYLEEFASNTSQKKFLSQILSDGTL
FT                   NDKISALTLLIQEAPLHNLKALDTLLAYCDKKSRTAALQSIVALKDLFVNSLLPDRKLF
FT                   AFDKQPLRKDDSDIQLAIYYFEDHLKKVYFKLIQILEKLSHDPIVHVRMTVVNHIFDLL
FT                   GAKPEQEVNLLKLGVNKLGDIDNKVSAKASYLILQLEQAHPAMKQIITDAVIDVIFQSN
FT                   NDDHAKYYGVTTLNQTILTRKEHELANSLVKTYFALFEKILVESDGYNKDTKDDKSIGD
FT                   SKKGRKNNRKNFKKGKKGGKSVKIEEKTEQELVEEKNAKFFSALLTGLNRAFPFSKLPN
FT                   EIFQSHLDTLFKITHSSNFNTSIQALVLINHIVSEQGLNSDRYYRTLYESLLDPRLANS
FT                   SKQGIYLNLLFKSLKNDIANIPRVLAFVKRMLQICSHWLNVGAVAGMLYLMMELSKTIP
FT                   EISDLLVEFASRPDDTEESSEKDTEEVDKTKDENKDIEYDPRKRDPKFANANRSSLWEI
FT                   HQFLNHYHPTIAIYASSFLDGTEQVKPDLGLYTLSHFLDRFVYKNAKQKPQTKGSSIMQ
FT                   PLGGAHTGSLLVRSTNLVDTTVPVNTENWLGKKIEDIKPDEKFFHQYFSTKVNKLKTKK
FT                   DDRKLKTKKDDRKSKEEGDNEDDEEDDNEMDDDEV"
FT   gap             946651..946750
FT                   /estimated_length=unknown
FT   gene            complement(<946796..>948802)
FT                   /locus_tag="CAWG_02770"
FT   mRNA            complement(<946796..>948802)
FT                   /locus_tag="CAWG_02770"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(946796..948802)
FT                   /codon_start=1
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02770"
FT                   /product="hypothetical protein"
FT                   /note="similar to urea transporter pseudogene"
FT                   /db_xref="GOA:C4YQL1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL1"
FT                   /protein_id="EEQ44500.1"
FT                   /translation="MSESAVHLLDQAAGYGVLVGVGALFAGGMILTTFLLQRYLHENAN
FT                   STETFAVANRSVGTFLSASAVYSSWSWSTEFLLVSSMTYNYGIQAGYYYGAGLAIQIAV
FT                   MSVIGIHAKKKIPTAHTSLEAIELRYGKSAHLLYLTLSLICNICSCSAMILACASGISI
FT                   IAGNLHIVASTLLIPFGVLLYTVVGGLKATFLTDFVHSSILLIILCYLNTSVLTSEQVG
FT                   GLNGLYDKLLKVSATKHIEGNYDGSILTGKSQGAAIFGLILTAGNFGLSIMDSSFWQKT
FT                   FSARPRSTVPSYLITAFLICSNVWPLSAIIGGSSHFLETDPSFPTYPRKMNQYEVDSGF
FT                   VLPYVLKATIGNGGVGALLLIFYLAVTSTVSAQMVSVSSIVTFDIYKRYFKPDAQNKSM
FT                   IRVSHITCIVFGFGIAGFSIMLHYVGINMTWYTYFYPILICPGVIPIILTVTWDRQTFW
FT                   AAFISPLAGFAAGLAVWLSTAYHFYGEVTIASTGGQLPALYSSLTALLLPGVLSIIISL
FT                   IKPKKFDWDQLKKADLLVKSDDSSQDEQVSETDREKVEKNDQVEVNVDSDRNSSLEQQE
FT                   HPTKLTEKELDFWIKIATGAAIFILLITWLIWPMSVYRDWIFTPTYFKGYVTVGLIWLY
FT                   VTLIVIGVIPFYTGRHSMAKVFKGVYNDYIKKK"
FT   gene            complement(<949940..>951247)
FT                   /locus_tag="CAWG_02771"
FT   mRNA            complement(<949940..>951247)
FT                   /locus_tag="CAWG_02771"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(949940..951247)
FT                   /codon_start=1
FT                   /gene_family="HOG000093907" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02771"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQL2"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL2"
FT                   /protein_id="EEQ44501.1"
FT                   /translation="MLILSIGLIHHTSNKSLYTISPNKGKRYEPFTTTSLGNFQFHVVR
FT                   FLHRLIYGTQRYQELFPPIQKIKNINNVKQQRIFPVNCAADDLDLGFGESDQIELFNHP
FT                   SKDTYGQFNLIQLIDIFDPPQVHAPSSADEFFKSNKDSEHIDIFDMITRQPPPFHQHQL
FT                   NIETPYFEDFATPLVLPPHEVSSDDVESYFSGSVSTVSSIEPLDDEFVPPPQPPRTHTS
FT                   RKRKHDSISPPASSDSSSSSYVPQLIPSSSSSVTSNGDSPVSPTTKRKYTKKKQPVFSN
FT                   VDEPIVITTTTKTNNIDVKKITTTKNGTVENRFDCPSCDASFKVKGYLTRHLKKHSTSK
FT                   AFECPFFDNHGVHGSKCHPTGGFSRRDTFKVHLRALHFIYPAGVKASQRNSFSGRCAGC
FT                   FQYFDNNSEWLENHIEAGKCTGTVQYKQNVSNLLLD"
FT   gene            <954763..>956351
FT                   /locus_tag="CAWG_02772"
FT   mRNA            join(<954763..955038,955941..>956351)
FT                   /locus_tag="CAWG_02772"
FT                   /product="predicted protein"
FT   CDS_pept        join(954763..955038,955941..956351)
FT                   /codon_start=1
FT                   /gene_family="HOG000177542" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02772"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C4YQL3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL3"
FT                   /protein_id="EEQ44502.1"
FT                   /translation="MSASLDKSLDDIISSNKKTFKSKRPGAKFGAKGGNRVGKKIGGTN
FT                   NNKKPIAKFNKPAAAAAAAAVPAIDLSYATKVNVSGLPKDLKHDNIKEFFQSQIGGVQT
FT                   VALSYNEKGQFKGFATIVFKSSKFATAAVDKYNGASIDGGAAKLRLELIIDTSKKPLAA
FT                   RIAPNAKAAAAAKTAGGKKIAAAKNALNKKKAGPGNKNNNKQKKPKQKKKTIEELDQEM
FT                   ADYFEN"
FT   gene            complement(<956437..>956655)
FT                   /locus_tag="CAWG_02773"
FT   mRNA            complement(<956437..>956655)
FT                   /locus_tag="CAWG_02773"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(956437..956655)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02773"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL4"
FT                   /protein_id="EEQ44503.1"
FT                   /translation="MSQTLTFASLYTIIRLIERSYQLDTKQKKKRKKQRTLTTLIIITF
FT                   NTMELNTYLSSRITLFNKQKKNKNNTW"
FT   gene            <957447..>959336
FT                   /locus_tag="CAWG_02774"
FT   mRNA            <957447..>959336
FT                   /locus_tag="CAWG_02774"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        957447..959336
FT                   /codon_start=1
FT                   /gene_family="HOG000246760" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02774"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL5"
FT                   /protein_id="EEQ44504.1"
FT                   /translation="MPNIEYIVTAEFHIDKGPSIVHQFPNQLPGMDNLYFLPELMLPDQ
FT                   IHKRNEDYTLFLLHRNTTNGEFQYLFNKSTCEDNPYYLYTIVDNRKNDEFKRGASIKSL
FT                   SIITKLSYFKNFKPLLLICLDLYFKNNDVKYLEELYRVINEKKFDISPGYSVSIIKKLL
FT                   ITSILDLPINDKIYYDESFRNKLLGIGKDDYVNDDLFIRKDLSFNSVIKFNNMNIPIKI
FT                   PMLTLPDTIGDYLNPTDLNFKPSLINILQAKLVSTNLNNELTIYGLQTPPIIILINAIL
FT                   TGKKIIFLSYEHSSGYIIDHILLTLKIITGGGILSGILTNYNVFPMIDVSKINLLEECE
FT                   SFIAGTINPFFKQNDRLWDLMYDLDNNEFILSSQLPGDDIEFKNSIISEDAKFLSNLQL
FT                   SLFNYNDDLTTIQLIFRRHINEIIRILLSSKNFNSNLAPTSQDLILLLDGIGYYWASDT
FT                   NKLLEISCYQLISKKFHFLLYNGKLIYNLLLPNLSNELNLMIDLHYHLQSLNNPASNSR
FT                   INEREIWFNILKFLISGKSLEIFLLITYLIPPNSSSSLQSSSVYGGNLTIFDKNKGIEL
FT                   LLLNLFNQDDQVKSNVIMILQELQDNFLCSWCLDKFLKSNLIYELAFSDLINE"
FT   gene            complement(<959513..>959923)
FT                   /locus_tag="CAWG_02775"
FT   mRNA            complement(<959513..>959923)
FT                   /locus_tag="CAWG_02775"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(959513..959923)
FT                   /codon_start=1
FT                   /gene_family="HOG000246759" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02775"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANI3"
FT                   /protein_id="EEQ44505.1"
FT                   /translation="MLNIAKSTESRNTILRKLGIFGSIAIGLFIIGKKHIAYQKNHRHE
FT                   LESDSSTLSSRHQDEEFGYVSSRPGFPLTNPNLDYSSPDRKSKYVGSGDAFSTRRPGDR
FT                   LSLWNMVKMRWFPDEVEESKYYTPSRSDKLDK"
FT   gene            <961458..>962549
FT                   /locus_tag="CAWG_02776"
FT   mRNA            <961458..>962549
FT                   /locus_tag="CAWG_02776"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        961458..962549
FT                   /codon_start=1
FT                   /gene_family="HOG000159426" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02776"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5ANI2"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANI2"
FT                   /protein_id="EEQ44506.1"
FT                   /translation="MSNQELAHAVSGAVGGALALGITYPLITLSTIAQTAAKKKEAEEA
FT                   STTEDGKKPQPTVSLTTLEKIAHVIQNNAAYIAAKEILKEKGPLGLYSGLESALYGITL
FT                   TNFIYYYFYELTSNVFLRANGKKRNGLSTIQSIITGAIAGAFTCVGSNPFWVANTRMMT
FT                   EKKKEKTATAGDAADAKEENDNSSNSTFKALVNIVEQDGVGALFAGVLPALVLVINPII
FT                   QYTIFEQIKNIIIAKDGPKAFTAVKAFFIGAFGKLIATSLTYPYITLKSRMHIKRKKLN
FT                   IDNQQQDEEKQLSMIQEIRKIVKEEGLEGLYAGLAVKLTQSIATAAFLFYFKEELFSGS
FT                   VKLIEILRVFSFKKSLKSPVVQV"
FT   gene            <966989..>969538
FT                   /locus_tag="CAWG_02777"
FT   mRNA            <966989..>969538
FT                   /locus_tag="CAWG_02777"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        966989..969538
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02777"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQL8"
FT                   /protein_id="EEQ44507.1"
FT                   /translation="MKQVTNQAYFLLLLLHHRRRHRIPITYITSIMATHHHRHRHLLCI
FT                   ITIITRPLIIQDLGSHHRHQVHHSYHHLIITNRHLQNLHQKNLNIDIQSIFIDKIIKDI
FT                   DIDITSHPHHHHPPPPPHHHHHHPRDFQKQNGQDDIKSKHTDENSQNSKPSSPRWLDNM
FT                   SVSSSDSSRSVSSPQSQHNDKSQYSNHKSSTQMSSCTNSVTQTLDRPPKIVSTQQNNLT
FT                   PTSKILSNSPFTESELVKYDLPKWEVLNKIFNYYYIYNQPSHQIFPGKAILLENLALNT
FT                   DSSIIHAIIATTCLIISKYDSSINIVADELYWINKMHKFWDNLNDLGILCCYKLLVKCT
FT                   SIRFNIKKMNDINIKLWEMINNNQYVDIFKQKKFDFQESRIIPTFGTKRQNYERELTLK
FT                   IIWSFYINNIILLRFNQGRPYYKLSSIMNGFKFDYDRDQYSNNILLPMSDIDYLSLKSA
FT                   GNRTNWNQLYEKSHIPTDATSLILSSKSFENSLSKLSNKDITFSNLISKDEFHVDLRNK
FT                   LKTKYYEIIHDEKLVVINTNYWFSNIILRLSELIQYNYILCDIMVFKMCKYDWKTDLGC
FT                   NSDDRGDSKDTNTTQGEKCQDADENSIQHKENYKDSVSNPGLLQHPLISNEIQSVEGLT
FT                   TKLKSLNNNDWKILIEMIKSINEYVDLIKLIPSSEYTDYSIVVGPTTFDDNYNNENETT
FT                   KRFRNLINNSSEWWNKQELKSSVQQSWAKLPIYILSFTSGVLSIIYSLAVLTKYIKFKK
FT                   SFESGDLIVEFLETNEARTIEGCNISVPQQKQMADVYEIFTEIHILSQLFVLCEYVKFK
FT                   LSYSNEDLAALSIQRLNNLNQHLDEVLQQNFTKIKPE"
FT   gene            <970183..>971316
FT                   /locus_tag="CAWG_02778"
FT   mRNA            <970183..>971316
FT                   /locus_tag="CAWG_02778"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        970183..971316
FT                   /codon_start=1
FT                   /gene_family="HOG000246758" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02778"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANH8"
FT                   /protein_id="EEQ44508.1"
FT                   /translation="MINVFKPIVQRDLVPTAYYNNEILQYNGVSPKDTPILPFNQTIED
FT                   LNRDIYAKPLHSHNDYWREYPLFSALSAGAISVESDIWYFPQSYKLTRTVTPSTSKYNN
FT                   NNKQGNSSVNETLIFKNDEIYVGHSQEFLKPINTLFNLYLNPLSQFLQFVNPTYEIIDG
FT                   DSNSENSRLEQDFFAQSQSERNSVFYNNPGQPLYLWFDFKTEANSTYDALKPLLKPFID
FT                   NGYLAYYNTTDDKYYSGPLILTITGNLPVEKVTNETIRYLFLDGPLDKFTIDNNNTNKD
FT                   ELKKWSKLSRVASGSLETILGSESYATSTKNDFNEEQKSQLKQVLDLAHEYGLKTRIWG
FT                   DITWPWNVLDSHLKILFELGSDLLNVDDLERASQLFS"
FT   gene            complement(<971432..>972385)
FT                   /locus_tag="CAWG_02779"
FT   mRNA            complement(<971432..>972385)
FT                   /locus_tag="CAWG_02779"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(971432..972385)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02779"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQM0"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM0"
FT                   /protein_id="EEQ44509.1"
FT                   /translation="MDQEITSPNTSHHETLHPLKEITFGATSGMVGKVVEFPLDTIKVR
FT                   LQSAGSSGGITTLQMIKTTYHNEGIFNGFYKGLKAPMIGACLENAILFSSYNFGSTVIT
FT                   NYLNKNNDKNQYTHETLPFSGKILAGGFAGFMASFVLTPVELVKCQLQVSNLSSDKSHH
FT                   TYGTIIKSTIRDRGIIGLWKGLNSTIVREVIGTAIWFGTFEYVNDYYKKVKDPWVSNKD
FT                   VQLLIAGAMAGVTFNFSMFPVDTIKSNIQTHDLFNNNRNSNSMGKHMGFWQTTRSIITK
FT                   PGGILNLYNGLGITMVRCIPANALIFYTYELLKQNF"
FT   gene            complement(<972886..>973689)
FT                   /locus_tag="CAWG_02780"
FT   mRNA            complement(join(<972886..973301,973677..>973689))
FT                   /locus_tag="CAWG_02780"
FT                   /product="40S ribosomal protein S15"
FT   CDS_pept        complement(join(972886..973301,973677..973689))
FT                   /codon_start=1
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02780"
FT                   /product="40S ribosomal protein S15"
FT                   /db_xref="GOA:C4YQM1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM1"
FT                   /protein_id="EEQ44510.1"
FT                   /translation="MVDATAPKKRTFKQFSFKGVDLKDLVEMPTEEFTKLCGARVRRRF
FT                   SRGLDSKPMGLIKKLRAARAATEPNERPAVVKTHLRNMIVVPEMIGSVVGVYNGKVFNT
FT                   VEIKPEMVGHYLGEFSITYTPVRHGRAGNASSKFMPLR"
FT   gene            <974147..>974479
FT                   /locus_tag="CAWG_02781"
FT   mRNA            <974147..>974479
FT                   /locus_tag="CAWG_02781"
FT                   /product="hypothetical protein"
FT   CDS_pept        974147..974479
FT                   /codon_start=1
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02781"
FT                   /product="hypothetical protein"
FT                   /note="similar to cytosolic ribosomal acidic protein P2B"
FT                   /db_xref="GOA:C4YQM2"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="InterPro:IPR001859"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM2"
FT                   /protein_id="EEQ44511.1"
FT                   /translation="MKYLAAYLLLVQGGNTSPSASDITALLESVGVEAEESRLQALLKD
FT                   LEGKDLQELIAEGNTKLASVPSGGAAAGGASASAGAAAGGAAEAEEEKEEAKEESDDDM
FT                   GFGLFD"
FT   gene            complement(<974597..>975619)
FT                   /locus_tag="CAWG_02782"
FT   mRNA            complement(<974597..>975619)
FT                   /locus_tag="CAWG_02782"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(974597..975619)
FT                   /codon_start=1
FT                   /gene_family="HOG000246757" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02782"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM3"
FT                   /protein_id="EEQ44512.1"
FT                   /translation="MSHSYTYTKNFIQNQVNILNEPYRINSRIRNILAEQDEITESELQ
FT                   TILNLLNNEIKECNDELFLSQINNQIVSQILKLEKQKLKIVNSQLFKINSFIKPITLPD
FT                   FDNLTNQDQNKKLAELREQIKELPDSKYLFVSSTDTTDIQDEYDLDDDDQGQDMENEPR
FT                   EEQAEDNETDKANTDIVQDDQEEVASTKQMKKEFIQEIADKVNDSNAQPDQELIEKYDK
FT                   LRTDLIDISDRLQYKSGKLGYLSGLQQTLSEIVGVRSTTIDTESNQIYDSDEEVSTPND
FT                   NETNLQPGPDSTRTNIQSEINRFRMLVEKISYKVNTKNLTSDNLREKLQEINHNPNSAI
FT                   "
FT   gene            <975856..>976956
FT                   /locus_tag="CAWG_02783"
FT   mRNA            <975856..>976956
FT                   /locus_tag="CAWG_02783"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        975856..976956
FT                   /codon_start=1
FT                   /gene_family="HOG000093908" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02783"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM4"
FT                   /protein_id="EEQ44513.1"
FT                   /translation="MFGANSSAFGTSGFGNKSSSGNAFANQSNPFATSSTNSGFGGFGA
FT                   FKNTGASSNASSQQSGIGGFGAKSDAPSQSSAFGSTGLGNTTNTTTGFGSSGFGSTGFA
FT                   KSTPPSNSGFGSSGFGAKSNPTASAFGQSGFGSSGFSQTNTSNSSSSPFGQMGNTNKPS
FT                   PFGTTASQPSAFGSTATQPSNNKPSPFGQTNTSNSPFGSNTAATTAPTNTSSPFGSSNN
FT                   NTSNPFGGQSSTSSPFGQTQTSSSTFGASNQTQSAFGTASTQNTNSGFGSNNSASTIAN
FT                   TNQNSSTTNNANPFGSTSEATPTFSFISTQPKSQPQTQTTSSIDVDIQESTQNDSLPAS
FT                   ILEAFNGSMFTLGKIPDVPPPPELCR"
FT   gene            <977116..>978006
FT                   /locus_tag="CAWG_02784"
FT   mRNA            <977116..>978006
FT                   /locus_tag="CAWG_02784"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        977116..978006
FT                   /codon_start=1
FT                   /gene_family="HOG000246756" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02784"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM5"
FT                   /protein_id="EEQ44514.1"
FT                   /translation="MICIECGYSNIDCLYSKYKSDYIKLSVCPECNKIADKYIEYDSVI
FT                   LFLDILLLKRQAYKHLAYNLTEMEMEIGSSTNFHVNDNTNFKFFHTYRKLMKLIFMILS
FT                   FEVYLTWANEEKLLIHSQLINLIFNQSVVYQYLFFIIKSSLENLILNLSLQLILRLGYK
FT                   WGQGPQKINGNIRDKELFGYKTSVLLVTTMVSGSIRLFPILMFIWPYDNISITKPLINL
FT                   IAFINIVEALRVVTSLGYVELILSLAFSIVIRNIVSKSLLVLIVRLFLDFNFTEVYYNE
FT                   MYQLYSQIQTYIRWI"
FT   gene            complement(<978003..>980603)
FT                   /locus_tag="CAWG_02785"
FT   mRNA            complement(<978003..>980603)
FT                   /locus_tag="CAWG_02785"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(978003..980603)
FT                   /codon_start=1
FT                   /gene_family="HOG000212982" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQM6"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM6"
FT                   /protein_id="EEQ44515.1"
FT                   /translation="MIDNIINNLQIILQQNDDNFTSPHDDVIYRPHSARVARYQVIIAS
FT                   TLGLTALLLFSILRLKYPKIYVANFNHLNFSLHSTSRRNLPKLPSNSLFGWIPTVYKIT
FT                   EQEILEHAGLDAVVFLEFFKMCIRIISICLVFAIIIISPIRYKFTGRVDEDYPDDDSDN
FT                   DDDDGSNNNGTTIIKHIVSAGISVASKDSDGEHYQQFLWLYTIFTYVFTFVTVYFLFKQ
FT                   TNRIISMRQKYLGSQNSVTDRTVKISGIPGSLRDEVALARHIDRLNIGEVDSVLIVKEW
FT                   QNLNKLFKRRRRIVRKLEESWVEYFEKNGITNKSDLISLHPQVGESYRFSNRYTDDDAE
FT                   ESPDWGSQNSNSAQASIIDQESESVEGDSSDTLNRLLNDESRTRPSLRKGWFGLFGPKV
FT                   DSINYYTDKLEVIDKEITRARTREYPATSTAFLTMKTVAEAQMLAQAVLDPKVNHLITN
FT                   LAPAPHDIRWDNLSLTRQDRNTRILAVTIFIGIMSLLLVYPVRFMASFLNTKSISKIWP
FT                   SLGKAIESHKWAETLITGLLPTYLFTILNIVIPFFYVWISEKQGYLSHSDEELSSVSKN
FT                   FFYIFVNLFLVFTTFGTASFVDTTKIAFDLARSLRDLSMFYVDLIILQGLGIFPFKLLL
FT                   VGNLLRFLVNSLFRCKTPRDYLNLYKPPVFNFGLQLPQPILIFIITLVYSVMSSKILTA
FT                   GLLYFIIGYFVSKYQLLYACVHPPHSTGKVWPIIFRRIILGLFLFQITMVGTLALQDAI
FT                   TCATFLAPLPFLTLYFWWSFHKQYIPLSTFIALRAIESNENINPTDLEQIIENNNNKTL
FT                   DERRELNTKYEYPNLVNDLDGPMIALDGEDVLIVNRDGTTVRKPPQYFSSEWDY"
FT   gene            complement(<981225..>982652)
FT                   /locus_tag="CAWG_02786"
FT   mRNA            complement(<981225..>982652)
FT                   /locus_tag="CAWG_02786"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(981225..982652)
FT                   /codon_start=1
FT                   /gene_family="HOG000093909" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02786"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM7"
FT                   /protein_id="EEQ44516.1"
FT                   /translation="MHEEIDHTLTSSSTTGSASFNKRSNFQFTYDSETHLLLLIHKYKE
FT                   DIFTRGNIIKTWEKVLQEFNERCHSNIVQSRTINHRFQMLKKNLENRLKHDNQLLDQVV
FT                   LNENEKLLVDILEYMYKNSHTEVSPYSLGGSSNNSNIAANTQIDSLYAQQNPTAPIDNP
FT                   LAIADMSQISPNTYEHKLNRDRAQYLMSQGFDHSIHHQFQNSMDFSNTIRQHQLAPSSG
FT                   NSSLGANKNIVSGYVPSLEQPELINTSNQIGHPEETMLQPHPNNQASSHIIYKQPEINM
FT                   STSESPNLQHNSQHQPRHSNSSTPMGSSASTSHHQQQQQSSHDTKQNFGNNISPSIQYN
FT                   NNTNTRTIDFAYRQDQNQDQNQNPQQHQYQTQPQQDNTTVSLLKQLIVSQTQVTHSINA
FT                   LREDLSDFKRETNQRIDRLTSDYSLQQNNSMNQKLDSLIRMLRSQNLKSVHSSPTDEDM
FT                   TNENDSSYGADQGTSSD"
FT   gene            complement(<985419..>987308)
FT                   /locus_tag="CAWG_02787"
FT   mRNA            complement(<985419..>987308)
FT                   /locus_tag="CAWG_02787"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(985419..987308)
FT                   /codon_start=1
FT                   /gene_family="HOG000184377" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQM8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM8"
FT                   /protein_id="EEQ44517.1"
FT                   /translation="MRILCVAEKPSISKEVANILGGGRKKVRNSREKFIKNYDFTFTFN
FT                   SEDGPCQVTMTSVAGHITGLDFGSAFSWGNCVPGRLFEADIETIITKKSIYENIAEEAR
FT                   NADKLMIWTDCDREGEYIGFEIMNAARKYNRNLGLNNIWRARFSHLERNHIIRAAKNPV
FT                   NLDMSAVSAVSCRMEIDLRVGTSFTRLLTDQLRQKGIIEKNELASYGTCQFPTLGFVVD
FT                   RYKRVKSFTPEPFWYIEIETRKENKKTIFNWVRGHFFDKMYVVMLYDRCCKSGEFGTIS
FT                   KIESKRKPNFRPFPLTTVELQKDCARFFKMSAKTALAAAERLYNLGYLSYPRTETDRFA
FT                   KETDFKSLLEVHKQDPRWGSYTTKLLNEGFETPRSGSHDDKAHPPIHPIKYVSLDTLNT
FT                   LDEKKVYEYVVRRFIACCSKDAVGTQTVVTLKWGDEFFTASGLMVHEKNYLEVYTYKKW
FT                   ESSKQLPKFTEGEQVKLSSGVLKDGKTSPPNHMTEPELIALMDANGIGTDATIAEHINK
FT                   IETRHYIDKLKKGKNEYILPTPLGMGLIEGLEKMEFEDVSLSKPFLRKSLERSLEEIAT
FT                   GSRPKVDVLNTTIGVYVDAYSVCSHQILVLCNECRRIILGNSSNNNNNNNNNT"
FT   gene            <988005..>989837
FT                   /locus_tag="CAWG_02788"
FT   mRNA            <988005..>989837
FT                   /locus_tag="CAWG_02788"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        988005..989837
FT                   /codon_start=1
FT                   /gene_family="HOG000093910" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02788"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQM9"
FT                   /protein_id="EEQ44518.1"
FT                   /translation="MASSNNGFESINLASTISGPYQEEDTPIKRLHSIPASTSEDEDEL
FT                   DPEEFILNKVDKPATKDSHVSYNKFSDKHISDEQLSHLLDNHKPNLVTTTTLIDSIKES
FT                   ESLYNTMDSLMIKSINFPAAMYQSNDNNSQSPIEYLSNRVKLLTQELYEDSVKYGKFLQ
FT                   SGNNHIYQLRSRILQTFDQLSESHYSLNELYNKDMSYAETLHGSFKKWDQQRNKVLSKV
FT                   KSIKSDTSKHGAKLFTLLDEVNDVDDEIKLLEAKLQQLRSKKEILNKEIEDTSSVLESR
FT                   TAKYVDIFKDLENKGRSAITDFLQSNGVPEKEIDTIVRFSPVDITISSNYSSKKEPKKE
FT                   IHITKESIPQNESASKPANTPSIGMQPFIIPEAEANTKTSDLQSMNHDHGPTPFEKGYA
FT                   MGTQNSTALKNKMNHIMKKFLDSLPTTPSSNISTMPATSRIKVDDLSNTISKRLDLDPI
FT                   MVFLEHKVAALHDLAIKSSQNAALFHEFGRIWESVTKLMNSQEEKLESILNDDSNSKLV
FT                   TRILNSTLEQLNSTLSALKNNPVTSGSPQDEVLISLITSEYNAIEQAVKLVSPGLRTIG
FT                   ELNSSGGLPPSSSKPTSQVYPVSTSDTKSTTKME"
FT   gene            complement(<989969..>996025)
FT                   /locus_tag="CAWG_02789"
FT   mRNA            complement(<989969..>996025)
FT                   /locus_tag="CAWG_02789"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(989969..996025)
FT                   /codon_start=1
FT                   /gene_family="HOG000246755" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02789"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQN0"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN0"
FT                   /protein_id="EEQ44519.1"
FT                   /translation="MSHPVTPQSGVETQKPPEYDNLVKLINLSLSEPGNSPTHETAIKQ
FT                   TIEYLRKYKNDPHWFCRPYMYPIACYSLILFSFPNNPVLEELKVYIGKSLSTCPYCLRA
FT                   FAIAKTHLRNGFITMKKTPIVNVNQFLKAITTWEAALVQPCLNLVYNSLETIEKVQKQL
FT                   HHCRDWFMSNPDLLRYYKDNKEKFAHIVKVLCASGKLPSPGTLFAGLVYLLFEGSGEEK
FT                   LWACQWMEEMRQQKIRYNKSSLEEPLVVEFSIHLYRIQDAKYFNDGTAIKFWEIFYKIF
FT                   DFMDDEAFILRFNTPKDIGAMSQYMNLKLSSIINVLCNSLMSNLAAPLPILLKVFTKLL
FT                   SRFGSKLYRHTAPFPPATLLTGILGNPEFSKQLILSASEKSSMNDYSFQDFTDWIFLFI
FT                   NSLSGSQKQNASMKIGAYLLRQGNGYASSTNDLRSQRVNTLKEFGVKIFAGLFPSTVID
FT                   MNPKDPKLSVEIMSFRDVRAALEYEANTILSCAMNSPQNVDAMDLVRRCLIYDVLILVK
FT                   NSYLLSKGEIPNMFDTFPIFWSSILKSKLYSNVSLVKVIIQCLRLMPMAIKFNEIKYNQ
FT                   ANKDLESAKTQHNKSMNTICDLQNQIFSSFSLCDPENIKQIINDFDCAESVWGCIFTPL
FT                   ISQAALDFMNEVYNASGRLETFQECFSNNLKSSLVSININLANLTSLACYEPTPKAIRI
FT                   IMDIIKALADPVDSSLSTSAANCEGEVVLFWKNCWTFLIMVFKETFVWANQFHLDELLE
FT                   FARDTLDLSHLLLDSFRFIVDTLKEQTNKDMSYEFFGSFMNAFQHIIVWLKLGDLSLLN
FT                   SCVELVIKGFDLASEEDFKVQDQIVEQLWKYSKKVKGHNNKLSESQRMMLMTKARELNE
FT                   ALVETMEREESEQKYARAGAKAEPKLRPADDEIQELRPEEFAKKINKKQQTLEGFVSFT
FT                   NKAPVAPAPKEVKGTQNLDSIRQKLQQSRSSITGPPKSHLNPAPPRPAGFNSKKSPPPA
FT                   PSVAIGRPLHAVKKKTTDSESSSEDESDTDLTDLFVEGKAKKIAKITEVDMNLKTIDRS
FT                   NLQKRRKQIDEAKMAKERMRLRLNVNLKPLYLTVLRWNYNSKSDFPSKDKSIYQEIKDT
FT                   YKDVKDYVQVTEPLLMLECWQAMQSAKLTVDEKPFELLIGSRTSVDGFFDVFASMEKTV
FT                   LQDRKIGDSDLVVLALKDESLQHASDIRRYIKADGTMTCLAKVQDTKYTNSDYCDVVLR
FT                   VYPSGPMMGALTPKSVVTGMKVMQMVTIEREFSSLKGLQYYDLADSIISATPNKPIEIE
FT                   EEDAKKMRKIYHVNDSQARAIMGTFKSEGFSLIQGPPGTGKTKTILGIVGYSLSQEKNN
FT                   KVIDISGSGSSPTPSDKAKILICAPSNAAVDELVLRLRDGVRNSSGEHMPLKVVRLGRS
FT                   DAINSSVRDLTLEELVDKELQTKQTEVVIDPNIRLEHTKCINERDELRKRLATESLEEK
FT                   EITELEEKIRAINKKRSELAKKLDEQREKASIANRTKEINRRNIQARILSEAQVLCSTL
FT                   SGSAHDLVANLSVQFDQVIIDEACQCLELSAIIPLRYGCKKCIMVGDPNQLPPTVLSQA
FT                   AASYNYEQSLFVRMQKNHPDSVYMLDVQYRMHPMISKFPSSEFYNSKLKDGDGMLELNT
FT                   RPWHKDPPLTPYRFFDILGKHEKNELTRSLFNTDEAIVALQLTDKLMQLLPQDRFSGKI
FT                   GIISPYKEQIRKIKEVFVRKYGKPILDEIDFNTVDGFQGQEKEIIIMSCVRASATGNVG
FT                   FLSDVRRMNVALTRAKTTLWILGNKDSLSRNEVWKKLLTDAGERNCITQAYPGFLNPSN
FT                   PNPGLKRKEENVFTPQQTKFAKKQKVSNESERNVHKIRNNLTKPTYRPTNAGVLPSKSK
FT                   SSNGNNKPDYSANNLQSSAKQSNKDTKSNTTDDAPKPYINQPKPQGDPKNGPTRSGTIS
FT                   KPSTTSTPAPTSSGTVKPNKPVDAGKSAPKDSTTPQNKSVNSSTPSVKSTDAAKKPTKT
FT                   VAPSSSGVVKPPSNLFIPRKRPFAKK"
FT   gene            complement(<996373..>998523)
FT                   /locus_tag="CAWG_02790"
FT   mRNA            complement(<996373..>998523)
FT                   /locus_tag="CAWG_02790"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(996373..998523)
FT                   /codon_start=1
FT                   /gene_family="HOG000246753" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQN1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN1"
FT                   /protein_id="EEQ44520.1"
FT                   /translation="MEEKKKIRRSRNGCHTCKRSKIKCDENKPTCSYCSKTKAICDYSL
FT                   KLTWGGRPFKDANKRKQLPSVKKEVQPMLNDFPVMTSTSLSTSITNSSNTKGDTGLTFI
FT                   LHEFNTESIKSPSSPSESVSSHIDPPAPHRNGKRKIIEIDSIADSEIKKRDTHMTLTDI
FT                   IPELNNGIENLTNALIDFGGQQFQLQNSDIFSTYIQNPQRYMGVTQYGSDSDSSATSFL
FT                   NNYSEDISRIDKYLPNDQSNLIGDTFPMRSLYSSINESPTSVDIWDSIPPSLTPLPTLL
FT                   LNVPFYRNLMHFWVTVASQNLVPAPSSIYKDNPYKILLTQMAMEYPAILNTLLAFSAKL
FT                   RSSLIGTDDTPDIVIDQLLSRSCTELLQLLKDESKATSDEALATALLLSCYEVFNSKDF
FT                   SRHRAHNIGARQIIKARSNTPHKRGPEAGTESDMTFFLMRWFVYTDVIGALSSTTDSHD
FT                   YLLTSNDLSTYEPLESLTMLHEIDKMEDETQYPKKTIDYLMGFNIKFLPHFTKITILVR
FT                   ETNAHLGKTKASAANLPLEIVYKALEVKEALIETQRKDEESILQSHEKIIELKSGNGQQ
FT                   LYADDLPQETVTLIRENDILRFTNKIFCDAGLIHLYRRVLLIPRESNLVQDLANGIGEL
FT                   AKLHIESRSPADICCIFCLFTAGCEVLCPEMQQFFEKRFQNLGQMGNINARKGLQIMKR
FT                   CWKTNEDWITAAEKIGVDLTLL"
FT   gene            complement(<999190..>1000227)
FT                   /locus_tag="CAWG_02791"
FT   mRNA            complement(<999190..>1000227)
FT                   /locus_tag="CAWG_02791"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(999190..1000227)
FT                   /codon_start=1
FT                   /gene_family="HOG000185254" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN2"
FT                   /protein_id="EEQ44521.1"
FT                   /translation="MDSFSQKVKTFDAFPKVDPQHQVRSQRGGLSTLLTYFCGLLILWI
FT                   EIGGYIGGYVDRQFTVDDQIRSALTINVDMIVAMPCQFIHTNVEDITHDTYLAGETLNF
FT                   EGIHFFVPDSFKINNPNDFHETPDLDEVMQESLRAEFRSEGARVNEGAPACHIFGSIPV
FT                   NQVRGDFRITGKGFGYRDRSHVPFESLNFSHVIQEFSFGEFYPYLNNPLDATGKVTEER
FT                   LQTYMYYAKVVPTLYEQLGLEIDTNQYSLTENQHVIKVDQSTHRPDGIPGIYFLYDFEP
FT                   IKLVIREKRIPFFQFIAKLATIGGGLLIAAGYLFRLYEKLLFIFYGQKAVQQNREQKTG
FT                   GLLDI"
FT   gene            <1000535..>1001983
FT                   /locus_tag="CAWG_02792"
FT   mRNA            <1000535..>1001983
FT                   /locus_tag="CAWG_02792"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1000535..1001983
FT                   /codon_start=1
FT                   /gene_family="HOG000246752" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02792"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQN3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN3"
FT                   /protein_id="EEQ44522.1"
FT                   /translation="MNSENQRTTDDLDEFSDDIRVQELQSCKYIYPDCEIDLSSLSGTV
FT                   NIKVKSDNDITIRLIERTSKGTRIIATNKISNLPPIVLNFQLSADYPFVAPPEIKMTCV
FT                   WLATSKTDLLTKDLYDIWKDYRDQVLFNLIDHLQDQVQNHLDVLIPAPFDIFDIDEYYK
FT                   VVDFNIEAEIEEFNSQTYTCDICQKTLKGLHCTKFDSCGHVFCNNCLAEYFESCIESGD
FT                   IDKVHCPDFECTKKYVDKKKKFMELETWVHNDKKVKDMLNQLLIPSIPLAMLTKILKSP
FT                   SLVDRYYNLFKKSQYEWIGNLLPNRLVKCPRVGCDEVIFREDIDEKLVVCPKCKYAFCN
FT                   DCRKSYHARFKLCSKINENDKYSGIPIEDLEAYPLLPADSYDKKIMNAKYGRKRIDRAI
FT                   EEYQMDQLFQQMMRERKTVVQCPGCSVATEKSEGCNKMKCSLCKTDFCFNCGSKIGNNH
FT                   DHFVDPSSPCYKLLFFGMPGTEDI"
FT   gene            complement(<1002029..>1003795)
FT                   /locus_tag="CAWG_02793"
FT   mRNA            complement(<1002029..>1003795)
FT                   /locus_tag="CAWG_02793"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1002029..1003795)
FT                   /codon_start=1
FT                   /gene_family="HOG000246751" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02793"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN4"
FT                   /protein_id="EEQ44523.1"
FT                   /translation="MDTTDQSSDSLQQSPSISSSISSNSYKDFAIDVLNKAVVKGNSIA
FT                   ESNPGSKRAIAISTASTIVEMSLEKYSSSNLSSRRSGRSGSIDLTDEQISQIESVPSSA
FT                   DDNGDGNKRKSGHFADRMIEKLLKSVLPQDIPEREIFEKRLNDPERNKRPGLSFGILTS
FT                   NVKQMAGKMTNFFALQYEVLYIIAWKKPTKTISALVLYTAVCLWPHLVLAYPLLFVLFG
FT                   VLIPGFVHRHPQRNPELIKVKKRGQSLLSFLFETPETSIVEDLINEEYLQASDEVASST
FT                   YSISEETSEVTVSSSMPTDSESPKKDDVAKHRKSQIALLINLRDFQNLTTDILKGINNA
FT                   EKFYYETGGFKDERLSTFIFYGVLLSTFGILFVGKYVPWRLIFIQGGWTGAILCHPNCK
FT                   KFLVDASKARKARAAIEKAKKEEKSVPEIIIEEADDTVTQFDRNDIIVDDSPEARTVEI
FT                   YELQIKSILKHSWTFYRYSTTIYDKNNKARIAGKRPPGVDHLSKVYPPNDWKFDFGLVN
FT                   KWNLDTKPKEFLRERSLNPSLFIVKNDESQGWIYDNMEGIVHSDIVYEFRRRRLYRECY
FT                   RYGRPHKQPSKY"
FT   gene            complement(<1004283..>1005560)
FT                   /locus_tag="CAWG_02794"
FT   mRNA            complement(join(<1004283..1005068,1005543..>1005560))
FT                   /locus_tag="CAWG_02794"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1004283..1005068,1005543..1005560))
FT                   /codon_start=1
FT                   /gene_family="HOG000197305" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02794"
FT                   /product="hypothetical protein"
FT                   /note="similar to 38K ribosome-associated protein"
FT                   /db_xref="InterPro:IPR019084"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN5"
FT                   /protein_id="EEQ44524.1"
FT                   /translation="MSFQNKNLYDLLGNDVEEDAAPSAPSREVVKKNTSSKKSDAAPAS
FT                   ADPAKAKKKKSPTGNEAALKNKNFNKDVAPPQSTATKHSKKPFDRHSRTGKTDSKKKLQ
FT                   QGWGQSDKRELEGEVEGTEDAEAELEAEAEENDESANAIPKKSLQEYLAELELSKQELE
FT                   GSKKLRQANEGAEQKWTAEEKIEKQQEVFFASTHTKKAKSKAQKEKVFLDIDANFGDEQ
FT                   PQTTRGGFRGGKRGGARGGSRGGAKRGGARGAAKPEVNDKNFPSL"
FT   gene            complement(<1005916..>1011435)
FT                   /locus_tag="CAWG_02795"
FT   mRNA            complement(<1005916..>1011435)
FT                   /locus_tag="CAWG_02795"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1005916..1011435)
FT                   /codon_start=1
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02795"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQN6"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN6"
FT                   /protein_id="EEQ44525.1"
FT                   /translation="MSEQEEETASKSQEIETPSESIEKNGQKENTTTDNTSNGNKKSDD
FT                   SLQPATEEELHQPENVVQETTNIEDVVEDTVPTSDDTDSPKNTENNKPNTETDNAFNAN
FT                   IEGTPRSINSPESVPDTVITPAEDVSVQSTPRANHNRQSSILSISSNATVDNAQIFKKT
FT                   FDIILTSKEAKKDDSFKNLIQTALDSLNDPESKNPQIIFNALKACCDTSSTNLKSKAID
FT                   LFAKLFDYAQFDDYSEQVKLTDDSVSVISACFEGEGTDPELEVQVVRALMHSILLMPCH
FT                   GASLLQAVRQIYNVFIFSLTARNQAVAQGILTQVIGTIFQRVEESVKNKSKRNSTPRLT
FT                   SSSSDDNLEIQASDETENQEKLTLKRLENLNDVINDNDRLNEANFATETDEDLAVKDAF
FT                   LVFRAMCKLSIKSLDSATIDMKSHSVRSKLLSLHIVHTILKDHIDIFLSHDVIILSSNT
FT                   NEHVRMVNAVRQYINLALSKNAASALAPVFELSLEIFWLIISNLRAEFKREIPVFWDEI
FT                   YFPVAEMKTSSAHQKRYLLSIIERLCNDSRCIIEFYLNYDCDSNMPNICEKLIDYLTKL
FT                   SLQRVEVTPQQKYAYRENRRNGISVYDINKISNLTSKTMSSRPPEPEIYSQFPLEYALK
FT                   MTSIGCAVAFLRSLYSWAQRGLTNANSKQFTIDNNNKSLSSLRNRSDSTNTSISASRNH
FT                   SFINGDSLTDSDNPQQFENQKQRKKAFLEGVRQFNQKAKKGLRYFIDNGFIAADDPKDI
FT                   AKFLLTTDGLDKATIGEYLGEGDEKNIAIMHAFVDEMEFEETGFVDAMRRFLQSFRLPG
FT                   EAQKIDRFMLKFAERFVLGNPEVFSNADAAYILSYSVIMLNTDLHSPQIKNRMTIDSFI
FT                   MNNSGIDDGKDLPREFLEKIYDEIQNNEIKLQSEQHAALLAGDLSIPASGQSIGFFGGR
FT                   DVTREAYIHASKEMSTKTEKLMRNLGKKSKSDDSEGVFYAASNVLHVKSIFDTLWMSIL
FT                   AALTPPFKEYDEEDVSRTCLEGIKLSIRIACMFDLNYAKTSFISALVQFQNLHNYEEMK
FT                   QKNIDSIYIMLELAVSEGDHLGRDAWIQILTSISQLERLQLIAQGVDQDSIPDVTIAKL
FT                   VTRNSLETSRTSGSFFRSFSSSQTPSQTAASKFHNQQLSPEVASLLTKTELEVAIDKVF
FT                   TNSANLSGESIVQFVRALSEVAQEEIDSSGQSTNPRTYSLQKVVDICYYNMSRIRLEWS
FT                   QLWAAMGETFNAVGCHTNPAISFFALDSLRQLSMRFLEIEELAHFKFQKEFLKPFEYII
FT                   LHNDSLEVKDMVLECINNMILARADKIKSGWKTIFGVCTAAAKENKESIVMKAYKMANW
FT                   INKEYVEEVRLQDSFSDLVVCFTVMAKNEKFQRVSLLSLDVLSRLIHEIAQYTVLNTGE
FT                   DNKPIVPDIEKNEHLVKLWFPVLYGFHDIIMTGEELEVRSRALTYLFDVLMKYGQYFDF
FT                   EFWKIICENLLFPIFHVLSNHWEIGLDDINDQLSVWLSTTLIQALKSMMTLFTHYFDAL
FT                   NSFLDGYLELIISCICQENDTIARIGRECLISLLIDNAQNFNNEHWGKVSDALSNLFEL
FT                   TTAKELFTSDPLRNRTVKDSEGSSSDIGGEDVEHTESKNSIIDDAEERLKKSKDKSSIV
FT                   VKSVLQLLLIQSLSELFESDDFYENVPYDYLFKMAKLLFKSYNFAKKFNDDYDLRVRLW
FT                   NAGVIERLPNLLKQESSSAAVFINITFRMYCDDDKASPANKQSLLDYLVPLCNTIVERY
FT                   SELDETNQQRNISTWKPVIVEIYEGYVELDDDDFTKHCPALYHLTLKLFSKSMSSELRL
FT                   AIKAFLTRVGEEFVSISDNNKERR"
FT   gene            complement(<1011770..>1017367)
FT                   /locus_tag="CAWG_02796"
FT   mRNA            complement(join(<1011770..1014529,1014533..1015008,
FT                   1015012..>1017367))
FT                   /locus_tag="CAWG_02796"
FT                   /product="fatty acid synthase alpha subunit reductase"
FT   CDS_pept        complement(join(1011770..1014529,1014533..1015008,
FT                   1015012..1017367))
FT                   /codon_start=1
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02796"
FT                   /product="fatty acid synthase alpha subunit reductase"
FT                   /db_xref="GOA:C4YQN7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN7"
FT                   /protein_id="EEQ44526.1"
FT                   /translation="MKPEIEQELSHTLLTELLAYQFASPVRWIETQDVFLKQHNTERII
FT                   EIGPSPTLAGMANRTIKAKYESYDAALSLQRQVLCYSKDAKEIYYKPDPADLAPKETPK
FT                   QEESTPSAPASAGPVESIPDEPVKANLLIHVLVAQKLKKPLDAVPMTKAIKDLVNGKST
FT                   VQNEILGDLGKEFGSTPEKPEDTPLEELAEQFQDSFSGQLGKTSTSLIGRLMSSKMPGG
FT                   FSITTARKYLESRFGLGAGRQDSVLLMALTNEPANRLGSEADAKAFFDGIAQKYASSAG
FT                   ISLSSGAASGAGAANSGGAVVDSAALDALTAENKKLAKQQLEVLARYLQVDLNKGAKSF
FT                   IKEKEASAVLQKELDLWEAEHGEFYAKGIQPTFSALKSRTYDSYWNWARQDVLSMYFDI
FT                   IFGKLTSVDRETINQCIQIMNRANPTLIKFMQYHIDHCPEYKGETYKLAKRLGQQLIDN
FT                   CKQVLTEDPVYKDVSRITGPKTKVSAKGNIEYEETQKDSVRKFEQYVYEMAQGGAMTKV
FT                   SQPTIQEDLARVYKAISKQASKDSKLELQRVYEDLLKVVESSKEIETEQLTKDILQAAT
FT                   VPTTPTEEVDDPCTPSSDDEIASLPDKTSIIQPVSSTIPSQTIPFLHIQKKTKDGWEYN
FT                   KKLSSLYLDGLESAAINGLTFKDKYVLVTGAGAGSIGAEILQGLISGGAKVIVTTSRFS
FT                   KKVTEYYQNMYARYGAAGSTLIVVPFNQGSKQDVDALVQYIYDEPKKGGLGWDLDAIIP
FT                   FAAIPENGNGLDNIDSKSEFAHRIMLTNLLRLCAVKSKKTTDTRPAQCILPLSPNHGTF
FT                   GFDGLYSESKISLETLFNRWYSEDWGSKLTVCGAVIGWTRGTGLMSANNIIAEGIEKLG
FT                   VRTFSQKEMAFNILGLLTPEIVQLCQEEPVMADLNGGLQFIDNLKDFTSKLRTDLLETA
FT                   DIRRAVSIESAIEQVVNGDNVDANYSKVMVEPRSNMKFDFPTLKSYDEIKQIAPELEGM
FT                   LDLENVVVVTGFAEVGPWGNSRTRWEMEAYGEFSLEGAIEMAWIMGFIKYHNGNLKGKP
FT                   YSGWVDAKTQTPIDEKDIKSKYEEEILEHSGIRLIEPELFNGYDPKKKQMIQEVVVQHD
FT                   LEPFECSKETAEQYKHEHGERCEIFEIEESGEYTVRILKGATLYVPKALRFDRLVAGQI
FT                   PTGWDARTYGIPEDTISQVDPITLYVLVATVEALLSAGITDPYEFYKYVHVSEVGNCSG
FT                   SGMGGVSALRGMFKDRYADKPVQNDILQESFINTMSAWVNMLLLSSSGPIKTPVGACAT
FT                   AVESVDIGIETILSGKAKVVLVGGYDDFQEEGSYEFANMNATSNSIEEFKHGRTPKEMS
FT                   RPTTTTRNGFMEAQGSGIQVIMTADLALKMGVPIHAVLAMTATATDKIGRSVPAPGKGI
FT                   LTTAREHHGNLKYPSPLLNIKYRKRQLNKRLEQIKSWEETELSYLQEEAELAKEEFGDE
FT                   FSMHEFLKERTEEVYRESKRQVSDAKKQWGNSFYKSDPRIAPLRGALAAFNLTIDDIGV
FT                   ASFHGTSTVANDKNESATINNMMKHLGRSEGNPVFGVFQKYLTGHPKGAAGAWMLNGAI
FT                   QILESGLVPGNRNADNVDKLLEQYEYVLYPSRSIQTDGIKAVSVTSFGFGQKGAQAVVV
FT                   HPDYLFAVLDRSTYEEYATKVSARNKKTYRYMHNAITRNTMFVAKDKAPYSDELEQPVY
FT                   LDPLARVEENKKKLVFSDKTIQSNQSYVGEVAQKTAKALSTLNKSSKGVGVDVELLSAI
FT                   NIDNETFIERNFTGNEVEYCLNTAHPQASFTGTWSAKEAVFKALGVESKGAGASLIDIE
FT                   ITRDVNGAPKVILHGEAKKAAAKAGVKNVNISISHDDFQATAVALSEF"
FT   gene            complement(<1018346..>1019662)
FT                   /locus_tag="CAWG_02797"
FT   mRNA            complement(<1018346..>1019662)
FT                   /locus_tag="CAWG_02797"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1018346..1019662)
FT                   /codon_start=1
FT                   /gene_family="HOG000093911" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02797"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQN8"
FT                   /protein_id="EEQ44527.1"
FT                   /translation="MNSKSQPCIYPKRYKKTKTNMLFQLPPEIMEIVLDNLHQRELLQI
FT                   SQINKYFRHLTLLRQYSVISIDSSPKLFQRDTKSLNDFQELRGVYQLDSYSIRAVNISS
FT                   VYCLKLFFKTLIENPQYGGYIKIFHVEHLPDIPDLHVVEFLQRVLPLMNRLKEFHWNHS
FT                   YPVSMKLLQYNLELTAVSGNILCDNINMDAYPLLNEAVLTVTDFHLPLRKLTIKNVDLN
FT                   NISVNTTLLKSLTIENCSNEKDFLIKLDAPRLEDLSLSIEDQPFFAKMFSQLHLKSLKL
FT                   SIPEQCEMLKVSHILNFLNKDISRLEISNQPDSHSYKILPKFNNLDYLHLSVLEKDIYK
FT                   LLSSLTKKLRFLSLNVLEATERRNCLIASEFWECSMIDENQLKYTDFTLEYHRKLDRLK
FT                   WLRFQGNDTTYIFECNESEPIIFRDGFYHYFDRIVNTLI"
FT   gene            complement(1020048..1020134)
FT                   /locus_tag="CAWG_08066"
FT   tRNA            complement(1020048..1020134)
FT                   /locus_tag="CAWG_08066"
FT                   /product="tRNA-Lys"
FT   gene            <1022420..>1023757
FT                   /locus_tag="CAWG_02798"
FT   mRNA            <1022420..>1023757
FT                   /locus_tag="CAWG_02798"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1022420..1023757
FT                   /codon_start=1
FT                   /gene_family="HOG000246749" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02798"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5ANF0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANF0"
FT                   /protein_id="EEQ44528.1"
FT                   /translation="MFNTKIFENTGSSGSTTAMNIPVQSEPSNTNSAQPQPIDITFNHR
FT                   PSVFNNSRFRRDSVAHSQGMGGISWGSVTIGSWLKDEVMMASGGNNNHLNPHYHPTQSH
FT                   NNQSSYPNYSQQQQQQQQQSQHQQNLINPRRGSFRTSNHPNLSPHLQTSYLPELEADYC
FT                   KDYNCCGELLPTLHDLLRHYEEAHISASPPPDQNHFILNSRNRNNYNNAHNVMETVSTT
FT                   DVFLNNNHNNHHAPTMHPSATTTNYNGNNSFGNQQAHQILQQHDQQQQQQQQQQQQQQQ
FT                   NQNQLHHNSDNYQHSSQSTSRQPGQQFGQGNSHFGPQQQSPSSGSQGGGTPMQTDEDDM
FT                   YIDDPARHLYVMENEENKPFKCPVIGCDKTYKNQNGLKYHRQHGHQGQNLRENPDGTIS
FT                   IIDPDSNCPYLDNAALEKDKPYRCEVCGKRYKNLNGLKYHRGHTTH"
FT   gene            <1024660..>1026280
FT                   /locus_tag="CAWG_02799"
FT   mRNA            join(<1024660..1025590,1025679..>1026280)
FT                   /locus_tag="CAWG_02799"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1024660..1025590,1025679..1026280)
FT                   /codon_start=1
FT                   /gene_family="HOG000033911" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02799"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP0"
FT                   /protein_id="EEQ44529.1"
FT                   /translation="MAISRSLITETSNRFIPSSSSTSVYKTRHKNELQSSYQSHENLDN
FT                   NIPHANLSIRDDSLFTHSTSSISSNTHFQSSSSSIGSSSAIKRVTLGSTKPSDLHQKIV
FT                   AEALNFVSSSKVLKFDNKSRSKKIQNRIDAKLVESLTIAEREVSVDAGKSRSTSSIKTI
FT                   IATDILQAPGLRNDYYSNLVSWSFKTNRVAVGLGSKIYLWGVDNNVTQINHSNEDLVTA
FT                   VSCSKEYWILVATAGGKIILMDQQSNSVVSEYTNNEGKCIFCFAWFDKSNMFIAGDDFG
FT                   EVYIFKIHKLFNVQIELVRVFKCHQQQICGLALNGKNDEIAVGANDNCCTIWSIKDFSA
FT                   PVLKFVLPHNAAIKALCYCPWTVSLLATGGGSKDRKIRFWHTSSGTLLSEYYTDGQITS
FT                   LIWSRFRKEIVATFGFGGTSKSNLLCVYTYPQMQPILEVNAACNLRILSATLSPDYCSV
FT                   CVATNDSTIRIYQLWEGSLEILPSATQRIMGAFGSDIIELLEGISKTGDVIR"
FT   gene            <1026649..>1027506
FT                   /locus_tag="CAWG_02800"
FT   mRNA            <1026649..>1027506
FT                   /locus_tag="CAWG_02800"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1026649..1027506
FT                   /codon_start=1
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR020473"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP1"
FT                   /protein_id="EEQ44530.1"
FT                   /translation="MSAALVNRSLTTIRTELEFLKDSDVITEGLYEKLLQSLPTKYQKD
FT                   SAPWDVDRIAGGSSGPEKVQNKSAADVLADDFSKTNISAPPPAYPPAQPPRSAAPKPVG
FT                   YCIATYDYKAQQAGDLDLSKGDKLAVVEHLSEDWWKGYKSDSSPEKTGVFPSNYVKIIS
FT                   QLEFEADERKAAPPAPVQSPSYEQNGYSAYGPPATYPPQQLQQQPSYGGYAQYPPPSTN
FT                   YYPPQQYQQPQQPQQSQQVVEQQPEQQHSSGSEHVKKFGSKLGNAAIFGAGASIGSNIV
FT                   NSIF"
FT   gene            <1028971..>1033470
FT                   /locus_tag="CAWG_02801"
FT   mRNA            <1028971..>1033470
FT                   /locus_tag="CAWG_02801"
FT                   /product="suppressor of toxicity of sporidesmin"
FT   CDS_pept        1028971..1033470
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02801"
FT                   /product="suppressor of toxicity of sporidesmin"
FT                   /db_xref="GOA:C4YQP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP2"
FT                   /protein_id="EEQ44531.1"
FT                   /translation="MSTANTSLSQQLDEKPWLDASDNSSVQEYQGFDATASHNIQDLAR
FT                   KLTHGSTNGDHHSANDLARYLSHMSDIPGVSPFNGNISHEQLDPDSENFNAKYWVKNLK
FT                   KLFESDSDYYKPSKLGVAYRNLRAYGIANDSDYQPTVTNALWKFTTEAINKLKKPDDSK
FT                   YFDILKSMDAIMRPGELTVVLGRPGAGCSTLLKTIAVNTYGFHIGKESQITYDGLSPHD
FT                   IEHHYRGDVIYSAETDVHFPHLSVGDTLEFAARLRTPQNRGEGIDRETYAKHMASVYMA
FT                   TYGLSHTRNTNVGNDFVRGVSGGERKRVSIAEASLSGANIQCWDNATRGLDSATALEFI
FT                   RALKTSATILDTTPLIAIYQCSQDAYELFDNVVVLYEGYQIFFGKASKAKEYFENMGWK
FT                   CPQRQTTADFLTSLTNPAEREPLPGFEDKVPRTAQEFETYWKNSPEYAELTKEIDEYFV
FT                   ECERSNTGETYRESHVAKQSNNTRPASPYTVSFFMQVRYVIARNFLRMKGDPSIPLISI
FT                   LSQLVMGLILASVFFNLRKSTDTFYFRGGALFFSVLFNAFSSLLEILSLYEARPIVEKH
FT                   RKYALYRPSADALASIISELPVKLLMTMSFNIVYYFMVNLRRTTGNFFFYWLMCALCTL
FT                   VMSHMFRSIGAVTTTIATAMSLSTVFLLAMIIYAGFVLPIPYILGWSKWIRYINPVTYI
FT                   FESLMVNEFHGREFECGQYIPSGPGFENLPVENKVCTTVGSTPGSTVVQGTEYIKLAYQ
FT                   FYSSHKWRNFGITVAFAVFFLGVYVALTEFNKGAMQKGEIVLFLKGSLKKHKRKTAASN
FT                   KGDIEAGPVAGKLDYQDEAEAVNNEKFTEKGSTGSVDFPENREIFFWRDLTYQVKIKKE
FT                   DRVILDHVDGWVKPGQITALMGASGAGKTTLLNCLSERVTTGIITDGERLVNGHALDSS
FT                   FQRSIGYVQQQDVHLETTTVREALQFSAYLRQSNKISKKEKDDYVDYVIDLLEMTDYAD
FT                   ALVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSICKLMRKLADH
FT                   GQAILCTIHQPSALIMAEFDRLLFLQKGGRTAYFGELGENCQTMINYFEKYGANPCPKE
FT                   ANPAEWMLQVVGAAPGSHAKQDYFEVWRNSSEYQAVRKEINRMEAELSKLPRDNDPEAL
FT                   LKYAAPLWKQYLLVSWRTIVQDWRSPGYIYSKLILVISSSLFIGFSFFKSKNNLQGLQS
FT                   QMLAVFMFFVPFTTFIDQMLPYFVKHRAVYEVREAPSRTFSWFAFIAGQITSEIPFQIV
FT                   VGTISYFCWYYPVGLYANAEPTDSVNSRGVLMWMLLTAFYVYTSTMGQLAISFNELIDN
FT                   AANLATTLFTLCLMFCGVLAGPNVIPGFWIFMYRCNPFTYLIQAILSTGLANAKVTCAP
FT                   RELVTLKPPMGETCSSFIGPYTEAAGGYFSTNSDGTCSVCRIDSTNQFLESINALFSQR
FT                   WRNFGIFVAFIGINIILTIFFYWLARVPKGNREKKLKK"
FT   gene            <1033826..>1036342
FT                   /locus_tag="CAWG_02802"
FT   mRNA            <1033826..>1036342
FT                   /locus_tag="CAWG_02802"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1033826..1036342
FT                   /codon_start=1
FT                   /gene_family="HOG000157224" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02802"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP3"
FT                   /protein_id="EEQ44532.1"
FT                   /translation="MAGSQLKQLKAALKDKGLIGQTNVSQKKSKKKNSQSSTTNNTKNI
FT                   NRDEKLQQLKEIRDQFNKFDQKINRSKHDISIIHQGKFVKVGSKQHNSSAVKNGNMQRQ
FT                   MKMQYDLEKFQHGKTGGILDKRFGENDSHLSKEEKMLARFTKERQSGSSKKRSVFSLAS
FT                   DDEQEPDESDGEDNGGFMLTHGGNALSLDDEETINYVDEDSLQQQPPKKKSKNEVMKEI
FT                   IAKSKFYKQQRQKEFAKTQDQIDELDEDFGDVMDDLRNVQSQISKTTANSGSGKADGVF
FT                   STKTPEQIEYDNKVRELTYDRRAVPAERTKTDEEIRREHEEKMKKLEADRLRRMEEFVD
FT                   DDRDTQGDDLDNDFWAGSDRENDENEADGFTIKNSDQESDSEEEEQDQLPHKRQVKSQK
FT                   ITSVIMPFTIEEFIQEMSNVDPNKQPEYVKKICETYKPNLAEGNKEKMSNFVGILFEYI
FT                   LHIANQYQDFEPFVKILRKLAESSTSSRATTITTTTTTKAYNESLVERVREHIKHIQSR
FT                   IDKQLAPGDLVFFTIIAYLFSSSDHYHIVITPSLILINQILSNIIYHPKTVTDIAHGVY
FT                   LIDVLLMYQRFAKRYDPEIISFIEHALFMMIPEVDKLDTLKLLSISPTAATAGSITVQF
FT                   SMNKSEKICSQEQTLSIKQLYEEDLNKSSLISKLIQLMDKCVTLWKEKSSLIEILESFI
FT                   SILKHITKYNATVAGPILTKFTRLHANLVKDRKPLTLQQHKAIAIATFAPKFEENFNPD
FT                   KKSYDVNRERQELNKVKHELKKEKKAALKDIRQENRFIAREQISEKKRMYDDYHKKMAN
FT                   IVNSIQSEEGAEKNQYERERKQRKRR"
FT   gene            complement(<1037755..>1038267)
FT                   /locus_tag="CAWG_02803"
FT   mRNA            complement(<1037755..>1038267)
FT                   /locus_tag="CAWG_02803"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1037755..1038267)
FT                   /codon_start=1
FT                   /gene_family="HOG000185206" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANE3"
FT                   /protein_id="EEQ44533.1"
FT                   /translation="MLAIGDVILRAFNFVFLVIALGLTGSLAATTITQHNPQINFAVFA
FT                   AAFGLLTSSFYGVFAYFVAAFAWPVILFVFDFLNFVFTFAAATAIAAGIRAHSCSNQDY
FT                   LDDNNIAQGSSGRCRKAQASTAFLYFSTFIFIASAIFSAISLSKGGLFGHSSRPAPRTG
FT                   VPTMSQV"
FT   gene            complement(<1040691..>1041437)
FT                   /locus_tag="CAWG_02804"
FT   mRNA            complement(<1040691..>1041437)
FT                   /locus_tag="CAWG_02804"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1040691..1041437)
FT                   /codon_start=1
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02804"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP5"
FT                   /protein_id="EEQ44534.1"
FT                   /translation="MSNASQSNKFAIHDAIKEGNTLLAKKLIDEQPASKLYISDDDERT
FT                   PLHWAVSFNNPDLVQYILSKTPNDLDIDEYVDGSGWTPLHIAAALGNSTIFNQLMRRAN
FT                   GTTTTSNNSTQPELDVNLQTNSGTTCLHLAISKNNYDIVKELIETYKANCRIKDKKGYT
FT                   PLHRAASIGSTPIIKLLVEKGKININAQDNDGWTSLHHALAEGHGDVAVLLVKLGADPN
FT                   IVNNDGETPVKIAVDDKVAKYFTENI"
FT   gene            complement(<1041835..>1044081)
FT                   /locus_tag="CAWG_02805"
FT   mRNA            complement(<1041835..>1044081)
FT                   /locus_tag="CAWG_02805"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1041835..1044081)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02805"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQP6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP6"
FT                   /protein_id="EEQ44535.1"
FT                   /translation="MKNLSVFPFLTRIMYDASLEDEYYRQMRQKSSSISAFKVGLVAAM
FT                   GGFLYGYDTGLINDLLEMEYVYTHFPSNNKSFTSHERSILVAILSLGTFIGALIAPLAS
FT                   DRYGRKFSIMMSSGLIFITGNILQIASASIALMCVGRFVSGVSVGILSAIVPLYQAEVS
FT                   PKWSRGSVVFTYQWSITAGLLVSSAVCQGTRKINNSGSYRIPIGLQFLWALILFFGMSF
FT                   LPESPRYYVQQDNLQSALDSLCKLRKLPPDDDDLIEELVDIKANYDYELSYGKTTVLDC
FT                   FKSGGGRHKQGLRMLTGIGVQFFQQCSGINFIFYYGVNFFSSTGINNYYIMSFITYLVN
FT                   VIFTVPGIMMIDVVGRRPLLFWGGVGMAVCNFIIAIAGVSVKNDEVNGILCVSFACVFI
FT                   AFFASTWGGCTWALCSDIYGISIRQKAVALTAATNWLVNFIFAFITPYLIDTGQHTAAI
FT                   GSKIFFIWGSFNACGAIFVFFTVYETKGLKLEEVDYMYVNCDNARVSTKFISTKIDFAH
FT                   LDENYNPIPMTQLPDSTSSNEMYHDKGSDENSSPQQLPHHHQQQPLYNGEDQNNLTIIP
FT                   YDNSSTISSVNSIEERRDSIPSTNGLSFTSSSQSHPQSNSYSHSNSHSATYRSKSHNSM
FT                   ISNDYQSYLESIQREYSQHYQNSSAMIKQLSRNSRNNGSDQEERHEPIQKQEIIDSPLN
FT                   INSINHINNIPTTVIATPFFAHPPSDSDSSDDEEEEEVVVEQEGVKINDVTTIK"
FT   gene            <1045258..>1046307
FT                   /locus_tag="CAWG_02806"
FT   mRNA            <1045258..>1046307
FT                   /locus_tag="CAWG_02806"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1045258..1046307
FT                   /codon_start=1
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02806"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQP7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP7"
FT                   /protein_id="EEQ44536.1"
FT                   /translation="MNVTSPKISENVRLRNNGNTQLKNITRDMNNNDNESNEDSETKAP
FT                   PNSYRIYNIFSIILALFRSLIKTTSKTTNSVFQMSMFYINHFILLSLFFMIAIYKNFQY
FT                   LYRRVYLKYLAVTYYPSKSPQVIREDINKLEKIPKIVSCILDLQDDEDENGGKDGLINS
FT                   ISELTAWSMSAGLTKLIIYEFTGALIENSGCIVDLRKYITKTLVLYFGTEAIPTFSIRI
FT                   PHKNLIIYSDNHIDSNAVDLEIDLISRIDGKPTLVELTKTMSELAVNRELSIRDITIDL
FT                   IDEELHELVGPEPDLLISFAPSLNLEDYPPWHIRLSEIYWEPDNKDVNYAVFLRGLQQF
FT                   SNCKINIGK"
FT   gene            <1047245..>1047790
FT                   /locus_tag="CAWG_02807"
FT   mRNA            <1047245..>1047790
FT                   /locus_tag="CAWG_02807"
FT                   /product="ADP-ribosylation factor 1"
FT   CDS_pept        1047245..1047790
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02807"
FT                   /product="ADP-ribosylation factor 1"
FT                   /db_xref="GOA:Q5AND9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AND9"
FT                   /protein_id="EEQ44537.1"
FT                   /translation="MGLSFSKLFANLFGNKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRYYFQNTQGIIFVVDSNDRDRIAEAR
FT                   EELQQMLNEDELRDALLLVFANKQDLPNAMNAAEITEKLGLHSIRQRPWYIQATCATTG
FT                   DGLYEGLEWLSTNLKNSS"
FT   gene            <1048952..>1049756
FT                   /locus_tag="CAWG_02808"
FT   mRNA            join(<1048952..1048954,1049397..>1049756)
FT                   /locus_tag="CAWG_02808"
FT                   /product="60S ribosomal protein L35"
FT   CDS_pept        join(1048952..1048954,1049397..1049756)
FT                   /codon_start=1
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02808"
FT                   /product="60S ribosomal protein L35"
FT                   /db_xref="GOA:C4YQP9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQP9"
FT                   /protein_id="EEQ44538.1"
FT                   /translation="MAGVKTFELRTKSKEQLESQLVELKQELATLKVQKLQRPSLPRIH
FT                   TVRKNIARVLTVINLNQRENVRAFYAGKKYIPKDLRAKKTRALRRKLTKFEASQETEKA
FT                   RKQRIAFPQRKFAIKA"
FT   gene            complement(<1050018..>1053246)
FT                   /locus_tag="CAWG_02809"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            <1053362..>1053943
FT                   /locus_tag="CAWG_02810"
FT   mRNA            <1053362..>1053943
FT                   /locus_tag="CAWG_02810"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        <1053362..1053943
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQQ0"
FT                   /protein_id="EEQ44539.1"
FT                   /translation="MLFVPRKLAGKSETYTHHNKTKEKTATYTQISWRYIQHQPVPPPV
FT                   PLNTIGSFKRLALSYQTKNFENPTKPNETEQKKKIYFTTTKQQQPFFYFDKYLQNYSFC
FT                   FLTPKIKLNRKGKKIPSYKRKKLSSFSPIIIARSNTNQPTYIIFVVRKSLLSALFLFFY
FT                   KKREFNRVQFPQFPQFLDIDFYIFYSVTLF"
FT   gene            <1054187..>1055410
FT                   /locus_tag="CAWG_02811"
FT   mRNA            <1054187..>1055410
FT                   /locus_tag="CAWG_02811"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1054187..1055410
FT                   /codon_start=1
FT                   /gene_family="HOG000093913" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQQ1"
FT                   /protein_id="EEQ44540.1"
FT                   /translation="MPNNVSTVPAQGMDKNHTAIPSSLLTALSKQQDKLYILHLEKDLI
FT                   KFIKNSVLGNIKQPEYIIQAQYLKNSYYRLLSHQLCQYYNLQHWNNTFNEIIVTPIPNF
FT                   DYQQFIKAIEGSDNNEGGEFVKIVSVAHKYKSENTATTTTNNTDAPEQPNKPAPIKKLM
FT                   VRKIINKPMSDPTPGQAPGTPESEVSDLTKELDESKLISEDTGSSTPISESSENTTNNI
FT                   ESQRASKEALYMKLREEIFENNNEEEEEEEEEEDGDYGTTESQESNNRGYKFHNNFIKG
FT                   RNHGNYSGYKTTPYQQQQLQHQPPMYNTIPMPVPYQFNPNSQGPPIPGMIYSPYYQPMM
FT                   YGYAPNYPGAPTNNNNVVPAPKYDKETERRILNNPYIILPNDTKNGKNNNYSNKHTKHK
FT                   KQFTNTNI"
FT   gene            <1056102..>1056713
FT                   /locus_tag="CAWG_02812"
FT   mRNA            <1056102..>1056713
FT                   /locus_tag="CAWG_02812"
FT                   /product="rho GDP-dissociation inhibitor"
FT   CDS_pept        1056102..1056713
FT                   /codon_start=1
FT                   /gene_family="HOG000175765" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02812"
FT                   /product="rho GDP-dissociation inhibitor"
FT                   /db_xref="GOA:Q5AND4"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AND4"
FT                   /protein_id="EEQ44541.1"
FT                   /translation="MSNSNVDDDLVPEKVEGYTVGEKKTIDEYKNLDAEDESLAKWKAS
FT                   LGLTADTKPYPVKPGDKRKVVVTELALEFPEQPDLQPIRINLEDSDGNTIVDKEIKFNI
FT                   KEKSIYQLVVKFRVQHEIITGLKYLHSVKRGGIRVEKVEEPLGSYAPNTIDKPFYERKF
FT                   AEVEAPSGMIARGTYSAISKFIDDDDNVHLTVPWSFSITK"
FT   gene            complement(<1057147..>1059741)
FT                   /locus_tag="CAWG_02813"
FT   mRNA            complement(<1057147..>1059741)
FT                   /locus_tag="CAWG_02813"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1057147..1059741)
FT                   /codon_start=1
FT                   /gene_family="HOG000248796" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02813"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YQQ3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQQ3"
FT                   /protein_id="EEQ44542.1"
FT                   /translation="MMSTSNQVLDKILESLNANQRKAVTAPCNGRLQIIAGPGTGKTKV
FT                   LISRVAYLLISENIRPDNMIVTTFTKRAANEMIERLTKLVEGTDINIDKLIIGTFHSIC
FT                   FRIIKKYGKLIDLENYTIADERDKSYILKTMLTNLSAKDIERLDSFGEESLQKLRSQKA
FT                   NEKYHGLDLSVISKKISSLKSNCISHDVYSGKSKRNPALAFFYEKYQALLTDLKKLDFD
FT                   DCLLECHRLVENFPVLNYIKHVLVDEFQDTNEIQLRLMYHFAKGNTNGDPKYQNNVTIV
FT                   GDPDQGIYAFRDAQSINFEKMSTHYTKLNLSLDKISLNENYRSTSSILNISESLMNQQK
FT                   GRMPKMLKSQLDSSIKPVYSCLNSAKEEAKWIVYQISHLLSLPNSAVQEKDIAVLFRAA
FT                   YQSRALEDELVKRGLSYKMIRGKAFWDRQEVIAIMDYMKVCSDEYEQAAVIRTLNYPKR
FT                   GIGSKTLDNIEKIIEKRVKQGKSVHQCLLAMTKKSEEPEIKLTKKQIQGVEEYYTMITK
FT                   VKKKLSKMEGLSDEDITNTAKELFDLIYESSKLKQEFENDEERSKRLNVEEVGNLLVQF
FT                   KPKDEILPDYIGGDIEDDDAVDEGDRNFLAQFIESVGLYETNDEVEKNGSESTGDDTAK
FT                   EEKSCISLSTIHGSKGLEWPVVFVQGLTDGLLPAGFSFRNSFGDNDENLNEERRCFYVA
FT                   VTRAKVLLYISSYIESQSNVFYGEALNQESRFMESLKKNLARTQLAFSNVNNLRVLYKL
FT                   LGKQFPTGNLNWTRFYETYKKSFRRFVSGEPMVFSVGTEEEEEDRPSKSIGQSGFSSAQ
FT                   SLMNGFSGVQSIRNGTNNKNNKVATFISNPKTVNRAPPYIPERRSKKSKKMV"
FT   gene            <1059980..>1061821
FT                   /locus_tag="CAWG_02814"
FT   mRNA            <1059980..>1061821
FT                   /locus_tag="CAWG_02814"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1059980..1061821
FT                   /codon_start=1
FT                   /gene_family="HOG000247988" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02814"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YQQ4"
FT                   /protein_id="EEQ44543.1"
FT                   /translation="MTSLLFAFSLFLSFSVGSIFPFSTSNGPAVNDTLQNAIRSQRDVS
FT                   KPIPIDRVGFSGVSLSSFFESEGYSSDSLSNLNGLLKENVDGVMIDLYWNEFTSKWQLC
FT                   PAPFPNNITYTTASNRIVDVSWNNKTYKCDPNLSTDNIMSILNSFIRDTNTDVEANFMH
FT                   VMYNLKSIHYEKSNQTISLENIYKEKNSNLNVVGMDTLNDTVSLLSSYIFTPTLLKQYQ
FT                   STSNKYTNSSSSIRYIDSLNETQAIQDFYSQSTILMPSLQTVLLTQYKRLMVHVVTNDM
FT                   AESSRSYQISSSDKDTIFFNSDLPASIFHTDNASADELCYELSDAYNRTDVNIAEFNKV
FT                   SLNATLRLVVDDDKTPFTTKSLSKYVRCGYCPIFNSTEYSSQKVTEGNSSIISREFASN
FT                   LFWSWAPGQPSGPDNCINCTRPTTNNTSKHSDDNGEEEEGNNIAYKCVALTEEGWEVSN
FT                   CYEKYLFACQNKLSRNEWKLNNSTKRNYFDIDDDDCPEGYFFSLPRSNIEMLSLMTTVK
FT                   QENVNYPIWIDLNDITVENCFVSGGPYAQCPYQETVTTDKFVRMIAPSFVVAMVVLVLI
FT                   FIEKVFRKTPIQTNRKRYWKKAIQEYYAKNDYEGVPS"
FT   gene            <1062094..>1063005
FT                   /locus_tag="CAWG_02815"
FT   mRNA            <1062094..>1063005
FT                   /locus_tag="CAWG_02815"
FT                   /product="prohibitin-2"
FT   CDS_pept        1062094..1063005
FT                   /codon_start=1
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02815"
FT                   /product="prohibitin-2"
FT                   /db_xref="GOA:Q5AND0"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AND0"
FT                   /protein_id="EEQ44544.1"
FT                   /translation="MNDQNWKNLSNELRRRAEQARSSSNMKSPKSPLGIFGGIGGLLLL
FT                   GGATMFIQNALFNVDGGQRAILYSRLDGVQSKIYPEGTHFVIPWFQRPIIYDVRAKPKE
FT                   IASLTGTKDLQMVNITCRVLYKPDIWQLPTIYRTLGLKYEEKVLPSIVNEVLKSVVAQF
FT                   NASQLITQREKVSRLVRENLVRRASKFNVLLDDVSITYMTFSPEFSQAVEAKQIAQQDA
FT                   QRAAFVVDKAIQEKQQLVVKAQGEAKSAELIGEAIKKSKDYVELKRLDTAREIANILAA
FT                   SPNRIILDNDTLLLNTVTDNRK"
FT   gene            complement(<1063208..>1065358)
FT                   /locus_tag="CAWG_02816"
FT   mRNA            complement(<1063208..>1065358)
FT                   /locus_tag="CAWG_02816"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1063208..1065358)
FT                   /codon_start=1
FT                   /gene_family="HOG000034159" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02816"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNN6"
FT                   /protein_id="EEQ44545.1"
FT                   /translation="MDEFLSDVYYYYRGRGLLNIVLSRGFDLIILIFILIFTVFLKWGI
FT                   DYSIFFDNLHQEESKHITLNDMIIPNYFATIPLLIKFILFGFSVYILLRSVQLYLDYNY
FT                   KLKELKNFYHYLLDVTDDELMTISWKTIVEKLMLLKDYNSLTSTTKSNNFSENHYVNDL
FT                   SSKVRLNAHDIANRIMRRENYMIALINKDILDLSVLFMNEKSLLTKTLEWNLKLCIDNF
FT                   IYNQQGQINGKILKEYNRNQLARELTSRFKLAAIINLILSPFIVIYFVLLYFFRYFNEY
FT                   KSNPASILGLRQYTPYAEWKLREYNELSHLFNKRLIMSMGPANTYIDQFPKGFLVVNLM
FT                   RLINFISGSILAVLVIMGILLEDENHSFWSFEITDGRSALFYISIFGTIWAITASSATG
FT                   TSHESTISTTSQSSNSNSNSNAASTFVYDPEASLRYVAQFTHYLPSSWNKKLHTIQVKN
FT                   EFCQLYCLKIIIIINEILSSVLTPFILWFKISHNSGNIIDFYREYSIHVDGLGYVCYFA
FT                   MFNFEEKDKNMMSDLNKSKKRRTRMKNKMNKYGKTKMVNPISGKTVNSEIEMTKISKSE
FT                   SERSSDDESGNEQDYDNDEELDYLSYKKDDKMIKSYMYFLESYGGSKQPQLQPPQQQQH
FT                   PQNQNQTVGGLRNRNPIQSIDPAIMTGNYYDQQSLNSSIYNINYKFDDSGLLQDETMNS
FT                   SSRKKGGVLGMLNQFYKQDINR"
FT   gene            <1068629..>1069488
FT                   /locus_tag="CAWG_02817"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            <1070974..>1072314
FT                   /locus_tag="CAWG_02818"
FT   mRNA            <1070974..>1072314
FT                   /locus_tag="CAWG_02818"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1070974..1072314
FT                   /codon_start=1
FT                   /gene_family="HOG000093914" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02818"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNN7"
FT                   /protein_id="EEQ44546.1"
FT                   /translation="MKPLFTYKIPDSPHWYIVITDTSHHFYFNNHDKSSYWQLSDIQEH
FT                   YKNDIDIEKQLIKSINFDELAILFAKSRGVKFEVIENESESIEVDHSKEEVQPKQTEQQ
FT                   QVTEEEEIVVVENIPSKVTKAKPKEEKQPSTKQINSIIQGYLSSDDEEDEEEEVNSKET
FT                   KQESSQTINIDELTSQALAQHQKSTEIESDDDDDNDNGSLDLSLSETEDAATASTSSAE
FT                   QDFINLLNQFSNRISIYESWDLVEEELLPEFTTYPEFFAISSKSERQKLFQKWCTQQEP
FT                   KSPQTTINEGAFPTVKLNYLLFLQDFKQDIKQSFYQSFYNSHYQKLNEFNLSSQMKETI
FT                   FRNYKIMLNDFTKFAKNYKKSNVGDNRNLKVMKLNEFLQNKLHSHVTNTADSGPFNVDS
FT                   NLSDLDNWINLLNHYDIPTDIAENEINFLVGDEKRLNSYIDQLKPTK"
FT   gene            <1072363..>1073688
FT                   /locus_tag="CAWG_02819"
FT   mRNA            <1072363..>1073688
FT                   /locus_tag="CAWG_02819"
FT                   /product="hypothetical protein"
FT   CDS_pept        1072363..1073688
FT                   /codon_start=1
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02819"
FT                   /product="hypothetical protein"
FT                   /note="similar to GH20093p"
FT                   /db_xref="GOA:C4YNN8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNN8"
FT                   /protein_id="EEQ44547.1"
FT                   /translation="MTRVVVTGMGMVSPLGVGLSHNWKQLIANKSGLISHQTLPDYESA
FT                   GWDKIPSKVIGKVPHGTISEGHWQVGDHIPASEARRMATFSHYALASTHEALKDARLLT
FT                   EDNNALNMDTNKVGVAVGSGIGSFEDIYNNSIAYNASGYKKVQPLFIPKLLNNMAAGNI
FT                   SIKYQTKGPLHSVSTACATGLQAIGDGFNFLKMGYGQVMICGGTESSIHPLALAGFARA
FT                   RSVVTDSKFNSNPTKASRPFDKSRNGFVLSEGCGILVLETLSHALERGVTPDQIYGEIL
FT                   GYGVSGDAYHITAPHEDGTGAYNAMNQAIERSGIDPEQIDYVNAHATSTVIGDRAENNA
FT                   MMRLFNPQKTKVSSTKSSIGHLLGAAGAVESIFTLNAIKTGQVPATLNLDNVGQHEGDE
FT                   QSQFKFDYVANKSITMDVNYAVCNSFGFGGVNSSLCFAKYHN"
FT   gene            <1074261..>1075475
FT                   /locus_tag="CAWG_02820"
FT   mRNA            <1074261..>1075475
FT                   /locus_tag="CAWG_02820"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1074261..1075475
FT                   /codon_start=1
FT                   /gene_family="HOG000248798" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNN9"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNN9"
FT                   /protein_id="EEQ44548.1"
FT                   /translation="MTTTVIKTQERTRKRLRTNTSEIVFKESYQEKTTNDEQEDVAIVP
FT                   PTEISFDKKHQSILSITHFKDPLKVQSRYPIPELQPYEILVNNKAIGLNPIDWKGKKYG
FT                   FGIYHFPWINGRESSGDVVKLGDQVDKFSIGDKVIVSSTSYRDNRTSTFQQYTAIDSRL
FT                   VWKLPESFSYEDGATIGVGLVTAGIILYNSFEFELSATPTKQTTTASNNNTILIWGGAT
FT                   VVGLYVAQLAKIYGLNVIAVASTKHETYLKQLGVDHLIDRHLSEDEIINEINSIDGIES
FT                   IEYGVDCVGKETSKTVLKILDLKSQPQQKSKDEQIVKPKFSGIVGVPKEYPESVDVRNV
FT                   VIKRFHEDVSFGEKFIDVTSELLNKKVIEPVRFKQYKGGLHIIDNALKDLEKIGANGEK
FT                   YVVSV"
FT   gene            complement(<1075518..>1077248)
FT                   /locus_tag="CAWG_02821"
FT   mRNA            complement(<1075518..>1077248)
FT                   /locus_tag="CAWG_02821"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1075518..1077248)
FT                   /codon_start=1
FT                   /gene_family="HOG000093915" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP0"
FT                   /protein_id="EEQ44549.1"
FT                   /translation="MNEETLPVNESSLPRISSLTELPDEILNKIIDYLCTDQVTPRSNN
FT                   SKSLIGFPKYTYILNHIRIGSLYHDILALSSTCTYFRKRLAPILFQSLSLVRTNQVDAV
FT                   LESPKSQQLFSDTKTIQQHFMKELIVNNIEQCERAATTWTSFQTNTFDDKMFKSRYGKY
FT                   LMMTRFVNYLECDNSFLNGEGIRLFSNLTALKVLDIGEGAVFMSNFELANLRYLAINAQ
FT                   TLIYSPQFLRIVPKLNRLDLFLDYGNLPSLVGIRPLIQQFRTFSQLTELVLLLNNPFTI
FT                   AYLDTIKLLETISKNASNFAKLTIRYIRRNNESTVDQSGWELYQGRIGGKLLKIFKNLT
FT                   DLIIDISILDLIKFDPETYSSPVLYTDHLMEKRITLVDEVVVGPNIDSTTREIAGVIIR
FT                   HCQFTHLFFQYGESIEESHLHVLKLLTDFVGWLSNGHLDQSRNYLGIRQISLEKCWSMT
FT                   DDSLLRDMIGSSIKSKSESDLSALQKVYPWTTTINNSPRYKDIDSYNINYVEEAGLSIT
FT                   DSRGYFIGVSDQDADRPQFTTVDKKSGIQTINMEFWSGESSLLDFEQYSIRQRRSLLWG
FT                   "
FT   gene            complement(<1077628..>1078648)
FT                   /locus_tag="CAWG_02822"
FT   mRNA            complement(join(<1077628..1078076,1078537..>1078648))
FT                   /locus_tag="CAWG_02822"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1077628..1078076,1078537..1078648))
FT                   /codon_start=1
FT                   /gene_family="HOG000213425" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02822"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNP1"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP1"
FT                   /protein_id="EEQ44550.1"
FT                   /translation="MGRDHTSKQHVRSGHRTAPKSDNVYLQLLVKLYSFLARRTDAPFN
FT                   KVILKSLFLSKINRPPVSVSRISRALKQKGVAEKTIVVVGTVTDDNRLLEFPKATIAAL
FT                   RFTAGAKDRILKNGGEAITLDQLALRAPKGQNTLIVRGPRNSREAVRHFGFGPHKGKAP
FT                   RILSKGRKFERARGRRRSRGFKV"
FT   gene            <1079001..>1080002
FT                   /locus_tag="CAWG_02823"
FT   mRNA            <1079001..>1080002
FT                   /locus_tag="CAWG_02823"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1079001..1080002
FT                   /codon_start=1
FT                   /gene_family="HOG000248804" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02823"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP2"
FT                   /protein_id="EEQ44551.1"
FT                   /translation="MAQLTPIRGFTNTPVTRSICMISTVVPIMLSVLAIKYVVKFAIDP
FT                   YIIQYNQFWRVVTYQLSVVNESDYLITVLLWFQFKVLERFYGSRKYLSIITLFTVYNAV
FT                   ACLLIMSLGQLLLYYILFVIKVFIMGYDQGSIHYNVTFLNEIIPGPLGILSSLYVCYGA
FT                   NIPVSYYFKILLKDPRNADQPETSSPSKELNLTNLFPIHILYTILILNNGLRSIIPCLV
FT                   GLLIGKLYVYELLPGGSSWLLSNTVFRLFINPVKRAGVWLEAVRRRLSIRYERLSGGDS
FT                   QEALEEEELNENNDEPDDNDEILDETRQQENQIRAETPVRPLGSQFLDTFRT"
FT   gene            complement(<1080081..>1080692)
FT                   /locus_tag="CAWG_02824"
FT   mRNA            complement(join(<1080081..1080621,1080676..>1080692))
FT                   /locus_tag="CAWG_02824"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1080081..1080621,1080676..1080692))
FT                   /codon_start=1
FT                   /gene_family="HOG000184744" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02824"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNP3"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP3"
FT                   /protein_id="EEQ44552.1"
FT                   /translation="MADFLAPKKTNPRGIPEAPFIEKVETVIKNPETEFDNTMSMFQQR
FT                   LQQYKYMEASKKQQLADLQTKIPDIEKNLDVIKHIKQRKEEGDDKMVTNYELNDTLYSK
FT                   ATVDVQNLNSVYLWLGAEVMLEYNLEDATELLNERLKKNQEQLQIVKEDLEFLKENITT
FT                   MEVNTARLYNWDVERRKKAKAN"
FT   gene            complement(<1080913..>1081977)
FT                   /locus_tag="CAWG_02825"
FT   mRNA            complement(<1080913..>1081977)
FT                   /locus_tag="CAWG_02825"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1080913..1081977)
FT                   /codon_start=1
FT                   /gene_family="HOG000106048" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02825"
FT                   /product="hypothetical protein"
FT                   /note="similar to STI35 protein"
FT                   /db_xref="GOA:C4YNP4"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP4"
FT                   /protein_id="EEQ44553.1"
FT                   /translation="MTPPTMLQTAPVESFNLNPKSTQQAINLKSDAKNGKVSFADWNEF
FT                   KFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAIIE
FT                   ASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSKV
FT                   LQFPNIKLFNATAVEDLITRKDPATNLQRIAGVVVNWAQLDHDTQSCMDPNTINCNVVL
FT                   STSGHDGPFGAFTAKRLEQLGRAPRDVTAGFTKPSITTSKLQEPEPISNFQLGGMKGLD
FT                   MNKAEDAIVKGTREVVPGLVIAGMELAEVDGSNRMRPTFGAMALSGVKAAESVLNVLEL
FT                   RKQQNEACYGAYKG"
FT   gene            complement(<1082384..>1083724)
FT                   /locus_tag="CAWG_02826"
FT   mRNA            complement(<1082384..>1083724)
FT                   /locus_tag="CAWG_02826"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1082384..1083724)
FT                   /codon_start=1
FT                   /gene_family="HOG000191866" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02826"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNP5"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR016691"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP5"
FT                   /protein_id="EEQ44554.1"
FT                   /translation="MDSSLANPIMKDYLIHLASTFPKFRIAELEALADLYNIDVDLSSH
FT                   NEDSTFLVVSLENDEQARQLISRSVMSFGIYELWGYGETYDKLHEDVRAKSADKFEKYK
FT                   DVSFKFDFKNFRGRPSNKGKVRIIESFSYLPFEGKIDLKNPDEIFTVVEEYKYNDRAKS
FT                   ETPTRIWFTRQLQLSERSNGLVETYDLKKRNYIGTTSFEAELSLVTCNLAQIAPGKITY
FT                   DPFTGTGSFLVAAAHFGGYPIGSDIDVRMLNGKGNDKNVKSNFKQYGTSGNFIDVLTMD
FT                   FTHNALRKDFQIDSIVCDPPYGVREGLRVLGAKNEEKAAGREHDVFDGEIAYLRREFIP
FT                   PKKPYSLANLLEDLLQFASERLPVGGRLAFWMPTANDNFEETQIPQHERLELLHCLEQS
FT                   FNQWSRRLLVYVKRDESYKGITSNGLKEKNIRDFRVRYFKRFIDKNE"
FT   gene            <1084518..>1085945
FT                   /locus_tag="CAWG_02827"
FT   mRNA            <1084518..>1085945
FT                   /locus_tag="CAWG_02827"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1084518..1085945
FT                   /codon_start=1
FT                   /gene_family="HOG000248803" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02827"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP6"
FT                   /protein_id="EEQ44555.1"
FT                   /translation="MSLEDDEALFEDLYGDDEKQEEKQDTVQKEVESTEKETTAVETAS
FT                   ATENASSAEVETTTEGESESVPPPPPPPIPASGDVNAQSNTAQDNATSTAPGSVPAGMP
FT                   QFPFDPAQFQQYAAANGLQFPGNANQQNFGAAGGVPPPPPPAPTANATSAESAGGPSRK
FT                   CFIGGLSWDTTEEALVSHFQKYGNIVDYTIMKDSATGRSRGFGFLTFEDAKSVDALLKD
FT                   RHVLDGKLIDPKRAISKEDQEKVGKIFVGGIDPMVTEEEFDNFFSQFGKIIDCQLMIDK
FT                   DTGRSRGFGFVTYDSPAAVDKVCVNKYLTLKGKAMEVKRAAPRGQHNQQVMMQQQQQQQ
FT                   QQQAQQQAQQQAMYPYGSYGFQQMNPGAMNPAMSQEYMRYYQWFMYQQAQAAQQQQQSG
FT                   TSASPEAQPAQPLNPQQQAAEEESEKSDEQARPAIPTGPKRAPPTGPSYRGGGRGGGRG
FT                   GYRRGRGYHPYSRGGRR"
FT   gene            complement(<1086039..>1088765)
FT                   /locus_tag="CAWG_02828"
FT   mRNA            complement(<1086039..>1088765)
FT                   /locus_tag="CAWG_02828"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1086039..1088765)
FT                   /codon_start=1
FT                   /gene_family="HOG000246455" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02828"
FT                   /product="hypothetical protein"
FT                   /note="similar to DBP10"
FT                   /db_xref="GOA:C4YNP7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012541"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP7"
FT                   /protein_id="EEQ44556.1"
FT                   /translation="MSDDEAFDIAGSLALKDEDDYSDSSSNEGEDFQDEIIPSDDEKEP
FT                   SPPPKKKSKPNPQAFPSLELSDNEGNNDDDDDDDSKINSYFINNNPTAKKAKAGSFASF
FT                   GLTKFILANIAKKGYKQPTPIQRKTIPLIMEGRDVVGMARTGSGKTAAFVLPLIERLKS
FT                   RQPGGVRAVILSPSRELALQTYKQVKEFSHGTNLQSIVLIGGDSLEEDFSKMMTKPDII
FT                   VCTPGRFLHLKVEMQYDLMTVQYIVFDEADRLFEMGFAEQLNELLASLPSNRQSLLFSA
FT                   TLPRSLVDFAKAGLTNPVLVRLDAESKISDQLQMAYFTTKKNEREANLLYILQEVIKMP
FT                   LGSEEQIKKLKDMDKRKIDSDSEDDDDDEERKKGKKRYKFKKERLPPANRLPSPHSTIV
FT                   FVPTKHHVEYVTKLLRDAGYLVSYIYGTLDQHARKNQLYQFRVGLTNVLVVTDVAARGI
FT                   DIPVLANVINFTLPASSKIFIHRVGRTARAGNKGWAYSIVNEKELPYLLDLELFLGKKI
FT                   LLTSMHEAKVEMLKKSSTGTFIPPVVNYTERLVLGSVPRVDLETFQELYENLLRNNYEI
FT                   KVLKDVAAKGEKLYHRTRQPASQESLKRSKEIIESSWDDQHLLFGENLEKQKDAFLAKL
FT                   QDRNSKQTVFELKGSDESLVEFMNRRRRQLAPIQRKAKERKELLAKERLAGLTHGIEDE
FT                   ILRADGENGYGVDEDELQEAFEDADKKKSFRDPQFFLSHYAPASVIQDQQLSLSTSFAN
FT                   EAQAATFDLDNDDKIQTNKQVMRWDKKKGKYINSKSTDKKYIISENGTKIPASFRSGKF
FT                   DEWRKQRNLKPTSTVEDDSNKRFKHKQQRAPKLPDKFRDDYHKQKKKVEKAIESGVNVK
FT                   GFHTPQQEIKSTEQIRKARLLKEKRKAKNARPSKKRK"
FT   gene            <1099804..>1101140
FT                   /locus_tag="CAWG_02829"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            <1107549..>1108103
FT                   /locus_tag="CAWG_02830"
FT   mRNA            <1107549..>1108103
FT                   /locus_tag="CAWG_02830"
FT                   /product="hypothetical protein"
FT   CDS_pept        1107549..1108103
FT                   /codon_start=1
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02830"
FT                   /product="hypothetical protein"
FT                   /note="similar to rheb GTPase RhbA"
FT                   /db_xref="GOA:Q5ANA9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015602"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANA9"
FT                   /protein_id="EEQ44557.1"
FT                   /translation="MSVKARKIAVVGSRSVGKSSITVRFVEDHFVESYYPTIENQFSKS
FT                   IKFNNQDYAIEILDTAGQDEFSLMNEKHLIGIHGYLLIYSVTSQQSFETVEFIRDKILN
FT                   SIGNESIPMVLVGNKNDLTYQRQVETTQGQELAKKFNCKFLETSVRENINVEKAFETLI
FT                   DEIEKIQNPPIQKQQEKCIIM"
FT   gene            complement(<1108546..>1109892)
FT                   /locus_tag="CAWG_02831"
FT   mRNA            complement(<1108546..>1109892)
FT                   /locus_tag="CAWG_02831"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1108546..1109892)
FT                   /codon_start=1
FT                   /gene_family="HOG000240109" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02831"
FT                   /product="hypothetical protein"
FT                   /note="similar to metacaspase"
FT                   /db_xref="GOA:C4YNP9"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNP9"
FT                   /protein_id="EEQ44558.1"
FT                   /translation="MFPGQGRHTYGGQQSNYSNQQQGYDQGYNQGYSQGYGQEYNQGYD
FT                   RPSGPPPGQGQYNRPSGPPPGPPPGQGHYNRPSGPPPSQQGQYNRPSGPPPGQYGNNQT
FT                   RGSGNEQNYGNMHGSGHYSRPPTDSQSFGVENYNYQYSNCSGRKKALLIGINYIGTKNE
FT                   LRGPINDVNNVEQFLLANGYSSDNIVKLTDDQRVQRAIPTRQNILDAIQWLVKDARPND
FT                   ALFFHYSGHGGQTEDQPDEYGNYDEDDEYDEVIYPLDFETNGFIIDDLLHSMMVKTLPQ
FT                   GCRLTALFDSCHSGSVLDLPYMYSTKGVLKEPNVMKEAGAGLLQSAMAYATGDRSRMLS
FT                   GLGGVVKTFMNQGKAEKANEYSKQTNTAPCDAISLSGCKDDQTSADSKENGTATGAMSY
FT                   AFLTVMSQNPNQSYLSLLQNMREILSAKYSQKPQLSASHPIDTNLQFIF"
FT   gene            <1111335..>1112139
FT                   /locus_tag="CAWG_02832"
FT   mRNA            join(<1111335..1111354,1111722..>1112139)
FT                   /locus_tag="CAWG_02832"
FT                   /product="40S ribosomal protein S19-B"
FT   CDS_pept        join(1111335..1111354,1111722..1112139)
FT                   /codon_start=1
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02832"
FT                   /product="40S ribosomal protein S19-B"
FT                   /db_xref="GOA:C4YNQ0"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ0"
FT                   /protein_id="EEQ44559.1"
FT                   /translation="MPGVSVRDVPAQDFINAYAQFLQRQGKLEVPGYVDIVKTSAGNDL
FT                   PPQEAETWFYKRAASIARHIYLRKQVGVGALNKLYGGAKNRGFRPHKHVDASGSINRKC
FT                   VQALQKIGVLEISPKGGRRISENGQRDLDRIAAQTLEEDDE"
FT   gene            complement(<1112370..>1113923)
FT                   /locus_tag="CAWG_02833"
FT   mRNA            complement(<1112370..>1113923)
FT                   /locus_tag="CAWG_02833"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1112370..1113923)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02833"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNQ1"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ1"
FT                   /protein_id="EEQ44560.1"
FT                   /translation="MNNGTFRTFMNRVEEIRSNYSDVAKNLSGIYTIFESLGRLNHFYK
FT                   FSLMRFVNNFAHLLRVNIKLSPSEFIMELFKDSFARISTSLQYKHKIVLALVLSTAYYM
FT                   EDIGDSYKTAFMKMLKLIVTDKLPNSISDVFDVCLARRKSGWDVEKVLESNQDNSVLQI
FT                   LSDLLLSFGSTKNKEDFVDTFSKISGFLYKDGEAPYSSPYDLNYWINDSGIRTIILTCP
FT                   EVYDASYKVEQSARQFGKKLAVISMGTKEGIEMANKEIEAASMSARWVLIQNIHMAPSW
FT                   ISHFESQLSNLHAESKIFLTCKNTSQVPIGVISECKVLNFENEVGIQRLVLDTYKSSSM
FT                   DKRERIERHVLLLLIWYHSVILERVRYSPVSFKKKYDFNDSDYTCGVHIIEKVFESYDG
FT                   KTETIPWNEIKYLIGTITYGGKVDDKEDLEFLETFAGAIFTERSFDSNFNLIENEFTKE
FT                   NNEVLLLPDTTEEIVSWINKLPYDTPLSWIYLPDDANSLVKKQLGLEIVESVLDLSEDL
FT                   "
FT   gene            complement(<1113916..>1120092)
FT                   /locus_tag="CAWG_02834"
FT   mRNA            complement(<1113916..>1120092)
FT                   /locus_tag="CAWG_02834"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1113916..1120092)
FT                   /codon_start=1
FT                   /gene_family="HOG000175136" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02834"
FT                   /product="hypothetical protein"
FT                   /note="similar to cytoplasmic dynein heavy chain"
FT                   /db_xref="GOA:C4YNQ2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ2"
FT                   /protein_id="EEQ44561.1"
FT                   /translation="MFSGVERLQYAKESSCIVGVVSEQGEELVLHNPVSLIKHTRLHEW
FT                   LSELELEIKLTLSRLVKDNIKLLRETVFKKDGLVSLIESIPAQVATLLQQITFTSLIEN
FT                   PTTSLSSLHESLSNTIKTLVRAIGSEIEDLTRKKTQYLIIEIIHQRDVVEQLINAENES
FT                   DRKFIRNIQQRFYYDISNTDLLKSLTIKQANSEFIYGLEYLGIPEKLAYTPLTNDGYLA
FT                   MCQALSIHKGGSPFGPAGTGKTESIKALGHNLGKMVLVFCCDDSFDFQSMGRIFLGLCK
FT                   VGIWGCFDEFNRLDDKILSAISSQIESIENGLKNPDMAISVSEKNVKVNPETGIFITMN
FT                   PGYAGRVELPENLKKMFRSFSMDSPDNEIIVEILLTSQTFVNSKALAKSIVPFFQELAS
FT                   NTSNQLHYDFGLRALKNTLVRCGQAKRKSTNANANESLAFEQELVVQSIVETILPKLIK
FT                   EDEIVFEKLRNKYFANVVGKVLDKSKLIAALEMYFTKNGVQFDEKFINKALQLIDIQNT
FT                   HHGIMLVGESGSGKSTILDSIMYALSVVTNVEHTKVLIDAKVLSKDEIYGKLDLVTRDW
FT                   TDGLFTSVLRKMSENLRGELSKKLWIVFDGDIDPQWAENLNSVLDDNKILTLPNGERLS
FT                   LPENVRIVFEVDNLKYTTPATISRCGIVWFDVSLISLDAHLHKLVHQLNTYKITNDDMI
FT                   RDNMLADNLRKSFVEELSNLLSYNVLSGICEVAKQAEHIMEFSFQRAIGSLEVCIKTYL
FT                   RRLLNFANSNDNETVEIKKYVQKALLLSIMWAFAGDSSYEDRIEFANAMKDKNILWGVE
FT                   MPHGNVLDYDVSLPDGEWLDWNTSVASVELEPHQVSNPNTIVPTLDTVKHEQFIFSVLN
FT                   EHSPLLLCGPPGSGKTMTLFEALRKSPQLELLSLNFSKETSPVSLLKALDQYCEYRKTN
FT                   RGIQLAPRINGKWVVVFCDEINLPQVDKYGNQNVISLIRQMVEHGGFWRVKDNQWVSLE
FT                   NIQFVAACNSPNDPGRNKLSERFLRHVPVIMVDYPGYTSLTQIYQTFNMAILKCAPDLR
FT                   GFAKAITEASIQVYEKTRKKLNSQIQKHYVYSPRELTRWSRGILEALKSHMYKDLSAFL
FT                   RLWYHEGLRLFYDRLVTDDDKSWTLQMFKEVAENNFPNINLNATFKEPVFFSNWMSLDY
FT                   KSVNEQELRSFVSSRLRVFSEEEMEVDLVLHDEMLDHALRIDRVLRQPQGHMILVGPSG
FT                   SGKSTLAKFVAWINGLKVVQLHVRSNYGIDDFDETLRGILTRCVHGEKICFIIDESSIL
FT                   EASFIERMNTLLANAEIPGLFEGDDYTSLMSKCLELSHAQGLLLDTDAELYDWFTQQIS
FT                   KNLHVVFSISDSVESNSQSVISSPALFNRCVLSWMGDWSDRCLYEVASSRISTVPLDIS
FT                   NYVIPNTFAPFLSNRRAKNLRDAIVDTLAFIHRFIPDHKSTLSYRRTPTDFLNLVKMFT
FT                   DLFNIKHKELEDSQRHITVGLDKLRETVIQVDKLQGMLSEKESILKIKDKEAKEMLNKL
FT                   LTDQNEAERKQEFSIATQAELAKQEKEIEKRKSVVMKDLEYAEPAVLEAQRGVQNIKKQ
FT                   HLSEIRSMANPPAAVKMTMESVCILLGYDVGTWRDVQLVIRKDDFIPNIVSFNSEESLP
FT                   VELREYMERVYLTREDYTFEIVHRASKACGPLVQWVQAQLAYSRILQSVGPLREEVELL
FT                   EQKTLKTKAQLTAIDEMIFELEESIEKYKDSYTELIRETENIKTEMSLVHKKVDRSTAL
FT                   IKNLKVERERWKESVKTFGDKRDKLVGEVLLAAAFIVYGGLYDQKGREILLKTWRNKLK
FT                   ESGIPFDKTLTMSSYLTTSKKALHWTNCGLVNDNINIENFALLEWCQNPVIIDPNGVIV
FT                   EILSKASSKSVTVTSFLSDGLFNQLENTLRFGGVIIIQDCEYYDPLLDTVLRKEIHRNG
FT                   GRMMIRLGDQIIDYSSEFKLILASKESGLVLPPSVASRASIINFTVTSGSLENRALDIA
FT                   LKETRPDVEKERTDLVMLNGEWKLRLQTLEEELLDSLSTTPGEILDNDNVMNTLETLKS
FT                   ETDGLNE"
FT   gene            complement(<1120171..>1124853)
FT                   /locus_tag="CAWG_02835"
FT   mRNA            complement(<1120171..>1124853)
FT                   /locus_tag="CAWG_02835"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1120171..1124853)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02835"
FT                   /product="hypothetical protein"
FT                   /note="similar to cytoplasmic dynein heavy chain"
FT                   /db_xref="InterPro:IPR013594"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ3"
FT                   /protein_id="EEQ44562.1"
FT                   /translation="MEESVTPLLSVNQLYDCIIGFLPFNENVPKFTQCEDVLTKFISNN
FT                   NQDTLYLIKSIEEKTSRISNDLSDLDMGFKDLDTFVIIIKSKGELRNDIPLTQQLNIMS
FT                   IPIPQDENHETNDSFEKLRLAVSLGLSPYFDFISTKNEESALATTKKKFNELSLALQHL
FT                   QQRIHIPDLLITTHPKIKMLIAEKGSEYPDELIDDTEFLNEITSITNNWVRQIQSITRL
FT                   NHEPSDGDSIMEDIQFWKSMDLALISLNQQINSPEVNLTRELLSKAKRFHITLSFENDI
FT                   GLKEKLNETKLYNSFLRELPINDLSTITDDDGFQKFDDALANIFSHLKLKLNLLPLERA
FT                   MKSVEVILNDITEKFQSLLGTYDLMSLSLDKFEELISLCNKELDTIEVNIKFIINLLRE
FT                   LLRKRQEKFKLIKIDQTKLENIKERLLYLRQFRHNHQNLMTGIESVLPQEEQLDSISKL
FT                   NEAYNKHIISINPVDISHQGKLIWSMNEHAYLEVFHNLNSLLTKKINKFFNNAHTFIDF
FT                   ITIYKNFFIGDNSNSLLSSISDDHKLRTLTIADREIQRLVELNSDHVSETSFSSITWKI
FT                   QLSAKLKFYRDYLELLLGFNWKSYSVGTKIDTTTNKLLESLDPVTAINKWVDEEVNQNL
FT                   PSANLGKIFTVSENSHERFDLNINFNFQMFEIYRQLNQLYNLGFSLPSLIMLQFKKINQ
FT                   LYPITNIIKDHVQLLNKLFNVDLQEGYGKAFGFLVATQIKKVEEMLKETMNIEWVHLLH
FT                   AVELHKVNDNDFKSTENLIEHRSMRQLTEFQDSVTQLNLSLIKLKNFSKFMDQCKFLLR
FT                   TANFEFTSIEGHLKTLQLEFNNISLEKVENLEGLADLINLEVQTVLRERLQTQLFIFNI
FT                   KAMGYNDEQEIEIFELDKYLLEFPIFKHYLSFNDETFVIEPPLNTGKQSAFNQINHIVS
FT                   IVETQHMIKPLTSHSQSFSTVAEDENSMKQLNLVFEKIETLYQDAELYISKWQLLQNLW
FT                   ELNLDDPDDFAKLFKADQNVESWFQVVQEIFKYRNVYDLPDPEKAFGNLFVINITKIQH
FT                   RVAIKFETFQKSLLSKFAKKIDQEANSFNRLLINAKQILEMPLTFHDSTEQLTSGIDSY
FT                   LKYQNSLQSWNFLLETFQSVQSFLMKHRFKFPNDWLYTEQLENNISMVQALVAKKSLLI
FT                   EENLEIVTSKIKAEALKINDSINSLNQNWQSKKPIAGNLNPSVAMMDLDNFQMHFSKLT
FT                   AYVESLINISNHLDIHIVPFEDMSLSIDEIKDLKSVWSSVNGLWEELERLKKLKWSDLQ
FT                   PRQLRHQLDDLLNSARNLPMNIRQYSAVDEIQASVKTHLKTHQKISDLKNCAMKPRHWK
FT                   ILLSQLGVPDIKFEDLTVGDVWGLNITLNIQTINAMVEQANSEKTIEENLNNINNNWAS
FT                   ITFELFNYENKCRLVKNWEQLIDQCNTDINALTSMKNSPYFGAFEREISELEKKLTQLF
FT                   IVLDIWIDVQRQWLYLEGVFGNENNDLKSLLPIESSRFTNISYEFLNLLKRIYKFNLVI
FT                   DIVLITDLQPMMTKCFESLVKVRKSLTDYLEKQRKLFPRF"
FT   gene            <1127127..>1131632
FT                   /locus_tag="CAWG_02836"
FT   mRNA            <1127127..>1131632
FT                   /locus_tag="CAWG_02836"
FT                   /product="suppressor of toxicity of sporidesmin"
FT   CDS_pept        1127127..1131632
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02836"
FT                   /product="suppressor of toxicity of sporidesmin"
FT                   /db_xref="GOA:C4YNQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ4"
FT                   /protein_id="EEQ44563.1"
FT                   /translation="MSDSKMSSQDESKLEKAISQDSSSENHSINEYHGFDAHTSENIQN
FT                   LARTFTHDSFKDDSSAGLLKYLTHMSEVPGVNPYEHEEINNDQLNPDSENFNAKFWVKN
FT                   LRKLFESDPEYYKPSKLGIGYRNLRAYGVANDSDYQPTVTNALWKLATEGFRHFQKDDD
FT                   SRYFDILKSMDAIMRPGELTVVLGRPGAGCSTLLKTIAVNTYGFHIGKESQITYDGLSP
FT                   HDIERHYRGDVIYSAETDVHFPHLSVGDTLEFAARLRTPQNRGEGIDRETYAKHMASVY
FT                   MATYGLSHTRNTNVGNDFVRGVSGGERKRVSIAEASLSGANIQCWDNATRGLDSATALE
FT                   FIRALKTSAVILDTTPLIAIYQCSQDAYDLFDKVVVLYEGYQIFFGKATKAKEYFEKMG
FT                   WKCPQRQTTADFLTSLTNPAEREPLPGYEDKVPRTAQEFETYWKNSPEYAELTKEIDEY
FT                   FVECERSNTRETYRESHVAKQSNNTRPASPYTVSFFMQVRYGVARNFLRMKGDPSIPIF
FT                   SVFGQLVMGLILSSVFYNLSQTTGSFYYRGAAMFFAVLFNAFSSLLEIMSLFEARPIVE
FT                   KHKKYALYRPSADALASIISELPVKLAMSMSFNFVFYFMVNFRRNPGRFFFYWLMCIWC
FT                   TFVMSHLFRSIGAVSTSISGAMTPATVLLLAMVIYTGFVIPTPSMLGWSRWINYINPVG
FT                   YVFESLMVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGA
FT                   YQYYNSHKWRNLGITIGFAVFFLAIYIALTEFNKGAMQKGEIVLFLKGSLKKHKRKTAA
FT                   SNKGDIEAGPVAGKLDYQDEAEAVNNEKFTEKGSTGSVDFPENREIFFWRDLTYQVKIK
FT                   KEDRVILDHVDGWVKPGQITALMGASGAGKTTLLNCLSERVTTGIITDGERLVNGHALD
FT                   SSFQRSIGYVQQQDVHLPTSTVREALQFSAYLRQSNKISKKEKDDYVDYVIDLLEMTDY
FT                   ADALVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSICKLMRKLA
FT                   DHGQAILCTIHQPSALIMAEFDRLLFLQKGGRTAYFGELGENCQTMINYFEKYGADPCP
FT                   KEANPAEWMLQVVGAAPGSHAKQDYFEVWRNSSEYQAVREEINRMEAELSKLPRDNDPE
FT                   ALLKYAAPLWKQYLLVSWRTIVQDWRSPGYIYSKIFLVVSAALFNGFSFFKAKNNMQGL
FT                   QNQMFSVFMFFIPFNTLVQQMLPYFVKQRDVYEVREAPSRTFSWFAFIAGQITSEIPYQ
FT                   VAVGTIAFFCWYYPLGLYNNATPTDSVNPRGVLMWMLVTAFYVYTATMGQLCMSFSELA
FT                   DNAANLATLLFTMCLNFCGVLAGPDVLPGFWIFMYRCNPFTYLVQAMLSTGLANTFVKC
FT                   AEREYVSVKPPNGESCSTYLDPYIKFAGGYFETRNDGSCAFCQMSSTNTFLKSVNSLYS
FT                   ERWRNFGIFIAFIAINIILTVIFYWLARVPKGNREKKNKK"
FT   gene            <1132724..>1133920
FT                   /locus_tag="CAWG_02837"
FT   mRNA            <1132724..>1133920
FT                   /locus_tag="CAWG_02837"
FT                   /product="candidapepsin precursor"
FT   CDS_pept        1132724..1133920
FT                   /codon_start=1
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02837"
FT                   /product="candidapepsin precursor"
FT                   /db_xref="GOA:C4YNQ5"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ5"
FT                   /protein_id="EEQ44564.1"
FT                   /translation="MFLKNIFIALAIALLADATPTTSNNSPGFVALNFDVIKTHKNVTG
FT                   PQGEINTNVNVKRQTVPVKLINEQVSYASDITVGSNKQKLTVVIDTGSSDLWVPDSQVS
FT                   CQAGQGQDPNFCKNEGTYSPSSSSSSQNLNSPFSIEYGDGTTSQGTWYKDTIGFGGISI
FT                   TKQQFADVTSTSVDQGILGIGYKTHEAEGNYDNVPVTLKNQGIISKNAYSLYLNSRQAT
FT                   SGQIIFGGVDNAKYSGALIALPVTSDNELRIHLNTVKVAGQSINADVDVLLDSGTTITY
FT                   LQQGVADQVISAFNGQETYDANGNLFYLVDCNLSGSVDFAFDKNAKISVPASEFTAPLY
FT                   TEDGQVYDQCQLLFGTSDYNILGDNFLRSAYIVYDLDDNEISLAQVKYTTASNIAALT"
FT   gene            complement(<1134221..>1135009)
FT                   /locus_tag="CAWG_02838"
FT   mRNA            complement(<1134221..>1135009)
FT                   /locus_tag="CAWG_02838"
FT                   /product="60S ribosomal protein L8-B"
FT   CDS_pept        complement(1134221..1135009)
FT                   /codon_start=1
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02838"
FT                   /product="60S ribosomal protein L8-B"
FT                   /db_xref="GOA:Q5ANA1"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ANA1"
FT                   /protein_id="EEQ44565.1"
FT                   /translation="MAPKGKKVAPAPLATKSAKSSESKNPLFESTPKNFGIGQSIQPKR
FT                   NLSRFVKWPEYVRLQRQKKILSLRLKVPPSIAQFSQTLDKNTAAQAFKLLNKYRPETSA
FT                   EKKERLTKEAAAIAEGKTAKDVSPKPVVVKYGLNHVVSLIENKKAKLVLIANDVDPIEL
FT                   VVFLPALCKKMGVPYAIVKGKARLGTLVHKKTSAVAALTEVNSADEAELSKLISTINAN
FT                   YIEKYEENRKHWGGGIMGSKANDKIAKKAKAAAAAVSTSN"
FT   gene            complement(<1135507..>1137282)
FT                   /locus_tag="CAWG_02839"
FT   mRNA            complement(<1135507..>1137282)
FT                   /locus_tag="CAWG_02839"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1135507..1137282)
FT                   /codon_start=1
FT                   /gene_family="HOG000093916" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02839"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ7"
FT                   /protein_id="EEQ44566.1"
FT                   /translation="MAINTHQLLNHSSLDTISVSISSSHPSIDSINSSCIMQKHKHQLL
FT                   LPQTEKYNNNNNNNNISAYQPDKQLLQQKQSKTKNSQSEYSPKRRTKMKKSFSINNIKQ
FT                   ITSSIDNHPLNHNYNDTDTDTNPSTNSHGENNFEDYQDDSMELDDDYDSDDLSYTSCSS
FT                   SQSNSNYSVVFEKDPTTMSPTSDQIPFSYHSFNNDCFLYTNTKSSLGISIPMNRSHPMS
FT                   SSLQSPISSQSLLSMSPPPSVFCLPSTTTSCSPITTNSISQSLEMERSLRRSSSSDSLY
FT                   MLLKNASTSSSTPFSSSSPSTQSSSPSPTSTSLSPFSKKQSIKSTSKKSIYSNLSTSLR
FT                   LFRNKLSSYNKENLLKFIMDSPRLTDEKLPLQKPSCPEAKVQEEETEETEETPMEELTT
FT                   FHHHQHHNHHHELGLEKSQCIKYKTRESRTNSRFLILYAFDMNARCNSMTLPNSPTQDE
FT                   LYKIIKHHPNIKKFHYKHNIRRISNMSREKLWNNVILPPRQDDSPELFIKSDPYIIYND
FT                   HNELDNGLDGHYSIVRKSGKYMPWALKPSIKPAGVLPNSKWVFNGQAPNSGITKTQFTV
FT                   KGWCNPRWVDHTPTN"
FT   gene            complement(<1139208..>1141460)
FT                   /locus_tag="CAWG_02840"
FT   mRNA            complement(<1139208..>1141460)
FT                   /locus_tag="CAWG_02840"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1139208..1141460)
FT                   /codon_start=1
FT                   /gene_family="HOG000209091" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNQ8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ8"
FT                   /protein_id="EEQ44567.1"
FT                   /translation="MSYERIETIDNPFNDGNIIDNDTSTLFVTENNDDDDNTITTTTTT
FT                   MQKNNDDNQSSGFQESSNQDVTTVSSSSPSNSNNNITNNNNNNNNNNNNNNRFSNQRNN
FT                   NKDNFQKPTTNHNEFKDSNTDEEEEEDDDDMFEPIQFKNSDDEDEEEGDGLSSSSLSSD
FT                   INSFTDNFGNSYHNIDFDNKRYTLKLNFKGKRLVYFTSGFVSLFVSLFGYSQGVVSSLL
FT                   AFDTFNKYFNQPSAATIGIVISIQEIGAMISSIMVAKLSDKFGRKRTLLLGTFIFMIGG
FT                   SLQAFCPNIFILAIGRVFSGMGVGILSTIVPSYQCEISPSEERGKLVCGEFTGNITGYA
FT                   LSVWVGYFSYFIQDIGDSRNQPHSFTANLSWRLPLFIQVVIAFVLFLGGFFIVESPRWL
FT                   LDNDMDQQGFHVLALLYDSHVESTKPKSEFFMIKNSILQERITTPKSQRTWKHLLTHYK
FT                   IRVFVACSSLIFAQFNGINIISYYAPLVFEQAGFDNANALLMTGINGIIYLLSTIPTWF
FT                   LVDSWGRRPILITSGIAMAICLFLVATFMHINKSYTPSVVAVFVIIYNASFGFGFGPIP
FT                   FLLSSESYPLSVRSKGASLAVSCNWFSNFVVGLMTPILKQEIKWAMYLFPASSCVLSVI
FT                   VVLLFYPETKGVELEDITRIFDEFYATSPTKRVKIRGLRRKRKDKGKRSGEKYKAKYNP
FT                   LSGGGGTGTGTSSSTTTTGDFIDDQEAFEMRALNEFDFESDNDDDINVSHTRRQML"
FT   gene            complement(<1142264..>1143325)
FT                   /locus_tag="CAWG_02841"
FT   mRNA            complement(<1142264..>1143325)
FT                   /locus_tag="CAWG_02841"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1142264..1143325)
FT                   /codon_start=1
FT                   /gene_family="HOG000203496" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNQ9"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNQ9"
FT                   /protein_id="EEQ44568.1"
FT                   /translation="MLAKFKSPNAEVWKTFPPFDTPVPPSPFENEFLNKIYYASMNVTT
FT                   PLTIAIIYFTSVHFINSIIRNKQIAKYNSKTSSESKVDITKLDDKKLQKILPTVPNSIA
FT                   KTSIFKLFVFLHNVFLCLYSIWTFLGMSHTIATTMNLFEGNFLQSLVNYQPKKLDIFLH
FT                   SVCDPKIGIFSRLLTNEKGLHNLEVFGWWFYISKFYEVLDTAIILLKGRPSSLLQSYHH
FT                   AGAMMCMWAGIRYQSPPIWIFVVFNSFIHSLMYFYFSLSCLKIRVPNFFKRILTTMQIT
FT                   QFIVGGSIAILHSFVWIVDTSHVISPDNLKWVSCISTPDQALPILINVLYLLPLTALFT
FT                   AFYIESYLKKKSA"
FT   gene            complement(<1144519..>1147500)
FT                   /locus_tag="CAWG_02842"
FT                   /note="conserved hypothetical protein; frameshift"
FT   gene            complement(<1148992..>1150710)
FT                   /locus_tag="CAWG_02843"
FT   mRNA            complement(<1148992..>1150710)
FT                   /locus_tag="CAWG_02843"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1148992..1150710)
FT                   /codon_start=1
FT                   /gene_family="HOG000246747" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02843"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR007521"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR0"
FT                   /protein_id="EEQ44569.1"
FT                   /translation="MMEISPANIKEQSRSRSRSRTRNSTANSRSTSATRRPSLSSTHRR
FT                   SLSSSSLNKLTITTTQVDQERSVPSVQVYLDNSLPLDFFKQDIIALTKTLKISKWHKRQ
FT                   LTINNLSINRISGALTNAIYKIEYHDESQNIHLPTLLLRVYGKNVDELIDRDNELAILI
FT                   KLSQKRIGPRLLGIFSNGRFEQFLDGFITLNKEQIRDEILSQMLGRRMKDLHYKIELDA
FT                   KDYESKQPTCWNLIDKWLKIFEQELLPGYLEVNYNLQDIFIVPFDQFKQIITKYKQWLF
FT                   NKYDDKHFTNNYKFCHNDTQYGNLLLHESFNPKDIVVSTSDTTNSSNNIIDGEVTIKST
FT                   SNKKDTNLVVIDFEYSGANFPAYDIVNHFSEWMSDYHDPEKSYFIHQENYPNQLEQINL
FT                   IKSYIEYDFQYPSSNLKTGKTPEDLINNTTNPISIIQYEIEKLYNECIYWRATVQIFWC
FT                   LWGLIQNGPLKKPLNSNALSEQGINSTYNITVGGIENLDISDHTQDEIAGSNNDALIEE
FT                   IITSSDDDFDYLKYANQKVALIFGDLIQFGIIDEKEVDEKYLSIIKYIDTKTFDI"
FT   gene            <1152010..>1155405
FT                   /locus_tag="CAWG_02844"
FT   mRNA            <1152010..>1155405
FT                   /locus_tag="CAWG_02844"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1152010..1155405
FT                   /codon_start=1
FT                   /gene_family="HOG000093917" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02844"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR1"
FT                   /protein_id="EEQ44570.1"
FT                   /translation="MSFSTYVIIIGCAIGSIYYYLKNLELAKLRDDHAKLASHIETIQR
FT                   NLDSNRDKLQVVEKLNSELIAKSKASASIETRAIAEDKANQEKLKTQLKDITKKYNDLI
FT                   EEKIKLESQFKEKQLSIISEHNDKIKELQLSKESYESEVKNKLEKTFDFKLNTAIEQVV
FT                   AGRDLQIQQLTDELSELKKVLEQEITDHNESKVTNERKLLELQQLKDETEKKYDDQTVL
FT                   YDKLQLVNKLQLEENEQYIKDITAKEEEIESLQKKLKEMNADLTQVTKDLKDSKATIVE
FT                   IENTTKDLKLSQELLHKHLSSEKDLKDELVAKVEKLEKDITSKQFILDEQDKKLSLIEQ
FT                   PLLVLEDYLEVLKETDDNFPHSLLDHEKDVSKSIDNDSDAIKEEEEVTFDDDVFSKKSI
FT                   KVLSLAHKYIDILRQKTVSKRQLIEQQNKDIEDYKQQLMKVNSNNVILGCEIISNLQIL
FT                   QQELEKKEDKDSKVNGKIEEIKSIVNSFTSPVAPNKVSKEDITEKSQNAKTIVDETKDA
FT                   STVKNQNNTTESSTDVISNTDYNDIDNSTTAETPFTESEKDTVSESLDTTTAPKTSTTN
FT                   SDDDVAQLNDKKSIVSFGSFDEQIDEKTEESLRELKSLNRLSDKLEIKNSDTPNKSTNA
FT                   AINDVQEKTKLEKVSTLLNDDDEQKVKTEVNVELKDKTEEEKKSEEINKLTPPDVVIDK
FT                   GEPVKILDKSLGETKEIKKDTAVKPSTTTKEVSKNDSIVEPKTIKFHTEVKRETKSDST
FT                   TEPKVKETPKDTKEEIKTDAIVEPKVAKPIDESKDDIKKDSVSAEPKVAEPLDEHKEDK
FT                   TEIAKICTDTSKIAEQPPVKTEIVDSKKKEPEPLADDKTKASEDIKDVNKIEKKSGNKE
FT                   TTVDTKLETTLDKEVDTDSNIQEKKELFQIKEPVKDEKQIKEDLVKVETPSKDEEPAKI
FT                   EVPSKDETPFKIQNIDSTTDNDKAKDEKDNVSKVDSNVDTKVVTKDDQDGIKKVEEKPV
FT                   EKKDDDEGKKDNEKVTVHKDNEEEDKDKGVNETKDKVQKDDEEEEDIDKDIVIVNKEEE
FT                   DKDKDVKDVNKEVNKAVDNDKENENEEDDYNTDNENNTLKTPYDFEASPSPSPSISSQS
FT                   SQSQKSSPSKKNKKKGKKKNKTTF"
FT   gene            <1158905..>1162366
FT                   /locus_tag="CAWG_02845"
FT   mRNA            <1158905..>1162366
FT                   /locus_tag="CAWG_02845"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1158905..1162366
FT                   /codon_start=1
FT                   /gene_family="HOG000246748" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02845"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013887"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR2"
FT                   /protein_id="EEQ44571.1"
FT                   /translation="MSSSTNNDKLIKGLLKRYKKLEASLNKFNSKKYNHSNNGAILKGN
FT                   ILRTSLLPFLRISTYQLDELFTKDTPVYKSLSNVIVAVFIKWWNALISNLIFDNGSRNG
FT                   TNMPVLPKTASVEPINYSNIPAVDRNAYLEAIGRIIAHPYWNFSDDTGSYQVLLTSTLS
FT                   YVIDKLGKLKNITPPMGAFAGKVFAHAFFKLPNVSNALLFLLNVKQITFGDCLKKIPQP
FT                   AIDFNNLKTAFPEHLHYLIGFQGLQNLTTRGQKCFMNCIPAPKHPVDGIKDPNGDWVRR
FT                   WSCSDSNVFNSFFRHYINLVQTYLYEEETDTIEEVLYYCPGFNIIISHIYQIFEVSVTR
FT                   ITSTNCNPRNMTSNGNNISAVNPTNTSNGSVSPTPSNNTTKNKSTDSSTPPPPPPPAFS
FT                   HNMKQSDMYYNSIIKIFRTVRDIAYSATLNDKSIDSVSATLVKTIDSCLIAIAKETTIH
FT                   NFNKNGIVLSIVNEFINHIENNCSSELKYLVNWEFWLSCNYMMINYCDHVQSLLRNFAF
FT                   LFNTWDLIPDTLSSFVTINENGDNDDDKKNTKRSTQESLKWITETECSFKLNFVNFLIS
FT                   DEVFERFFTHWKSHGRSYYIKLLIWRIIGINNYQSSTSIQVSRNVQFKLNRAFEMLSRF
FT                   TMTYNGKIELNYKPDNPLVNRKFGVVPINIKDDYLSIDERSNDIYIPSATSLKPSELKK
FT                   TFPYEVFDEAIYTCSNSASTNGTRSDPTTPRGGSTDLLPNKPNGRIGNNNSLVNSLGRL
FT                   FKILSTDDNDNTTKATTITNNKRKSQLNDIQENVTSDLTDMATVNRVKRNSVSLTSLST
FT                   TYSFKSRSSSPSVMSYRSTPTSLTESSASTDDESVYSMDTLKTKSSSASTASSSSSSAL
FT                   FPNSYNIPPPELSRLPPEIIRPIYKFDVIVCHDSLNEKFAMIHTKNTLISRGIVNNNNN
FT                   AGSTMYMSKSPVTSYFPLSPQIPFISIFVNSDTFKNRIYMNEEDGLFLETEFDTYYRDN
FT                   NMNENNESFQNATFAQMMNLGKSLNEFNLMVEEFKQFFSNRVEIDSMNYSETDENSIFK
FT                   QQPPQIQQSYGHYIQQQRGNDNSDKVRQSSIFFSRRNSIIRGGSKSTSTNNELSTTTNN
FT                   SDSSNTTDSDNGNLTGNDISEFVYFKKIIPFLSVDSSNEMKLLNAN"
FT   gene            complement(<1162543..>1163508)
FT                   /locus_tag="CAWG_02846"
FT   mRNA            complement(<1162543..>1163508)
FT                   /locus_tag="CAWG_02846"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1162543..1163508)
FT                   /codon_start=1
FT                   /gene_family="HOG000093918" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02846"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR3"
FT                   /protein_id="EEQ44572.1"
FT                   /translation="MSWLRYLGLTVPLAALRSYLYMATTATTSLFVLLPIAMITYDQYY
FT                   KTLIPNESSPIIPLNFTTTTITYKNLKSSSNNNNNNNNNNNHISNTKNILISNAINPIF
FT                   QNYQYDDQLIYIFNINIQAICLPHNNLQHEITKINYELISSTTTETTNDKNDNDNDNNN
FT                   NNNNKSFKQGSIILNCDPYVIYSQNNQFIPFNFRFWLSPYLIEHSQINNINLLPLEIPG
FT                   DQLKNWNNFKIILNNNNNDNINNQVSTPTAAQNQEIRYLIDDNFSWIQFDVKWTGFRYY
FT                   MVKYYYSCYLIGTIIFFMVSAGVGFFTSYTILLLNNRNKL"
FT   gene            <1163902..>1165158
FT                   /locus_tag="CAWG_02847"
FT   mRNA            <1163902..>1165158
FT                   /locus_tag="CAWG_02847"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1163902..1165158
FT                   /codon_start=1
FT                   /gene_family="HOG000240902" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02847"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNR4"
FT                   /db_xref="InterPro:IPR007006"
FT                   /db_xref="InterPro:IPR016900"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR4"
FT                   /protein_id="EEQ44573.1"
FT                   /translation="MFNNITHHLTQPYIDEIFHLRQCQTYCQYNFHHWDNKITTPPGLY
FT                   ILGFIYSEGIKILTRSSSTGGGGGHLTCFNDNVLRSINLIGGVVILPRILQQFHNGWSK
FT                   NSKNQFFWSINIISQPLLFTYYFLFYTDVWSTILIMLSLGLINYKLLQYPMLSALVGFI
FT                   SLWFRQTNIIWIAFIASIFIDRQIKIKTGVIDRIRQFIMKSLTNWNKLLGYIVNIILFV
FT                   IFLKLNGGITLGDNDNHQIELHIVQVFYCFTFITFFTIPNWLNKSTIKKYYNFIINHII
FT                   LNLIIGLIIWYIMENFTIVHPFLLADNRHYAFYIYKRLLSQSYLKPLILMAYHFSSFQI
FT                   ISSLIKGGQLSFIGIFSYLIAVGLTLIPSPLFEPRYYITPLIIFNLYINHPHNLLEFIW
FT                   LNSINLITSYIFLHKGIIW"
FT   gene            complement(<1165262..>1166914)
FT                   /locus_tag="CAWG_02848"
FT   mRNA            complement(<1165262..>1166914)
FT                   /locus_tag="CAWG_02848"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1165262..1166914)
FT                   /codon_start=1
FT                   /gene_family="HOG000093919" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02848"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNR5"
FT                   /db_xref="InterPro:IPR009203"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR5"
FT                   /protein_id="EEQ44574.1"
FT                   /translation="MKFGQKLQEFVYFLTTNDKYSEFDSRKSFNRINKPDSENLLGHHH
FT                   NNSSLELVSHTNDDTSLAKNSNNSNNNLQGIHEVNLAWRHIKNWLHKYSPDLNNSLQSK
FT                   CTDSDLQDFQKDLSIKLPNCVIQYFKLVDGQYSDFESSGLIFGLKLMSLDEITTATENW
FT                   RRVAGHLNEELKQNFKSGLTKLPSSHSNSNQLTRKFTSTSNNADTSLNSIGAINDIDMA
FT                   NIGQDPISTRSSIDISTTTSRTSSTHSTNTATSMGYNSNIPPSTKKRGMNIPKQRSIPP
FT                   NFIRETFAHPMWIPLITDGVGNYIGIDLSPASEGLLGQVILFGRDFDFKFQISDNWGDF
FT                   LLIFANDLELGNWDLKQDQKNNDGDLFVGNEGDLVFIDKSSGLEVPYFEILKTRSVKKW
FT                   LDNLQKSTPETDSNEQQQQQQQHEQLLDELKNSQVSILTLSNKKFQSIDSFINNNLTLI
FT                   DSMKKSELEGKTTITANNKTKLSSPSSPVTFTNNASKIKSPLSQDVTEIILEGGEEEEE
FT                   EEKDATNKKSTQPAPRPTTTKTNIDQTLEEVDL"
FT   gene            complement(<1168674..>1171301)
FT                   /locus_tag="CAWG_02849"
FT   mRNA            complement(<1168674..>1171301)
FT                   /locus_tag="CAWG_02849"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1168674..1171301)
FT                   /codon_start=1
FT                   /gene_family="HOG000248236" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02849"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNR6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR6"
FT                   /protein_id="EEQ44575.1"
FT                   /translation="MAKYNNNSNASKATNLKQQVVLPTYTLDSNLVLLPGIMYNVTFSR
FT                   FKAAALLYRYKNFISQVSIINNLLNEYDFNSGNTNEEERFEAEQKLEQPETYHEINPSV
FT                   ISPEAVEGIKEFFQYETGMKTGRGVEKGVKSTQNDAIKEFDWLTLAIIPNLEKIKNPET
FT                   NSSAGDGSSSSKVVTVARIVGIVDDTTNIKLTLQAITRGVQIKDDGKNNHHKRGLKTNE
FT                   QVIGIDWNHNVSDLKGKFTTLQKNYQQLFQSIDKFLIDYREALDYNKNNSNNNNNNNNN
FT                   RNGNLSLIKGNSTTYSNNKNYDDKPNQDIKSQNLLTLNPLANALYMQLVGSKDFNKAFH
FT                   RLQKLFSQVIQGDEYKIDNETYLRLVDLTCGILPFPNFQKLALLNEYKLDDRSILINEM
FT                   MSQLIQIFGNLQTNTSFVNSWFHSEATNIQKATVVANQLKSIRNLLEGMTKNRPIKPNK
FT                   RNPGPASSAPSFSNGKTPPARPKVNHHQDGSHGHDSDYDNNDDDDDGDEDLKAIFNFIK
FT                   HKLPTISSLSADSKRLILKDFKRVKASANSPGGGGNSDFHVLRNYLEIVMDIPWDNYVT
FT                   KFKSNKDIDLKLAKKQLDDDHYGLEHVKKRLIQYLVVLKLLGINAEKDQALQSKDEENS
FT                   KNPAHSDSNSNSNCNSNSRSLTKSPTSSLASKTPSSIVIANNDETYLAKQQAKTRNQKS
FT                   ITEAKTNVSTKMVPSNESIQVSKNNKSPIIMLAGPPGTGKTSLAKSIASALGRNFQRIS
FT                   LGGIKDESEIRGHRRTYVGAMPGLLIQALRKSRCMNPVILLDEIDKVIGGNSGGVNKFN
FT                   GDPSAALLEVLDPEQNNTFIDHYLGFPVDLSQVIFICTANDPWNMTRPLLDRLEMIEIG
FT                   AYDI"
FT   gene            complement(<1173689..>1174865)
FT                   /locus_tag="CAWG_02850"
FT   mRNA            complement(join(<1173689..1174384,1174776..>1174865))
FT                   /locus_tag="CAWG_02850"
FT                   /product="40S ribosomal protein S0-A"
FT   CDS_pept        complement(join(1173689..1174384,1174776..1174865))
FT                   /codon_start=1
FT                   /gene_family="HOG000232073" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02850"
FT                   /product="40S ribosomal protein S0-A"
FT                   /db_xref="GOA:C4YNR7"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4YNR7"
FT                   /protein_id="EEQ44576.1"
FT                   /translation="MSLPASFDLTPEDAKLLLAANVHLGAKNVQVHNKPYVYKTRPDGM
FT                   NIINIGKTWEKIVLAARIIAAVPNASDVAVCSSRTFGQRAVLKFAAHTGATAIAGRFTP
FT                   GNFTNYITRSFKEPRLVVVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCN
FT                   NKGKHSIGLIWWLLAREVLRLRGIIPDRTTEWSVMPDLYFYRDPEEIEQNAVEEAKTEE
FT                   VEEAPVAEAETEWTGETEDVDWADSGATPAAEDAAASNW"
FT   gene            <1175993..>1177819
FT                   /locus_tag="CAWG_02851"
FT   mRNA            <1175993..>1177819
FT                   /locus_tag="CAWG_02851"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1175993..1177819
FT                   /codon_start=1
FT                   /gene_family="HOG000246569" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR8"
FT                   /protein_id="EEQ44577.1"
FT                   /translation="MTSVEPDIESEALLEIAANDAYQAIIEEEEDVDEANSSQDEDVIW
FT                   LREQIENNKAISWINRPSVYILGLVICIFMIAFASTIGVKQIILFKLACNTVANSKGYC
FT                   DPIETQVLVSSYEMYSMVGGTLVSLIPVAKAGELSDIYGRKPFFIAMFVSATTSHLCSY
FT                   LIFHHYNTFPFKLLLGAQWISSICGGMIMVPALIGSYISDIVESQGRIYALGLGMSSLF
FT                   IGQSLGPMFGNWINSIGKHLNQEQKEKIGIRAITTLSSILPSEFFLLKIEIIIDIIICI
FT                   YVITLFPESRNAKARAKSRANSITSSRSSNSNSSTRGGVGDFIGTAGDAVDQLQELNNQ
FT                   QQSSSKSKLSMFFNIFSPLVILTYPTNLINENGKHRASQYRFVVISLIISQCINMMMIM
FT                   TLGQILIQYGIFVFDWSSEDVGNLLTVLASTRAIILIVILPIFQNKILKKKFKFRVLKK
FT                   QLDMIDYSLIIIGYSVDFIFLILLVYTKSTTQVLTLGAFYSIGSIAHPTTQSTLLKFYP
FT                   TSKIGVVFGANTLLHNIVGVVAPVMIMNFYSKTLKNGWPGAVFILYSLLVLIIIILIVV
FT                   SKRVLKLNVNTTDERLIRSNSSVSLSRSNAAL"
FT   gene            complement(<1177895..>1179838)
FT                   /locus_tag="CAWG_02852"
FT   mRNA            complement(<1177895..>1179838)
FT                   /locus_tag="CAWG_02852"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1177895..1179838)
FT                   /codon_start=1
FT                   /gene_family="HOG000247987" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02852"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNR9"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNR9"
FT                   /protein_id="EEQ44578.1"
FT                   /translation="MNSIQPPLQIYFPNDLKIHYQDQGYWLGYKLNNIYIVFSLVVNDK
FT                   DLKLPPELSDLAIIGTHNQKTTKQREGGYSNYDLNLIYDHTNQLLINQNQDSYLIYFDP
FT                   PNFKNLEYFSITPILLQSMGPNLSKSQDDQLFNKLKQFEYQNPLKTKKNDQSFISDDLV
FT                   LDKINHLYRNRLLYKRFHSNRSFRALNSKKFNFFIIQNIIIPIIKFIQKMLIMMITIIN
FT                   YKFLNLKSGSNYDDGLSLVGVSRVFRQLDLRLKQFNYFPTQFLCYYYDKNILYSRNSLK
FT                   LPIFNDNLNINNSNYINLYNSIWLIFNDILIGVTLYHIIMDNFTSIIKFIRFRVMEKYL
FT                   FLELMKLITWISTENPAGFKLNTDLGKFLGDLYIWTIGFCQNIILKLDRGSQHFNYISL
FT                   ISKILGLLCYYGGCSFLLSFLIDGINLITLHIYGFYYCSAKIYRRQLEIIKSLFQLFRG
FT                   KKYNVLRNRIDNLNNYELDNNNNTTTAIDGFGFDIDQLLLGTLLFMMMIFLLPTVFAFY
FT                   LVFFIMHLLILMSLNLLENLQIIICFIPLFVILLKLKNSKRLQGGIRFEFIKFYQGMTI
FT                   LKLSNKSLTYQEIFINFIKLFRGAKNFRDSILWKFLLGKIVKIKYDNNLKFHYLMLPQE
FT                   YSETINIWKFVK"
FT   gene            complement(<1179798..>1180127)
FT                   /locus_tag="CAWG_02853"
FT   mRNA            complement(<1179798..>1180127)
FT                   /locus_tag="CAWG_02853"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1179798..1180127)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02853"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS0"
FT                   /protein_id="EEQ44579.1"
FT                   /translation="MEFIAFTFIEDSILLRLFLVLFILLVTYAVIIYLIETLFINRYPF
FT                   VNINTDKVEAPDLFLSVNSARNQTTKLLNRETFYKNLNNSSQYLRRDSYSANEFYSTPT
FT                   TNIFS"
FT   gene            <1182361..>1184739
FT                   /locus_tag="CAWG_02854"
FT   mRNA            <1182361..>1184739
FT                   /locus_tag="CAWG_02854"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1182361..1184739
FT                   /codon_start=1
FT                   /gene_family="HOG000183089" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02854"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS1"
FT                   /protein_id="EEQ44580.1"
FT                   /translation="MSKNKLSSLGNHGTTTTSSLSSSSSSSISNNTSIAKIIFVFSNIL
FT                   KLVQSIPIGHITHGNVGGDYSTETKRPVLTPEEFYMNLFTSIFLVLAGGVFAGLTLGLM
FT                   GQDEVYLKVIAHSGDSTERKHAKKVLQLIGRGKHWVLVTLLLSNVITNETLPIVLDRCL
FT                   GGGWPAVVTSTVSIVIFGEIIPQSICVRYGLQVGSLFAPFVLVLMYIMYPVAYPCAMLL
FT                   DHILGEDHGTVYKKSGLKTLVTLHKTMGVERLNQDEVTIISAVLDLKEKPVSSIMTPMD
FT                   RVYTMSADALLDEKTVEEIFNAGFSRIPIHLPNEPTNFIGMLLVRVLISYDPEDALPVA
FT                   SFPLATLPETGLDTSCLNILNYFQEGKSHMIVVSENPGEPTGAVGVLTLEDVIEELIGE
FT                   EIVDESDVYIDINKNIKRKHPGPLAKRNLTSYLHTLYQRNSSSNPNSKRNSIDSSVYRN
FT                   ANANANGNGGRVSPPLHISERLRQGSESSQISYTTNNNNTKNRKQQDQNEVAGAAAATT
FT                   TTATATATAATNWKPKNPASNPLETKKKFVTIKRPDQDKIESMKKITSPKLVPTQVGTI
FT                   YSTEKGALEEAHRRSLDEREHGPKFLLPMEREGDVSEINQQNYHGENGSHHHIDIPMNG
FT                   NGNGNDNHNDNHNQANHSNGSHTGNIDIPIPEYQESRSYKTGGIVESVVNVQGVSKVII
FT                   ENVTDADDDEDEIALAIENLSSNDNNNKKHKLKKSKKSKKKSKKSPSSTLKSVTTSLND
FT                   DDDDDDVNDDQTVEQTQSLLHSGNGSRNSSIGSNTSNNK"
FT   gene            <1186348..>1188090
FT                   /locus_tag="CAWG_02855"
FT   mRNA            <1186348..>1188090
FT                   /locus_tag="CAWG_02855"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1186348..1188090
FT                   /codon_start=1
FT                   /gene_family="HOG000248697" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02855"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNS2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS2"
FT                   /protein_id="EEQ44581.1"
FT                   /translation="MPFKNIFTSSSSSSSLNEDNVIKSTSSHRTILKQRDTSSLSASPQ
FT                   STSSRINNNNNNHPRNSNNNNINTDHPMHIAPSINSNMSQSSLSTAGTTGTTTINNNNN
FT                   STTTHSPTSTKSHRGPSLRRFFKKFKPRDHHDKSSSSHQQQQHHHHHHHHYEKQKHFGA
FT                   GKPAPINSNATNLFAKYGSPGKLLGTGASGSVNLLTSKNDPTKIYAVKKFRARMTNEQE
FT                   SDYKIKVANEFKVGEMLQHENIIKTFELIKDYSNTTKQIIDPDYYIIMEYCQYDFFNLV
FT                   MSGLMETKEIYCYFKQIINGVAYLHSKGLAHRDLKLDNCVVNKFGILKLIDFGSAVHFR
FT                   KEIPKGYYITSDDIMLAPNYKLIRARGVVGSDPYLSPEVFEPLGMGYDPRGADVWSIAI
FT                   IYCCMILKRFPWKLPKLSDPSYRSFAGPQLNNHNHHHNNNNTTATTTSTNSNNDVNGGL
FT                   VNDVNGLSINNNNNNSHSSNDYDRNTNYQSLVGPERLLRLLPIESRDLIKNMLILDPKK
FT                   RYYMPDVIQDPFVNNIHHCYTLVDVDQIIPSQDHVHHLVTEEDLNKLTQERERVKRLKD
FT                   AGMA"
FT   gene            <1188406..>1190187
FT                   /locus_tag="CAWG_02856"
FT   mRNA            <1188406..>1190187
FT                   /locus_tag="CAWG_02856"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1188406..1190187
FT                   /codon_start=1
FT                   /gene_family="HOG000166838" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02856"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS3"
FT                   /protein_id="EEQ44582.1"
FT                   /translation="MSSDVKQLLPQWIYIISFYSSITSTIIILLSIYFHLLNYRKPFQQ
FT                   RLMIRIQLIVPLFAISCYSMLINQTSPINKFLLEPIREVYEAFVIYTFFSLLTDMLGGE
FT                   RQIIIVTSGREPISHPGILRYLLPKLDISDPHTFLNIKRGILQYVWLKPILCITIIILE
FT                   LIGLYNVNDLSIKSIYFWLTLIYNASVTLSLYCLAIFWKILWNDLKPFKPVGKFLCVKL
FT                   IIFASYWQGVILAILSVLKLLPNGDIAENDGENIGIAIQNALLCIELIGFAIGHWISFS
FT                   YYPFTISQLPYGRFQFKYAIKDCLGFKDLISDFGLTFHGDYYKDYKQFDSVEAMVAHPE
FT                   SKGRMSRIHQGLRYHYDGKHKHWLPENQSLLSATTLLSQQGQGQGQGQGQLSISSNSMS
FT                   VPSTSEIHALDTSSILSNNTSMKGLYPISSRRSSSLEDNYSPLLDLQQQQQASSEHQYI
FT                   QQPISIQDIMENDLELSSSSSSSSNNHGDSIDYTNEEFDIDEILYDESIKQINIYRLDD
FT                   KKIKKIINYPIVDEVIDSHLYGYKVQKLRQRQKIRDLKSKQQQQQQQQQQNRDASGGSS
FT                   VSPILQSNESYRYGSIV"
FT   gene            complement(<1190327..>1191625)
FT                   /locus_tag="CAWG_02857"
FT   mRNA            complement(<1190327..>1191625)
FT                   /locus_tag="CAWG_02857"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1190327..1191625)
FT                   /codon_start=1
FT                   /gene_family="HOG000093920" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02857"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS4"
FT                   /protein_id="EEQ44583.1"
FT                   /translation="MSLRIILKRDFSQCIRVLESGSKSPTIANRFQAQYGNKNNNMKRN
FT                   TANNGTGNGNRFHNKYNNESRRPYPKTKYQQQQQQQQQQRKPQQHQQYIIDPRKIKFDN
FT                   GTESARNAIEEIFNRVNQLQRNYQIQLITDSGLKKCHLSEILQKLDLSINGLQLIDKST
FT                   TTTTTTTTTTTTTTNTSDEDLPLIKIITVRDMINQYSTYLNNLKQLELIKLGSSKTLKT
FT                   LDIKLKLEQKKSTTKEILMKWSINNNDFKLQKTNEIKKLINNNGGNGKSFLINMVYNKR
FT                   NTNKPINTIFKRRSNTEEDEQELIEIELKRRQLLIENLQSLLTELNCKWTIEGDINTKM
FT                   TFNVTPKGQPTTIEPSTTTNIVDEEIEDYNNNNNNDDGDCDEKKMNRTERKKRKSEQQK
FT                   QKQKQKQQSKTNTNSNTAKEEDLDALYSFKIED"
FT   gene            complement(<1196695..>1197870)
FT                   /locus_tag="CAWG_02858"
FT   mRNA            complement(<1196695..>1197870)
FT                   /locus_tag="CAWG_02858"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1196695..1197870)
FT                   /codon_start=1
FT                   /gene_family="HOG000093921" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02858"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS5"
FT                   /protein_id="EEQ44584.1"
FT                   /translation="MYCYDDMMMETSPSTTATLQFHNNIDYLQYIPSSTTTASSNNDLH
FT                   YLQDNLMLTTFHKFLKSNPQYKYHDELLFHRLLNICWRRIYKNHNNLKEYNPLEINWDK
FT                   NSDITWLYGPQLELIEKEKETIPRSCDFEMEVDNISNSSTSVNSTDEDNDDGRLDLFHD
FT                   DLDNSSISSIESYCSTLEEEEEEKEDHDNDCYYEGDEEDDYSNSNYITNSNCINKRQRK
FT                   DNITYHTTVIKVNRRHGSSSNIGGGGGGSRRRSTTSTNSSLLDDDDIDVVNAKAKQDEI
FT                   MYSNYSGNQNHHHGHECLSKKSILKTKTQTQTNNYTTTTTTNNNNNSIDCYYQWVFHNN
FT                   NSNNSKNEGGVRTNTNKQLKKKKVSFNHIVNTREIINGMSVDYDFLDHNCL"
FT   gene            <1207157..>1209445
FT                   /locus_tag="CAWG_02859"
FT   mRNA            <1207157..>1209445
FT                   /locus_tag="CAWG_02859"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        1207157..1209445
FT                   /codon_start=1
FT                   /gene_family="HOG000185918" [ FAMILY / ALN / TREE ]
FT                   /transl_table=12
FT                   /locus_tag="CAWG_02859"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:C4YNS6"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C4YNS6"
FT                   /protein_id="EEQ44585.1"
FT                   /translation="MASHSNSNSNFLFQNDKNNNSNRDIAIPTPSNSSSFRNTNTNPTP
FT                   SIRSPSPSINSYNNNNNNNSAIPTTTTSRSITGMSNASINDSGDSNPQSYDEQISQLNN
FT                   LNNKKSFDLKTISKHLINQEDSLKTQGGDITRRLYHQMENITGNNNHNNNNNNTDTTGN
FT                   DLDDNVSIGGNSTFRDGPPPRLRTRSASFSSYLEETRRGSMASDINIPGGFRREFLINK
FT                   AIQKNQQPPNFLTQNFMEFLSIYGHFAGEDFSDEEEEGDEGDEEYDNGHDGDEVFDEES
FT                   SLLGNERRGGGSGGGQPFRQLPKKSHPHPQKQPPKGTASVFKTFLLLFKALVGSGVLFL
FT                   PRAFYNGGMLFSMITLSLFGLLTFFCYIGLIESKTILRLSSFGELGYK