(data stored in ACNUC8465 zone)

HOGENOMDNA: CANDC_2

ID   CANDC_2; SV 1; linear; genomic DNA; GRV; FUN; 2289089 BP.
XX
AC   FM992689_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
DE   chromosome 2, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; mitosporic Saccharomycetales; Candida.
XX
RN   [1]
RX   PUBMED; 19745113.
RA   Jackson A.P., Gamble J.A., Yeomans T., Moran G.P., Saunders D., Harris
RA   D., Aslett M., Barrell J.F., Butler G., Citiulo F., Coleman D.C., de
RA   Groot P.W.J., Goodwin T.J., Quail M.A., McQuillan J., Munro C.A., Pain
RA   A., Poulter R.T., Rajandream M.A., Renauld H., Spiering M.J., Tivey A.,
RA   Gow N.A.R., Barrell B., Sullivan D.J., Berriman M.
RT   "Comparative genomics of the fungal pathogens Candida dubliniensis and
RT   Candida albicans.";
RL   Genome Res. 19:2231-2244(2009).
XX
CC   This Genome Reviews entry was created from entry FM992689.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2289089
FT                   /organism="Candida dubliniensis"
FT                   /strain="CD36 = CBS 7987 = NCPF 3949 = NRRL Y-17841"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 2"
FT                   /db_xref="taxon:573826"
FT   CDS_pept        join(complement(3520..3645),complement(2990..3541),
FT                   complement(2854..2925))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   mobile_element  4592..7829
FT                   /mobile_element_type="LINE:2A, Zorro1-like"
FT                   /note="5' truncated ORF1 + 3' truncated ORF2
FT                   (subtelomeric)"
FT   CDS_pept        join(4592..5980,5982..7865)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581739"
FT                   /orf_name="CD36_15030"
FT                   /product="Polyprotein of l1-like non-ltr retrotransposon
FT                   zorro 1 (Frameshifted), probable"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAX43281.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR015706"
FT                   /db_xref="UniParc:UPI000192CDCA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA62"
FT                   /transl_table=12
FT                   /translation="MDKAMLYIAKEDNCRVNEMNDETYRVEYHDIVQESNELFPKLDTQ
FT                   TVVEHFIKKYPMIETEKGPIKLTIQNIQHDNIGIFRLSHGVPDWQVERYIESFFNNKSK
FT                   KWRSTLKSRANIPVKGGEDIDFTVLKSCKNEAVKGSTKSRYGETTASFFMIGWSGNRMP
FT                   KKTRYFWKTRRLDLASTAKFCTTCRTLGHTRWTCTYGNHCFRCNENSHSTGGHFAYMEA
FT                   QEAKVAKTTGYTLISKNKKKRRVQIPGYPPKNSPANQGQTISTNQGTTKNLPADQGPTT
FT                   PAEQGKTTSAEPGKVQNTSAITAPTEPVSQDGVQTPSENTDPFKTVVTNWVPTIREHTE
FT                   PVVEGLNKINYTNNSTVTTPKPVKPLESVWMNETSKEDEEITILEERKVPRIRKPAQNP
FT                   VSMSSEEDDENDADYTDETMDEVSEQDSEDDNMETEDYQDGITNVDVPEETINQFIQIK
FT                   NESQYEYVNVGSFNCEKTQNVLAPQELIEKYDILFLQELNESNIKIIKKLNLPTTLIFS
FT                   EKTGIIIHHKINGLIKVHKQHVIDIGIQLPPYLSDALVTINKKKYHLINTYYPIADKSK
FT                   QQKALTTCLSENLTKDKPIIWGGDFNHILSKTLDRSYEGADKPGEAGSRKLSLELYHQL
FT                   QLKDVFRSLFPTQKNHKNNNPHNNRRIDRFHISETIDVGEFHQEKLTTIKSTHDLIAIT
FT                   VKISNKPIIDMGRPRFIIRDNLMENPLFIKDIIKNKPKNWKQLKQTIAKLTKTKRYKKV
FT                   EKELDSDTFDDLRVRFDGKTKPKNKAILKMEDVDGSIAETTDEILIIAKHFMETLYKKS
FT                   PNIPNNITHYLKEFTTKVTNDERAKLDAPITLNELTDELTGKSASSAPGEDGFNFRFIK
FT                   ICWDVIGPILVNVSEEIQNSGKLPQELQNIIINLIPKKGKSNHINNTRPISIIDCAIRL
FT                   ISSVYNSRFQKILTNYISPNQHGFLSGRTISDASQKIQLVIDEMNKHKRKISGPGAILV
FT                   DMAKAFASLDHSYLKQVLKKFNLGPRTISFCMAITSGHKGQVSVNNKTSEEFKLDRGVR
FT                   QGNPLSPLLFILALEPLFFQLNRRIQGIHMGKKSRVTRRHIL"
FT   mobile_element  complement(7841..7938)
FT                   /mobile_element_type="LINE:2G, Zorro1-like"
FT                   /note="partial ORF1 (subtelomeric)"
FT   tRNA            complement(10221..10292)
FT                   /gene_name="tRNA-Val (CAC)"
FT   CDS_pept        complement(10377..10970)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581740"
FT                   /orf_name="CD36_15040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43282.1"
FT                   /db_xref="HOGENOM:HBG396239"
FT                   /db_xref="UniParc:UPI000192CDCB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA63"
FT                   /transl_table=12
FT                   /translation="MYPCNFYFFFFFCPAMIFLVLVCLFVLVRGGLVKNEVDSVGYRFS
FT                   LGVETGNSIYKVFEIGDGQLFHGNTTVQCLTGNSTYQTPDPCGNCESAAYCKVRKSPQY
FT                   IVLTSGVLRNQRGAIGEIVANHQFQFDLPSQPDALFNKGWSIVSWNGKSLLALNGDTQF
FT                   WHCQAGTNGLYKLYNASIGGQCSPVYIVVLQQVW"
FT   CDS_pept        complement(11036..12190)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231783"
FT                   /orf_name="CD36_15050"
FT                   /product="Esterase/lipase, putative "
FT                   /protein_id="CAX43283.1"
FT                   /db_xref="HOGENOM:HBG398400"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI000192CDCC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA64"
FT                   /transl_table=12
FT                   /translation="MITIDFFLKLVTLPYTVTKTVLQYYTVGTVYSRTNREFQGSLWKN
FT                   VLLSVQYHVSGNYKKQNIKAVVYQPIERVIAKFKKHPLALALNHFGEKFDEYSFWIHKS
FT                   EDPNAKVLIYIHGGGYLLNMFESQFVFVAALHYALDDRAAEKTSILVVDYSLTMFDSVY
FT                   PTQLYEHLVTYHNLVAQGYKEIMLLGDSAGAHMSLSLARAIAYPEEVEDQLARHGFKVG
FT                   FSVGDLPQPETLILVSPWVQPCTEPKLPPRHGCDVWGDLGAQDTTMGELYAGDNDKSVI
FT                   NNFLTFTNTTWAEHWKEVAALNNGNTLMIVGEREVLRDGVDDFYEIIKGSVEYYTEPGG
FT                   IHAGLVYVESLDYVSKHGAQRAIEGDFTDKFAYNLVAKFINERV"
FT   CDS_pept        complement(12286..13902)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581741"
FT                   /orf_name="CD36_15060"
FT                   /product="U3 small nucleolar ribonucleoprotein protein,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX43284.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG396177"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniParc:UPI000192CE13"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA65"
FT                   /transl_table=12
FT                   /translation="MREDTLERIYDRPYEIFSLRKSNGEFFNKLVKSFIDPLAKKYSVL
FT                   DEIYVDGLDSSQVFGQTKMVLDGVGEELLGVMSEINRVVEKPEEEEGQSEEEEGQSEDL
FT                   EEEKESEPEEDEPHQQSEEELEEESEEIPEEPESETETLTDPIQKDAFGLNDGFFDIDQ
FT                   FNKQVLAMERDNGDDEIDYFDSLSEDDEEEMDYYNDFYDKPGKFKPAKEEKEFEEEDYD
FT                   NAVNSAMLDLFAEDEQPAESLSSFEKQQKSIQAEIAKLEAELVADKKWTMKGEITSNER
FT                   PQESLLEETEIAFDRTAKPVPVITEESTQTLEDLIRKRIKEDEFNDLPRRIITDISKFH
FT                   KAPKAEVSEQKSSKSLAELYEDEYNNVDAQQESINEEVKKQHDEISELFTKVTHKLDAL
FT                   CSAHFIPKPHQAKTIDIKVSPVVSMEDAQPLHVSSEARLAPQEIYKIGDDKGKEVQLKS
FT                   GLSYSKDELSRDDKQRLRRAKKRKKAKVFNDAKRQKKDSVVDTLASAKNVTVIGHKGEM
FT                   RDVRGNLKKDGGVQSSNRFKL"
FT   CDS_pept        complement(13970..15280)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537380"
FT                   /orf_name="CD36_15070"
FT                   /product="Alpha-1,6-mannanase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="CAX43285.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG396470"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000192CE14"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA66"
FT                   /transl_table=12
FT                   /translation="MYRLFKILVLIPLCLSAPAVRVMVVTAPVEVVTVTKVYTGVGTQT
FT                   SGGMASPTKSLAPSLVETSVSPSASSPSVTVNSYYDTMAKVWQRFWVSQDGKWNDKDSI
FT                   CNDGYALPVLWTMAVLGEAIIKTGDVSGLEVTLDRVMDYYDSNTKAFSASPNETAEVYS
FT                   DDNAQLAWVFIDAYKMTGKKKYLGYAQDIISYIQTQQGPNGGIIWRKDKNYIASISTAE
FT                   AALAAVRLYDITHDQSLIDFATDCMEFMFKNLQDPKDKLFYDGTDKNDLSQIDKGKLTY
FT                   TVGCSISTLVYLHKYRGDPDMLDKASELASAATNSGGAFYDGNGHWNNKLEYVHLLFAG
FT                   FADAFELSDQFGEYKDEVVKQGNYIYEYLQDPKDEGLYFTSISKSTRSTFDQYSKSFRG
FT                   GFDEDKSVYCNDDPSQPGKKSLLVNASAVQILYFIPK"
FT   CDS_pept        15457..16080
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581742"
FT                   /orf_name="CD36_15080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43286.1"
FT                   /db_xref="HOGENOM:HBG396291"
FT                   /db_xref="UniParc:UPI000192CE15"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA67"
FT                   /transl_table=12
FT                   /translation="MKVYKHPILVNPTRWLRGPKKHAKPLYQSGYYPSLKSNPFAAALS
FT                   RLDANSPSSTLPIGNGIPLTVSHRADNTYVLTPNIHETPTQPSRLLINSARYIKLIVDR
FT                   PKAIQKLVPLQFIQQCKSSKARVTIDKDIVEQIDTLYRQKIESLLPDSSECGDYGIILK
FT                   PMDVPVRIDGGTTYVNSTFNTFINYNTHRDLAQLILAYTDFVNL"
FT   CDS_pept        complement(16085..17236)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581743"
FT                   /orf_name="CD36_15090"
FT                   /product="GPI-anchored cell wall protein, putative "
FT                   /protein_id="CAX43287.1"
FT                   /db_xref="HOGENOM:HBG398421"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniParc:UPI000192CE16"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA68"
FT                   /transl_table=12
FT                   /translation="MLFSSLLVSTLVSVATAANEQVEAIQFNNLGFSGTYNQVEKLSNI
FT                   YKDSCSCEVNKTPVSFSGTNAPLNEEVSVHFRGPLVLNKFASYVSDGFKYGDDSSGDWK
FT                   RLSYYEGSSGTSENVTFLTRAGKNSSCLGLGLTYAGTDGTSKADSSTVLSKNTLINSND
FT                   EFVIFSNISCGKSGYNNDCGVYRSDIPAYHGFYGTTKMFLFEFQMPNETHTSTDISNYN
FT                   MPAIWLLNAHIPRTAQYSMNANCSCWRSGCGEFDIFEVMNSTEYLHLYSTIHDYQGSDD
FT                   IQTGMAAPAYIERSLSGTMSGGVAFDSSGNAVVWMSNSTSFDATVGASSVNSWVKKAGA
FT                   DVATTMATVTGQSATTSKKNSGVSYQPSFITNLIMSVLTLWVI"
FT   CDS_pept        17653..18288
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093530" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581744"
FT                   /orf_name="CD36_15100"
FT                   /product="NADH-dependent oxidoreductase, putative "
FT                   /function="FMN binding"
FT                   /protein_id="CAX43288.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG396346"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000192CE17"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA69"
FT                   /transl_table=12
FT                   /translation="MHRLRKYSSSCLSEQFRLAMGRTASQAMILTSATTTINELHGMTL
FT                   GSVCSLSVFPSPLIQFNLHLPSYTSTELHKHKFLALHVLPPTKNSVHLSRIFAKGVKLN
FT                   KGTKLAATKEEKIDGQVFHEMTKPFTRLQQGVDYSFYDIAGVQIPVLNDVETTLICQTQ
FT                   DTFPVDNHEIWVASVVDILHNKTYSQKSGGILYFDRGFHKIGKSLSED"
FT   CDS_pept        complement(18298..20442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581745"
FT                   /orf_name="CD36_15110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43289.1"
FT                   /db_xref="HOGENOM:HBG396351"
FT                   /db_xref="UniParc:UPI000192CE18"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA70"
FT                   /transl_table=12
FT                   /translation="MQQTSTTNRNVTPSYHDTNSNHEILQTTTARMRSRSTSDLHHQYQ
FT                   NNNANFPSSSSLRDILSVVFIMLSFPQYMSLGLLVVYLMLGSNFMGGKFLINFLLPQSH
FT                   KLTFASFKHSFVTFIKMGGIDVFLFYGLSRVVKRKSYFNYLVILSKAIVASEFIGSSSI
FT                   NYINSISSKKFTTKIQYDDKNRIFNSNLINAIVCFIIINYVNYVLNWVNLSFQLFNTSQ
FT                   YSAHITNFNFSQWNVQVYLFLCIHTIIQALFRKSPIAQSSIPSITDDISVNVDNNKLLD
FT                   IEIKDLPKFNGNYASNYSVALKNFENFIISPFNSKLSVMKNRMRASSLSNLAMKTTTTS
FT                   TTTSLTSSTTSTSLTTTTISPNVTLIENTIIVQPFWSIIAAVKAILKNPNLFNGESTKK
FT                   KNEGGVFLTKEVQPNVPMAIMVIDSSKVVLHLLSSIPSDIQVRLNNIKWSYFKVVGEYL
FT                   VIYGLTPLFQYEVDIVAQSQVLNHLVINTTNDDNQIMNKSSKETSSLATLQTSLELVMN
FT                   KTETLKAKLKKYKKDENKKITEMRNSIELLKSKISKNRQGNDNRIFGKIKGLKHSVMQL
FT                   ENEIEGLNKEIAELNKTECELQEAMKSKESMQVQEIAELNKTYSEFESRMKDARAELKN
FT                   ASHELASLSAKSQKLMAKQAAKQEELRNLSTDIKNIKKNEISAKFTKRMKRTNEKFETI
FT                   LPKIIEETENLTLEYNELVA"
FT   CDS_pept        22610..24139
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581746"
FT                   /orf_name="CD36_15120"
FT                   /product="Meiosis-specific transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAX43290.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG447530"
FT                   /db_xref="InterPro:IPR007888"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="UniParc:UPI000192CE19"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA71"
FT                   /transl_table=12
FT                   /translation="MHPSAQANNHQHAPQPYQQMSHYNAQQMHQQQLHHQLMTPNPYQQ
FT                   HFQQQMHPQLHHEDHLNMHFNPMSFQQQQQQQQAQQHLHHFGHQIPTSAQQQGPAPQQP
FT                   HLHQQIPHPLSHHQTPQPTPQPLVQQQQQQQQQSPQPARQPRQTKKQKQQQQQQQQANQ
FT                   DRADAHSQAQQHHMAMLARANQNDMLESSTRKVAPRSSDLFRVGPPFSITKQHQPVYCV
FT                   GTDMPVTPLLHARIDRGFEMGETGSWIGYKRNYFTLVASFTLQDFDFEKFIGNKFYTYD
FT                   KINNKVNGFPPHHPSHPQNQPQNHPNHPHHNQHAGEVRVPITYFAIRLVAKCSDEDVAI
FT                   SLIQHTAKRDKGPQFPPPIYPAVPSDLPDHETVKVSCNKRNNNKIETMNKIFYFDRGNY
FT                   YQEYNLDSYKDQSILKSYPSQSISKVARFERIQFTSSIRVKSTNTAARYFTLHVELLGI
FT                   IEDEDLQIQPILLSSIESPPLIVRGRSPSSYHKDRTSGYRATNTPTPTPPQ"
FT   CDS_pept        24609..25826
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231784"
FT                   /orf_name="CD36_15130"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX43291.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192CE1A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA72"
FT                   /transl_table=12
FT                   /translation="MTQSNTNSGTDKVPNVSLIPSSAKPVYTRIPIPGHLSNDQSTPIE
FT                   DIKIIDKQSIDYIIRSGLAGGLAGSCAKTLVAPLDRIKILFQTSNPEFLKYRGTFGGFI
FT                   DAGKRIWKTDGVMGLYQGNSVTLLRIFPYAAIKFVAYEQIRTFLIPNDSYETAARRFMA
FT                   GSLSGLASVFFTYPLDLVRVRLAFETRNLSHAQIHHHHKEFMAHRRGRIFSTVMLIYNE
FT                   NPPIKTTDPSWLKFMRKFSPSPIQHLANFYRGFAPTILGMIPYAGVSFYTHDLLHDILR
FT                   SKWLAKYTVQSVNHQNVVVKKKGKSSRESRAPLKAYAQLFAGGLAGLCSQTAAYPFEVI
FT                   RRRMQVGGAINQGQFLSFKNTAKLIYRENGLRGFFVGLSIGYMKVVPMVACSFFVYERM
FT                   KKFLGI"
FT   CDS_pept        complement(25880..26527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093533" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581747"
FT                   /orf_name="CD36_15140"
FT                   /product="N-terminal peptidyl-methionine acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.88"
FT                   /function="peptide alpha-N-acetyltransferase activity "
FT                   /protein_id="CAX43292.1"
FT                   /db_xref="GO:0004596"
FT                   /db_xref="HOGENOM:HBG396072"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI000192CE1B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA73"
FT                   /transl_table=12
FT                   /translation="MFLFKGFGVAFRPINNGIFRSFRFQSTRIPPNKKPQGIKALMKEY
FT                   GYPALAVYLGLSCIDLPICYVLVHSMGQEKIEVYENKVKQTFGYGVSDEELKKKQEINK
FT                   IQQDIESHGEPAPENSGSMASYILSQFSWTEFAIAYGIHKSLIFIRLPITAAITPGVVR
FT                   VLRGWGFRIGTDKFSTTASIAKDLAKSGIKDITASSTKFGVKAGNKKWWWFF"
FT   CDS_pept        complement(26619..27914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581748"
FT                   /orf_name="CD36_15150"
FT                   /product="Hypothetical mitochondrial outer membrane protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX43293.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG621057"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192CE1C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA74"
FT                   /transl_table=12
FT                   /translation="MSPRSVILSVVATAAVTIGLVEAFHCYERKKVAPQTTPVKRDHSE
FT                   ELIREQLARNYAFLTEDGMDKVRKQRVVVVGAGGVGSWVATMLARSGVESLRIIDFDQV
FT                   SLSSLNRHAVATLKDVGIPKVECIKNHLLEIAPWIEIDTRNQLWNLESAEELIYSDGFQ
FT                   PTFIVDCIDNLDTKCDLLTYCYEKKLPIVSSGGAATKSDPTRINLADISKTEEDPLMKK
FT                   IRVILKKRGIVNGIPVVFSAEKPDPRKAKLLPLPDDEFTKGDVDQLSALKDFRVRILPV
FT                   LGTMPGMFGLAIATYILTTVAGYPMEPVEGKNRYKIYDDLLQSLAGQQTRIGKTDQRVQ
FT                   IAMHEVNYVLEEVFRGKSPISNYSTRLTLSRWDPSKEISLQNVVVMTKDEQRNHEKRVL
FT                   NGGEKIEDVYSKEVVDLVKSRFADEKYFSQFR"
FT   CDS_pept        complement(28010..28921)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581749"
FT                   /orf_name="CD36_15160"
FT                   /product="Urate oxidase (Uricase), putative "
FT                   /EC_number="1.7.3.3"
FT                   /function="urate oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="purine base metabolic process "
FT                   /protein_id="CAX43294.1"
FT                   /db_xref="GO:0004846"
FT                   /db_xref="GO:0006144"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG558657"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="InterPro:IPR019842"
FT                   /db_xref="UniParc:UPI000192CE1D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA75"
FT                   /transl_table=12
FT                   /translation="MQSELYSSTYGKGNVKFLKVKKDPSNPTVQDVLEANVQVLLRGKF
FT                   DESYTKADNSSIVPTDTVKNTILVEAKTTDVWPIERFAAHLAKHFTSKYGHVDGIEVTI
FT                   IQAKWSKIRLEGKEHAHSFKHEGPETRRTYLNYDKHTKKLQLSSSIKDLTVLKSTGSMF
FT                   YGYNVCDYTTLQPTKDRILSTDVDASWTFDPAQITTLEDILSQPKLFDTTYNTARDVTL
FT                   ELFCKENSPSVQATMYNMSHKILENVKEVGTVTYVLPNKHYVLFNLEWKGIKDNKDLFY
FT                   PSPDPNGLIKCTVGRKGDKAKF"
FT   CDS_pept        complement(29151..30548)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581750"
FT                   /orf_name="CD36_15170"
FT                   /product="Peroxisomal membrane protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43295.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396085"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI000192CE1E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA76"
FT                   /transl_table=12
FT                   /translation="MEASSGSTKNEKATPQSVVGESATVPGTSTETTTELRANFADATD
FT                   PKISAKPQSSPLLSSTPPSVSKALVNSYPYLIIINKILSITTWTNDDYWVNVVIISLYA
FT                   LVVLYFENLVIWSGHLILVAILISYALLNNKIIKEANLHPTLDDVVQALTSTCVKADIL
FT                   LSPITSLSLTAYDIKRLIFTTLFLTPVYLVVTFLLIKPRTILLLSGVYLLTYHSSYSIV
FT                   TRRILWKLKIVRLIFFYLTGLDLSETKNHSLFAAAFAKVSSSGTTSSKSNKPVRFTYVI
FT                   YENQRKWLGIGWTSNLLSYERTPWTDEFLNESSSIDSFKLPNASDDAANGDSNMQGATW
FT                   RWVDKTWRLDLTNDGAITLSSSKRSKTTANPTNDEGFIYYDNTWKKPSTEDTFSKYTRR
FT                   RRWIRTAELIFDNKQDDVLDSPEKVTATGVSVQDSTTNKKVKSLRFAEDEQESNKEKSA
FT                   DTDKKND"
FT   CDS_pept        30755..31555
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581751"
FT                   /orf_name="CD36_15180"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /biological_process="RNA splicing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAX43296.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG396091"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="UniParc:UPI000192CE1F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA77"
FT                   /transl_table=12
FT                   /translation="MDFSNLLSNEINKKRKKVTANGRKRSKVSAKEPAKPNLPEPITPQ
FT                   PTTTDNEPSEEQLDKKLSQFGESDPSLTKPEKARKLQLLLQQQIKNTKYKSWLDQEAPL
FT                   YQDPEKQLITLDLITDIANKQDEVYLKLRVYIKQLIKQWQECDNDDQELLMETKKSIVK
FT                   LLYKLRNHKLSLDMLISLSTIVYYIQQNEFNKANESYMKLSIGNVCWPIGVVNVGIHAR
FT                   SAASKITGASNVSNIMLNESTRRWIISIKRLISFKERLCNNARD"
FT   CDS_pept        31718..31954
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080449"
FT                   /orf_name="CD36_15190"
FT                   /product="Ribosomal protein L38E, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43297.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG748692"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="UniParc:UPI0000036CE1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA78"
FT                   /transl_table=12
FT                   /translation="MAREIKDIKEFVELARRSDIKSAIVKVNAKVNANGKKFKQTKFKV
FT                   RGSRYQYTLVVNDASKAKKLQQSLPPTLKITNL"
FT   CDS_pept        complement(32062..33213)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384655"
FT                   /orf_name="CD36_15200"
FT                   /product="Transcription initiation factor IIF, beta
FT                   subunit, putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="helicase activity"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIF complex "
FT                   /protein_id="CAX43298.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005674"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG396105"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000192CE20"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA79"
FT                   /transl_table=12
FT                   /translation="MSSIKTSPTKKTSESTTKQEAGDDQTNIENFDEEPSMLSDPEDYL
FT                   EENETLDMNLSKGDQKVWLVKLPKYLMDEWSNPESMNGQHLGNVKIKKDARGKLQVKLV
FT                   LDNNKNEKIPKEYDIRMLNTQVRNSYVFTEENLKKFKQELTEVSDMPEQPQLKDLNPEK
FT                   KKFQVRRKFKYFRVQKEGENGQPVKKYIPFVKTIPKKTSLMGKVCHDCTVVPARTASNH
FT                   GETLMKRQNMIQGKERPKVTLLNEIPGVIQSNAGPSIKGNTASIFLKSTQGKNKNEGRA
FT                   IRMPKKDLLDLLFRLFEEYEYWSMKGLKERTRQPESYLKESLESIATLIKRGPYTSKYT
FT                   LKPEYRRLRDAERAVRLGLDNDDEQNKENNEDEDEDEEMEDVV"
FT   CDS_pept        33359..34747
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231785"
FT                   /orf_name="CD36_15210"
FT                   /product="Arginyl-tRNA--protein transferase 1 "
FT                   /EC_number="2.3.2.8"
FT                   /function="acyltransferase activity"
FT                   /function="arginyltransferase activity"
FT                   /biological_process="protein arginylation"
FT                   /protein_id="CAX43299.1"
FT                   /db_xref="GO:0004057"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016598"
FT                   /db_xref="HOGENOM:HBG396111"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017137"
FT                   /db_xref="UniParc:UPI000192CE7A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA80"
FT                   /transl_table=12
FT                   /translation="MILTPPHYFGDRHCGYCKHSNKRDYYALESQIGSNFPQQSVTIGS
FT                   SVWQMSCKEYDELINTGFRRSGTFLYKPDLLRTCCRLYTIRTRLAMCKLTKEHRKVVNR
FT                   FIKEICPELPQPKKNTFDLNRLYEAQLQSKRFQTRFEPSVFSKEKFELYKKYQVSVHND
FT                   DPDDVTESSFKRFLCDTPFPDDEVEGDKDQFQGLEPKNWGTSTTPRAGPTHELYFLDGK
FT                   LIAISILDFLPSGVSSIYFIWDPDYAHLSLGTLSGLKEMQMCEKLDYSWYYLGYYVEDC
FT                   VKMKYKRKFGGELLDLCNEVYFPLEIVDPYIKNGRLFVIGEKDDEYESELEIESLGAPL
FT                   DYKDSDFFGKKLVNVAEDIYGNERVNEDAKKARQILKVKYQIDPNNSQLRLPNVVPGII
FT                   PLWQILEWFDMGTIDEEYVVEIFMGGKMLEYSLGELNGEGRAIVVDCIRAFGLEKVQGM
FT                   VIML"
FT   CDS_pept        complement(34819..35772)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231786"
FT                   /orf_name="CD36_15220"
FT                   /product="Cu/Zn superoxide dismutase, putative "
FT                   /EC_number="1.15.1.1"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAX43300.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG447527"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="UniParc:UPI000192CE7B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA81"
FT                   /transl_table=12
FT                   /translation="MIFIPITILIFLLSLAASDKSPKIKKNPRNVVAVADFPFGGDTQV
FT                   KGNAVFSAKEGKYVNVHIDMTGLPKDEGPFFYHIHERSVPGNGNCEAVGLHFNPYNASP
FT                   VCDEQKNDAYCQVGDLSGKHGCINTTCFELKYSDPYLSLNKKSKSSIIGKSLVFHYPNL
FT                   TKIACADIEEANELRLQSLIEEYTQTDDTIQLKELNTPLENDYTFDEVEALSSEVYHSD
FT                   TDPDPPQQQELVSTEKLYNKTDNVYTPEEPKSSDQNKKSHRHSLLPLAKWKKNSPKNYS
FT                   NISLHGISSDCLNDGMMVTSSIFGSLVLGIAAGMFV"
FT   CDS_pept        36592..36861
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080450"
FT                   /orf_name="CD36_15230"
FT                   /product="STF2-like protein, putative "
FT                   /protein_id="CAX43301.1"
FT                   /db_xref="HOGENOM:HBG396127"
FT                   /db_xref="InterPro:IPR006861"
FT                   /db_xref="UniParc:UPI000192CE7C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA82"
FT                   /transl_table=12
FT                   /translation="MTRTNKWTVHEKRPQEPKWFTHNGHSDTDPTKVKKNGAGKNNWGQ
FT                   PGDELDDDEVRHYQKSTGRRNSNHEMNKERLNNLNDKLDNQLMN"
FT   CDS_pept        join(complement(38037..38109),complement(36936..37981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080451"
FT                   /orf_name="CD36_15240"
FT                   /product="Ethanolamine-phosphate cytidylyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.14"
FT                   /function="ethanolamine-phosphate cytidylyltransferase
FT                   activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX43302.1"
FT                   /db_xref="GO:0004306"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG378440"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192CE7D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA83"
FT                   /transl_table=12
FT                   /translation="MYERPEGIENCRIWIDGCFDFAHHGHAGAMLQARQLGKELYVGVH
FT                   SDEEILANKGPTVMRLDERITAVEACKWTTRAIANAPYVTDPKFMDEYGCPYVVHGDDI
FT                   TTDANGEDCYQVVKDMGRFVVVKRTPNISTTDLVGRMLLMSKDHHYPAISRATETLLTQ
FT                   DNLDRFKRYATDETGLNAGSGVYLNRGELEVIVSPKTEIGDIVYIDGGFDLFHPGHIEI
FT                   LKIVQQEAKKLGAKVVVGIHDDAEVNQYKGLNYPIMNLLERSLCVLQCRYVDAIILGAP
FT                   YIPTPEFFSKLGKSKVIKVYHGPTEIDQGVYDEIDPTIYETIGKHKYDDMNTEFIVNRV
FT                   LANKQAYEERQKRKGWKAEIEKKLKQSEQSQQ"
FT   CDS_pept        complement(38247..38942)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581752"
FT                   /orf_name="CD36_15250"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43303.1"
FT                   /db_xref="HOGENOM:HBG396141"
FT                   /db_xref="UniParc:UPI000192CE7E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA84"
FT                   /transl_table=12
FT                   /translation="MSQIQDQLENIPGYDVVMDYFNEYGEEHWNAKINPFEDENGNKRR
FT                   LPKDLATKHDQQVWKKIQSQAWTDDKCFLGSCAVGLDCGLGLAPLVVLIFPVLGPLIMY
FT                   GVHARVINIAQKNYNLPNTLIAKLQTNILIDLLITFPPVIGSFFGWLHACSTRNAGMVY
FT                   VYLEKMLKHKASDQGVSYVGARMTAGTYGDSSRQGIAQPQTVKSGGLFKKKQTTDNSIR
FT                   VGQQESGFM"
FT   CDS_pept        complement(39013..39648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581753"
FT                   /orf_name="CD36_15260"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43304.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396146"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192CE7F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA85"
FT                   /transl_table=12
FT                   /translation="MFKKRVIKDSRVSKRKIDDINETSDDVSTTQVKKKNTVITKKSDV
FT                   QKKPVVLPQLSPEIPSSKSASDDAAVEVVSRKSKKGELKPLAANIKTTIITDFQPDVCK
FT                   DFQQTGYCGYGDTCKFLHVRDESKQRIPIKKDWEVGGQKEVKEKEAIPFKCVLCKGDYK
FT                   SPIKTGCGHVFCKACFLDRYKTKKKGTCYICHKETNGNMIPVNPDKLS"
FT   CDS_pept        39818..40456
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581754"
FT                   /orf_name="CD36_15270"
FT                   /product="Molecular chaperone, putative "
FT                   /function="chaperone binding"
FT                   /function="heat shock protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX43305.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG396151"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="UniParc:UPI000192CE80"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA86"
FT                   /transl_table=12
FT                   /translation="MLTRFIGITRSGICRTYSTASTKSFYELFPKNFPHGGPPQDSFIV
FT                   NDKSLRREYRSLQSESHPDISSDTIKSSNINRAYTTLKNPYTRIAHFIHLKSPDHVNIT
FT                   DDAVAKQLIKNYQKKSMEASMNYKEMLMQVMEAHEQLELAESENELETLGAENDERIRS
FT                   TEEKINQSLKHTSIDWEELMMDAIQLKYWVNIQNGIKDWEPGKPVHLTH"
FT   CDS_pept        complement(40536..41420)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384656"
FT                   /orf_name="CD36_15280"
FT                   /product="Casein kinase II, regulatory (Beta) subunit,
FT                   putative"
FT                   /function="kinase activity"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="CAX43306.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI000192CE81"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA87"
FT                   /transl_table=12
FT                   /translation="MPSDPEEDYIPWIQQFCELFGHDYFVQVSQDFIEDDFNLTGLSSQ
FT                   VPYYREALYTILDYQVETAEDHNNDNTNTTNSNNNDSRNGTSKRNASELPNKALLAHSA
FT                   ELLYGLIHARYIVSKQGLTAMASKFERNDFGSCPRYFCDGMHLIPVGSTDVPGQETVRL
FT                   FCPCCNDIYIPSSSRYLNIDGAFFGTTFPGLLVKMFPEIENQCRIRITKFSQNDFGLKL
FT                   FGFKINELSATGPRMKWLRMHPKTEDEKQEYDSCEYNVPISYLDEDEEMDEDDEDEEDE
FT                   VENEDDDRTMASE"
FT   CDS_pept        41826..42425
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080452"
FT                   /gene_name="GET1"
FT                   /orf_name="CD36_15290"
FT                   /product="Golgi to ER traffic protein 1 "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43307.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG396163"
FT                   /db_xref="InterPro:IPR007514"
FT                   /db_xref="UniParc:UPI000192CE82"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WA88"
FT                   /transl_table=12
FT                   /translation="MLLPDLHPYTILLSIFIVLLLKQLVASIGKSTIKEFVWLVYLKVS
FT                   SNQSIKTYNSKQHELHETNKEKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQK
FT                   ASIDKVSNALLLVLTTLPIWVARVLYRNTHLFYIRQGIFPKYVEWVLALPFLPNGAVGL
FT                   TIWMFAVNSVVSNFAFLVSFPFAKKVSKPVRDTKIE"
FT   sig_peptide     41826..41906
FT                   /gene_name="GET1"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WA88 "
FT   mat_peptide     41907..42422
FT                   /gene_name="GET1"
FT                   /product="Golgi to ER traffic protein 1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WA88 "
FT   CDS_pept        join(complement(45224..45260),complement(42454..45158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080453"
FT                   /orf_name="CD36_15300"
FT                   /product="Histone transcription regulator, putative "
FT                   /function="chromatin binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43308.1"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG396168"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192CE83"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA89"
FT                   /transl_table=12
FT                   /translation="MQILKIPWFGHKTENKTVECYAVTINKDGTRLASGGLDGNVKIWD
FT                   LSTITSFYKMADQPYKSKKDSASTKLEELLPDKSLRRPLCSMSRHNGVVTSLKFSPDGR
FT                   WLASGSDDKICLIWEKDNTQIAKSFGTDEHDLEHWTVRKRLVAHDNDIQDICWSPDGNL
FT                   LVTVGLDRSVIIWNALTFEKIKRYDIHQSMVKGIVFDPANKFFATASDDRTVRIFRYYK
FT                   KLNEYNNYEFQMEHVVVDPFRKSPLTSYFRRMSWSPDGQHIAVPNATNGPVPSVAIINR
FT                   GNWGSDISLIGHEAPVEVCSFSPSLFQIGDTPANEEIKFQTVVATGGQDRTLAVWSTCN
FT                   SRPIVVCSDIVDNSITDICWSPDGETLYFSCLDGSITGIRFASGELGHSVKEDLIDQQL
FT                   NRYGADRESTILPESVEQLRLEEQSKDARAISIRRMMPIHDLTEKQEAKPEQTQHIATP
FT                   ASAAIDMEKLRKQTVTMTKSGKKRVAPFLVSASATPKNVVQKPLEKKRRIKFNSKISQA
FT                   AYLLPKSGVQTTVHGIKKKTESGSNEIEVEENNDNDEIGDNVIANANSVSDAALKRQRN
FT                   RRKRKLMESKYPNSFKYVSSLPEGLFNNHTLQNIEINKIYKTHSKHKDISAEISSSTAV
FT                   EIDEDLVFSVVFRVFEHMRKENEVFGQTSKRVRTTIEVRNGKPWDDDSSDRDFDDATKV
FT                   IVTEEGKDKREYSLFFPFRVQHVLPIILNDVLKYYVFCSFHGSVQVISASTGSYKCPTF
FT                   ELGESVVTMRHNQGYLLVLTSSGLFYSWNLKAMKVIMNGVSVAAILNNYEINDKTVVSP
FT                   IVKGLEINPKDGSPLVLLDTTNDVYGYSIDLQCWVKTIDSWYYGVGVEKGMDVGLMSLA
FT                   KKSKISYEEDKVTEKIFTYKFDSSNDLEAAMKKRGQELLDLI"
FT   CDS_pept        complement(45450..46925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581755"
FT                   /orf_name="CD36_15310"
FT                   /product="Aromatic amino acid aminotransferase, putative "
FT                   /EC_number="2.6.1.-"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX43309.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG752297"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192CE84"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA90"
FT                   /transl_table=12
FT                   /translation="MTSDTKPQAKDLTHLLSNESKARQTSPLKGIFKYYKQPGITFLGG
FT                   GLPLSDYFPFEKVTADVPTPSFSGGIGAPIDGENKTTIEVFKRAADNIPDQIELARSLQ
FT                   YGSTFGSPEFLQFIREHTDMVHKVPYENWDVVVSVGNTEAWDSTLRTFCSKGDSILVEE
FT                   YTFSSALESANGQGVNTVPVTMDEFGIIPEKLEELMSRWVGNKPKFLYTICTGQNPTGS
FT                   SLSAERRKQIYDIACKYDFLIIEDEPYYFLQMEPYTKDKAAREGKAVHDHDEFLKALVP
FT                   SFISLDVEGRVVRLDSFSKVLAPGLRLGWIVAQKDLLERYVRLHEVSVQNPSGFSETLA
FT                   NALLRKWGHSGYLDWLIGLRAEYTHKRDVAIDALDEFVPKEVSSFNPPVAGMFFTVTLD
FT                   ASKHPKYKEFLEDPLKVEAAVHEQAIKQGCLLAPGSWFKAEGQSSPPQKNLPANPSHKT
FT                   HIFFRGTYAAVPLDQLVVGLEKFGKAVRIEFGL"
FT   CDS_pept        47680..50946
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000040492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231787"
FT                   /gene_name="RAD5"
FT                   /orf_name="CD36_15320"
FT                   /product="DNA repair protein, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43310.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396181"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192CE85"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA91"
FT                   /transl_table=12
FT                   /translation="MKVVKRRFFKPKEEALSSEEVPDSQPSAEPIHSLFVPDDSEDEEI
FT                   TNDAPPKSDFETDITAIVGKISPVVMQYLYTKYSQKRNGAKFAVSELLTNPPDVEKLHQ
FT                   QSITSQSSKRPHTIISDHVPPNKKMNIDLQGTGSDDEPLVWRRFIGSLNIQAMATRPTM
FT                   KPLKYQEKLKLKRITTKNSTLANSAIVRVYHNEREIGRIPEDLTRILSPLFDLNIAVFE
FT                   ASVLEETKSRLSTGDSFVIEIEVYLTSSSFAKNLDSIENPVDLKKSNFDYSKESEGEAA
FT                   LRLRQFAISNLFDRLAIKPLKVSENMDEEDEEETPSQETDSGEVEHPVPEINLDQMKEF
FT                   YQSNNQLKLLEGLPETTTPPKENFALDLRSYQKHGLSWMLAREKELDVLEILSNEDKLS
FT                   SQSRKELENMGTMNPLWRKYKWPYATEATQDPTQNQTEKYFYANMYNGELSLERPIIKS
FT                   SLRGGILADEMGLGKTIATLALVNSVPYDNFPEAKSDRPYASQTTLIVVPMSLLFQWKS
FT                   EFEKCNNNSRHFCRLHYGEDQETNLAWSLCNPDKSKIPIVVITTYGTVLNEFTRLSKRR
FT                   NSKGEFPKIGLYSVKFFRIILDEGHNIRNRNTKTAKSVYELQSSRKWILTGTPIVNRLD
FT                   DLFSLAKFLELDPWNNFSYWKTFVTLPFEHKKISQTLDVVKSILEPIFLRRTKSQKKNG
FT                   KPLVELPAKEVVIEQIKFNEDEEKLYQWFKDRAYASFAEGIKSGQLLRRYTQILTHILR
FT                   LRQVCCHVDLIGGAHEMDDEIIEAEQDEEMRKFLSSIKENQIRFASDTDVKEIMYNLYG
FT                   KIKEENECSICTQVPIPYSEMVVTPCAHTFCLSCILEHLDFQKELKKEKLCPNCRSPIS
FT                   KYQLFRIRKQPTRGNEIRFHTQKYAPDYDFQLYLYDPNRSSSKIQALIRHLKALHSQSP
FT                   NSKVIVFSQFSSYLDIIHSELKLASEDFIVFKFDGRLNMNDRTKLLESFNQPLDNGKIA
FT                   ILLLSLKACGVGLNLTTASRAYMMDPWWSPSIEDQAIDRIHRIGQNETVKVVRFIMENS
FT                   IETKMLKIQERKKQIGEAVAAEEEERRRRRVEEIQILFEE"
FT   CDS_pept        complement(51006..53099)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581756"
FT                   /orf_name="CD36_15330"
FT                   /product="X-Pro aminopeptidase, putative "
FT                   /function="aminopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="CAX43311.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG315401"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI000192CE86"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA92"
FT                   /transl_table=12
FT                   /translation="MSSRVARAQCANCTCSPGLISRANRKSIYKRLSLNRRDSTPTSGC
FT                   TSREGSIFTFNPSLCLPDAKEVNTSKRLESLRKQMKEHDLGIYIVPSEDQHQSEYVSAY
FT                   DQKRSFISGFSGSAGIAIITRDMNSVGDTFEGTAALSTDGRYFTQAVDELDFNWILLKQ
FT                   GAKDEPNWKEWTVQQAVQLSLDSGIAVRIGVDPTLITYKLYKEFQSIVEKELTKNEKVK
FT                   IEFTAVKENLINKIWEQFEELPPRNLGEIKSLDVNFTGRNVEDKLADVKKHLTGDIKGI
FT                   VISALDEVAWLLNLRGSDIQYNPVFYSFVILTDESTTLYIGENRLSEDIVGDLKTAGIN
FT                   IEPYESFYPSLTTVSTKLSESNKKFYIPDNANWEVVRNLKCEFTQGLSPVEDLKAVKNN
FT                   VELEGAKIAHLKDGRALIKFFAWLEEQVIEKQELIDEIEADEKLTEFKQQEDNFVGLSF
FT                   DTISATGANGAVIHYKPTKGQCSTINPRKLYLNDSGSQFLEGTTDVTRTVHFQKPTKEE
FT                   ITNYTLVLKGNIALSTLRFPQNTTGNLIDAIARQYLWKYGLNYAHGTSHGVGAYLNVHE
FT                   GPIGIGPRPNAAAYALKAGNLISNEPGYYQEGDYGIRIENVMFIKESDLRYDGKSYLEF
FT                   ETVTKVPYCRRLIGIHLLNDEEISWINEYHADIWNSFHENFDKNSYTYKWLKRETEPLV
FT                   KSK"
FT   CDS_pept        53612..56620
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581757"
FT                   /orf_name="CD36_15340"
FT                   /product="Pleiotropic drug resistance regulatory protein 6,
FT                   putative"
FT                   /function="binding"
FT                   /protein_id="CAX43312.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396197"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192CED6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA93"
FT                   /transl_table=12
FT                   /translation="MSDELNIDGVVRDIVSLYSSSNASEIHELQERLQTYQKSDIGYQL
FT                   GFKLLENSNRNVKYFGALTITVFLNTHDSSATFGNCFNEILGVIIKLSTTDFTANLFII
FT                   KKLLSNLSLLYIMNADKAYFDPVLRLLSAISGSRDTAISTMIYQLQDEKQLELLLLFLS
FT                   IIAEDIIKSPTQSAKLHTLIHGTVFKYCLVLFEYLYNNLSSISTRIILLSLDFLSSWVV
FT                   YVSVAETNSEERYTEDVQVFLQYLLKQLNIETNISNMEILNKSFTLFTEIIDSIPRILS
FT                   PLRSTIFDILFGDNKFGAFYTKLICTNQEFRETYTLEIENYVNLVISYLGLNLVLITRN
FT                   ISDVNVLNIIQMTMALSSIPGIPTEDENVSEQLIVFWEDFTEAYIDDQEVTKTLFTEEQ
FT                   DLAKFITKRNEILLEVSRIFFKKVLYYPGATKEFRLYRNSVAELFGSLYSLLGVSLYSS
FT                   ICDLIYFNLDQQNKTIDSFQNLEAGLYLIYKITADIYFHDDHEEDNFGKVTLTPLINEM
FT                   FSKDLVQVVKGAPEVATKQLKITLLNMMSILPFFYKNEIGSQHLPATFDFLFDIILNGG
FT                   NENISLMASRTVYKICQDSEGKLIPFLPNLELILLEMLKNPNFDDTIRERMTFSYISIA
FT                   RATKNPVDWGNRLHAVLMEIESCYSNLNEELEGYAISLISCISEMSNASLLPEDIEDYF
FT                   TLDQLNVHKAYWIEDPLEIRNKVLKNLKLFSLETDMLSKNSIVTEKCCNVLKYGFREEI
FT                   PGPFTFSVDIVFEYLVAKVRNCNAQSIPIIHGLLESIIITSFKTVSQDAIEILVHGIFI
FT                   EIYTTIVSDVDLVKSSLDLFTTMLEKRPSLLLQTPFFNDTIIPFAIQPLYLHEIFVVKS
FT                   VIKFWNTTITLKKGSSSEHQQIKDIMNSTIQNSTIGVSLIEALLSGFVSAPRSAVEYYF
FT                   PLFRTLVAKMPLEVKNWISHVLLSILIGKAPLDSKDSETFLNKLLLTRGQRQANDVLRD
FT                   YWLQVNKLTNFKN"
FT   CDS_pept        complement(56719..58590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581758"
FT                   /orf_name="CD36_15350"
FT                   /product="Replication factor-A protein 1, putative "
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43313.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG618684"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000192CED7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA94"
FT                   /transl_table=12
FT                   /translation="MSGLQLSKGALKQAFSKNGHDSVKIPMILQITNIKAVDLPNDVKK
FT                   FRILLNDGEYSTHGLIDESCNEYIKNNNCQRYAIVQVNAFSIFATQKHFFVIKNFEVLS
FT                   PTSEKSHNNFIPVDTYFNEHPEEAHLTLTKKPDSLERESPAPGVTPPLAQSTNSFKSDV
FT                   GSGVPAQSKPPGPHRKVSPIETISPYQNNWTIKARVSYKGDLRTWSNSKGEGKVFGFNL
FT                   LDESDEIKASAFNETAEKAHKLLEEGKVYYISKARVAAARKKFNTLSHPYELTFDKDTE
FT                   ITECFDESDVPKLNFNFVKLDQIQNLEANSIIDVLGALKTVYPPFQITAKSTGRVFDRR
FT                   NILVVDETGFGVELGLWNNTATDFDVEEGTVVAVKGCKVSDFGGRTLSLTQAGSIIPNP
FT                   GTPESFKLKGWYDNIGIHESFKSLKIDTGGSGADKIAQRISINRALEEHSGSTDKPDYF
FT                   SIKASVTFCKPENFAYPACPNLVNSADATRPAQTCNKKLVQQDHDGTWRCEKCAMTYEE
FT                   PTWRYVLSCSVTDSTGHMWLTLFDDQAKKLLGIDATELIKKKEENPEQVNQIMNNTLFK
FT                   EFSLRVKARQETYNDELKTRYQAAGINELDYASESQFLIKELDQLLV"
FT   CDS_pept        join(complement(60285..60353),complement(58824..60026))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231788"
FT                   /orf_name="CD36_15360"
FT                   /product="Cystathionine beta-lyase, putative "
FT                   /EC_number="4.4.1.8"
FT                   /function="cystathionine beta-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAX43314.1"
FT                   /db_xref="GO:0004121"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192CED8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA95"
FT                   /transl_table=12
FT                   /translation="MENKLESSLCNGDFRQCQFLIPQKSYSLETELVLNKSGDQYNASV
FT                   PPLYQSATFKQPSLSNMGEYDYTRSGNPTRTHLQNHIAKIMKAEHAFAVSSGMGCLDVI
FT                   TRLLKPGDEVIAGDDLYGGTHRLLTYLSKKGDIVAHHYDTTNTELIKSKINNNTKMIFL
FT                   ESPTNPLIKVVDVKSIADYAHKVNRDIVIVFDNTMMSPVLMTPLDLGVDIQYESATKYL
FT                   NGHHDIMAGVIATRSALLAQQLYYIINSTGCGLSPFDCWLLSRGLKTLAIRVEKQQQNC
FT                   IRIAKFLENIGFKVRYPGLKSHPQYELHSSMCSGYGAVLSFETGSVRLSEKIVENTDIF
FT                   GIAVSFGCVNSLISMPCKMSHASIDAKTREEREFPEDLIRLCIGIENCDDLIDDLTKAL
FT                   LRSGAVKVNDRDELYNAVGIQPKL"
FT   CDS_pept        complement(60429..61160)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000257748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231789"
FT                   /gene_name="NUO24"
FT                   /orf_name="CD36_15370"
FT                   /product="Subunit of NADH-ubiquinone oxidoreductase,
FT                   mitochondrial, putative"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /function="NAD or NADH binding"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43315.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG616790"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192CED9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA96"
FT                   /transl_table=12
FT                   /translation="MLARFIGKSTTTPVGVYASTVSKRYSSIISVHRDTKEDNPNIPFE
FT                   FNSENKKRAEEIIAKYPPQYKKGACMPLLDLGQRQLGFTSISVMNYVAKLLDMPPMRVY
FT                   EVATFYTMYNRHPMGKYNLQVCTTTPCQLCGSDGIMKAITDYLKIKPGQTTPDKLFTLQ
FT                   EVECLGACVNAPMIAINDDYHEDLTPEATINLLKQLQEGKELTEIGPVDGKRQSCEPFS
FT                   GPKVLLNKEPNDIRKFTRADL"
FT   CDS_pept        complement(62481..66194)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581759"
FT                   /orf_name="CD36_15380"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX43316.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192CEDA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA97"
FT                   /transl_table=12
FT                   /translation="MGKYRKRFNEKARTGMLAKQAALRKARNKQFYRQDDEEENEPTPD
FT                   TTEICNTQDSNSEILAPVTEEERLAKKRALEQNLYSENSKKEKMSRAKKKRLDKYIDHQ
FT                   LKREEKKILLEKLAETKMDTSNFAALKELGKGKQTKKEEMIEALELERQGRGDEHTREI
FT                   LYEERDIKDFNDDEDGSIFKSFDEDIHVQEEEEQRSTFVDNRPKKFGGQGFGFGFANIP
FT                   VIKKDTTEAPKKKYSWRKRVEEEEKKRLKKEDDDDFASSSEDDEEDGISNTQEIVEAKE
FT                   LNDSEVEEEFETEAESSPEVGDSAESEVDLSSEEEEEEEESKLMKSKPRHSTTAASFKE
FT                   WAEQQVRIMEGRDKNVLTPEASDEIKKKYSKQTVRDEDIDHSSDEEGYIPINKEMQRQA
FT                   FVVEVGRTDYIQKQRVLLPVFAEEHRIMEAVYHHDCIILGGETGSGKTTQVPQFLYEAG
FT                   FGNLSHDLYPGMIGVTQPRRVAAVSMAERVGNELGDHSHRVGYQIRFDTTIKNEGKENG
FT                   TALKFMTDGVLLREMMTDFLLTKYSAIIIDEAHERNINTDILIGMLTRVVKLRRKYHKE
FT                   NPQQYKPLKLIIMSATLRVSDFSENPALFKTPPPIINVQARQYPVSIHFNRKTNYDYLE
FT                   EAFKKTCKIHRKLPEGGILIFLTGQNEITTLVKKLRQEFPFKKKSAIQYDENIDVKLSE
FT                   NVQQEVEDVDFSVQSGDTGLLDDYEEGEENEEEEEGFEEAVDNKESEVGPLYVLPLYSL
FT                   LPTKQQMKVFEDPPPGSRICIVATNVAETSLTIPGIRYVVDCGRSKERKYNQENGVQSF
FT                   EIDWVSKASANQRAGRAGRTGPGHCYRLYSSAVFEDFFPQFSVPEILRMPFESIVLSMK
FT                   SMGIDQIANFPFPTPPDRFSLKKAEELLIILGALDKQHKQITDLGKKMSLFPLSPRFAK
FT                   ILIIGNQQECLSYIIAIVSALSVGDPFIGENELVGNMSDEARREFRTKFYRSRALFSKL
FT                   DASSNCMMLLSAVCAYDHVPKEEQNEFLQKHYLRHKMMEEIQKLRKQVGNIVENMIMSA
FT                   DGLQLAQKVKLPIPNKKQVSAMKQMIASGFIDQVAIRGDLISSEVKVANKTSIINIPYC
FT                   PVMPIEDGPFVYLHPNSLIAESGQIPSSYLVYQSLSTKGNTGEGETKKVRMNPLVDISG
FT                   KQLANIAKSSVLLTYSKPLGHPYAPKNLTPTRRECYVVPRFGAAIGSGGVGWDLPAIKV
FT                   IQEKRKGVWVNL"
FT   CDS_pept        join(66529..66556,66625..67442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080454"
FT                   /orf_name="CD36_15390"
FT                   /product="Synaptobrevin (V-SNARE), putative "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43317.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG396229"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="UniParc:UPI000192CEDB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA98"
FT                   /transl_table=12
FT                   /translation="MSQTDLHKHLIHCTLTINSTTLYTYENSNLVHLVNSSNVNCSEIV
FT                   SQELGLINASKTLIGSIPISSSNSIKLSMYFMKKLLANQDGSRDLITVVAIVHVHANKT
FT                   LVLNILKNIMDKYIEYKRELESNKPVSGQPSKTKLGEFKLYMNQIIKYEEMNYDSNEHV
FT                   YNYGSTNENNEEGHPADQINPNQLLLANEEVDEVRSLMLENINKLLSRGDKINSLVDQT
FT                   DRLNTSSSVFQKRAQQIKRKMWFMKTKFLLSISGGVLLILYLFIGSECGFPAFSHCIRN
FT                   "
FT   CDS_pept        complement(67468..68214)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537381"
FT                   /orf_name="CD36_15400"
FT                   /product="DNA polymerase epsilon subunit D, putative "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43318.1"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG448617"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192CEDC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WA99"
FT                   /transl_table=12
FT                   /translation="MPPKGWRKNADGQYPQPSSKENELISIDDILFPRTTIQKLAKNII
FT                   SDDENNTSQMTIAKDSLLALQRSATVFVSHLLFQAKQISKEANRKTVSAQDMLAALERA
FT                   EFSGFIPEVKQKLSVFEANVASKKQSKAAKAISTTEGGEKSTLKKPKLDNESMEIDADD
FT                   VNVNGDEDDDNSADENEDDDENSKQDIENGDEQEEDGDDDNDETEEDVSNPISALAKEE
FT                   QELQGVETEPEIEDKPDSSETEEEED"
FT   CDS_pept        68456..69511
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581760"
FT                   /orf_name="CD36_15410"
FT                   /product="Histone acetyltransferase, putative "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43319.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396237"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192CEDD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA0"
FT                   /transl_table=12
FT                   /translation="MSATTTNIITASPKRKTKANTKEQDNSYYGQLNKRNINKVTFGKY
FT                   EFPTWYGNAAYFYPHDLSHSTLGYEYANKVASEGSMARKIHKKDVFDENLHEFWLNHLF
FT                   VCEYCFKYTSNETTLNQHVTACTYNRKRPNKGKLLYYDQANGYIIREVRGFQDPLFCQN
FT                   LCLFGKLFLDDKSVYYNIDHFDFYIVFGKDDSSYIPMGFFSKEVLSYDNDNNLACICIF
FT                   PPFQRRHLGSLLIEFSYKLAAVTPGQLKCSGPEFPLSPYGKVTYLRYWSKRLATKIYQQ
FT                   SGSFTLSQISKETGFRKEDILLTLEYMQILVKDGNGNVALSLEYLEHWCSQNRVIPGVD
FT                   INILNSECLIL"
FT   CDS_pept        complement(69554..71353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581761"
FT                   /gene_name="CDH1"
FT                   /orf_name="CD36_15420"
FT                   /product="APC/C activator protein CDH1 homologue, putative "
FT                   /protein_id="CAX43320.1"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192CEDE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA1"
FT                   /transl_table=12
FT                   /translation="MDKGDSNKRSKDNAIHNPFVSFETPRSPSRSTRSLNPPKLNEVNG
FT                   IQSSPPRRRNNNTIFSDRYIPNRTGVDLQAAFSLTNEEILPDLRNNRNADNEIEIRREE
FT                   EANRTFSTVLKAELFGDNVPMATANLSSATANTSLANNRSKTGRANTGIVNGAIASASA
FT                   AAASTSSLSTTPPRSSTSGQNFPGSTGSSLPGNNNINGTNDSHNIISTNANNNISSDID
FT                   DITSTPRRKTNLFTYQSPKKSKPISRDLQQELYSLSPVRQDSQKLLLSPQKKPRTISKV
FT                   PYRVLDAPELSDDFYLNLVDWGQQDVLAVGLGDSVYLWDGATQSVDRLCNLTNKDKVTS
FT                   LNWIGTGTHLAIGTSKGLVEIWDATRIKCIRTMTGHSLRVSSLAWNEHILSSGSRDRTI
FT                   LNRDVRIEDHYVNKFDNHKQEVCGLKWNVEENKLASGGNDNNLFVWDGLNPKPLHQFTD
FT                   HTAAVKAIAWSPHQRGILASGGGTADKTIKTWNTLTGNLVHDVNTGSQVCNLIWSKNSN
FT                   ELVSTHGYSRNQIIVWKYPSMQQIAQLTGHTYRVLYLSLSPDGETIVTGAGDETLRFWN
FT                   VFEKNRHNESPASVLLGAFSQLR"
FT   CDS_pept        72305..73633
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093540" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080455"
FT                   /gene_name="SAP30"
FT                   /orf_name="CD36_15430"
FT                   /product="Aspartyl protease, putative "
FT                   /EC_number="3.4.23.-"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX43321.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG447529"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192CEDF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA2"
FT                   /transl_table=12
FT                   /translation="MSFTSLEMLFTILSLLVPSLAVAVSNARDAVKLDLTISEEHMYYV
FT                   ENVALGTPGQSISNIIVDSGSSDLMIVDSIYNFSASSTFYNSNQTAIMKYGYGGEFPVY
FT                   LVNETISSRDWKLSNLSMGLANISDMDSFSGILGIGFTRQELFKTNYSNFPYLLKDQGY
FT                   TKSVLFSFNGQDQNPSIIFGGISTNIIDGPLVRAPFIKVISFINQVNYWLMPTFTVNQI
FT                   KLGDAIVSNQKTLYQIDSGTNGFVPPTPVLNNIFKILGDDYIKDDNGNIYFDIKYIEGL
FT                   NITLSVQGYDIGFQLVDIVGDTIERNGTTFVALNVASCDIGYNAYEGLLPNFIFKYHYA
FT                   IFDYDNAQIYFGKYKNSNKVANIVAVTNGNQLPVPTVDVPNAEDTYSVIYVAESETTVA
FT                   IAPTRVESSNSSFNASQVTSSSITYSSTTDDEFTRSTSNSKYC"
FT   CDS_pept        73897..77682
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080456"
FT                   /orf_name="CD36_15440"
FT                   /product="Nucleoporin, putative"
FT                   /protein_id="CAX43322.1"
FT                   /db_xref="HOGENOM:HBG396246"
FT                   /db_xref="UniParc:UPI000192CF2F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA3"
FT                   /transl_table=12
FT                   /translation="MDSTNTEIRRKRNRENLSQPLIPTSVLDQASQRLFVVSVFILIQS
FT                   WKIYDLVLLKSEIPATGEVLTSLSNFTFVLKYSVLDGLFLWLLPVLNIQYLSFAPLKTL
FT                   LLTIILYGFSIFLVSSMALPLLANVFLPVWRFLLQEKELNIIGESIDRSQILDMDSHFK
FT                   GQLTIHYLPDSSAKMNPFHFDQTCLGLNNNNIINMPIEFNTTSGIGYLQIQHTTPDNEI
FT                   QYLNYTGYSLRKLFKQDYAHLSRYKDYKKSDKRIFYLEYPITKAGIYRIKNVLDNKGNS
FT                   IRTYKSEFVISDCPSARFFYPPNFESSNRFKCVTTLEDESFPLPWIEVFSTTPSSVKLN
FT                   VKVNGKEFRMMNLTIGQETDHKISRTDFSWLKTVRLVRNSLQEKILDSKNSLKWNDQSV
FT                   LEFQLLQVKDSFGNVHRYEPLSKDKDVWYKLELRKSPSIGIYDKETNQELLVGGQKVLH
FT                   FSNLENFNEEDFPIDVEVKYIGEQEQNLTRTFKTKADLRNGFAITRPGKYVLSSARDKY
FT                   CPCETDKTPVDIELASIPSLDIVADPVSDRCLGTVGYNFDFNFTEGRPPFRVQYQIYSN
FT                   ISGILKPVYSDTGRLNRELKSFEKSHSFKFKPPSEGSYTIVFTNLKDANYFKDPIALDE
FT                   NEYSYSTYFRQLSQVGFQVQQRIIHTCYGHTTKVPIFFNGNGPFSFEYDFLDVSSKKKL
FT                   VDTVKVSNVESYAIDTPRELIGKTYDLKLSNAKDRFGCNAIIVDANSPVRVVSRSDIPE
FT                   IEFSQTGQKLQVVEGSYVDVPLKIKSKVTVNGNDKIEVKYLKPTSKEPSIIRAQMVDSS
FT                   IRLSEEGTYWLHSFESNGCAGRIGKADQFITINYYAKPSMEIFASNEMLQHTDDSTIHL
FT                   KPVCNGCSNEITLKLTGEAPFVVDYEIKLPSGKLEMHSMNIETRDITIKLPTKSNGRFE
FT                   HQFKRVYDRLYTKTRGKTTSLHVPKVIYDINPLPTAQFVPDDHFTQVCENKLSEDSIIA
FT                   HIPIQFSGAYPFDVLLTLTNEKTGKMHDIRYRNVADSYITLKTLNILGLGDYSLKFAKV
FT                   SDANGCTTHHFKTNDRYLVSITEPPTIYKADPARKHYCVGDHVAYNLTGVFPITIFYEY
FT                   NDKVRRAESYSRFERLASRPGVLSIHGLKDSGINSCAVNYTFDTTKSDELRLEVHEIPT
FT                   VEVNKGDYLIEDLHEGDQTELIFTFLGEPPFQLTYIRTIDIKKGKKTLRKLVEKETIKD
FT                   IWQHELVVMASLEGTYEAIEIKDKYCRAVKKVDYIE"
FT   CDS_pept        complement(77812..78156)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581762"
FT                   /orf_name="CD36_15450"
FT                   /product="Pterin-4-alpha-carbinolamine dehydratase,
FT                   putative"
FT                   /EC_number="4.2.1.96"
FT                   /function="4-alpha-hydroxytetrahydrobiopterin dehydratase
FT                   activity"
FT                   /biological_process="tetrahydrobiopterin biosynthetic
FT                   process"
FT                   /protein_id="CAX43323.1"
FT                   /db_xref="GO:0006729"
FT                   /db_xref="GO:0008124"
FT                   /db_xref="HOGENOM:HBG396253"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="UniParc:UPI000192CF30"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA4"
FT                   /transl_table=12
FT                   /translation="MSRRVLPALHEIAIRQGLENINQLGYPHWSFIKLDEPPSHVLTVH
FT                   YQLKNFKTTWEFLNSVAELAASKKHHPTIITTYNKVDIQLTTHDSDNNVTQDDLDMAEA
FT                   IQKQYHELTN"
FT   CDS_pept        78802..80808
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537382"
FT                   /orf_name="CD36_15460"
FT                   /product="Clathrin-associated protein ap-1 complex
FT                   component, putative"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAX43324.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG396260"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000192CF31"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA5"
FT                   /transl_table=12
FT                   /translation="MISAIYIIYLAEKQQSNEFSQIELLVNRRYNQTLPHDEIILQNFH
FT                   NLMTNLLPSEQVPVLYYDGLSYTYMRCLNGIILLIVSNQNIDVMSAVMFLNQFQLVLVH
FT                   YLCNSKLTNDKMSAPKSLDRDIIIDNITLILELLDECLDYGLLQITDYKLLEEYIKVIP
FT                   NIPKIDSLADEYDTSDSDDTSDEDDNDEPNKYKKKSKSKTKNGKNKRGSKREIKSTHNQ
FT                   AVKTDVIENEQTNMINSSILRTYSSAINWRPKGIFYAKNEIFIDIIEDCEFVYDLGTGV
FT                   IKRNEIYGTCVVKSYLSGMPVCRIGFNERNLSRIEDDEAEKALDIPENQLKEAQNEEEE
FT                   EDDDEEEDVKEQENNSEETESLEQTMESPALADKRQKHKIPIRNIQFHQCIELSKIYKE
FT                   NIVTFIPPDDKFVLMTYNVEQQKQKKKEPLIMVKPQFRIIQQTGKLQIMCTINTNFHRR
FT                   RHCKNLIIRIPINPHYFELDANDNDLKYKAELGEVSFKIDSFELVWKIDSIDGKKMVRM
FT                   MTELALVHAERINEQRISDYLLRRAALSSVVGADDLSDTAEDSREELDKFYGVNGKSTS
FT                   SAQKISLKFKNSVFNDDIKVQFKLPMVTYSGLKLSYLSVEEEQMKYPCFPWVRYLTRSI
FT                   DHYEPDISLENQKFSGRCCDYRFKLGSNCFVVA"
FT   CDS_pept        81305..83842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231790"
FT                   /orf_name="CD36_15470"
FT                   /product="Fungal zinc cluster transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43325.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396267"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI000192CF32"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA6"
FT                   /transl_table=12
FT                   /translation="MSLDNTLQGNTISGSASISKGKKNRNGCLTCKKKRLKCDETKPNC
FT                   LNCTKKNIECGGYATKFKWKSFNEERSHTSSSNKSLKRHLELASFSVTGKSIEEINKEN
FT                   ELIAKGINPETVKSGTTSNRSRTNSFNTINTQRPKSFDKSHSFPLPPNEHGRVQSSSVY
FT                   KSDLNSLADAAMKQIGKSPASIPSTSPALKTHQQHQVQSLANNSAMQHIMVQQAPQPSP
FT                   PPPPPFTPNFEAMLTTEKPMVKRTAISNFDTEINLTPSLSAILNFAFNHEEIEVPSVET
FT                   LSPLTLNHEARIDAPMNNDKIITTNKQVTEQEQILHLFNEYTSGIMSIKNGAHENPWRN
FT                   LITPLALKYSCLFNSIAAMTLFHMAGRTNVVHSPDDLRTKGWYYMKKCIFELANGLSNN
FT                   VKDLPLDVALVTCLNLAVCEQWDTHTSSGIAHLKGAKSMIQQILELLKEQQQLIKQKKF
FT                   ENVESRSLIDEDQRLLMNLKKKLVLIDDFDYEEMIHEIIKCPEKAAVIPKSIQFILNNW
FT                   IYFEVLAQMTSDSMCDDKGVDLVAAITSSSQNKLDKDKDRNPKSPSDVSDSSDKTFRFF
FT                   ETLHSLNYNNEVIDPLLGCSQSLFVIMGKVANLITKIRKAKHKNQSKKRNTLTTISQAS
FT                   ELKQELVNWKPSVVASIMDNEITSESSTTWDLPSCIATAEAYKYSTLLYLHQAVPEIPS
FT                   FSAHALAEKIFILLASIPASSNLSIVHIFPLLVASSEAEPGEEREWCENRWKLLSQRMW
FT                   IGNIDRALEVVKEVWRRKDGFQETCDDRKFHQLGGLMVALNGDPSNNSNGSNGGNSHNN
FT                   NNSATNTVDANTIDSNAHWSTVMKEWGWEVLLG"
FT   CDS_pept        90216..91220
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581763"
FT                   /orf_name="CD36_15480"
FT                   /product="HAD-superfamily ia hydrolase, reg-2-like,
FT                   putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43326.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396272"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192CF33"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA7"
FT                   /transl_table=12
FT                   /translation="MLRNLLLSRRTFVRMSSTKSRLISQPFKMENTQMIRETARKFPRP
FT                   NFISFDLFGTLYVPKKPVPDQYYEIAYHEFGINKSIQSIEEEFPIIYNEMLQSYPNYGK
FT                   GHPKFDNCDSWWKELIIRLFQLDRHDDQALALCHRLIHHFTSEEAYCVYDDVVPTLQAL
FT                   QEHGVKLIVASNSDPRALTILESLKLKQYFHCSEHFHCSGVFLSYDSDYSKPTKEFFDE
FT                   IALVKYRAHVDANYRSKTYPPSGFLADCWHVGDSYNDDYVGAVRAGWNGVLLDRNRISE
FT                   FFKNAKTPKNDGCFLNDSPEPKGDERTDNEMLILANNRVVITKLSQLLDIFKL"
FT   CDS_pept        92134..93489
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581764"
FT                   /orf_name="CD36_15490"
FT                   /product="Cell wall mannosidase, putative "
FT                   /EC_number="3.2.1.101"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAX43327.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI000192CF34"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA8"
FT                   /transl_table=12
FT                   /translation="MISLQQLIISILLFFTSSVQSVDLTVDDKDSVCSAAKVVVQGVWN
FT                   YYEGLKNGGTVGMFAPPNYWWNAGEAFGGLVDFYTFCESDNSTLESLIYNGMYHQAGEN
FT                   YNYIPSNQSMTEGNDDQGVWGMAIMQAVERNFTEPESHSWLAMVQAVFNTMNARWDADN
FT                   CGGGLRWQIFTWNSGYDYKNSISNGCLFHLAARLARYTGNSSVYVDTAEKVWKWMEDVG
FT                   FLTEEQNGDVRIYDGAKIANNCSSVTDLRWSYTYGVFMTGCAYLYNFTGDDVWLTRTNE
FT                   IVQASLSYFFANKIMQETTCQPQNKCNNDQRSFRCLFSRCLGLTTQLVPETKDKIREVL
FT                   EASAEGAAKSCSGGSDGVTCGENWALGSWDGVYGLGEQTSALEVMMALIVEPPLSVKTG
FT                   GTNRTNYAAGTNSEDNANKNELTITGKDKAGAGVLTAIVLAVILGGAIWMIF"
FT   CDS_pept        94166..96010
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581765"
FT                   /orf_name="CD36_15500"
FT                   /product="Mate family drug/sodium antiporter, putative "
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43328.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG398292"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000192CF35"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAA9"
FT                   /transl_table=12
FT                   /translation="MVLFPTINRLANPNNAGGLTGSRRRRLFVPPSTQYPLFIYGDGDD
FT                   QRSFLSNIEVGSQIYSPEDEHSDVASVSTSRSLPSTLSSVHTVDDQESFHDWLQEEHQR
FT                   RISAASSPAGSSDEDEFDDDLELGRRRSSTMPTVVSPQEDFLNLKTDYTIESKSLFKNS
FT                   FPLILTFILEHVFSIVCLVVVGKLGTKQLGAVSLATMTSTITFAIFEGTATALDTLCPQ
FT                   AYGAGNYELMSIFVQRCNVFSMILFFPCALFWWFSGSILKFVIDDPEVVDLTQEFLRYL
FT                   ILGAPGYILFENSKRFLQAQGIFEAGTGILFVSAPINIGLSWFLVWNENYGIGYIGAPI
FT                   ATGINFWLMMILLVLYVRYIDGGKCWFGLASTEELFSNWNQIIHLALPGIVMMESEYMA
FT                   YEIMTLFASYFGTVQLAAQSAVSSIASLTYMVPFSVGIAATTRIANFIGGQNMAGAILA
FT                   TRVAMVAAVIVSTINCLSLFSFRYEIARIFSDDPEVISLIVDLLNPLVSVLQIFDGIAS
FT                   VNSGILRAQGSQKIGGYINFIAYYAFALPLAMVLSKIVGLQVFGLWIGVGSGMAVIALS
FT                   ETAVIMFSNWDDILMKAGIMNEFGFDDTDDDDDDDDIF"
FT   CDS_pept        97229..98938
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581766"
FT                   /orf_name="CD36_15510"
FT                   /product="Choline and nitrogen mustard permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43329.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192CF36"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB0"
FT                   /transl_table=12
FT                   /translation="MSDSIEKKDSNSPRRASFGKGEIHNILSNRVTNHVTTNLDALAVA
FT                   DDKKAERLLKEAQANLELVAETGYSPELRRNFSIISLLGIGFGITNSWFGISGSLVAGI
FT                   SSGGPMMIIYGIIIVAIFSVFIGITLSELSSAYPNAAAQIYWAQKLAPPKYARACAYFT
FT                   GILSAAGSTFTTASVNMTSATAIVGMYMLHHPEKTIQRWQVFIVYEAITILLVFFNIYE
FT                   KPLPMISSTTLYTSLFSFVVITIVVLSMHDGDFQSPHFVFVEFNNGTGWSSSAIAFIVG
FT                   LINPNWSFSCLDAATHIAEESLSPATDIPKAILGTVAIGFITSFTYSIAMFFSIKNLDD
FT                   ILSSNTGVPILDIYYQATNSKAAAVGLEFLILLTSLGCSIGCSTWASRIIYSFSRDNGL
FT                   PLSRLWAKVDSRTGNVVNAHLLSNFWVMVIGCIYLGSSTAYNSILISCVTFLLLSYLIP
FT                   TVFLVFKRNKIRHGPFWLNGFGLVANVGLIVWAIFAFVFYNFPTVMPVSGSNMNYSSAV
FT                   FGVCLIFSVIDWTLRGKHQYTSLEEREKVKDELASQVSNQITNIQSIVSNRH"
FT   CDS_pept        99155..99664
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581767"
FT                   /orf_name="CD36_15520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43330.1"
FT                   /db_xref="HOGENOM:HBG396299"
FT                   /db_xref="UniParc:UPI000192CF37"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB1"
FT                   /transl_table=12
FT                   /translation="MSNSNDWSFSLCDDSLELFDTIAEGDDDNDTTVHTKSDNSCSGNK
FT                   CTPLNQYNPFILTKMNYFKRKHPKAKSKVFDKKIKVKTLDIIKNLETASLSELNWDFTC
FT                   NWFHRKGFPSEVLKEGFCNRVINSENYKFIKSKLSHEGWFIATTTKKKKANTCKLQLKT
FT                   EKSTKN"
FT   CDS_pept        99981..101771
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093549" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080457"
FT                   /orf_name="CD36_15530"
FT                   /product="Chromatin remodeling complex subunit, putative "
FT                   /protein_id="CAX43331.1"
FT                   /db_xref="HOGENOM:HBG396303"
FT                   /db_xref="UniParc:UPI000192CF38"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB2"
FT                   /transl_table=12
FT                   /translation="MTKDIENKSSLCMYIYPRIEKKKTCNGPTTNHNFQVSKFENILPD
FT                   LFIVYEHTNKYVLTSEILPVDFYQENPMKIVSSLQSHTTTDVTSIENKFKNGQYSTPYQ
FT                   LFHDIKAVASILLNKEVNGSLEYKELDFFYKFSTELLLREVGNLIKFNNETAEIKTELE
FT                   TQLDEDFTKIITNYNISNGEVITYISTTEESETQSSSVFYQHHQHKEEPTKKTQPLFSS
FT                   VVSKSELDNRATIVPSPYRIAQVVPSIKDSVSENTLETLSPITNRIPSPLDQPTNILHD
FT                   FFHPTWYTISVPTWLTYTSQTIKPANFNANQELEDGAGASTKTKLSILKNRDNDFSTKP
FT                   TNIWGPGNYYRSFAPSRNSSGSIVGNKLKANVWLQHIGMTEIAELKQSFVENTHETSPL
FT                   VNDTVPDKEDGSESKSNTENGSKPTNGQQIRERAQEPAEENPSPQNINIANIIKWDPTK
FT                   VEELNYLKEHKQDLVNPQKLQKMISISLLKLNKLRQERYSRSDVRNPVAPQHEENILYN
FT                   RVVKLISIAIQLFNINPGCFSYQFSKNIPVLVSEFSGTLPGIPPTKAITNNGTSSNTKS
FT                   NRLPNLKGPSAYRKRPTRLG"
FT   CDS_pept        complement(101923..103473)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000152204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537383"
FT                   /orf_name="CD36_15540"
FT                   /product="Vacuolar Nramp iron transporter, putative "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43332.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG312498"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniParc:UPI000192CF39"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB3"
FT                   /transl_table=12
FT                   /translation="MSEQQQQQQPLLKRVAQSVQKYATFIGPGLVVSVSYMDPGNYSTS
FT                   VSSGSMYQYKLCFIIFMANLFAIILQALCVKLGTITGLDLAEMCRLHLNPRLNLFMYFC
FT                   AEIAIIATDLAEVVGTAISLEILFGIPLLYGVLITVLDVLIILMAYHKDGSMKQTKFFE
FT                   ILVSILVAATCVCFILELFKCNFEPGSGWEIFKGFLPVNKEIFKESMALFLSCGIVGST
FT                   VMPHSLFLGSALVQPRLKEYDETHGTKLNVLPDGNESTTRLVPPHQPVEGSRLRRISDG
FT                   SLLANKYKPSYAAIKYCLNYSYVELVLSLFIVAVFVNSAILIVAGSTLYGKPDAADADL
FT                   LSIYEMLSYYISPAAGLVFALSMLFSGQSAGIVCTMAGQIISEGFINWTLEPWKRRIVT
FT                   RVLAIVPVIVVVGILGREGVSKVMNSSQVVLSFILPIVSAPLIYFTSKKEFMTVVDTSL
FT                   TDESTPLLEENDLDEQIPVRKISFENGSVLRNASILTWIIITGLNIYLIIAFANGADI"
FT   CDS_pept        104430..106028
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093550" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581768"
FT                   /orf_name="CD36_15550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43333.1"
FT                   /db_xref="HOGENOM:HBG396313"
FT                   /db_xref="UniParc:UPI000192CF8A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB4"
FT                   /transl_table=12
FT                   /translation="MILVNPIISKCLVNTDVISKHWLKLLANRFVSTTNRNFTNNSLIY
FT                   NLNNYKSSFPEDFTINEDITKYINLNKHRLETQSLKIGVIYANEETRTNSKLIEALMAD
FT                   PLASGNEIWFDKIVKRKSLGTFVYNETVEVDEESGEFRLPSPILSGNYRNKFQQQIESA
FT                   NDLIIEEVSDIANTSDYVFLINVSNELKNTDYCKDVENRILLNVLDNCEFTPHSSESTP
FT                   VTFASGSHSHLIKINSQLAYNGISEFISKDVLATDTFINSMTNSNIYELYKAINWFSQT
FT                   QVLQQWLLHNIKFKIKQRISTAAAPEEINDISNMEIARFTDLVNTELQDEFKPKTTSFF
FT                   RKNLIWWKLYYKNDNVEYDIKDFFMNHFMNKSIENYNYLKGKISSGEADVIDNPLLKLK
FT                   NKVINKGVAEEIQPFVYRALATAFLYYQFPISLISFCGYQYFGYGANECVALATLGLVL
FT                   GFNQVSKVWTNFTDRWLNNLFEEIRICLGKECIEDGLLKQSNLQLDKDIKITLLRQEIF
FT                   NEINKDPIDGTNKNK"
FT   CDS_pept        complement(106103..106816)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581769"
FT                   /orf_name="CD36_15560"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAX43334.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG294208"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR017065"
FT                   /db_xref="UniParc:UPI000192CF8B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB5"
FT                   /transl_table=12
FT                   /translation="MFLNRRLLAYIPKRLYHFKTLPTPNPNALKFISPECNILPMEDKT
FT                   FEFTTTLQAIHSPLALTLFKIPGVKSVMLGYDFLTVNKQDYINWANLRPEIVEHLDEFL
FT                   TSKKHPVITKELVDEAQREAEEESELISMIKELIETRIRPAIQDDGGDIELKGFDEETG
FT                   TVFVKLQGACKSCSASEDTLKHGIESMLMHYVEEVKEVIQILDPEEEIAMKEFERLEQK
FT                   LKNGNSQSEQAPPSL"
FT   CDS_pept        join(complement(107675..107738),complement(107279..107409))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537384"
FT                   /orf_name="CD36_15565"
FT                   /product="ATP synthase J chain, mitochondrial, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /function="hydrolase activity"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="CAX43335.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG398405"
FT                   /db_xref="InterPro:IPR006995"
FT                   /db_xref="UniParc:UPI000192CF8C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB6"
FT                   /transl_table=12
FT                   /translation="MGSLPRYPFPVLKTYWPYAIGAGITYYLVYKGSIASANSDEFIND
FT                   PRNPRFAKGGKYIDLDKRD"
FT   CDS_pept        complement(107958..108917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093551" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231791"
FT                   /orf_name="CD36_15570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43336.1"
FT                   /db_xref="HOGENOM:HBG396324"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000192CF8D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB7"
FT                   /transl_table=12
FT                   /translation="MNRRFFSLIEQRVPAKYISFTVDDLKYDAQLEFVHCIQTVLPLNP
FT                   YYVKTVLKEYIKHIESSNEDTSDELYESYCDPEVLNARELGPEQTDVIKYFISGFNQQY
FT                   NGNDKDTITIKETPKLISGSNTTGLRTWEAALYLSNFLNAKDSPPYNLANKTVMEIGCG
FT                   TGLVSLALAKNYHNIKKLIMTDGSTNVFDNLQETLRLNNLNDSSIIQCQQLIWGEKTTV
FT                   EEHVDYLVAADITYDTRILDPLCQTIKDLFSNNNLQFAVIAATIRNVDTIKEWESKLDV
FT                   WFSGKWSVMETESDPHSIQSNCWFNVNTPEIRIYEIHL"
FT   CDS_pept        complement(109006..110034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256158" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384657"
FT                   /orf_name="CD36_15580"
FT                   /product="Allantoicase, putative"
FT                   /EC_number="3.5.3.4"
FT                   /function="allantoicase activity"
FT                   /protein_id="CAX43337.1"
FT                   /db_xref="GO:0004037"
FT                   /db_xref="HOGENOM:HBG480577"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniParc:UPI000192CF8E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB8"
FT                   /transl_table=12
FT                   /translation="MTNVLSQDDFQKQVVSQYTDVIGEKLGGKILSFSDQWFADAENLI
FT                   KPKPPIRDATRFTYAGAWYDGWETRRHNEADADWVIFKLGVSSAKLIACEVDTAFFNGN
FT                   HAPHISVEALQNFDASDENLSNVKEEDWEQVIAKVECGPSQKHFFSRGSLTNKNYTHAR
FT                   LRMYPDGGIARFRLYGQVIPVTDQSSSSVTDFASVQNGGVAIKFSDQHFGTADNLLLPG
FT                   RGHDMSDGWETKRSREPGHTDWVIVRLGAPAKLSEIVVDTAHFRGNFPQKVNVKGIKVD
FT                   DESKIEADSDSWEVVVDDSKTSADKEHTFKVKDDSKVYSHIKLTIIPDGGVKRIRAFGV
FT                   KA"
FT   CDS_pept        110733..114065
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581770"
FT                   /orf_name="CD36_15590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43338.1"
FT                   /db_xref="HOGENOM:HBG396334"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniParc:UPI000192CF8F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAB9"
FT                   /transl_table=12
FT                   /translation="MPPAELHDSDLSSVASSTAPSTAQESLENENIPVQLDESKYVGDN
FT                   TENFIVNAYFPEGDERNFAYTIIKEEPEIKPSLWNKFLDFVWPDYILKHLDYPSFKITF
FT                   RSWCQLWVCTVLTIIPATSHWMGGAAYLIIVLGFITVSGGTSIAMNTLSSIAGFIGVII
FT                   AFLHHVITTKIINHLHYGITPETLTKNLVEEGLCHFDSSLEDCIQDQIFTGRYITTTGS
FT                   AVTILSIITCTFILGNMREHLHPLWALVYVSGQIAICIFACYGHFSPLFDPLEIGYVVI
FT                   KPFALGFVAKIVSALLVYPTTSNWTFFNGYTKILKGLKSSSEKNAKFFKTMKPSASNFG
FT                   NYKAFKKEILKLRGSMAPLEIVASTIWLEYSYGRFDVGDVGEFRSLLKNLFTSSSTYTY
FT                   FYQLLEERTHFVRNEFALVRKRSNASSQFARKPAFDKTDLSYTDVAEYELKQRSKIMKS
FT                   RIILQGEEDSRLTTVVIDEIATRISQYFSGLLDNADSSIEVIAEWLEAANDFRIFSWVP
FT                   GQWSKHISVQKQLNAKVVEAKSELEIELAKFDNVETLKKIMIDSSKPEKEVLFLISQGV
FT                   FFLQIVKNQCENILKVLDYCIELDERRPTPKFITYFSKTKYSEPKHLSNKIDVTNPGSE
FT                   NIVRKRNADTLPPINLFQYTGYLFTKLYKYLISNEFWFWIKVGGIITIGAIPYFVRPLA
FT                   NLYYRNRMIWLVIVIAVSISENTGSSVYVVFARLCYSFFGAVVGMVAWYISCGNGEGNY
FT                   YGYGAVTAILFMYFIYFRHFSVHQTLLPQILYSVTAVLVLGTSWVDAKYNKLANVDVGY
FT                   KPAYLRFIGVAIGLCLGMLAVLLPKPISSKAIVRNVLAKTISEAGNIHCDVANFALARL
FT                   ETPSYNIKGRQDAVLSNYSSLLMRMAGLSKLISLKLEVPIAGYWPESKYKRLSGLVTDV
FT                   IQLYLMLSGALQGLDGPEKWLPIVIKRIGFCFPDLQAEVFASIHMASDSLRTKQALPKI
FT                   TEANISLKHMELLRQQWGLRRISLSERFYSDSASKRDIVNNQDSSKELDHYKLFSNDGQ
FT                   LNIVSLLVAHMIYNRLDEIMILVKGLVGEIYDLNERILVDEDDYIEFNHELEYSNDKEN
FT                   SAL"
FT   CDS_pept        114441..117899
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581771"
FT                   /orf_name="CD36_15600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43339.1"
FT                   /db_xref="HOGENOM:HBG396334"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniParc:UPI000192CF90"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC0"
FT                   /transl_table=12
FT                   /translation="MMLPFSFSDVYFDILISTIANLNEMSNSRDSHESLTSLDSSSSLA
FT                   SSRVSPTHVDAPIPLQDLNQQNDDEELQDDDKDNNIANAYFPDGDERNLIHSIMDEKTE
FT                   TKPTLWRKFLDIIWPNYILKHLDYASFKTVCRSWCHVWSCAVLTIVPRTCHWLGNAAYL
FT                   IVVLGFLSISGGSSIIMNLLASCAGIFGMMVAFIHHVVRSKIINDINHGITSQELAQQL
FT                   IQEGSCQMNDQLQACISEQIFTGRYITTKAAAVSILSLISFTFIVGNIRQHSHPLWALA
FT                   YVGGQFGNCILTCYGHFSPLYQPLEIGHIVLKPFGLSLVAKVLSSLIVYPSTSNWMFFQ
FT                   GSIKFMTQLQKAMDGNTKMFKTLKPSAPNFSNYKAYKKDITKLRSSMAPAENVASTIWL
FT                   EYSYGRFDVGDVGEFRSLLKNLISSSASYAYFYQLLQERTFYAKDDFAIVRKQSNASSH
FT                   LAHGHAKLFSAIQDSYKKVGKYESEKRMKVLRNRIAIHGAGNRMTLGGIDEVAKFMSKH
FT                   FTPLLESANLGIQIAIEWLEAANDFRVYAWLPGKWNIHVSKQKEMNEKVFKARAILRDS
FT                   LHKFEDVETMKKMMVDSTKSENEMLFLISQGVLFLEIAKQQCENILKILDLCLDLDERR
FT                   PEPKFITFFTKTRYSKPRHLSSDMDKPMPDYLASDIQERDADNLPPANAMQFFGLYFTK
FT                   LYSFFISNKFWFWIKAGGLITIGAIPYFVRTTASFYYHHRMVWLVIMIAVSISENTGST
FT                   IYVFCAKLVYTFFGAIVGMAGWYIACGKGNGNYYGYGAVSAVLFVYFVYFRHFSVHQTL
FT                   LPQTLFAVTAELVMGSSWVDAKLYPMTNVKYGFEPAYLRFIGVTIGLCIGSLAAIIPSP
FT                   VSSKALVRGILADGLSEVGNIHCSVTKFALKRAVDPHFHTEPRHDILLAKFRYLLLKVA
FT                   RLSTLLVPLKFELPIAGYWPESKYLRLQGLITDVTQLYLMLLVAFNELEDPVHWLPTIF
FT                   RRIGFCYAELEADIFATIHMAADALRTKEALPKITDANISVKHMELLRKQWGIEKISLS
FT                   ERFYSRMKKTCTPENGHEEITKELDYDKFFSNDGKLNIVSLLVAHMIYNRLDEIIIVVK
FT                   GLVGEIYDLDENVLIAEEEVNDDEEDQPYAWLSEEDDENDLLIQK"
FT   CDS_pept        complement(118099..118800)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231792"
FT                   /gene_name="SOD4"
FT                   /orf_name="CD36_15610"
FT                   /product="Secreted cu/zn superoxide dismutase, putative "
FT                   /EC_number="1.15.1.1"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAX43340.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396341"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="UniParc:UPI000192CF91"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC1"
FT                   /transl_table=12
FT                   /translation="MMKYLSIFPIVALALAGDSPISTDSKGSPPLVARFKKTSKSNIEG
FT                   TIKFEPANNGTVLVSVDLTGLPSGVGPYPYHVHEKPVPESKNCTATGMHFNPFNGSATA
FT                   KTPAALELGDLSGRHGNITSESFETEYDDSYLSLNKDSKAYIGGLSIVVHSNNNTRLNC
FT                   ANITTLDEGDDTASAATWSNSSSSSSSSSKNSTNGSSGTSTSASQGSGAGRAELSGFLA
FT                   AGIAGVVAALI"
FT   CDS_pept        complement(120503..121189)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384658"
FT                   /gene_name="SOD5"
FT                   /orf_name="CD36_15620"
FT                   /product="Secreted cu/zn superoxide dismutase, putative "
FT                   /EC_number="1.15.1.1"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAX43341.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396341"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="UniParc:UPI000192CF92"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC2"
FT                   /transl_table=12
FT                   /translation="MKYLSIFLLATFALAGEAPISTDSKYSKPLIAKFEKTSRSNIEGT
FT                   IKFEPAKNGTVFVSVDLKGLPSDIGPFPYHVHEKPVPESKNCTATENHFNPYNGTLRAA
FT                   TPAAYEVGDLAGKHGDITGESHKAEYNDPYISLNENSRSYIGGLSIVIHANNNTRLNCA
FT                   NITLLDEGNSTSNTTMSNSSSSSSQSSVNTSSNMASTAAQGNNADRAGINGFLAAGVAG
FT                   VIAALI"
FT   CDS_pept        124643..125554
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000032533" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080458"
FT                   /orf_name="CD36_15630"
FT                   /product="Endonuclease/exonuclease/phosphatase, putative "
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /protein_id="CAX43342.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG650771"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000192CF93"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC3"
FT                   /transl_table=12
FT                   /translation="MLGRILFIIFHWTLLVLADSETSDALDITIYSNNVRYAASRRGRG
FT                   RDELPWKTRKHGVVDAIKAQSGVYPILVGLQEVTHTQLKDILKGLNKKHSGDDGRWTHF
FT                   GVGRDDGHKKGEYSPIIYNTAEWNLLNGTYKWLSLTPDKPSKYPGASKKRIVTMGTFFH
FT                   VKSGKVVNFVNTHLDHRSVKSREYSAKLIIQYIKSIPNYFPTFLCGDFNSLDTDKAYAT
FT                   ISHYMVDASHVAEKKYDTNLKTFSGFGNGTSYSIDFIWSPLDTNNHSGINALFYTVLDN
FT                   LFDGGYRFSDHRPIMARYSVTS"
FT   CDS_pept        126149..128974
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231793"
FT                   /orf_name="CD36_15640"
FT                   /product="Mitochondrial respiratory chain complexes
FT                   assembly protein, putative"
FT                   /EC_number="3.4.24.-"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43343.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI000192CF94"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC4"
FT                   /transl_table=12
FT                   /translation="MISILTRSSGRSASILLRRSLPRINSVLLRNLHASSQLFKNRTPD
FT                   NWDEDLAKLKRKYKNFNLPFEPTVSNPVIKLSSSPFNIAYLERETVVYKFMLKEFVDKC
FT                   KEFDEIRGVNTLYPDLVDIIIKDIKETFAKDHKELAELTTDEILQTVRIYYELSNQYLY
FT                   LDDLEFNKPEVQKLFETYNKLDSAEEPDYNKIANELGLNPQAVKLWIEIFQTLESVDFA
FT                   VDGRKSFPLCPPEYNLLTNLKQVRENIEKITPKARQDPFGMFFNKANPKQDDKNTSKNK
FT                   SNENPKDKKKIVDISIELTPKNIFIYTLVFTLATSLILGMGSSNDDTEINFQSFVTDYL
FT                   TKNLVKKVTVINNSVVEVELNDNGAQQHHQQKKLYFTIGSVESFERNLREAQDKYDIPP
FT                   QLRVPIHYTTKGNMARFLINFLPTLLFLGAIYWMTKKAASSMGGMGPMGFGKSTAKKFN
FT                   QETDVKIKFKDVAGMAEAKQEVMEFVKFLQNPEKYEKLGAKIPRGAILSGPPGTGKTLL
FT                   AKATAGEAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKQR
FT                   SKGNATGANDERETTLNQLLVEMDGFDTSDHVVVLAGTNRPDILDRALMRPGRFDRHIH
FT                   IDNPELLGRKEIFDVHLQKITLQKDIDPDLSGRLAALTPGFSGADIANVCNEAALIAAR
FT                   YNAEYVTLRHFELAIERVIGGVEKKSKLLNPEEQKIVAYHEAGHAICGWYLKYAHPLLK
FT                   VSIIPRGQGALGYAQYLPPDQYLMSTLQLYDRMIMTLGGRVSEELHFASVTSGAHDDFK
FT                   KVTGIAQSMVLRFGMSKTVGMVNYYDTRSQDDLTKPFSDETSRIIDSEVQRIVNDCYQK
FT                   CKQLLIEKSKEVELVAQELLKKEFITREDMIRLLGKRPFPETNDAFDKYLDGKPTFKNE
FT                   QPENEKKDSEN"
FT   CDS_pept        129248..130564
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384659"
FT                   /orf_name="CD36_15650"
FT                   /product="Chromatin structure remodeling complex protein,
FT                   putative (Nuclear protein localization factor, putative;
FT                   fungal-specific"
FT                   /protein_id="CAX43344.1"
FT                   /db_xref="HOGENOM:HBG396343"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI000192CF95"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC5"
FT                   /transl_table=12
FT                   /translation="MPRVKKENENVGQSIEEAKHEKDDEYKEEQGVEPQEEGEQFAEED
FT                   VEVAPVRKRGRKRKITTVLEDEDNNATKSRKKSATKSEDDEGEEANENDEEDDDQEAEE
FT                   EEDDEEGETEEDGKKKRGRKKKPKVQLYGDDVFDDDGNPLIIENDEVVIPREDPKGKEK
FT                   IDDLGYLQGDRKFRMKTFKLLGKGDRLYMISTEPARLVGFRDSYLLFKTHRTLFKKVAD
FT                   NDEKMDLIQRGIIPNSYKGRAVNLVTARSIFREFGSRMIENGKKVIDDFWEQRAIDHGD
FT                   IPGELADPDQFYKNKLSNVLGDSGIISTGHATPLTATPIVSYQTDPTWMYQIAKQTSEY
FT                   NKKLYELRSNNMFKGNKDTYTNLTFYPQSTQPTQIKYSKFNNNNGKLVYDIVMTNKNIR
FT                   KPITGLAKVPKSILNEIDDPEIKQAIIDQQEYEISTRKI"
FT   CDS_pept        complement(130673..132232)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581772"
FT                   /orf_name="CD36_15660"
FT                   /product="Zinc finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43345.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396344"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192CFEB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC6"
FT                   /transl_table=12
FT                   /translation="METTLSVSDEKLTNSSTASNKFDDSKEQSQIFTTANTTTDSQQIQ
FT                   PNSQHQQPAVTTKPLSKEATHISLENDLILVDPTQPPKNTGSESVKDTTGDRSDHGKQQ
FT                   AIGDQIKVLVSSNPLNIEEYSGHLNRLATILYEEKFTSDFLVTLHYKLLQLMDELPKFV
FT                   DLQNPLKSQLYTIIDKNFDILIKLATNYNVMEISTASIRFLTTVFMNLNYWEVYNLLNK
FT                   KPVLYHFLNLIEFDLNECYTRFINDYQRFTYEKITQPTVKSRNKSKATKKRKLKGDSDF
FT                   AGSNTATATTSVTTPDANGPHGEKQQRSEAFFSLNPDTSDHDKYVADVISGANVQKRKF
FT                   RPDVKLEHHRIIKKPQPAADKSSTKSSNYDPDVIHECQLPSAEEPHKLCLRRFSRKYEL
FT                   IRHQETVHSKKKKLFKCFVCVKQNPGVGPRIFTRHDTLAKHIRVNHKISGKEAKAEVAY
FT                   SKKHAEVVEEGDITVHVGRRKTKVDFELRAHMEKRKSSGDDTNYMETSDLESGEEEVTF
FT                   NK"
FT   CDS_pept        join(complement(136233..136268),complement(133164..136025))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581773"
FT                   /orf_name="CD36_15670"
FT                   /product="Zinc finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43346.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396345"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192CFEC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC7"
FT                   /transl_table=12
FT                   /translation="MSNSRGESPPILNMTRINLDFHPTELVKQITKRIPRSLPYYNNGD
FT                   SETDADDPIVTELMKLRPHSSRFIISNILYNEEIVQYSAKLQELLYLLLEEKELDDNIR
FT                   INVENSLSELTTSLPALNQDDYRLNNNNNNNVSEPPTKKSKLQQNLPTPVPSQSTFPNN
FT                   YLSKILIDNFDSLLKFSTSYFNLSLASHITKYVVELIYSLNYWEVIHLVYLNSNIINFL
FT                   QLLDFEIVNGSFGPIVRPPENYLSDIMLQGLQYPYPYPFYNYSYHSFNSHVEEQKFRKI
FT                   SIIPYVDITLKNVDEPVQRKKRGRGRKAKNPLPKKEDNNPAMHNTEIQHPEVAKQATGK
FT                   DEEPTAEASRTVSEVSEDEMEKQPQPKTSVKSSISSVTSVMNPSAINTEAVPVAIDAGK
FT                   MSRVGGSASSTATPPTDTVSNADINPPSSYATQSGQALPKIGEFASSKQGSQFSVPRND
FT                   AFVNKTANLSISPISGHDYSTTNPYASYPYSQSSYQHQHQRHDKNKISLSQNSNPNTIP
FT                   TIQPPNEMFVSGPQPELNYRNPSQDRSDNQSRLDHHSNSSAFHGVSPIANYQSKTSNIL
FT                   PSIDRLTNNPTSQTGFSDIGHYPKRPSFGNSPTVGAFATRHNSTSKQHDHHLDQSISQS
FT                   KESTSSQKYENKRENASRAGSQSIASEFPQRKISVEGRISDVDGPSGTQNHLSAEEKAK
FT                   KSKSGVIHQCHLLDAGSLEECSKIFYGKNELLRHQEFVHATKKKIYKCIYCARMGAKVQ
FT                   SYPRHDSLARHIRRKHGITGKENKMAVNYAKENVEIIDPDQLITKQHDFQEPLVSDSQG
FT                   VFLPPKEGASQQQKSSQYQQEQPQFEQKLPSLPPQQQQYSDPIRFEKPAGIPQFMSKFG
FT                   ESGTQLPSLQSYSLGVSQRQPSTTYSSRYNTQPTQPQEIHKYDNPIPTVSPPVGSVPMR
FT                   RPSPLEGKNTDNSSYYISANQSQSPSDMLEQPKKD"
FT   CDS_pept        complement(136591..138213)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581774"
FT                   /orf_name="CD36_15680"
FT                   /product="Triglyceride lipase-cholesterol esterase,
FT                   putative"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX43347.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG332621"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniParc:UPI000192CFED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC8"
FT                   /transl_table=12
FT                   /translation="MTIPLIGRLSLSDWPLIIISFTLAWVEFIISLITTLLPSKFIDFC
FT                   TFVTKQIYKFTPNPITLIIKQKKIDINDEENIKYSYIKSDIPKFTKKSYDLTIELLNSE
FT                   NIEQMVSLFGYEIESRIVRTQDDYLLNIHRIKGKNRPSNGKVIYLHHGLLMCSEIWVTM
FT                   IDKYQNLPFILYDLGYDVWLGNNRGNKYSQKHLFYNLNSIKYWDFSIDEFALFDIPNTI
FT                   DYILQTTKKSKLTYIGFSQGSAQAFASVSVNSDLADKIDQLIAISPATTPHGLYSKFLD
FT                   ILLKSSPNVIYLLFSRRVLMPSCIFWERIMYPPLFDNMIDIANYLLFNWRATNITKLQK
FT                   LSSYAHLYSTTSVKCVVHWFQVMSSKNFQMYHDSNSNLSGLKPISYPLKNIQVPIRLIY
FT                   GTTDSLVDIDVMKSQLPKSTTKAYPVENHEHLDNLWSNDVYEVVFKKVLKFLGEDTDKV
FT                   YARLFRQSEDTKFIEDTIPADESFIVDDGETLHNSSSNGHQSYLKSANNERSATSSGNI
FT                   QVESDIVIDYERQQSIGGNSIFL"
FT   CDS_pept        139447..140304
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384660"
FT                   /orf_name="CD36_15690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43348.1"
FT                   /db_xref="HOGENOM:HBG396347"
FT                   /db_xref="UniParc:UPI000192CFEE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAC9"
FT                   /transl_table=12
FT                   /translation="MQLVNYTQWEIVSYVQVFLFAILLLAFLVITTIKKNERKGLRQIL
FT                   PFFIFFTIFLMLKIVGGILGLVFMHQKTFNVSLFIPTYIFDSIGLGFIARSITSLVTHN
FT                   FKYQDDLPAFFRSKHQKVKKHNHSHSFEKSDNDSDNDHDDDNDEINYWPFRVLTMILIA
FT                   AIVVNIVGTNIIVNYQGSSTGIALIKAGAILFLIEILLMILFLVIIRLSGSQLNIVIYL
FT                   LIVGLAILIVRCVFSLLSGFHWSTWENPSPYIIYFGKYGYYTFLALLPEVITAGIILGA
FT                   FLFW"
FT   CDS_pept        complement(140506..140871)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581775"
FT                   /orf_name="CD36_15700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43349.1"
FT                   /db_xref="HOGENOM:HBG396348"
FT                   /db_xref="UniParc:UPI000192CFEF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD0"
FT                   /transl_table=12
FT                   /translation="MYYRGFYRGAPFCRFGFGGLFLLGGAFILGSIVSGNRPYWSRSFH
FT                   HWGCQCPDCVRRSLRFRNHHHMGCQCPECSLRLKHSNYHETNDSQQGIDNRFERYGDNH
FT                   NYPRNEPSSNNGNNGPM"
FT   CDS_pept        141557..142183
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581776"
FT                   /orf_name="CD36_15710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43350.1"
FT                   /db_xref="HOGENOM:HBG627271"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="UniParc:UPI000192CFF0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD1"
FT                   /transl_table=12
FT                   /translation="MSKALSCYAFESLLFKLNLESNKIPLSKYFETLHESTTTLPSRAP
FT                   LFITWNKNHQLRGCIGTFSALPIESGVSRYALHAALQDPRFSPVNASEVEALEVSVTLL
FT                   DNFVPINNPLDWEIGANGLKISFELNNEHYSGTFLPSVAEEENWDKLTTLYYLLKKADY
FT                   PVSQKNVSKFYEKGLKEGWLELTRYDGLKNRLDYNEFTKIRNQME"
FT   CDS_pept        142574..143755
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581777"
FT                   /orf_name="CD36_15720"
FT                   /product="3-ketoacyl-coa thiolase, peroxisomal, putative "
FT                   /EC_number="2.3.1.16"
FT                   /function="acetyl-CoA C-acyltransferase activity "
FT                   /protein_id="CAX43351.1"
FT                   /db_xref="GO:0003988"
FT                   /db_xref="HOGENOM:HBG370930"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000192CFF1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD2"
FT                   /transl_table=12
FT                   /translation="MFKKSANDIVIIAAKRTPITKSIKGGLSRLFPEEILHQVVKGTIS
FT                   ESQFDLNLIDDVLVGAVLQTLGGQKASALAIKKIGFPLKTTVNTINRQCASSAQAITYQ
FT                   AGSLRSGENQFVIAAGVESMTHDYFPHRGIPTRISESFLADVSDEAKNVLMPMGITSEN
FT                   VATKYGISRKQQDEFALDSHLKADKATQSGHFAKEIIPIQTTDESNQSVLVTKDDGIRG
FT                   GSTIEKLSNLKPVFKDDGTTTAGNSSQISDGGSAVILTTRQNAEKLGIVPIARFIGSSV
FT                   AGVPSGLMGIGPSAAIPQLLSRLNVDTKDIDIFELNEAFASQSIYCIEKLGLDYDKVNP
FT                   YGGAIALGHPLGATGARVTATLLNGLKDQNKELGVISMCTSTGQGYAGLFANE"
FT   CDS_pept        complement(143984..145021)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198978" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537385"
FT                   /orf_name="CD36_15730"
FT                   /product="Phosphatidate cytidylyltransferase, putative "
FT                   /function="nucleotidyltransferase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43352.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG448060"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI000192CFF2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD3"
FT                   /transl_table=12
FT                   /translation="MSSVPSSPIRNDSSFMVAEGQEARLRKEIKKTILDFDSNQSYIEE
FT                   EDRTYIYNNSSILDDDDELEDAEAEDDEDSYELDDTEIEIEEDDSSIVLEKVANSTTDS
FT                   TKDLKSLATEKPSLTFYQFLKKHEIPRKLFHSSIGVLTLWLYTIGVTVPQLFIPLGSVF
FT                   AVLLTNDLIRLNNPALNEKICKVMSFVIRDNEYNSYNGTLFYLVGVLIVLYAYPKDISV
FT                   LSILLLSWADTAASTFGRAFGKYTPQIASGKSLAGCLASCVTGVLTAYLWYGYFIPQYN
FT                   YWNQPGDIYWNASTNKLSLPIYSLLIGVITSISEVIDLAGIDDNFTIPVLSGTCIYWLV
FT                   RLTQQ"
FT   CDS_pept        complement(145603..147060)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581778"
FT                   /orf_name="CD36_15740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43353.1"
FT                   /db_xref="HOGENOM:HBG396349"
FT                   /db_xref="UniParc:UPI000192CFF3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD4"
FT                   /transl_table=12
FT                   /translation="MRFTGSLIPTLIWFISSIQCLNIESSSPSNDTISILTNHFQIIKD
FT                   LLPYSKTSKPQIKEARPLIKVSKDGVPINFHKAPAVIIASNRTDYLFGYGNKLSVSTEI
FT                   KTITEFATAIVSPTQEFDALQLELNTLSLETSALTFESSVDSQFTIVNTPTTQEPKVSS
FT                   NVLQMDAFEQIKKLEKLVLDLRLEMKDQQKSFNAQLLDVHTARNTVPVYTTHIITSVIP
FT                   SYAPEERSTVSHKIVSIASSSTTGIHETQSIDTLSKHKMNRKNILNKKPPPNSVLIAPQ
FT                   FQFHERSATKTAAAYLKPKIVWTSFPTTTATSMFDNFILNNLIDETDSETESGETESAD
FT                   DYYYYYSYEDDEKEDDSDEITAQILFSESKLPATTKPFEDPFERVSMENNKFEPANTSK
FT                   AKKFTNTACGTSTTAIASFENTIFDIPKFFYGNRRKKSNSFKTNNNTIRFDVFDWIFES
FT                   GTASQKVHGLVLVSSSVLLGTCLLFIL"
FT   CDS_pept        complement(147270..148172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581779"
FT                   /orf_name="CD36_15750"
FT                   /product="Nucleotide binding protein, putative "
FT                   /function="ATP binding"
FT                   /protein_id="CAX43354.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI000192CFF4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD5"
FT                   /transl_table=12
FT                   /translation="MLLKTKSLGPRKLFSTWSILTHENPLGIPRVAGKPNSIPKASKGL
FT                   PIRQKIPNVSNIILVSSAKGGVGKSTVSVNTALALYSLGKRVGILDADIFGPSVPKLMN
FT                   LKGEPRLSNSGKLLPLSNYGVQTMSMGYLIDEKQAITWRGLMVMKALQQLLFEVEWSPI
FT                   DYLVVDMPPGTGDTQLSIGQLLQITGAIIVSTPQDIALIDAVKGITMFNKINIPIIGMV
FT                   QNMSHFICPNCKHESHIFKSKGAEKVALENNLRVLSSIPLNEEICVQSDVGKPIVISDP
FT                   NSDIAKPYFDIAKAIVDFK"
FT   CDS_pept        148228..149838
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581780"
FT                   /orf_name="CD36_15760"
FT                   /product="GTPase MSS1, mitochondrial "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43355.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG746795"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI000192CFF5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD6"
FT                   /transl_table=12
FT                   /translation="MNCSDEILDSVLFFFFFSFWRDSSLLLIIFQIQLNILMFRQLLHV
FT                   GKRYLSNENPLKPTVFALSTKFGKSAIAVVRISGPQSKYIYHKLTNSTKPPKNRIASVR
FT                   KLYSFGHRCNQKSVFLDEALTLFLPGPKTYTGEDLLELHLHGGVSIIKSVLQSIKNLHD
FT                   PSNGIMIRQADRGEFSKQAFYNGRLDLTELEGINDMINAETESQRLASLASSSGQTKIE
FT                   FMNWRNEIVNQMANLTMIIDFGEDHDIEETDQIIQDVKENIAKIELEIKAYLLKVKSSQ
FT                   ILLNGIQLALLGPPNAGKSSILNILANKDAAIVSEIAGTTRDILDIPLEIGGYKVVVGD
FT                   TAGIRSFEEADSIEQEGIKRAKKRSMLADLVIVVLDPISVEKDPLELKEHLEALVKENK
FT                   QILIVLNKQDLFVSRSEEMISKYSQVFNLPKNYFYVVSCSTGSGIDNLQKALIEKFKDL
FT                   SQSETSDPIIVSSRVQDILENDILFGFKEFYQWADADDVLLAADCLRQSVDGIGKITGQ
FT                   SIDLEEILDVVFSSFCIGK"
FT   CDS_pept        complement(149923..151818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581781"
FT                   /orf_name="CD36_15770"
FT                   /product="Chromatin structure remodeling complex protein
FT                   RSC4, putative"
FT                   /protein_id="CAX43356.1"
FT                   /db_xref="HOGENOM:HBG396350"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI000192CFF6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD7"
FT                   /transl_table=12
FT                   /translation="MPPRRKLSQSSTESSPVKKSTEESQHATVTHSPQEYIEFFRTTLD
FT                   LVYRLKDGDADLAPPFIKLPSKKFFPDYYHVIKQPISLDKIGKRIESTYTGSSSREFLD
FT                   DFELLLQNASTYNAPDSWIVQSAGKIVNFVREQVEEFESTPSTNNATDDTKKPKIKLKL
FT                   KQRKNETETEGGSEFQSSVKVNKEEPLITFGRLAEFCINILRDVINHEFPKQGVLSGPF
FT                   LEEVDTEVYTDYLDYVTKPMSFNTILSNLEKKKLLSPKFPLLDNLKKFHDTTTLIFSNA
FT                   KAYNNDDSQIYQDAAVLEEYFNEQYNKLKSRIESEADKLHPSTQKLKHSIGRIDTSVAE
FT                   PQLKKRRKRSIKQDFPVEQIHEEDDINNTQPEAINADTQDVDESVDSGELDTSKSREVA
FT                   AEQNAPNTMGKTLPLLPEQNSIIQESALFSTPAVSTNITKFVQQKLSQPATILSREQEI
FT                   KKALFPTQPGNTIATLFSYKVPANGYTNQAYTIALPNGASPFVSFKVSLHNLLYQLKEP
FT                   ELIDDHGILSHLGNDDFQCKLSVNEEEVSNVADCFKEEKGENAVLGVQYDVKLSYGLNV
FT                   LSFNCKVAPNLSKKIKNTSIEEEEVAGRHTRHQLQQMQKTWDVETITFYVVCTSG"
FT   CDS_pept        152193..153962
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581782"
FT                   /orf_name="CD36_15780"
FT                   /product="NADPH reductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43357.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI000192CFF7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD8"
FT                   /transl_table=12
FT                   /translation="MTGDITILYGSETGNAEEYAKYLKQRLRSYNLKPISLASLDDYPL
FT                   RRLVTHTSYLIIICSTTGQGEIPRNGKKFMKFILKKKLPSDLFQHLHLTTFGLGDSSYI
FT                   KYNYAIKKIHTRLMQLGCQLLSPRCEADEISPEGVDGYYIEWEAELIAALLNKFPNATQ
FT                   VSSEAVPMPEYRISVSKGDATKNSKEVNNNAIVSRLGKDGLKLGTVLTNNRITSADHFQ
FT                   DVRDFKFSSTDLNYSPGDTVSLFPCNFDEDVDALLQSQPQWLKIADKPLNVKNMPHAEG
FT                   GFADVLTLRILFKYHLDIMSIPRRSFFALLWHFVDPSTEDGEREQEKLKEFGSFDEPEE
FT                   LYDYANRPRRSILETLLEFQNNLTIPVSYILDLFPLIRPRMFSIASCPSSNEVELVVAI
FT                   VEYKTIIRKIRRGVCTRWLKNLKPGDQFLFSIQKSSFKYKNNNSPIIMVAPGTGIAPMK
FT                   SLIDEVFQENSCQELYLFFGCRFKEKDNLVDSFWHGNENQNFHLINAYSRDSNSKYRYV
FT                   QDALFAQSELIGKLLIEQNARVFVCGSSGKMPREVKITFVEIVKKFTGMEEDEAQKYII
FT                   DLEDNGRYKEDAW"
FT   CDS_pept        154177..155517
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581783"
FT                   /orf_name="CD36_15790"
FT                   /product="Phenylalanyl-tRNA synthetase alpha subunit,
FT                   mitochondrial, putative"
FT                   /EC_number="6.1.1.20"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX43358.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG747088"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI000192D049"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAD9"
FT                   /transl_table=12
FT                   /translation="MLKLPYRPVFRTLKQLRLYSNTPVKDIVADGKTYKVDNWTNVPPY
FT                   ILELTKRKLYKNPNHPIGILHDLIKTSVNGMGYTVYEDFTPIVTKYENFDSLGFPEDHP
FT                   GRSRSDTYYLNRDHLLRTHTSAHEQQCFTECATPGYLISADVYRKDEIDRTHYPAFHQL
FT                   EGARVWDRNDPNLLENIRKDIDEIPKTNIIVEDEFRENPVTANNPNQQHLKEEEVKLVA
FT                   EHLKKTVEFIVYQVFEKARQSAKEQGLTMAYLDEPLKVRWVEAYFPWTSPSWEIEVWWK
FT                   NEWLECCGCGIVQQQVLLNSGIGEDKISWAFGIGLDRIAMLLFNIPDIRLFWSLDERFH
FT                   NQFKQGQINTFVPYSKYPGIKRDVSFWLDRDLHANEVMEIVRSHAGDLAESVSLVDEFV
FT                   HPKTQRKSSCFRINYQSMDRNLTNLEINEIHDKVENDLVEQFNVEIR"
FT   CDS_pept        complement(155563..156819)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537386"
FT                   /orf_name="CD36_15800"
FT                   /product="Leucine-rich repeat-containing protein, conserved"
FT                   /protein_id="CAX43359.1"
FT                   /db_xref="HOGENOM:HBG396352"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000192D04A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE0"
FT                   /transl_table=12
FT                   /translation="MILFQLPVELIQKVLSKLSNKELQHYFNIEGLLATTTDQITNSSY
FT                   LPIRLIALSVYFYNKSVIISNTVGEHYKHVQKHNTDIYVSLDHLQSLSINNFIIRPRQI
FT                   FIYITDDTDQNSCGCPLNLSHISFIHKLSQLLPVMMSQYCYRSDTKVNLSISLSTTEDL
FT                   NSLYDLLHTIKTFQKLSIKYTAKETLDIASEPLQDLQIDTLELQFFNQYRLIDNLQANN
FT                   NQLLSINHLQLSYNSISSLYFFPCYSNLKSLNLSNNNLVCINNHNFNWGNLYNLEVLDL
FT                   SNNNIIEINLTNRRNTRNYKLRSLNLSTNNLRTLPNFQQCKFFENLQDLNLSRNAITQL
FT                   SIKSFPNYLETLWLKGNYLSQLIDELNGEVFPKLLQFLDLTYCKIISLDRDYRYQATVI
FT                   EKLISVEKLNNLKVLQLEF"
FT   CDS_pept        157551..157997
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581784"
FT                   /orf_name="CD36_15810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43360.1"
FT                   /db_xref="HOGENOM:HBG396353"
FT                   /db_xref="UniParc:UPI000192D04B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE1"
FT                   /transl_table=12
FT                   /translation="MGNCLSCLLGTSNDDDYNETSSLLRHQQQHNQQYLSDYLQEEQIL
FT                   KQQQRQQELVSIVNELNDNLIDVTSFLSGNNNNNASLGNSGILANESNINEEEEIQVSS
FT                   TKKSLPYVYTKEDKDEILKKLNDIDDEVKQSFKIKSSEPLYIKF"
FT   CDS_pept        158604..159683
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384661"
FT                   /orf_name="CD36_15820"
FT                   /product="Oxidoreductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAX43361.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG396354"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D04C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE2"
FT                   /transl_table=12
FT                   /translation="MTIVTLNWGILGAGNISAQFVHDLVLNNQRDTQFHHIVKSIGCSN
FT                   HDKGLEFIKKNNITADNNFQITPIVESYEDFYKNSDIDVVYIGTPHTFHKEQSIACLNN
FT                   DKHVLCEKPVTVNRAELETILSVAKSKKKFFMEAMWTRFFPAITELKKKIYDEKVIGEI
FT                   YRLFADLSYNCDISNVPLSSRIRDKNLAAGSLLDIGIYPITYSRILLDDNLGADHSPFQ
FT                   IKSFLTIDSQDRVDHLYSAIVKYQNGKHAVLTASELVDGPKAYVRLECSQGHVEMYSDN
FT                   PARAKHFKVFNAKGDEIFEYKDDSGYNGFIYEANAVAKDIADGKLSNNTMPHDESLLIM
FT                   ETMDQIRHENGLVYPQDES"
FT   CDS_pept        159848..160804
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080459"
FT                   /orf_name="CD36_15830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43362.1"
FT                   /db_xref="HOGENOM:HBG396355"
FT                   /db_xref="UniParc:UPI000192D04D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE3"
FT                   /transl_table=12
FT                   /translation="MTSIKYTLRFLIWLIIYVIPTMSLFNNTKFESGQDSSFLQHITEF
FT                   AHWEKQNLYQRPVGPPKPQLKSINLNKTESFNSSFTLPIVKQFFNSSKLVNTSIFEQTS
FT                   RFRGDKKAPHWTVSTGLFADKSKEWNEEEEECFMPIKEIPQRRPKKYKPRKKYVRPVPP
FT                   PRPQKWSRPNYWSFTSEEDSFSDWWSSDCSESDWSSDDGGKLWFLGMNVAQEKSETTQI
FT                   SIIPSRKLVTRVNEQFYNTYRSNFSNNDIKKRNLDDSYDEYFGFDNEIQSRITNNLSKK
FT                   YVESNVLNSKSTQNKILSKWKLKLLVCLFALHTLYYS"
FT   CDS_pept        160999..161742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581785"
FT                   /orf_name="CD36_15840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43363.1"
FT                   /db_xref="HOGENOM:HBG396356"
FT                   /db_xref="UniParc:UPI000192D04E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE4"
FT                   /transl_table=12
FT                   /translation="MNKICLTNNLTKMPVNFFFKMLKLYLLFCIFSFHSVIAPIPTIEK
FT                   YNSTDSIHSTNINNQQDLKDLTFFSQVVLSTPKWDQSLTRYKRKKRDYDDVSSAVADTQ
FT                   ELSNNTFLMQGRKETSPKWHVGAGVYLNKERFSDTKKTFVKYESDYCSEEDYSSDEGGS
FT                   KRKWFKPFSIDLNETQDISIIPSSKILSVDTKGNFVSHNKISNFTLGYHSDTVQKDIFE
FT                   SSGDFKAFKMVYIVVILIIYSFLHF"
FT   CDS_pept        161930..162613
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581786"
FT                   /orf_name="CD36_15850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43364.1"
FT                   /db_xref="HOGENOM:HBG396357"
FT                   /db_xref="UniParc:UPI000192D04F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE5"
FT                   /transl_table=12
FT                   /translation="MFFTISIVLWFMISLPSTLPVSIDNKGLLLKRHVEPNDIQFFNQG
FT                   VRSSLSYLYQKRERSDSDNELILKKKKGKKKTVSTDTSGNENTTDFASAQEFEKWEGDR
FT                   EGWQISAGLYFDKAIASDSCDSDSEEEGRKKFWIFTDDAPLENEIVDVSSKDELEFNYI
FT                   PGNKSLDSSSKEIPKVDVNSTIHNQSKIKFNFDVTEENQFESGFGSVVSYNCFYLYILL
FT                   FCIFF"
FT   CDS_pept        162808..163473
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581787"
FT                   /orf_name="CD36_15860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43365.1"
FT                   /db_xref="HOGENOM:HBG396358"
FT                   /db_xref="UniParc:UPI000192D050"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE6"
FT                   /transl_table=12
FT                   /translation="MYKLILLTWLCLLPVQMVSSDSTKKLFPKTDVNDLVYFNQVFDMA
FT                   TKQTSDPDSDSFIENSNKTITLITLDKPPNNDTNAVDAQFKKKKGKLKPKWELNAGVYL
FT                   EKKVNKKLLKKSKKKNSKKFGILTNNNGETERILIPTELMVSRATPGTHNLFSQNSSNY
FT                   PFQLTKINITSIKKAPVLSTSIAHEFLDINHGIVKFSIANKVFDGFWNQIFWAFLYIL"
FT   CDS_pept        join(complement(164207..164254),complement(163529..164137))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177219" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384662"
FT                   /orf_name="CD36_15870"
FT                   /product="Vacuolar protein sorting protein 24, putative "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAX43366.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG713119"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000192D051"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE7"
FT                   /transl_table=12
FT                   /translation="MDYIKKKIYGPDPKEQMRKINQLLRKNKRELDRSMNQLVPLRKKT
FT                   ESLIKKSAKDKDYKSAKLYARELININKQYNKLYTSKTRIESITMSINEQYSMNKLTQS
FT                   IHSSTSIMKDVNSLIHIGAVSHTMQELSKELMKAGIINEMMDDMVDLDEMDEELEEVNK
FT                   IISDLTEDKFSKIENEIPSNEFNEQVIEPPAEVAEEDEEDELALDEMRERLKALQ"
FT   CDS_pept        164792..165277
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581788"
FT                   /orf_name="CD36_15880"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43367.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396359"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI000192D052"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE8"
FT                   /transl_table=12
FT                   /translation="MPVQQSATNTTPSSQEQFVLIVAAIILPPLAIFLSKKYSIWNKEF
FT                   WISVVLTLIGHIPGAIFAVYYLLCVQFPQQGVEGYTQLPDDVEQQLHAEHQQGSSQEQP
FT                   QEQHQGIRIYHDEEHVQPKENQILTANDLPSYDDIVGSSEAATGHRDVKGGDNKIQH"
FT   CDS_pept        complement(165330..166418)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537387"
FT                   /orf_name="CD36_15890"
FT                   /product="Replication factor c subunit 5, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43368.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG330815"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR019483"
FT                   /db_xref="UniParc:UPI000192D053"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAE9"
FT                   /transl_table=12
FT                   /translation="MSLWVDKYRPRTLDQLTYHDSITKSLRALAKSGDFPHLLVYGPSG
FT                   SGKKTRIYCTLNEIFGPQVEKLKIDVKNFVTSSNRKLEFNVLSSSNHLEITPSDMGNND
FT                   RVVIQDLLKDVASTEQVDFANQSRAKHRFKIVIINEADSLSRDAQAALRRTMEKYSSNI
FT                   RLILVCNSISNIIAPIKSRTLLVRIPSPSVDDINHILSHVAEKESLKFNTNNDSEIDHF
FT                   YSKVAEASNRNLRRCLLSFETISMQAETINVRSDVAKVALDWETIVRNMAINIQKNQNV
FT                   ATLAKTRVVLYELLSHCIPARIILKTLLFDLIDLSSKNNQLVLELINQASIFDERLSLG
FT                   SKSIFHLEGFVAKSMVSISNLK"
FT   CDS_pept        complement(166830..167387)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581789"
FT                   /orf_name="CD36_15900"
FT                   /product="Peptide methionine sulfoxide reductase "
FT                   /EC_number="1.8.4.11"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAX43369.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG748152"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI000192D054"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF0"
FT                   /transl_table=12
FT                   /translation="MVSTISPTILKTPTSKLINLSAGCFWGVENVFRKQFTNKGLVDIK
FT                   VGYANGKPSISNVTYEKVCTGTTNYAETVQISYEPSQLKLAEILDIFFKMHDPTTVNSQ
FT                   GPDVGTQYRSAIFTFDDEDKSLALKIRDQFQKEWYPNHKIATTIESIYNWYDAEDYHQN
FT                   YLTKNSGGYECPTHFIRTKPKI"
FT   CDS_pept        complement(167665..169767)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581790"
FT                   /orf_name="CD36_15910"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase, putative "
FT                   /EC_number="3.1.2.15"
FT                   /function="peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAX43370.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG396361"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000192D055"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF1"
FT                   /transl_table=12
FT                   /translation="MGNNETNNLLFGDGSDKIFGMENFGNTCYCNSILQCLYYTESFRL
FT                   KLIQHNQTKHDPKLMVIGVKPHSFTSKYEQLVQKKLREQGGKSGSSNSNTTTEERPKQG
FT                   SRKGSIFGIKFNNSTNTSTTTVPIVIHDSKKPYMKYIDKAKDCEALSLEQRIKISKSPE
FT                   FQKLDILITRPSINETTKKPVDDDNRNDYSQSSSMLLNDQPQQSIHEGSISTTSSAIIV
FT                   GIPHPEANLSTPINPFNSDPNSDQRKRSALINGPIINLDTSLQLPSEQQEDTALLYALK
FT                   DLFESMVENKSTIGVVSPTYFIQKLKDKNFLFRQNNMHHDAHEFFNYLTNEIIESLNKE
FT                   GFTDDKNWCSDIFRGLITNETKCLSCEKITSKQELFLDLSIDIPPGESAFSLSYALNNF
FT                   SKSETLTHQNKFYCNTCSSLQEAVKTIKLKKLPEVLVINLKRFKYDEQMDKMVKLFDSI
FT                   NYPFKLRLFNTTDDESLTDLLYELYALVIHIGGGPMHGHYVSLCKIKAGLWLLFDDETV
FT                   ELVEDSYVMRFFGNGPGLASAYILFYRQAKYDPDFGFNPDDIYNGNDDYSLKQTEDESS
FT                   TLATSVENDYPDAKSEASSIASFNVNEATKKTNVFKNFKFDKEDKAPGPISRSNSISAN
FT                   VAPSVPIKEVKEKKSWVGNLKRRNTESSNSGNIPPMERKPSTSSTISGNGNTSERRRSI
FT                   FGFKRK"
FT   mobile_element  170482..170658
FT                   /mobile_element_type="retrotransposon:solo LTR, phi D"
FT   CDS_pept        join(172480..172626,172628..172774)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        173769..175409
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581791"
FT                   /gene_name="HGT7"
FT                   /orf_name="CD36_15920"
FT                   /product="Hexose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43372.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D056"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF2"
FT                   /transl_table=12
FT                   /translation="MSQDNVSSTSTAEAVNNEIKVKDEIPQEEPAHTSLEDKPVSAYLG
FT                   IIIMCFLIAFGGFVFGFDTGTISGFINMSDFLKRFGGTRADGSLYFSNVRTGLLIGLFN
FT                   VGCAIGALFLSKIGDMYGRRIGIMSAMVVYIVGIIIQIASQHAWYQVMIGRIITGLAVG
FT                   MLSVLCPLFISEVSPKHLRGTLVCCFQLMITLGIFLGYCTTFGTKKYSDSRQWRVPLGL
FT                   CFAWALCLVAGMSRMPESPRYLVGKDRIEDAKMSLAKTNKVSPEDPALYRELQLIQAGV
FT                   ERERLAGSVSWGALFNGKPRIFERVLVGVMLQALQQLTGDNYFFYYSTTIFKSVGMNDS
FT                   FQTSIIIGVINFASTFVGIYAIEKLGRRHCLLIGSIAMSICFLIYSLVGTQHLYIGKAG
FT                   GPSRKPDGDAMIFITTLYVFFFASTWAGGVYSIISELYPLKVRSKAMGLANASNWIWGF
FT                   LISFFTSFITDSIHFYYGFVFMGCLVFSIFFVYFMVYETKGLTLEEIDELYSTKVVPWK
FT                   SAGWVPPSEEEMATSTGYAGDAKPEEEHV"
FT   CDS_pept        176610..178250
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581792"
FT                   /gene_name="HGT8"
FT                   /orf_name="CD36_15930"
FT                   /product="Hexose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43373.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D057"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF3"
FT                   /transl_table=12
FT                   /translation="MSSTNSTENHAVEEKYEDQQQQQQQQQQQQQKDALANKPLKEYIG
FT                   ISIMCVLIAFGGFVFGFDTGTISGFINMPDFLQRFGGTRADGTLYFSNVRTGLLIGLFN
FT                   VGCALGALFLSKMGDMYGRRVGIMGAMIIYIVGIIVQIASQHAWYQVMIGRIITGLAVG
FT                   TLSVLCPLFISEVSPKHLRGTLVCCFQLMITLGIFLGYCTTYGTKTYSDSRQWRIPLGL
FT                   CFAWALCLVAGMLRMPESPRYLIGNDRIDDARISLARTNKVSPEDPALYRELQLLQAGV
FT                   ERERLAGSASWKSLITGKPRIFERVFVGAMLQSLQQLTGDNYFFYYSTTIFKSVGLNDS
FT                   FQTSIIIGVINFASTFVGIYAIEKLGRRHCLLIGSVAMSICFLIYSLIGTQHLYIDQPG
FT                   GPSRKPDGNAMIFITALYVFFFASTWAGGVYSIMSELYPLKVRSKAMGIASACNWLWGF
FT                   LISFFTSFITDAIHFYYGFVFMGCLVFSIFFVYFMVYETKGLTLEEIDELYSTKVVPWK
FT                   SAGWVPPSEEEMATSTGYAGDAKPTEEHV"
FT   CDS_pept        179544..181205
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581793"
FT                   /gene_name="HGT6"
FT                   /orf_name="CD36_15940"
FT                   /product="Hexose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43374.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D058"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF4"
FT                   /transl_table=12
FT                   /translation="MSLDNSTENRDLEEKEEIPKNEQNEQNEQNEQNENNEHIPTLEDK
FT                   PLKEYIGISILCFLIAFGGFVFGFDTGTISGFINMSDFLTRFGGTRADGSLYFSNVRTG
FT                   LLIGLFNVGCAIGALFLSKIGDMYGRRIGIMSAMIIYIVGIIVQIASQHAWYQVMIGRI
FT                   ITGLAVGMLSVLCPLFISEVSPKHLRGTLVYCFQLMITLGIFLGYCTSYGTKKYSDSRQ
FT                   WRVPLGLCFAWALCLLGGMVRMPESPRYLVGQDKIDDAKISLAKTNKVSPEDPALHREL
FT                   QLIQAGVERERLAGKASWGALITGKPRILERVIVGGMLQSLQQLTGDNYFFYYSTTIFK
FT                   SVGLNDSFQTSIIIGVINFASTFVGIYAIERLGRRLCLLTGSVAMAICFLIYSLIGTQH
FT                   LYIDQPGGPSRKPDGNAMIFITALYVFFFASTWAGGVYSIISELYPLKVRSKAMGFANA
FT                   CNWLWGFLISFFTSFITESIHFYYGFVFMGCLVFSIFFVYFMVYETKGLTLEEIDELYS
FT                   TKVVPWKSAGWIPPSDEEMVHAKGYTGDIHGDEEQV"
FT   CDS_pept        181657..182298
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231794"
FT                   /orf_name="CD36_15950"
FT                   /product="60s ribosomal protein L16, mitochondrial,
FT                   putative"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43375.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG286097"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniParc:UPI000192D059"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF5"
FT                   /transl_table=12
FT                   /translation="MFNQFKSTTVFNSIFGSFRRFKHEYAPRFKEVEKAQKGRVSVRTG
FT                   GSIKGNSLEFGKIGLRLKSQGIRMHANQLQAADKVLRRELRPTKSKLYTRFVCDLAVCI
FT                   KGNQTRMGKGKGAFDHWATRMPTGKVLFEIDGPIHDKVARDALRKAADKLPGLYEIITP
FT                   ESKVRVSLTHLIDKPEPVDYVEKLNAKPTKKWANVQAYHTDPMYKQYSGR"
FT   CDS_pept        join(182457..182652,182710..182828)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231795"
FT                   /orf_name="CD36_15960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43376.1"
FT                   /db_xref="HOGENOM:HBG448061"
FT                   /db_xref="InterPro:IPR019269"
FT                   /db_xref="UniParc:UPI000192D0A9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF6"
FT                   /transl_table=12
FT                   /translation="MSKETPKLINNALKITSKLVESDTNISTIDLNLLENLNTNQSLNY
FT                   IKLEKNMNEIEANAKHLQILNSEFTGYTQELLQIENKVAILEDIISELDNWTRELENIK
FT                   "
FT   CDS_pept        complement(183257..183706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582764"
FT                   /orf_name="CD36_15970"
FT                   /product="Diphthamide biosynthesis protein 4, putative "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX43377.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG748874"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000192D0AA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF7"
FT                   /transl_table=12
FT                   /translation="MISYYDVLGITPEASIPELKQAYKSKLLTSHPDKIDNSTAQVDIP
FT                   LIKQAFATLIDPTSREKYDQQLIESSKLNGFNINGSGLDIYSLDDFEFDNDEWTKSCPR
FT                   CTAHNSICLTETDLEKGTPDKDGGFDIIVQCNSCSLWIQVKYYEE"
FT   CDS_pept        183894..185075
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582765"
FT                   /orf_name="CD36_15980"
FT                   /product="DNA-Directed RNA Polymerase I, 49 kDa
FT                   polypeptide, putative"
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43378.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG396363"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="UniParc:UPI000192D0AB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF8"
FT                   /transl_table=12
FT                   /translation="MSSNIKVNSVTEKPVATVGSFFNGLAVSPEVEFDLYKHKKRDDYV
FT                   LHGETDTLEYNGTSNNDNEYVVAVFDPNCKSVELYKTPYISTKVTAKKNRVYKGPKIKS
FT                   AGVRNVTQRNALGEAFGTKKAKSAITNLEKNRIDSEKLQDIEMDIVDTVKESTRDLPTQ
FT                   EDGVDRPAPFANVDATNVEDIYPLEKIIPEKDWQYLRVSSILTTENPLEKLPFTKSEFI
FT                   TKQLPILISQKNTEKLQMLYYASLLLGVYENRRVKDKQSLMTRLQNIPSEILVDGILDR
FT                   FAISRATKFGKSKDKSFTIDPYHEDKLLTYLFILLLHINNFTVELVPLSKDLKLKNTRL
FT                   VGLFRALGAIIKSATVGEAEALGIPKSAVGTYKIATLKVPFKLPELTRRGKRR"
FT   CDS_pept        complement(185820..186236)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582766"
FT                   /orf_name="CD36_15990"
FT                   /product="Ergosterol biosynthetic protein 28, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43379.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG444695"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniParc:UPI000192D0AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAF9"
FT                   /transl_table=12
FT                   /translation="MLGYFESILPYTNGGKLPYWLLFISVVSIFNSVQTYQNINLTKRV
FT                   YERNPNQVSPLSARTFGTWTLITSIVRFYGAYYLQNKQVYELTQFTFAIAAWHFLSEWL
FT                   YFGTCKLGKGLSGPLIVSSVSLVWMYLQKDFYVN"
FT   CDS_pept        complement(186458..187834)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232048"
FT                   /gene_name="CaPKAR"
FT                   /orf_name="CD36_16000"
FT                   /product="cAMP-dependent protein kinase regulatory subunit "
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /function="kinase activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="CAX43380.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG736470"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000192D0AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG0"
FT                   /transl_table=12
FT                   /translation="MSSSQQQFISDELSQLQKEIVSKNPQDVLQFCANYFNTKLQAQRS
FT                   ELWSQQAKAEAAGINLFPVVDHVNVNSSGVSIVNDRQPSFKSPFGVNDPHSNHDEDPHA
FT                   KDTKPDSSAIAGGIFKSNFDVKKSSSNPPAKEVDPDDPSKPSPSNQPIQQLPSSSTTTT
FT                   SSSKIPVAFNANRRTSVSAEALNPAKLKLDSWKPPVNNLSITEEETLANNLKNNFLFKQ
FT                   LDANSKKTVIAALQQKSFTKDTVIIKQGDEGDFFYIIETGTVDFYVNGAKVSSSSEGSS
FT                   FGELALMYNSPRAATAVAATDVVCWALDRLTFRRILLEGTFNKRLMYEDFLKDIEVLKS
FT                   LSDHARSKLADALSTEMYHEGDKIVTEGEQGENFYLIESGNCQVYNEKLGNIKQLTKGD
FT                   YFGELALIKDLPRQATVEALDNVIVATLGKSGFQRLLGPVVEVLKEQDPTKSQDPTAGH
FT                   "
FT   CDS_pept        188912..190969
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080711"
FT                   /gene_name="CaKAR2"
FT                   /orf_name="CD36_16010"
FT                   /product="Putative uncharacterized protein CaKAR2 "
FT                   /function="ATP binding"
FT                   /protein_id="CAX43381.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000192D0AE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG1"
FT                   /transl_table=12
FT                   /translation="MRSHQSSWLPRIGLLYVALVILIPFLVSPKHAFAVAAVSDDESST
FT                   DNYGTVIGIDLGTTYSCVGVMKNGKVEILANDQGNRITPSYVSFNGDERLVGDAAKNQA
FT                   SSNVNNTVFDIKRLIGLKYNDDTVQKELKHLPYKIENKGNKPVVKVEYQGEEKTFSPEE
FT                   ISSMVLGKMKSIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPT
FT                   AAAIAYGLDKGDKEKQIIVYDLGGGTFDVSLLSIEGGVFEVLATAGDTHLGGEDFDFKI
FT                   VRYLAKQFKKKHGIDITANAKAISKLKREAEKAKRTLSSQMSTRVEIDSFVDGIDFSET
FT                   LSRAKFEELNIAAFRKTLKPVEQVLKDGGVKKSDIDDIVLVGGSTRIPKVQELLEGFFD
FT                   GKKASKGINPDEAVAYGAAVQAGVLSGEEGVDDIVLLDVNPLTLGIETSGGVMTTLIKR
FT                   NTAIPTKKSQIFSTAADNQPTVLIQVYEGERTMAKDNNRLGKFELTGIPPAPRGVPQIE
FT                   VTFSLDANGILKVEAADKGTGKSESITITNEKGRLSKEEIDRMVEEAEKYAQQDQELKE
FT                   KIEARNSLENYAHVLRGQLSDTSETGLGSKLDDDDKETLDDAIKETLEFIEDNFDTATA
FT                   EEFEEQKQKLIDVANPITAKLYGGAGGAGGAGDAKFGDDDSDDEFDHDEL"
FT   CDS_pept        join(191336..191358,191497..193735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232049"
FT                   /gene_name="CaNOT31"
FT                   /orf_name="CD36_16020"
FT                   /product="mRNA deadenylase and CCR4-NOT complex subunit
FT                   Not3p, putative"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43382.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG396062"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="UniParc:UPI000192D0AF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG2"
FT                   /transl_table=12
FT                   /translation="MSNRKLQKEIDIIFKKIQEGLQDFDYHYERYESIQNTEDDSDNQR
FT                   EKEKLANDLKKEIKKLQKFREQIKHWLQNDTVHTLGPVGTSYESKLAENKSLIEDSMET
FT                   YKLVEKQSKLKTFSNQSIMMAFMDTTNGDEDDDDDDSDDDDDGLFSGSDEDEEDEYSDL
FT                   PEDAVNAIHFFKDSILHLREQTHKLDHEYEKLAAKKLRKNNLATIEAKKEKIQSTIGNN
FT                   KFHQKKLKKLLKKLKSGIVTEFNLIWLLKDDLDKYLESNGDYEFTRETELYDDIFNQIA
FT                   AVEEDYSEIHEDHHDHSYSEKASTANGSNHDSVTTATTAKNTSVSTQRTSPSPILTKAN
FT                   GHIKESSVESGSPTSLRSKLSKAHTNISQSSTHSNTAATTTTSTSSTHAPAPRQSPELT
FT                   SPAIVKTLRPATAPSKPVGSLKWSTAAAVAIPEVQEKPELAESESNGSNVHKTISKDQY
FT                   DETAGYEKQQQQQQQTSLESKILSTTQSLTPSLTDNINLEKCKQVIKNSNLTKTELGLF
FT                   SDMNLVRVPPGIQDLVISFASKRNNDNFKVLVDAAEFNQFALPLHKPYLPEIVQPSYYS
FT                   QYTSTNFKHPTPLVKFQSYWNQVRANFGFQKLVDEIKTLTLQNNADNLPIIAELTFVLF
FT                   YGFYYGVTPAENLIAESYLFELGWKPYKNQTEDGSNLSTTPVNLIDINGSKSKSRSNNY
FT                   YFWFKRVKLISRGEDMGQQSNIEFGDYQVFDLSFWEIFVKYGFKFDYNLCQMEPPKTLF
FT                   "
FT   CDS_pept        complement(193806..194201)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093571" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080712"
FT                   /orf_name="CD36_16030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43383.1"
FT                   /db_xref="HOGENOM:HBG396063"
FT                   /db_xref="UniParc:UPI000192D0B0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG3"
FT                   /transl_table=12
FT                   /translation="MQSLKSIIESGKIKAAKLREFDLVFANIDSYVEVPFIPNSSTYKN
FT                   MPIVVAKDGTQYKYKEAKEYVDKTEASVIISSSPCITSDKWLLSDADIGEVNGTLPTTQ
FT                   SDSILTSQSNFDSEGFTNVKEYENVNI"
FT   CDS_pept        194613..196004
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384904"
FT                   /orf_name="CD36_16040"
FT                   /product="Peroxisome assembly protein 12, putative "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAX43384.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396064"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192D0B1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG4"
FT                   /transl_table=12
FT                   /translation="MEYYSSLDASQLDSERPTLFELISANQLESLLSPSLRYILVHYAS
FT                   KYPRYLLQVNNNFDELNLLLRSFIEWYFLTYWQGTFTENFYGLKRVSQTPLSQGDYNSS
FT                   RLTQLVPSMIEERRKLSKLQKLVSLFEVTGVSFVSEKLNYCYEVWYTKYITNQLNTSDT
FT                   LTTEENVKIKIKRKFVEIYPYLQSAYRAANFITTLLYLSGSSKSPTLLTYLFRINFSRL
FT                   NQYDYSKNEPKQPLSDSKRPNRIHPPTAIEYILRLLSNNITKPSWKVIKFVLGTFFPVA
FT                   IFTLKFLEWWNNSDFSSKLSKNLGNVLDFTLPPPSSLTLALRSYKKNEDKKNTETEVKQ
FT                   QKKKQYKSGKVCPLCKKELTNPAIIETGYVFDYKCIYNYLEKSHIIVSKKVQTRQEEED
FT                   EDIYSEDESEDENIGHEKEEQKENIVIDINKGGRCPVTGRRLLGCKWNPIKEEWDIEGI
FT                   RRLIF"
FT   CDS_pept        196299..197573
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582767"
FT                   /gene_name="MRI1"
FT                   /orf_name="CD36_16050"
FT                   /product="Methylthioribose-1-phosphate isomerase "
FT                   /EC_number="5.3.1.23"
FT                   /function="S-methyl-5-thioribose-1-phosphate isomerase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43385.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046523"
FT                   /db_xref="HOGENOM:HBG682649"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniParc:UPI000192D0B2"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WAG5"
FT                   /transl_table=12
FT                   /translation="MSTTTRTLQAIKFDRNNIKLEILDQLLLPYSTTYIPITSIEDAFK
FT                   AIKLMQVRGAPAIAIVGAFSVVVEVSNYLKQSDSNRKTIENLNDSLDYLITSRPTAVNL
FT                   ANALNDIKQLLQEFNDTDIINEKIYQQIYDYAIALYDEDLANNKKIGENGLKYIINTLT
FT                   EQNFKGPFSIMTICNTGSLATSGHGTALGIIRSTYQALQKNNSKEEFWLDHIYPCETRP
FT                   YNQGAKLTTYELDYEQIPFTLICDNMVSSLINTLSDDDNKKPIKTNQISPVKFIIVGAD
FT                   RIVENGDTANKIGTFQLSTIANFFNNNKFIQQQSKSNTTKTTINKEIKFIVAAPKTTID
FT                   LNTKTGDDIVIEERPANELTTLVGPLLNEAGDVGEKLTVGIATPGISVWNPAFDVTPHE
FT                   LIDSIVTEDPHVFTKDENGEFNLIK"
FT   CDS_pept        complement(197681..200614)
FT                   /pseudo
FT                   /gene_family="HOG000141598" [ FAMILY / ALN / TREE ]
FT                   /protein_id="CAX43386.1"
FT   CDS_pept        complement(201769..202827)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582768"
FT                   /orf_name="CD36_16070"
FT                   /product="Vacuolar membrane protein, putative "
FT                   /protein_id="CAX43387.1"
FT                   /db_xref="HOGENOM:HBG396066"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniParc:UPI000192D0B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG7"
FT                   /transl_table=12
FT                   /translation="MGCGELLSVPLVFLSLFSNENVPFYKTENATSSDDVNDGKCELIG
FT                   TFSLMTQAILGMLCLSSLLIKRFYEYPIRRTWPVWIFDVSKQLIGALGVHIFNVILSMV
FT                   KTAPEIWLIKNNISDDGDNDNDNYDDSGDTKDPCDWYFLNIVLDCTIGVYILYHVFKTM
FT                   NKICQDYWHITQIESGEYGPNPNKPSTKAFLKQLMVYFTSLMITKIILYGLVECFENQL
FT                   LWFTSHILLIWLNEYPDEFEIFIVMFIVPIIMNCLQLILIDNFIRNQMWININKRMRLE
FT                   FPNFSDETESVQQQDIIQAQREEEEQQQKQKLQFSNNTIQDGNNYSSSSSNSDSLLGES
FT                   HNKSNYGTYNDV"
FT   CDS_pept        complement(203445..206405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384905"
FT                   /orf_name="CD36_16080"
FT                   /product="Regulatory subunit for type-1 protein
FT                   phosphatase, putative"
FT                   /protein_id="CAX43388.1"
FT                   /db_xref="HOGENOM:HBG398382"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI000192D0B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG8"
FT                   /transl_table=12
FT                   /translation="MSLSGEVFSGGATTSQHIEAQDDDHFENTTFKLKRTRSMGLLDEF
FT                   IPDKLKEQDGNSEANSAPSTTTTSSGNLAAMAAMASQSNSPFVDESPSSQHYEATETIS
FT                   NNSDANATQSSVAPSPPSPVNSPSPASSPALDLKSPELLPHDDTDLTAEPSRHVDYLSH
FT                   QWDVSDIWKSWRYVISKRRDVANAARLENASWRTWAQRRSNLKTISPEVVNWSKDSDVT
FT                   WLYGPILKDDDHVNNENHDSDAIETTATSSVAGDISIAKKCSSKNGPKPILKKRTMEQS
FT                   MISHSNLLKLQLATQIHQKKREQKLKQQEELKRQHQLNHPDEYFDPEALSNKLNSQYKN
FT                   TTPTHNSSVAKLQNLLKTSNSSSTASLKDLIKDEAVVVPSSEQISQDQNQEDGNVSGDI
FT                   GSKAERHIHFNDEVMQCIAVDVYSDDDQRFNSGEDYDSDDDDDDDDDDDYYDEYEPSND
FT                   SLAQSHLYEGDDESIEEEEDDDEDASEDEEEDDEGGFFLNVKSNSNAPLILGQHSSGST
FT                   STPVAPSLSRHTDITDDTASISTTNSKSYKTIQLLPSTSINYGSDESSDEANPYTSSLS
FT                   HNVNNEISRGYDYYYDYNTVYTCNPNNSVYASYQSPDVVDVPENLDMGSNFDYEFIENN
FT                   DSIPMVDTTFENNSTINNMPISYSSPSSPLSVAISGGGSKNSGVTANSPNFPIVNVNPN
FT                   SQSQSQTKPKASPFQLSDSEDDSDNDSDDSNDGISGLSIGTRRSSQALAESVFQSSLTT
FT                   SSQENPVPQHFPDTKEAEPVDEHISSINPRYSSTSISKQPTSSSSLSQSFFGGAGGFSS
FT                   TDKELSKSFLGGSTSSDEKITTDSNPEFIQTPNRDYTPSPDNNTLTRTLSNTSKKSSPL
FT                   PPQTTSENAFRGDGQHVPPQQSQQSQPRRGLLFDEGDSEDSEDEGMVIGKREDKIHGQG
FT                   YNALSQVADRNGIHSPSPQFGNDNLYHQHQDHDREHEENHKNLVGQARGLAKHFFG"
FT   CDS_pept        join(complement(210650..210871),complement(209148..210557))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537645"
FT                   /orf_name="CD36_16090"
FT                   /product="Choline transport protein, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43389.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D100"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAG9"
FT                   /transl_table=12
FT                   /translation="MSQSDLKHSNSVSPQLSSFAGGTTGDSDQEKKLTEFNDDNKSVTS
FT                   KDEEGTKMSRNFSTLQIVTIGFGLTNSWVLGISSTLILSISSLGPLLVVYGILIVASVS
FT                   VCIAVTLGEMASAMPSAGGQYVWARVLAPKKYSSFLAYVTGSISWGGAIFTTASMNLAV
FT                   AYQILGFWNMTHPNHVNQKWEAFIIYNILNWILFFFNIWHRFLPMIGDSVFGISLTSYC
FT                   IILITVLVCARGHYQDAKFVFVTAVNNTGWPSKGIAFIVGLVNPAWAFSCLDSVTHLSE
FT                   ETAHPERDVPRAVLSTVGIGFVTSFTFSIAMFFCIRNLEEIMNSATGFPMLDIFYQALG
FT                   STKVGAICLGSLITLVATGCTLSCIIYQSRLLFSFSRDNGMPFSKYLSIIDPKTGGPFY
FT                   AHLFSTVIVSIVSVLVFSDAALQATALACVSFLLLAYSIPTICLLARKRQIRHGPFWLG
FT                   KIGVFCNFVLLAWCIFALVFFSFPANYPVTAEGMNYFCVVLVIYIICMLGYWWFPIKKY
FT                   ACKYNFRGGNLNQEEVEFPEVCLTKW"
FT   ncRNA           complement(212066..212198)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR3"
FT                   /db_xref="Rfam:RF01251"
FT   CDS_pept        212578..215490
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582769"
FT                   /orf_name="CD36_16100"
FT                   /product="Nucleoporin, putative"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAX43390.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG396067"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniParc:UPI000192D101"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH0"
FT                   /transl_table=12
FT                   /translation="MFGNKTATSGTGFSFGQTNQASQQQQQQQQQQQQQQQQQQQQQPA
FT                   ATIGSTTQSVINPPNGPTTGTTTNFSLPVSVNTSNSSKLLKELLESANNLPKTNDNIQL
FT                   GSIHLTLNELERKSQQLRKQSEKDTNFTKAHYLLAGSGISADDIEDELNAIHIPKTGGR
FT                   MPSHRAIVGAENIENYLSAKKDENILNTIEQSLSLASKDFDNYIDANISIDWKVRRDEL
FT                   RKAIGLKTNTKFNEETLKNSIIWKSNSTASNILTPLNVTSSSSSSVKQISREKFENQAK
FT                   IIYSLNEARLQNKSFPLCLNFNEVNKLQNDIKAKQIAEIWKILITLTEEKTAKTSQEQK
FT                   FFNTTKNDLNAIIVSNSINYLQQEFFNYVDELYLKDGDKPEKFSPPSNINKVSYFIHQI
FT                   VLKNDPDLINKTLLVNGTPIWALIFYLIRAGLYLEADELVQRNRESFNKFDKNFPVYVK
FT                   SYVETTNHTLPSDLKERLHKEFNQQFQFIINDVDNNVNYDPYKYSVYKIIGKCDLSNKS
FT                   LPRLVNLSIEDWTWFHLSIINANQPGSESNLIFENYTLPDLQNKIIQLGPKNFMSSPNN
FT                   PLYLKTLVLTGLYEMAVQYSYEYVNESDAVHLAIGLAYYGLLKCSSFNKDNILTVNNNE
FT                   YEINYGRLIGAYTTTFKISDPKVACEYLIMIALANGGESKSALLVCHEALRELILISRE
FT                   FGVLLGELNQTNGTKIPGILERQRKLIKLESLDQFYQQIIEVAANKCEEEGRVFDALLL
FT                   YQLCCDYDTVVSLINKLLAEILATTDLNKPIIKSGNYEVISTGYITKEVDDTIDNNIIL
FT                   LAQHIMKVFNNNSHILGKLSSKVKQTSDLLLPIIGIRDLFINKNWRQVINDINQLGLIP
FT                   AGVNDDLIKIRTMSESIQNNDLDDNLIKVIPSLLIMVMTSISHVNYDILTKKYQSYGNE
FT                   KEELVHWKKIAKNCMIYAGMVQYKMPRETYSLLINLESSL"
FT   CDS_pept        215646..216362
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537646"
FT                   /orf_name="CD36_16110"
FT                   /product="Prolyl 4-hydroxylase alpha subunit, putative "
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43391.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG398383"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000192D102"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH1"
FT                   /transl_table=12
FT                   /translation="MPPKKKASKIEYTFPQSFHDLPKSLSKNYYQPEPESIINDQIIVI
FT                   RNFFTKDLCNELIKSFETQLDMETTPLIKSKEYAARFNDRSSMNDLLSADILWQYLQKI
FT                   LLDNLYDDEDINEINRIFQNAVGLNPQLRVYRYTRGHHFGKHYDDSVICPIPPQGTKNG
FT                   HTKWTLLIYLTGDEEFKGGGTIFYPEIRNTKPLNIHPSKGMALLHKHGNDCLKHEAEIV
FT                   ENGAKWVLRSDVVFPI"
FT   CDS_pept        complement(216355..218826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384906"
FT                   /orf_name="CD36_16120"
FT                   /product="ATP-dependent RNA helicase Chl1, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43392.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG381928"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="UniParc:UPI000192D103"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH2"
FT                   /transl_table=12
FT                   /translation="MVSESCSRNYNHPYTPYDIQIQLMDAIYDTIENGYKIGLFESPTG
FT                   TGKTLSIICSSMTWLRNFKRNNTFLETGPKVENGNEGDSESDSEDDEPEWVKQAYRSSI
FT                   VNRSKNKLIEYEHYLDKMEKEHTQNKRKEEELKEAVHKRRKAAALDSAEESFLPMDYYS
FT                   DSEIGKTEDQNLAITKEINRLLKKVENKEEVSYINECPIKIFFSSRTHSQLNQFSSQLR
FT                   LTNFQASFEDLEERTKYIPLGSRKQLCINDKVRAKGNDQSVNDACIDLQRETNGCQYLP
FT                   KNYMMSNATKEFADLSLAKIRDIEDLNQLGTELNICPYYSVRKGIDMTEIISLPYQMIF
FT                   QDTTRKILNLDIKDSIIIIDEAHNIIDVITSMYSIKVTSDQLNKVIKSLKVYLNKFLKR
FT                   LNSGNRINLMKLIKICQILLKFLNNNQGSVKSGDEIQIQDIFKDSTGDLVNIHKLDEFL
FT                   TKSKIAYKIESYIEKIELETGMKKSSSNPLLFTIIKFLKTLTNLSKEGKFFWDNENGSI
FT                   SLNYMLLDPSAIFKEIVDQAKCVLLCGGTMEPMADYMDYLFPTVPTNKINTFACGHVIP
FT                   KENLEVFPVSQWNDTNFEFSFQKRNDPKQLTSLGEFLIEITKRVPYGVVIFFPSYKYLD
FT                   QVLQFWKNTGILSSIESNKTIFREPTDPSNVEKVLSQYGYIIQTERKGAMLFSVVGGKM
FT                   SEGINFSDDLARAVIMVGLPYPNAYSGEMVTKRKFIETSVLKNGGTANDAREKSKNYYE
FT                   NLCMRAVNQSIGRSIRHVNDYSIIYLVDRRFSFPRIQNKLSQWVKERISTTTNNNAYIM
FT                   ESTTDFFNIIR"
FT   CDS_pept        219110..219529
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582770"
FT                   /orf_name="CD36_16130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43393.1"
FT                   /db_xref="UniParc:UPI000192D104"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH3"
FT                   /transl_table=12
FT                   /translation="MTKMSTDPATSDTESDDQELFNPGPQNDESYSSSEESERKLEPLL
FT                   SVASRSLNSSPPASPNMSNTSEEISENIEEVEKFKSDILQIFEMFDIIRRRELYNDPDY
FT                   KEYFESLNSFDKISKNFVFGMKDTLHTSQSEDSEE"
FT   CDS_pept        219914..222046
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582771"
FT                   /orf_name="CD36_16140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43394.1"
FT                   /db_xref="HOGENOM:HBG396069"
FT                   /db_xref="UniParc:UPI000192D105"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH4"
FT                   /transl_table=12
FT                   /translation="MSLINPIKVKRVNLAQCQNNPIEWSDNLQLSLNSYTDLTVLDPKL
FT                   PDYHSIVTNRDDKTVLEAKEFFSETILLHSESINMLPLGRFNRVIITDSNEGLNLIASE
FT                   PNIVLQQWTPNCETSRDNLLGVLFNSGELLILGRKNVQLSSYVVRINVFNILAEKYNVQ
FT                   CDSENMFVTTQEFRKLKIKYFAFSKYQGTLALTIVDHNNSLLLFTIDEKTFATTLLFEK
FT                   HIDVNVLKILWSIGYEHLIVIGLDNSITSYLIKDNFEKSGMIHPATRFKNHYNKFVISD
FT                   DKCYLISAFTGKIVVSEIGDTNYEFKLDTYAACNSIVSGITNGVLTLILSFDTGKFKTI
FT                   KFDIASKDFSQVPLDKSLVAFINKLLYSYQFQSDNEPSKGTSEPMMKLFGINSLPNGTL
FT                   AIFYKVISANVIDYRSMAFSDINIRFLKLSEPIGNEYQIYNRTSIAKFIDNCIDDFHNF
FT                   PTISNDLRLLRKDRVNKFIENFKDFKQQYLVNNYSFGSSDLHPLSDFETTLKKSFVENS
FT                   DVIQAQYCYILATFIETGLKPVSSEKLIEVDVILKEIQDYKKSIENSIIIYLRKLILGF
FT                   YNDKTVTDEYGKFSLITMLKQLRKLNDITEFNISESAEVTIKTKYYSETFQVSVNDIDD
FT                   DDDDSSNRHIVSTSGHGWTQCQLTNIPLLQMNNKTDERAQFRYVIRNDEFGELVNTLLD
FT                   TIDFCYITGNKIYPLK"
FT   CDS_pept        223004..224065
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582772"
FT                   /orf_name="CD36_16150"
FT                   /product="Catabolic L-serine/threonine dehydratase
FT                   [includes: l-serine dehydratase (Ec 4.3.1.17) (L-serine
FT                   deaminase); l-threonine dehydratase (Ec 4.3.1.19) (L-
FT                   threonine deaminase)], putative"
FT                   /EC_number="4.3.1.17"
FT                   /EC_number="4.3.1.19"
FT                   /function="L-serine ammonia-lyase activity"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAX43395.1"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG714501"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000192D106"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH5"
FT                   /transl_table=12
FT                   /translation="MSTSMDLQPYTKLSQPYIKTSLTEVTNLLPTKPPCRIFFKNELEQ
FT                   PSGSFKLRGIGHLVHKSIENAIKSHSNKIIHVFASSGGNAGLAAAYSAQFYKVKCTVVL
FT                   PIISKPIVQEKLKSYGAKIILFGNTINEADQHLKNLMNLIDLNSIYPVYCHPFNNPLIW
FT                   NGHSSLVDEVIQQLGFKDKNFLKGMVCSFGGGGLYNGIYQGMVNNQINGDILLIETLQA
FT                   PTLTQSLEADQVITLKSVNSLATSLACSYTTEQSLKYYKDQNLVKSQVELIDDIDSLRA
FT                   CVAFEKCFGKVVEPACGAAMAVVYNKIDLLYKNFKHLQPDDIVVIVVCGGSCTTGSDLK
FT                   GFEKMIQKSEIKL"
FT   tRNA            complement(224186..224301)
FT   CDS_pept        complement(224636..226756)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582773"
FT                   /orf_name="CD36_16160"
FT                   /product="Alpha-1,2-mannosyltransferase, putative "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX43396.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG396070"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI000192D107"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH6"
FT                   /transl_table=12
FT                   /translation="MISFPGSSKTIRLILVSLLLITLINILAAFQRSTLSPWFSSSRHI
FT                   INKFTDLRLALSSKESVLRDEEGEIYSLVGYHHDFDSNLVFVQKHYLLEKSKDADTTEH
FT                   FWNFLHSNFQTKSDYDLNLIDGYNYKKLIKALNQQNELQLSHSFVEQYKMENHFIQSFQ
FT                   KFFVELIKTIQDCKPELNPINNNNHYPNGDKIVKYYELRNKISPENMKRYNIERLIHRD
FT                   GKIPLYGGHLREQYKDELIRNKEFLSMYLTLNDDEVSALKKSHTKFLEIMMKDWPEDLF
FT                   KFNKFNNFMKGDGIVYLGGGKYNQLVLLSIKILRENGSRLPVEVIIPYKKDYDIQFCDR
FT                   VLPTLNGKCKLMTDYLPKSFVDKISGFQLKNIALLISSFEKILYLDADNIPIKNPDVLF
FT                   TNAPFTIKHLVVWPDLWRRSTSPHYYTIADIDVDPKFKVRNSYIDGDERGKYTDSMYYS
FT                   YHDCKGSIPEASSETGQLLINKKIHFQTLILAMYYNYYGPDYFYPLFSQGAAGEGDKET
FT                   FIAAAHKLDLPYYQVAEFNREFGPINDDTKKHEFYGMGQYDPIIDYYLTTTPTPKNNKI
FT                   NYNSPLPEKYANNDEDNTCSNYDFHLFQSSSLFFLHANWPKYYIESLFLHGYNENRGPI
FT                   TLEGDKRRLYGNELKKELGGYDFEWNIMKNIHWCFCEEPLIDLTGIPVVGTKTRTDVCT
FT                   AIEKHIEFLQIS"
FT   CDS_pept        228567..230570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384907"
FT                   /orf_name="CD36_16170"
FT                   /product="Sorting nexin-41, putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX43397.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG396071"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192D108"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH7"
FT                   /transl_table=12
FT                   /translation="MSTDNLFEDIEQDNNPSFYGNPSILNDPYRPTQQQQQQQQKQKQY
FT                   HESENKQSYNKSPKPPHQSINSVPSNSHPHQQHKHNISLNNGYPNELVNSTIGLSNRIL
FT                   ELLNDSELQVDIINSEKLVNSSVIVYTIELSSPTTKIVVKRRYSEFKSLRDNLLKLFPT
FT                   LIIPPIPEKHSILSYLLNTINHSHEISIIEMRKRYFKMFLDDLIFQSDTKLKNCPLLHK
FT                   FFDPNYELCWYNALNEPPVSLIPDNLLLANPINPADQNGLYSLLPIVNGFDFNSHIDNL
FT                   SNLKKINEDLYKLNDQVKLYELKGFEQDLKFSIPEELIQFEIKFHQTIKILTDLNKLNS
FT                   KTTKNYKSMVDTLIDLGGNLNNFSLQVYQQKSGSNNELSEAIEKFGSTMDQSFLNFESF
FT                   ILNQLVPQWQEPVDQLILYLQNSLGLIKFYKYKIVQFKILYKLKFNKFQQLINLTNIGG
FT                   GLSVARKSIDNNSNGNGNSNGNSNEEEEEEENLDTENFDHLKELNSPTINNALKNLSAK
FT                   KISKKSSWYGLFGGNNQTKKFNFQLPVEESTTSTLSSGDQQSEPPHSPQREQQSSSSAH
FT                   QSHQTSIRFKLNHIEKELNKLNQLIELCNLDMHKLTQALVTTFEEFLSKIEKKWLQLMI
FT                   TYIQNCKNMFEANLTNWKEFKESLVNETREVN"
FT   CDS_pept        230973..232157
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232050"
FT                   /orf_name="CD36_16180"
FT                   /product="26s proteasome regulatory subunit rpn9, putative "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAX43398.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG396073"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI000192D109"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH8"
FT                   /transl_table=12
FT                   /translation="MSAMDIDTEVSTVLATIRSESDNAELNHIIYQLEDFYERKLWHQL
FT                   TQVLDQIYYTFDPTVITLQLKNRLYNLFIRQFQLKLNPIKVVDYLLESYEEPQEILSTL
FT                   LTLKQDFINDLKKTHNYKDDEDPEFKQLIQDNEAIIYVNLQISRCYLRLQQLNNAEDIL
FT                   IDVAPKFESLNTNLNAKINAAYYLEKTENARILNNYNSYYSNGLLYLSSVTNLTDEERV
FT                   KLRYELCIAALLGDKIYNFGELILHDIFQEINEQSSPYNWLYQLIINLNSGNVKQFNHW
FT                   LTIAVKKAPILEQYQIFLKEKLTIMALLELVSANKKLSFNVISEKTDTPIDQIELVIIK
FT                   TMSLHLIEGYINQDQQYVVVSWIQPRILNLDQVKNLIQNVEHLSKNISLVCEKF"
FT   CDS_pept        complement(232420..233910)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537647"
FT                   /gene_name="SIR2"
FT                   /orf_name="CD36_16190"
FT                   /product="NAD-dependent histone deacetylase Sir2, putative "
FT                   /EC_number="3.5.1.-"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="CAX43399.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG396074"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000192D10A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAH9"
FT                   /transl_table=12
FT                   /translation="MTTFGAQTIQRQSGGVATTTSVPATTAASSGKSVPRTTPTKGIIT
FT                   PTPTPSHLRTNNDINDFDGKFIETFEPDLELRNKYRSFIHREGALSFLRTEITQSMTKR
FT                   DICVLILNLGYPKKAIQDYPILTLKELAYILLKLMLNDSAQLEPKVDMESDLGEIDDND
FT                   DDDDAMDVDDYQSENENENENEFEFDREIRPSRRTMKMTPFKYKLPDLISDLSKAKRII
FT                   VVTGAGISTSLGIPDFRSFKGLYNQLSKLNLNDPQKVFDLQTFMREPGLFYSIAHLVLP
FT                   PEGKFSLLHSFLKLLQDKNKLLRNYTQNIDNLEQRAGLKSEKLVQCHGSFARAKCVSCQ
FT                   GTFSGEKIFNHIRRQQIPRCAICWKNTQQAPIHFGAIKPTITFFGEDLPERFHTLIDKD
FT                   LQQIDLFLVIGTSLKVEPVASIIDKVPYKVPKILINKDPIPDRGFNLQLLGLCDDVVSY
FT                   LCKCLKWDIPHVDYNSDDQFKLSKLKNGDWEIVKKSSK"
FT   CDS_pept        235135..236817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176489" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080713"
FT                   /orf_name="CD36_16200"
FT                   /product="Transmembrane protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43400.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG327762"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniParc:UPI000192D15A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI0"
FT                   /transl_table=12
FT                   /translation="MKFLFVSLILYVGFVLANLARFDENSFSQVCSGMYSKQDWGGSFK
FT                   PHIGLTLNQYNDFKYDPKNKDQEVDKDISVSYIIFEYKDLVNIGADLGNGQYKFICDDT
FT                   AINDFKVCDEKQKGKFIVNKNVTNSTILTAQLTHLGQANINYPVNVTGYYCISTFSQYK
FT                   ETVYRGEVNFQNAFGQLSASEIPKLPAYGILAICYAIALALFGFQFFKKRKENQILPLQ
FT                   RYLLAMLGFLTFDTVVVWSYYDLVNRIESPSSGFARFYMIFLTLLNAAKITFSFFLLLC
FT                   ISLGYGVVKLKLDKKVMFGCKILAAFNFVASFVYLFFNYYGGSSNALVSTDSIDTAASG
FT                   SFLGLLPIIPIAIILSIYYVTILASIRKTTESLHKQRQIIKLNLYQNLFKIIFGSVILT
FT                   FLGLTLSSFVYLSMSSTEMFEQHWKGSFFIYDFWPSVVFFIVFMAIAWLWRPTETSYML
FT                   AISSQVANDDENGEYQQGMELDTFSLMSHSDDEEHNPQRQVERDSFELPSKNIQPENPP
FT                   QYDQLSTHEPHEAPSNTLFELGEDDEISDHEGDNRLKDHKHKE"
FT   CDS_pept        complement(237057..238874)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582774"
FT                   /orf_name="CD36_16210"
FT                   /product="Sorting nexin, putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX43401.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG396075"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192D15B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI1"
FT                   /transl_table=12
FT                   /translation="MSSEDQFTSIQWDREDGKNANDTPTDTNIKPKSSKSKKSKKSSSK
FT                   KKAGNKVSPPSTTETSDADDSPKEVTEQLESTQINDDDGDNGNKESNDGANQISNSDDD
FT                   PTNSLLLPANPQTKEPIASQEKEESVPIQQEPAPIQPPSNDIAVVNDEEPPIPQPTGYV
FT                   DITYYEKYSIKTTVTHPNRDLDTASKPFISYLVTTTTNNPSILKLTKEKKPKQGEEYLT
FT                   FSVRRRYGDFRYLYESLSNDFPTVMIPPLPSKSNFKYLTGDTFSSEFVHKRLHSLDRFV
FT                   RFILQHKILSQSSIFHLFISNSNDWATFTTSLKIKDSSSEESGIVGRVVNEDLITETVM
FT                   NFLTPSKHKKETNKDILEINDKLKKLYENLIKLDKIFTKLNKKNHELGVDYDQFSSQIL
FT                   KLSSVQKGEDSAMTTNFKIFSDSLSYFSKSYNEMYRYVDENFLVSLQDLAKFCLRFIQL
FT                   IKLKNDKSTDLAVLQDFLNKELANSGGHYNTSHQPPNPVISSYQGGIVNNTTQLIKDTL
FT                   STSSTIGSNKPDKIKNLEQEIAKETKLLTELTNKIINEEYPNWEKFNKTEIKSSMLGLC
FT                   DQNIKFYSDLLEKFGEVEIKLMKRLDEDV"
FT   CDS_pept        complement(239347..240705)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582775"
FT                   /orf_name="CD36_16220"
FT                   /product="Mannan endo-1,6-alpha-mannosidase,, putative "
FT                   /EC_number="3.2.1.101"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAX43402.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI000192D15C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI2"
FT                   /transl_table=12
FT                   /translation="MKFSTYIIISLFSSLSHAIWLDTNNETTIREDCNIIAKGLLDYYD
FT                   GNKYGGVIGMFSWPYYWWEAGGAWGSLIDYTFYFDNDTLVPLITEALLYQTGDDDNYIP
FT                   LNQSTTEGNDDQAFWGIAVMAAAERNFTNPKDSTKAWLTLAQAVFNTMQARWDTEECNG
FT                   GLRWQIFQWNSGYDYKNSVSNGALFHLAARLARYTGNDSYVVWAERVWDWMYGVGLLTE
FT                   QNWWFVYDGVKVANNCSNITKYQWSYNQGLMLAGCAYLYNYTEEEKWYNYTIKLLESAQ
FT                   VFFKNITGSMVMYEAACQPSNSCNNDQRSFKAYFSRFLGLTSVLVPQTEPVITKWLVDS
FT                   ANAAAGSCTGGSDGVTCGLSWTNWSEGWDGKWGLGEQMSALEVMQNLMVHKRPAPYTAD
FT                   TGGSSIGNPAAGYGKLTSDATPLSIDGGDRAGAGIITAIIGASLVGSCVWLIL"
FT   CDS_pept        complement(241322..243115)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582776"
FT                   /orf_name="CD36_16230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43403.1"
FT                   /db_xref="HOGENOM:HBG396076"
FT                   /db_xref="UniParc:UPI000192D15D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI3"
FT                   /transl_table=12
FT                   /translation="MDVRRCRRCKRKRLDDEPEEVRQYKTCAKCRIIERNKKNSRKPLA
FT                   EETMLYGLKQFREQQSAENYIEEEGLLKDEFFKRYHNKPFNYQVEIAKVLNNPNYVPPV
FT                   IHNHNTNEVVSSSNGNTAGPKYQMTMKTNNNGNQAPTKSRKQQQQQPQQQQQQQQQHQQ
FT                   HHQHRQQQQQQQQTHQQLHHQQETVVDDEEDLYKILSELGNENESPKDAKVIKANLDPY
FT                   SNDNVFDDFQKYLSTILEKLHSDKDIKNLVYLKEFNDAFTTNMSRFDAYTKDRTTLYQS
FT                   IRLNERQFRSHLLSNIRALYIDPIIACLGLLYKQEYSNINEFKSTTSIKSGFSYIAKSA
FT                   EQDEIKNLKESSITLVFNKKYHLLVIKLNHTSYRPSDIVYPTEFKQKVAAVFGLLQMEE
FT                   FSPVASFQNINLDYNAVTGGLVYDKLVSVSHTYNEELQNFIKELNKDAFIADFVNYEKV
FT                   FKLDEENGVDDMDVDEEKPENKKEQEEEEEVDDKMDVSKEADPELVSDVNQGNKDESEP
FT                   IGETEEEEELHVEGAHVPSEDESSESIAIENDNESENDINQTTTFVSNENKDDITIKED
FT                   DHDILSKKESTVEVLDPVFQF"
FT   CDS_pept        244871..246925
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080714"
FT                   /orf_name="CD36_16240"
FT                   /product="Lysophospholipase, putative "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAX43404.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG397277"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000192D15E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI4"
FT                   /transl_table=12
FT                   /translation="MNLLIYLLLLSVSLVLGSSPSGGYAPGIVQCPINSNSSVNTSSFI
FT                   READSISDLEKQWIKQRQSKVNTALIEFLKSANLSNFNAQNFIDSEDYKGINLGLAFSG
FT                   GSYRAMLNGAGQIMALDSRSSSAGSLGGILQSANYIGGLSGSSWLLGSLAMQGWPTVEE
FT                   VVFENPNDLWNLTVSRQLVNQTGLWTIVFPVVFDNLNSALSHMNFWDNDSNGVKFDLEA
FT                   KEKAGFQTSLTDAWARGLAHQLFPKGNDNYDSGATWSDIRDIDAFANHDMPFPFVTGLG
FT                   RRPGTTVYNLNSTVIEMNPFEFGSFDPSLNTFTDIKYLGTNVSNGVPVDSCINGFDNSG
FT                   FIVGSSSSLFNQFLNTLVCDDCNSLNFAIKWLLKKFLTYLSNSHEDVALYTPNPFYNSQ
FT                   YAKSENITTNNTLYVIDGGIGGEVIPLSTLMVKERALDIVFAFDNDVNTETSWPDGSAL
FT                   ISSYERQFAQQGSSNLCPYVPDSNTFLAKGLTAKPTFFGCDAKNLTTLEKDGVIPPLVV
FT                   YFANRPYEYYSNVSTYDLTFTDEQKKGLVKNGFDVATRLNGTIDPEFKSCIACALIRRE
FT                   EERRGIEQSDQCKKCFENYCWDGTYASGPSENYVNFTDSSLTNDSTVFYGDANSKVSSS
FT                   SGGLFGFLKRDTQNVEEFTGVILESNSDGLRFSKYLTIASLFATYLVIM"
FT   CDS_pept        247576..249111
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537648"
FT                   /orf_name="CD36_16250"
FT                   /product="Epsin-like clathrin-binding protein, putative "
FT                   /protein_id="CAX43405.1"
FT                   /db_xref="HOGENOM:HBG734700"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI000192D15F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI5"
FT                   /transl_table=12
FT                   /translation="MSKLVRSIKNVAGGYSSAQRVVRNATSNDPTGPTTFDMEEISSFT
FT                   YQSQTEFMEVMDMLDRRLNDKGKNWRHVAKSLTVLDYLVRYGSDKCVLWAKDNLYIIKT
FT                   LREFVHFDETNNDQGAIIRVKAKELVSLLRDDERLKQERANAKKNRRYRSYDDDGGDDF
FT                   DSDRRRRNREDRPRRDEPYDAELQRALELSRITAEEEQNRNREDENDPELEAAIKLSLE
FT                   EEEMRKQNNNLLDLNDETPQQQQPQYYLATGFYQQQPQFYAQQTQAQPFQQYDRFGNPI
FT                   QNPMETGLYNQQAYYQQQQQQQQQQFQPNQFTGFNYAQPQAQPEPLQSLKTGSNNPFAI
FT                   SSGSDNTNKPPTQSLNSLAQEQQQQQQQPQFFTQPTTAPLKQQNTSSSRFNETHELNDL
FT                   LTQGTGLDTFGNTGDTRIPHQHTKTQNFINSSGTGYKQTNNEPIRLSSNATGNPFLNTG
FT                   IGYQGATQQPQQQQVAQINPAYTGYGFGNAQPQPQPHQQQSRNGNDGPSLIDI"
FT   CDS_pept        complement(249409..252117)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232051"
FT                   /orf_name="CD36_16260"
FT                   /product="Cell cycle checkpoint protein, putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43406.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG396077"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI000192D160"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI6"
FT                   /transl_table=12
FT                   /translation="MFQNCNFLIIKSKQLTQDKDISQLLFANNVANIYIKDDFDNSKNY
FT                   MDPPKITHIISNTIDFIEHELAIKSMIPIVTPSWVYDSISNQKMQNIRTYNPDPAYFFK
FT                   DCFICCADNLPPGDKELIYAAAQAFGGGFLDNITKYTTHLIAMDISNEKSILASSIIHD
FT                   DNDSNNGDLPSIKIVLPHWIDHCITMGKRLNEEDYLLPDAKILHDESNDVLKNEILPEV
FT                   LNDSLPKNEVDPELQFFKNKKFYINSDFNLSQRSSNALKFVIERHGGSIQKKFDVNEID
FT                   IYLGKFRQGDTYKKSCASNRIIVGNLQWLYFILVSKSWTLPLHSNILYYPRPATPLNGL
FT                   EGLKISITNYSGEARSYLSKLITTMGGVFTKTLTKENDYLVCGKAEGRKFDAALNKWVD
FT                   SEGNSEIKVVNHLWLEDCYVEWRKVDSGLDKYKNFGDDSIGMEPWVGRAHLDAEVLKLW
FT                   YEDEEKSASDGSANIDDSMSEDESTQSRRGATTTTKQQLDNSQVSELVNVEEKNDVTPS
FT                   SSQPAKQQVSPMSVTSNKTLKSTTETTPELKLSPAQKEFSPEPLTSPIVATATNNFSSR
FT                   YGGRSAAKKAAAKLHDNMSDLIAYQEMAKSSRKMKSYMDQLEGSLTPSKKRKHTDKEEG
FT                   EDDEEEEEEEEVENLDETKESSQSGISKAKKPTHYHIIAIMTGCEQIIELNKSDLQKLQ
FT                   AIGIKIVNDVDKSSLLNTVIAPKILRTEKFLRSLSKVDKIIHPDYLVNVINHISKGENV
FT                   LKEYRIDDYSLDKINKNTNLELGYPTSVKINGITKLLSHDKKGKLFSGMNFNLSSNLNG
FT                   GIDVISRILKDHGMNHYKEIKTSINLNKSLIETDYNGGDKKIILIVNKTKDNKLTNSFK
FT                   KSIRSGIILEWDWCVKSIFKMELQDIKKFQI"
FT   CDS_pept        complement(252562..254022)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537649"
FT                   /gene_name="CYB1"
FT                   /orf_name="CD36_16270"
FT                   /product="G2/mitotic-specific cyclin, putative "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43407.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG750484"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniParc:UPI000192D161"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI7"
FT                   /transl_table=12
FT                   /translation="MPQVTKTNNENEFRLTRSKAQHQESITTNKNTTISNPQHEQPSQQ
FT                   QVSSPPHISVTSSEGVSHVNTRQYLGDVSNQYITNTKPATKRKPLGGDNAPLQKQQHRP
FT                   SRPIPIASDNNNNASSSSSSSSGSGSNNDANRLASLAVPSRLPQKRQATESSTNLVEKL
FT                   RVSQPEIGERSQSYHKKSRLIDYEWQDLDEEDSDDQLMVSEYVNEIFSYYYELETRMLP
FT                   DSQYLFKQTLLKPRMRSILVDWLVEMHLKFKLLPESLFLAVNVMDRFMSVEVVQIDKLQ
FT                   LLATAALFTAAKYEEVFSPSVKNYAYFTDGSYTPEEVVQAEKYMLTILDFDLNYPNPMN
FT                   FLRRISKADDYDVQSRTLGKYLLEITIVDYKFIGMRPSLCCASAMYLARLILGKLPVWN
FT                   GNLIHYSGGYRISDMRECIELMFQYLIAPIEHDEFFKKYAMRKFMRASTLCRNWAKKFQ
FT                   AAGRDLFDERLSTHRLTLEDDDEEREEA"
FT   CDS_pept        256009..256461
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537650"
FT                   /orf_name="CD36_16280"
FT                   /product="Hypothetical membrane protein "
FT                   /protein_id="CAX43408.1"
FT                   /db_xref="UniParc:UPI000192D162"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI8"
FT                   /transl_table=12
FT                   /translation="MSLILGINFFLFVSFLIWSLKNNILYHFVIKASLKPQFSLPSFQS
FT                   NSTVEHSNCLFCHPLLNNLEILFLWNLVSHYQHHHHSVLFFYLSLLLFLHRYKLFLLPS
FT                   DFNAYWALTYTKKKKNPHKKIKNFERTTKFKKKTIIYPIRKGYKQI"
FT   CDS_pept        complement(257974..259575)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384908"
FT                   /orf_name="CD36_16290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43409.1"
FT                   /db_xref="HOGENOM:HBG396078"
FT                   /db_xref="UniParc:UPI000192D163"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAI9"
FT                   /transl_table=12
FT                   /translation="MEDSTEDIIKSFTLEQSPEIKPKPKSKTSDLTDIVYAMDDDSIKM
FT                   KKFTIFDDKYDQNVSDSEHDLTPIKRKRQQQPPPPQQPSKFSSSIPQKPTLSPKKLASS
FT                   PTKNYTDHINQLRSGPNSPKKYQEDENVRSLKYEIKRLKQEQNLKLENLQNKIEYLTKE
FT                   RDELQDQLTSMSFENDKLAKKNRSLSHENNHLTLENSKLKTKEYSNEDLQLEKNKLQRM
FT                   NNTLRSERDELVKDFNLTRDKLKKYYDLYLHCQKNHVNVKSQRTEVGGDKPTADNISTN
FT                   EELVDILRKLSEMMIDQNKMSEPIAAIEKDKPSEDKTSSPNFDSSKDAPRIVSEFLEEF
FT                   IKRIVEEMSANSKSAPSSKQHINSEMYSQPNNFSNNTMPPSQSAAYIPSNSQPAPRPAA
FT                   AAAANIYSSSTPNTNGYNQSSHSNDRPNTFELPRVERDHWTDRPPSERSTQSTKYMKMD
FT                   PEEIRKLVVIITDQLKKEENNEKSSNTLDSETPIEKCQCCHGNPRNVNEPTNQKLCQSC
FT                   LNKGDFTMSEFMGHSN"
FT   CDS_pept        260074..260640
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000036776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232052"
FT                   /orf_name="CD36_16300"
FT                   /product="Adenine phosphoribosyltransferase, putative "
FT                   /EC_number="2.4.2.7"
FT                   /function="adenine phosphoribosyltransferase activity "
FT                   /biological_process="adenine salvage"
FT                   /biological_process="nucleoside metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX43410.1"
FT                   /db_xref="GO:0003999"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006168"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG703830"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="UniParc:UPI000042ECB6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ0"
FT                   /transl_table=12
FT                   /translation="MSDRVLEINALAKELKANLKQFPNFPKEGILFEDFLPIFTKPDLF
FT                   NKLVKAFKLHVGEQKIDYVIGLESRGFLFGPTLALALNAGFVPVRKPGKLPGPTFKVEF
FT                   QKEYGSDEFEIQQDVIPKGAKVLIVDDILATGGSAFGAGELAKKTGAEIVEYLFVMELD
FT                   FLKGRDKLDAPVYTLFGGQEEKFTE"
FT   CDS_pept        join(complement(261117..261138),complement(260765..261018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582777"
FT                   /orf_name="CD36_16295"
FT                   /product="Dynein light chain 1, cytoplasmic, putative "
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="microtubule associated complex "
FT                   /protein_id="CAX43411.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005875"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="UniParc:UPI000192D164"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ1"
FT                   /transl_table=12
FT                   /translation="MSEETSVPILKASDLAEEIQTKIFELSSQALATYKIEKDIAAFLK
FT                   KELDQLYGPTWHVIVGKSFGSYVTHEQGYFIYFYVGDMAFLIFKSG"
FT   mobile_element  261250..261636
FT                   /mobile_element_type="retrotransposon:solo LTR, xi C"
FT   CDS_pept        complement(261761..262450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384909"
FT                   /orf_name="CD36_16310"
FT                   /product="Metal dependent phosphohydrolase, putative "
FT                   /EC_number="4.2.1.69"
FT                   /function="cyanamide hydratase activity"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43412.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0018820"
FT                   /db_xref="HOGENOM:HBG325329"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR017771"
FT                   /db_xref="UniParc:UPI000192D165"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ2"
FT                   /transl_table=12
FT                   /translation="MSEYGFTKVSRDVQQAIPNPKEPSIQLNTELPLGSPLAKFVYDYS
FT                   KQRLPNETFNHSLRVYFYSMAIIKDQFADWTLDPEIVFVTSLLHDIGTTHENMHATKMS
FT                   FETWGGILSRDLILEQTKGNKNYADAVCEAIVRHQDIGKSGYITTLGLILQISTILDNV
FT                   GWNSHLIHEDTLSAINKKYSRQEWLNCFAAAIDKENELKPWGHTSALGVDEFRDNVLAN
FT                   TLRYEKL"
FT   CDS_pept        complement(262769..263875)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582778"
FT                   /orf_name="CD36_16320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43413.1"
FT                   /db_xref="HOGENOM:HBG396079"
FT                   /db_xref="UniParc:UPI000192D1B8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ3"
FT                   /transl_table=12
FT                   /translation="MMFNTKSFLQLDPLGLTEQSILVLPHELIAKILRMNYSINGQLKH
FT                   IYHFIVTCKEMYYRYVFLLYTFEPVMISLRKYNKAINLATMRFLKESKLSNEVKCLEWF
FT                   LTPKFTTTKRHQGAILNSVYQFSNLYKVCLTANSLDMLMKVNRLPECVSILKINLLTHV
FT                   NPTRHKMHLDKIPLFKLKVLIFETSAPLSLTEYYYPFFRSILISKSPLYSWMAIDENVP
FT                   EAHVNSPMNQVCNILATLIYHSKSTLEYLNIHKLHPVFVFRAMDVVFYHGGITLSLFNS
FT                   LHPNLQYFNQFPSLKYLKIDNSYSLTDNLIQKLMGKNKQSLIVLDYMYLKEIMHITLDE
FT                   TNHIHKVFYDRNTIFATKVLVDLNALSQ"
FT   CDS_pept        264522..269492
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582779"
FT                   /orf_name="CD36_16330"
FT                   /product="Suppressor of RNA polymerase B, putative "
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX43414.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG396080"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="InterPro:IPR009401"
FT                   /db_xref="InterPro:IPR018174"
FT                   /db_xref="UniParc:UPI000192D1B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ4"
FT                   /transl_table=12
FT                   /translation="MVGANASSISTQYYKLAHLGSINYTIYTSSDNNDQALLELELTIR
FT                   HKWPQILVTYYNKSLYYFVFGHNQANSEMIDLSNEFPQLSTKYTDTVNVDQFPNPHKTT
FT                   KGDDNLAMASLSFLKATKKMILYNLSLCGAIKLFGNYCVTTTGNSVYSILCIDPILFQN
FT                   GDLIVSCVEKPFTQLFSSSIAYPRNLAIDTNFVIYLIPSGIRCHLFDPTSLRNNLIEKP
FT                   QIENGKLLELLKITTGVQCDESTLWVKLIPNLKHLNNQTSTIGKFIHSVDNKKFILWPW
FT                   DLCLLQIGKYEATIHEEGFIESAELNNPLHLISSFLDFRITHNSQLKHQVDNLLDHQQG
FT                   EAVNVSLSAGSVQATGASSIGNVPDISKDVDTVGLNTTTPIETDLFNLQDTEEFFKSDN
FT                   IQMDIESQIHKTETENENDMEIDDLFGGDESEDNDDLEEVDGEKEKLTPSNITVERNGE
FT                   NDNALEEEFVSKPTPSKENANLDSKIAPPDSINEDIVPGKEDIKPKEVRPSYIDILKDK
FT                   MTIEKIDSSPDYKDPGAPLPIIPTPLVSSTISQSAATSNPPSVGSGLGPGGEALHEGNN
FT                   AYVQSSQISQLPQQKSAFSPILFNPIIKSDIDTKYGKGGKFYVAKDSTSNGNFEGKNRS
FT                   LRATSVSGMEIPFSSEDKKRLQHELELLDSSTTSENDEGGDNDDDGNDYENDKGDDDYE
FT                   EEEEEEEEEESDEDEESDIGKSTPLKLNTQNDSLPPQQSNYNPINTNDSGSNTSNNNTD
FT                   KQGFENTEGFGTPFPNQVSKYSMKPESPFAGNDMQSSVSPMYFDTSQSHQSPQLQPSAG
FT                   TLEVLKTSSLESPSKISESSNYLPLILRSINVATIPSSYLMNNLISSKLLPSFTISDDA
FT                   LENDLDITKSNEMIVKLGFLKEFLDFMSPNIIFDLGLMTTDESDYYINGADDLSLGSNT
FT                   GLSSDWILNNLSKVFPCTYPMKLIELLYDFKSLELEDQLDNQLNFLNEIANEEDFGGPK
FT                   ALYRKLKALEWDSFSSNDLNKANFDKYKNVMEKLSTENAVNDDDYFRLPTVKTRILKNG
FT                   NIVNLNNIGLKFWKYLNFNPVKKSKDFQILLIAETHRNTASYATEFLEQIIQNYKECNF
FT                   GTISKVNLSTVETRPDLEPISGGLVLVNKGHDQSYNDFYIQTNKKLISLVELIKLDLIN
FT                   KTNNFEFGKPLLLFFIDFNESLNSNVQICKIFRNFKVALTTHQLPLVDIFTKIVPSSLL
FT                   VKKVYHESALKVFSNYKLTKLSMNLYNECPNDLVNKSIVKNLFTTIVKDPPSKIQFKFM
FT                   NNSYRDNSSNNDIFLHLAYERSIDNNWFVASWSDPLGQVVHVKSWYCSDTVSKSEKSTY
FT                   RGDVMDIMSITDDIWNISTELFKILNDESCSIGGKKFLVLTRINSIIPDVELVHWKRLS
FT                   SKHKEISLIVMSVRQTPRMVGSNESETLEPKSNDSAPTPMIQDKDIFFGFKQTFSTSNT
FT                   SSPSASGGALVTSPNSLSLHSPQQFLNAPANFLSPQDLIAPSSSGISSAKPGNSSIDPE
FT                   VVLEIQDNEVYGVIPKVPLPSFNSPTRFCMKTGYLMMQVNQPTEEEYQDDVKKAYLVYE
FT                   INVLSCSNYWNLDVLMKLIMSQYKQMIALNDILCMNPILGESVISGAHSRNNAIVPWHI
FT                   NAVGKLLDYLVHIYVDKD"
FT   CDS_pept        269658..272486
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582780"
FT                   /orf_name="CD36_16340"
FT                   /product="Transcription elongation factor, putative "
FT                   /function="transcription elongation regulator activity "
FT                   /function="translation elongation factor activity "
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /protein_id="CAX43415.1"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="HOGENOM:HBG396081"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR017071"
FT                   /db_xref="InterPro:IPR022581"
FT                   /db_xref="UniParc:UPI000192D1BA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ5"
FT                   /transl_table=12
FT                   /translation="MSDSDQPIQVKKEPSFANDDDLTFDEEFRRAGDQGQENKEVENPD
FT                   DTTSLKRTREESEQEETNDKEKEDEKEEEEEEEEDEDDEDDEEEEEVSSRRKRRRGANQ
FT                   FFDIEAEVDDEEEDEDDEDEEAELMREEFITDDHAPVETVEKMPQDDRLHRQYDNRRQQ
FT                   AEDQDAEQLAETLKQRYRKTHSVYRGETATSGTVSQKLLMPSINDPSIYAIRCTPGREK
FT                   ELVRKLYEKKRTLERQGNPLDILTVFQRDAFTGYIYIEAKRPDAIDKALVGMVNVFVRD
FT                   KLLVPVKEYPDLLKQVKSSDVEIRPGIYVRIKRGIYRGDLAIVDNLSENGLDVRCQVVP
FT                   RLDYGQNDEIGPDGKVIKSKIKPMPALFSEQKARMYDPYKLQMGRVPNSFIYRGNEYYD
FT                   GYLYKDFKLQFIQTKDVNPTLEELDRFQNQNDEDGLNLQAIAATLKGNNASEGKSSTAF
FT                   QPGDKVEIRRGEQAKTIGVVVETALNEITIKVTDSGDPRFVDQRLTVPANDLRKIFYEG
FT                   DHVRIVEGKHFDETGLVIKIDGDSVVIVSDQTKEDVRVFANYLVKATDASSNFDLLSNK
FT                   YDIKDLVELSGLTVGVIVKAEKNIFDVLTTDGRLISVKQSGIASKLKQSRREQVATDRN
FT                   GMTIRVGDTVKELLGEKSREGAILHIYKNALFIKSNEIVENLGIFVANRMNVTTIATKD
FT                   SMVSKSLGPDLTSMNPNLRLPNPVAVAGLKTRVGGRDKLLYKDVAVTSGSYKGLKGKVT
FT                   EADDLYARIELHTKSKKIKVLKNNLNVIVHGQPVPYLRFIGAAPELSQPNPPVYGSNGD
FT                   RSTWNGGMTPSVAAASGGTSAWGGNRAGFGGDGGKTPAYGAGAASAWGGASAWGGGAGG
FT                   NSAWGGNKGAGSAWGGNKGAGSAWGGNKGGNSAWGGNKGGNSAWGGGSTWGSGGNSTWG
FT                   GKKGNNSTWGGK"
FT   CDS_pept        complement(272641..274146)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582781"
FT                   /orf_name="CD36_16350"
FT                   /product="Suppressor of stem-loop protein 1, putative "
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43416.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG315004"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="UniParc:UPI000192D1BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ6"
FT                   /transl_table=12
FT                   /translation="MDDSDEEYMGSKSPSSKLSSTAPETSSSPGAKSGVSARTRSSRRG
FT                   EVSDLKGANGYAWEDEYQRSWDIVKDDEQGGNSFEAMVQSIIENRKKKIMKNPSTPFQR
FT                   GIIRTLIIIIDGSSAMSEKDLRPSRLSMTLNYLQEFVVEFFDQNPISRLGIILMRNGVA
FT                   NLVSEVSGSPQYHVDKIRNLKARQHNRFEPKGDPSLQNSLEMARSLLKFNFGSTSNNSK
FT                   NSKEILVIFGALFTSDPGDIHKTIDSLVKDEIKTSVIGLSAQVAICQELVNRTNKEPRN
FT                   SQSKHYGVIMNESHFKELLMESVTPLPLTESEKQIQESEQNGVPVLRMGFPTKVQPTLT
FT                   SAIGGSDYIIEFPHLNASFPTQGSEDSKDVVEIQTNKPAAASSLIGYQCPQCKCKVCNL
FT                   PTICPVCGLMLILSTHLARSYHHLVPLAPYKEVKVSPIYDSTYCFGCQLKFPEGVKLGT
FT                   LKKSLESMTSSRYRCLKCSQDFCINCDVFVHEVLHNCPGCENN"
FT   CDS_pept        complement(274341..275183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232053"
FT                   /orf_name="CD36_16360"
FT                   /product="tRNA-specific adenosine deaminase subunit,
FT                   putative"
FT                   /EC_number="3.5.4.-"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43417.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396083"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000192D1BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ7"
FT                   /transl_table=12
FT                   /translation="MPTDLTPHFQYMATSLFVGYKALLNNETPVSCIVVDSKSDKIISI
FT                   GYNYTNHSLNGTQHAEFIALQRFTEQKPSIGYNDLILYVTVEPCIMCASYLRQLGIGKV
FT                   IFGCGNDRFGGNGTILPIHSDTTLPNATYSSIGGICRTEGIQLLRNFYIQQNESAPNPK
FT                   IKKNTDIESKEYPDNQFCSISKDEFLEFYGKERMHVYDGKVFEITPSIDKGYDVKDLVT
FT                   LDMMRKVPFLEDELGRITDEQIIEFHNLFFNIKDNGMVNYKKPICKYNSKKRHFKNDE"
FT   CDS_pept        275384..276463
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582782"
FT                   /gene_name="PPE1"
FT                   /orf_name="CD36_16370"
FT                   /product="Protein phosphatase methylesterase 1 "
FT                   /EC_number="3.1.1.-"
FT                   /function="carboxylesterase activity"
FT                   /protein_id="CAX43418.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG736614"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR016812"
FT                   /db_xref="UniParc:UPI000192D1BD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ8"
FT                   /transl_table=12
FT                   /translation="MSELHKAFLKRIKEQETALGLSGLVDEDDIPEPAVMPPTGNSINA
FT                   NAEDETILRNYKQFKETNFIQEFYENELGYKFKTYYKPSKKPGSVLFCHHGAGSSSMTF
FT                   GNLVNHIEDESVGIFLFDTRGHGESVATTDFSLNTLVQDVSFVLEQFISKHQQNSIFLL
FT                   GHSLGGAVLAKYSILYPNDILKGLILLDIVEEAAVQSLNAMPSFIARRPLSFPSLSKAI
FT                   SWHMNFLLFNEKSARLSVPDLFTDKLTWITDLNETKPYWQTWFAGLSENFLGFKGPKLL
FT                   MLSTHESLDKQLMIGQMQGKYQLVVFKNNEKSGHFVHEDLPNHVAVCLTDYIKRAVAPE
FT                   IFMKEDLGFVPKWGGKINK"
FT   CDS_pept        complement(276496..278640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080715"
FT                   /orf_name="CD36_16380"
FT                   /product="Glutamine-dependent NAD(+) synthetase, putative
FT                   (Nad(+) synthase"
FT                   /EC_number="6.3.5.1"
FT                   /function="ATP binding"
FT                   /function="NAD+ synthase (glutamine-hydrolyzing) activity "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="CAX43419.1"
FT                   /db_xref="GO:0003952"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG334087"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniParc:UPI000192D1BE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAJ9"
FT                   /transl_table=12
FT                   /translation="MGNYITVATCNLNQWALDFEGNRDRILESIKEAKRQGAKLRVGPE
FT                   LEICGYGCLDHFAENDLYRHSWEVYGEILSNPETHGILLDIGIPIIHKSIKYNCRIISY
FT                   NGKILLIRPKIYLANDGNYREMRYFTGWNRPKYHEEYQLPKFISKITGQPRVPFGDCIV
FT                   QTLETRLGCETCEELFTPESPHITMALDGVEIFTNSSGSHHELRKLDTRLKLITEATKK
FT                   CGGIYLYANQKGCDGDRLYYDGCASIIVNGNVLAQASQFSLKDVEVISATVDLDDVRAY
FT                   RNQKSASVQAVNQLEKFKVIYTDVELSPSDYVFDHSIVPSKPQPIKYHTPEEEIALGPA
FT                   CWLWDYLRRSKCGGYFLPLSGGIDSCATAVIVHSMCRLIVEAVPNDDQVLKDIQAITHD
FT                   DDFVPKTPQDIAQRIFYTSFMGTENSSKETRSRSKELSSKIGSYHVDLNMDNLVTSVVS
FT                   LFEVATGKKPIFKIFGGSNTENLALQNIQARLRMVLSYIFAQLLPWTRGKNVPGLLVLG
FT                   SANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIAWAEINFDLPILHEFLTVTPTA
FT                   ELEPITKDYVQSDEIDMGMTYDELSRFGTLRKVDKCGPLAMFIKLYHEWSQPPYNLSAK
FT                   QIAEKVKRFWFFYAINRHKMTTMTPAYHAEQYSPDDNRFDLRPFLINPRFPHASKKIDE
FT                   LVEEIEKRQHEIDSSNKSVD"
FT   CDS_pept        279253..280422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582783"
FT                   /orf_name="CD36_16390"
FT                   /product="Dioxygenase; putative"
FT                   /EC_number="1.14.11.-"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43420.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG329728"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000192D1BF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK0"
FT                   /transl_table=12
FT                   /translation="MHKDSLVVTPLADAPFGCSIELPSYCQNDPSLLKDDDFTKLDDAV
FT                   QRHFVVLIPDQVDLSPKSQYNLTKRFDPTIPEPKDMSGGYGHGKEFRHDQSVLKKDGCS
FT                   VKSQPQVQILGQGTFSPDEPGNENGETINLTHPTHTTFHHTPLTEDQIKNKNQTRFYRW
FT                   HIDSALYDLSPPKVTTLLGIRIPPTEYQKVVYEDDGSELKLARGATCFFSGAQAFKNLS
FT                   DEDKEFALNTTVEYAPHPYIFISPAKATWDGLTMVSEGKERDFKDLPEWEESKVKKLPM
FT                   VWTNPVTKEHHLQVHGCCLYKLHTKQADGSTKTLDLKEAREKAHKFLRPAIAPEQIYAH
FT                   AWKQGDLVIFGNRQVTHSVVSELAHLGEAGKRLMHQCNIASGKDPITVV"
FT   CDS_pept        280777..283116
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582784"
FT                   /orf_name="CD36_16400"
FT                   /product="Mg2+-dependent phosphatidate phosphatase,
FT                   putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43421.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396084"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D1C0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK1"
FT                   /transl_table=12
FT                   /translation="MQYVGKVGGYVYNQWNSLNPATLSGAIDIIVIEHPDGTLHTSPWH
FT                   IRFGKFQIIKPSQKKIDLYVNDIKTNLPMKLGDGGEAHFVFEVDDKNHALSHSVLTSPI
FT                   ISPVSSPGSSPASTAAEPPDDLDLNENTNVEERIKLSDIPSPRSKSPTPSLKTKIAFEN
FT                   AKKITQKLNIPTKFDLNGDMVIDLDGYKPNSQKNIENSDELFQKIFFEEIEGEYPQGEK
FT                   IKAWEQFITRDENGHYRISNTGEFDSGETEDESTAPTTLTTATTTSLNAFSTESSDSDK
FT                   TYFKTLRLTSDQLSKMNLHYGENSLKFKASDGNSQVTANLYLWKSTTPIVISDIDGTIT
FT                   KSDALGHVLNLIGRDWTHPGVASLFQEIRQNGYNIVYLTARSVGQADTTRQYLQGVNQD
FT                   GIKLPPGPVILSPDRTFAALRREVVLKKPEVFKMACLSDIKNLYFEPIEGNDDDEHTPF
FT                   YAGFGNRITDAISYRSVHIPSHRIFTINPNGEVHMELLELAGYKSSYLHIGELVDQFFP
FT                   PIRQVSSISSYWNNAQWNEYMQNHRTPSPLGSPRSPGSPRSVMEEFKTDEKFNDVNYWR
FT                   EPLDLDNLSDSEDDVQGLKQAVAEKNDIPLKKNEKLSHGMILNQDKEHNNNPELLEKSR
FT                   DRASTIERPTSGSSFTSPLKSFMMFGKKKDNRKDDDSEYNSEKVADGEFTEEDVEVDDI
FT                   DVDEEDDDDYTDDDYEEDDYDEDEDDDYEEDDDDDEEDDDYDDYDDEEIDEIIVPDSPL
FT                   LDIDEDSKSENNSKELRPEDVDKLRI"
FT   CDS_pept        283868..285703
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537651"
FT                   /orf_name="CD36_16410"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43422.1"
FT                   /db_xref="HOGENOM:HBG396201"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000192D214"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK2"
FT                   /transl_table=12
FT                   /translation="MVQKQYRFAPKSIFTFALLCFVAIVVVLSTSSLVQIEESLDPIEV
FT                   SDKFKKHDKKIVIFPNNFESDSHKLASFFTEVFGQKLNEGDIVYKNRDTYELPQTVYNW
FT                   NTIDLFRSIGEKDSLNCEKIPLNFETSKIYNKNADLYKILRDFKDENSFYYKEVSVFFP
FT                   DLAKQLQERTIKKHWFQLIGSSVWLESYGIHLMISRVIYTKTGNKVQPVISLSYVQAFD
FT                   RNWTELQNVTLIVPDDSTGKFKTVTYPSFMPIPVYHNVKQQRGKFYGVEDPRIILVKNK
FT                   QGYEEPLIVYNSFNRNSSNTNYLGEIKNLVKLDTYRSIFMAWIWRSQVGKNNVGSMIPG
FT                   TATTNDIYVKVKELRLPDKKKSKTEKNWTPLVIYEDQKMQGYDSHIYFIYSFEDLSILK
FT                   CSLWDTENCVWEYRMNNKKTKISELRGGTELMNVNQILDKHNFDGLEIVKDQFKDKEVW
FT                   IGFARAALSKCGCGVKMYRPNFTMLVRQKGSFQLSFVSSYMDFGVPILPWTKGKGLCNG
FT                   KNLLIPNGISNWVLAEGENGSFQDYMTLSLSRSDSTVDIIHIKGILKSILSEYLLHTSR
FT                   DILNNNAIHCALLESESYCKSYAENYKAHLKRWQN"
FT   CDS_pept        285924..286463
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582785"
FT                   /orf_name="CD36_16420"
FT                   /product="Polyamine N-acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAX43423.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG395761"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D215"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK3"
FT                   /transl_table=12
FT                   /translation="MTQLSSNQFIRNLTIQDIDDCIILESKGFPPEQRCSPENCRYRLS
FT                   VASNICLGLFETTPLGDSKLIGHILATKIATERITEAGMGKRIQGVENSGHFENSRNIG
FT                   IHSVVIDPEYRGVHLGHIFLTKYIEYIRQLKLADKILIINKESLIPFYSKVGFENLGLT
FT                   DCRFAGLIDYDMVYNL"
FT   CDS_pept        286685..287458
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232054"
FT                   /orf_name="CD36_16430"
FT                   /product="Oligoribonuclease, mitochondrial, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43424.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG448545"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000192D216"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK4"
FT                   /transl_table=12
FT                   /translation="MFRLFVPRRFPIVRFYSVMQEPLIKKTKSDIMESFAKQTSQIPIP
FT                   KKPLVWVDCEMTGLDVFGDDNIIEICCIITNEDLDIVDEKGYESTIYYPKSRLDKMNEW
FT                   CIETHGKSGLTEKILANPDRKLSAVEDELLQYIKKYVPEIRTGLLAGNSVHMDRFFMMK
FT                   EFPKVIDHLHYRNVDVSSIMEFGYRHNPKLMKMSPKKTGAHTAKSDILESIEQLKWYRK
FT                   YYFKSEEETKETVERLSSELPEEVSEDANSETNKE"
FT   CDS_pept        287821..288225
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232055"
FT                   /orf_name="CD36_16440"
FT                   /product="Cytochrome c oxidase polypeptide VIa,
FT                   mitochondrial, putative"
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrial respiratory chain
FT                   complex IV"
FT                   /protein_id="CAX43425.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005751"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324116"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="InterPro:IPR018507"
FT                   /db_xref="UniParc:UPI000192D217"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK5"
FT                   /transl_table=12
FT                   /translation="MFKAVQQLTFRRFNSHHLKPSKLLNELSYKSNKQVGEEFIKKYEE
FT                   KVHHSEGITNLWKRLTYLVAIPAVLLVAIPVGKVELKHAEHRKHQAHLSDDEWPQQYDY
FT                   QNIRSKPFFWGDGDKTLFWNSDVNRHVVKD"
FT   CDS_pept        complement(288612..290174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000089745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582786"
FT                   /orf_name="CD36_16450"
FT                   /product="Protein phosphatase PP2A regulatory subunit B,
FT                   putative"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="cell division"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="CAX43426.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG443924"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000192D218"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK6"
FT                   /transl_table=12
FT                   /translation="MPSDKNWKFSQCFGDKGDIENITEADIISTVEFDHTGDFLATGDK
FT                   GGRVVLFERNQTKKKQSCEYKFFTEFQSHDAEFDYLKSLEIEEKINKIKWLKSGNDSLY
FT                   LLSTNDKTIKLWKIQERQIKLVSENNLNGLTHLPSADIGISSLKLPQLQLHDKLISAQP
FT                   KKIYANAHAYHINSISVNSDQETYLSADDLRINLWNLGIADQSFNIVDIKPANMEELTE
FT                   VITSAEFHPSQCNFFMYSSSKGTIKLSDMRSNSLCDSHAKIFEEYLDPSSHNFFTEITS
FT                   SISDVKFSHDGRYIASRDYMTVKIWDLAMENKPLKTIDVHEHLRERLCDTYENDAIFDK
FT                   FEVQFSGDNKSVMTGSYNNQFVIYPNAVNTGGDHKPKSVSKNNTNKRKKNGYRGRDDDD
FT                   DDNNNDDDDDDDDDDDDDDDDNQFDKEVPVSKNSPSSQLDYYDDEDEPEKITLQADKSA
FT                   FKSKKISPHTVSGRMMSGVGGNIGRDFEDVDFKKSILHLSWHPRENSVAIAATNNLYIF
FT                   STL"
FT   CDS_pept        complement(291334..291693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582787"
FT                   /orf_name="CD36_16470"
FT                   /product="Small subunit ribosomal protein, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43427.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG744826"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI000042D164"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK7"
FT                   /transl_table=12
FT                   /translation="MPKKRASNGRNKKGRGHVKPVRCLNCARCVPKDKAIKRVTIRNMV
FT                   EAAAVRDLSEASVYAEYALPKLYNKLHYCVSCAIHARIVRVRSRTDRKIRTPPQRKRFT
FT                   SDRKVSPQDAAKKAN"
FT   CDS_pept        293357..293830
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582788"
FT                   /orf_name="CD36_16480"
FT                   /product="Cytochrome c oxidase polypeptide IV,
FT                   mitochondrial, putative"
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="CAX43428.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324015"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="UniParc:UPI000192D219"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK8"
FT                   /transl_table=12
FT                   /translation="MLSRTTFRIARQQTRLLSTSRVLLAAKTAPETAVKSAKDLSEVTG
FT                   AASLIGPGAKEGTIPTDYEQATGLQRLELLGKREGVDVFDMEMPISEGKGTMQDPYLVP
FT                   TYIGYRYVGCKGTPEQDHKPYWMKVEEGKVSRCWQCGTVLKAKYLGEPGMAHH"
FT   CDS_pept        294578..295672
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246508" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582789"
FT                   /orf_name="CD36_16490"
FT                   /product="2-hydroxyacid dehydrogenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43429.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D21A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAK9"
FT                   /transl_table=12
FT                   /translation="MTIKQKVLFLEKPNVEDLKQFEAKFDCIYYTLSTLEQLLIDFQTS
FT                   LQDVEAIYCGWNGFGMFGGFRGKVLAHAPQSLRIVATCSVGYDGFDIERMSERNIVLTN
FT                   VPSPLAFEAVADLALYNAINSFRNFKLYAENLSSNQYGHSGVSRTSMLHGNFDQSSGKA
FT                   IVEPVVGHTYGYACCKRDNLSPRGHNAVIVGFGHIGELIGRRLACIGMNVHYVKRTRLS
FT                   ESQEKSLGYEVTYHESLEETKDIADLIIIACPGTPSTRHMINKQLINSMGKPFRIINIG
FT                   RGFVIDEDALVGGLKSGKVLFAGLDVFENEPTIHPGLLGRDDVVLTPHIGSGIAENYRF
FT                   TALTSMRNIETILRGYDEEINRVN"
FT   CDS_pept        295904..299677
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582790"
FT                   /orf_name="CD36_16500"
FT                   /product="Cytoskeleton assembly control protein, putative "
FT                   /protein_id="CAX43430.1"
FT                   /db_xref="HOGENOM:HBG396086"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="UniParc:UPI000192D21B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL0"
FT                   /transl_table=12
FT                   /translation="MSSIYIGVYKALYDYTAQAEEELSIKENDLLYLLEKSDIDDWWKV
FT                   KKRVVATGDEIVDEPSGLVPSTYIEEAPVIKTATALYDYDKQTEEELSFNENDKFNVFD
FT                   LNDPDWILVGDLAKEKFGFVPANYIQLDSSEAAATTEPAQFQQQQQQQQQPQQTFQPPP
FT                   QQQQTQIPINNFPPPPSHKDRTPDFPAPPVHKDRSPEHPPPTPEKDYPRMLEQEPRSSA
FT                   TRYHQEPERREGEGEEEEAPPPMPSRPTASSIVAPAPVVGRSNTYEQEESIEQNEHSYD
FT                   GEFFTWYIDEVDGRKKRAIKLSIGQGLVIIKPNTTNPKKLRMRSSSSLDNQWRIKDLIT
FT                   FNNEKKHVFLEFKNPAASLELHAGSKDVAEAIMAILGDLKGAEAAHGLREVAKASKASA
FT                   NESNRKIGRLLYDFEAQGDDELDCKEGDEVYIIDQKKSKDWWMVENRETRRQGVVPSTY
FT                   IEIVSTSNLDKLTDGPLRTKSTKSKGRVVEAKDKRSSHHRSREERDRIREKDRAQRDKA
FT                   SSSQAEQDKSMPNFHRVRTWIDSSGTFKVEAEFLGCVEGKIHLHKTNGVKIAVSADKLS
FT                   VEDLEYVERITGTSLEQYKEQVMKQQAKRARSKSKSGATATTSGSNDTKYASSATAAIN
FT                   DIAPPKPTRPQTTTQVSNNGAPLYDWFDFFLECGVDIGNCQRYTLNFEREQMDENILED
FT                   ISPSLLRTLGLREGDIIRVMKYLDAKFDRKKTPEAPQQSGGLFIDKNGNLKNNSSSTEI
FT                   SKVSADALPSPVKTQVTSSTPVTESSQNNNKIEDDAWAMKPAARSSEDLLKPSPQPQTP
FT                   QYTGALSDLVNIKPVGTSNENKIKTEQSPAAPALQPTKTSNTTATTSSIPPQGSSVTPQ
FT                   RTGTLVPVQKTGGLVPVQRTGGGLVAVQTGGYLPSQPTGFVPITAQPTGFIPIQATGIL
FT                   QPQLTFGIVPLQTGTTTFNANNKTAPPRPETAPPPITTFGQQPTFQPAFVPLQTGVITM
FT                   PQTTFGGQQQQLPNQITGGAPPQTSFNQPALVPSQRTGGQITGGFVPQSNFGKQITGGF
FT                   MDSNTLSLGQQITGNAPPPPTTSFGQQITGGLPTTSFGQQITGGFPQTSFGQQITGGAP
FT                   QTSFGQHITGGAMPNTSFGQSFSQQATSNPFPQMANQFTQPQQPQPVMNQFQPQPQVPQ
FT                   QQPYFNQFQSQPNLNQMTNMFQNTSISSPATFNQQIPTTTFGQQPQFEGFGSQPLQSQP
FT                   TGMGFGNAPLQSQPTGKRANLQAATPDNPFGF"
FT   CDS_pept        300016..301656
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247956" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582791"
FT                   /orf_name="CD36_16510"
FT                   /product="N6-adenosine-methyltransferase, putative "
FT                   /EC_number="2.1.1.62"
FT                   /function="mRNA (2'-O-methyladenosine-N6-)-
FT                   methyltransferase activity"
FT                   /protein_id="CAX43431.1"
FT                   /db_xref="GO:0016422"
FT                   /db_xref="HOGENOM:HBG396087"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniParc:UPI000192D21C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL1"
FT                   /transl_table=12
FT                   /translation="MIYELKDFIPFIEFILNQDNKILDTPIYGQLWIIGPLIQESSNLK
FT                   FTTTKDFLDYIIQFNTISGYSLEFSGDLNNSINIKHLPRLACINFEGILMLQKRLKGKQ
FT                   TFSQIPNSKNRNPPTNLLQILEISSKHEMLPYSSTNNDSSNFSSELSLGVEFLQELINK
FT                   PTARTILNKQKARLRTIEKPFHSICNDHNHINLLATVGLNKKEYSHFGSKQTTPVDVVR
FT                   QRILKCRNILSNDVYKCAQDKIHFLPIINNHTDLNLGDCSYLDTCHKLKSCRYLHYYTL
FT                   APMKKEQSQVSEGQQQQQQQQRQIKLQGLEYTSGDCFSESFREPLPPQWINCDVRCLPF
FT                   SILGKFAAIISDPAWDIHMSLPYGTCKDDELLSLPMHELQDEGIIMLWVTGRSIEIGRR
FT                   ALLKWGYQIYDEMIWIKLNQLRRTIVTGRTGHWLNHSKEHLLVGLKGNPTWINKKIDTD
FT                   VVVSPTRETSRKPDEFYDIVERLVGTHSRKLEIFGRDHNTRPGWLTIGNQLQGVSLFEP
FT                   ELKYKYELYKQTTTGATAATTTSSGGGGK"
FT   CDS_pept        complement(301662..302240)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000263779" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582792"
FT                   /orf_name="CD36_16520"
FT                   /product="Endoplasmic reticulum membrane protein, putative "
FT                   /protein_id="CAX43432.1"
FT                   /db_xref="HOGENOM:HBG688529"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniParc:UPI000192D21D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL2"
FT                   /transl_table=12
FT                   /translation="MPGLFDLESHLVFYRSYHFNHTNVTIHLICIPIILLSTITFLTPV
FT                   TINFGGLINNSDYNLGTLLAWSYGIYYILLDWKIGLPSASVLFIFAHYIKQYYLTLSET
FT                   SVPTSNEFVKIAVALHVFSWLAQFYGHGVHEKRAPALLDNLLQALVLAPFFVAFEIAFF
FT                   LGYRKDLKKNMDNRAGVLIRDYTKQKKQT"
FT   CDS_pept        complement(302722..304989)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582793"
FT                   /orf_name="CD36_16530"
FT                   /product="Dolichyl-diphosphooligosaccharide--protein
FT                   glycosyltransferase subunit, putative "
FT                   /EC_number="2.4.1.119"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43433.1"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG314442"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniParc:UPI000192D21E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL3"
FT                   /transl_table=12
FT                   /translation="MAYTVTSSKPQLTVLGIDVESIRVLLKVIIFISIAGAAISSRLFS
FT                   VIRFESIIHEFDPWFNFRATKYLVTHSFYEFLNWFDDRTWYPLGRVTGGTLYPGLMVTS
FT                   GAIWHILRDWFALPVDIRNICVLLAPVFSGLTAICTYFLTKEMKDSSAGLLAAIFMGIA
FT                   PGYISRSVAGSYDNEAIAITLLMATFYFWIKSMKMGSVFYATLTALFYFYMVSAWGGYV
FT                   FITNLIPLHVFVLIFMGRYNAKLYTAYTTWYALGTLASMQIPFVGFLPIRSNDHMAALG
FT                   VFGLLQLVAFGDYVKSKVPTKQFKSFLIVSIILVVGLGIGGLFGLTAMGWIAPWTGRFY
FT                   SLWDTNYAKIHIPIIASVSEHQPTAWPAFFFDTSMLIWLFPAGIYLCFQELKDEHVFII
FT                   IYSVLCSYFAGVMVRLMLTLTPVICVAAAIALSKLFDVYLDIVDLFTEKVDNNNEDDDD
FT                   DGESKRSTKKSSFKFPIAGLLSKLLVLLSFTFYLFYFVLHCTWVTSNAYSSPSVVLASR
FT                   NPDGSQHIIDDYREAYYWLRMNTPEDAKVMAWWDYGYQIGGMADRTTLVDNNTWNNTHI
FT                   ATVGKAMSSNEDVSYQILRQHDVDYVLVIFGGLLGYSGDDINKFLWMVRIAEGIWPDEI
FT                   KEREYFTDRGEYKVDKDASLAMKNSLMYKLSYYRFTELFGGRDGVDRVRNQQIPANDVP
FT                   KLNVVEEVFTSENWIVRIYKVKDLDNVGRDLHQATAFEESSSSNTSKRNRSIKRPKLEV
FT                   RE"
FT   CDS_pept        complement(305434..307734)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232056"
FT                   /orf_name="CD36_16540"
FT                   /product="Phosphatidylinositol-3-phosphate-binding protein,
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43434.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396088"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI000192D21F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL4"
FT                   /transl_table=12
FT                   /translation="MSTTITMNTTTNIEEDNNKNKNENENETNNKFTINSTLPSNTTTK
FT                   ENDQNEQQQQQQETHQSESKQEDIKNENAINSVTDKPIDNDTKDEDSPTKSDLSFAKKD
FT                   LSKSRTQSFQSVLSTASLKSLKQQVLTNSIITNNGNNTANNVPQMHRNNSTISTHNLMR
FT                   SNSTINNSKNFSSFIQAPVLSSIQKPEEDCQIGQQLPFDGSSSRTRANSSDENDEDNIV
FT                   QQQNLTLKALKKLSLSPRPVTNPDDISVTREEEAKSKLVKEPYQPAEVDLSSFASLTRQ
FT                   PKQPHKFSSSSNDTTQKSAGPVENPANKSESSLSQYHSDIQQHQLNAIQRQLQPEKFNT
FT                   SPNTSRTKHQILPGQLTHPQLHHHQQPPQQQQQQQQQNQHQHHQSQAYTNFPHPHPTSG
FT                   IPAAVVPPTDFNAKRKPSIPKMHFQQQQQQQGIHGHTNISPESPNQNTQNHHLNHARST
FT                   KHLQQIKGLRNPMYVPAVLRVSQNGLSTPNRSQSNSPEELSSSPQQSYCNQQQRSQHQQ
FT                   HQEQPQDHYESYLQAFNKKDIVANSSNASVRSTDSGISIDSSMSTTSGQLGSLTGFLSF
FT                   NSNNGKNYDFVSRAPPTRKHWIKDEVALKCGIPTCPKVFNFFERRHHCRKCGGIFCKQH
FT                   TSHSLYINHLAQFTTGGRGTLSKVCDNCIEEYNQFIAKEFGVNVHSTKPSIPNKSTEQK
FT                   IESKNNVHSQSGLDTGAAYQSQQQSFIPTTQTHNYSNNTASNNIVAVSNDSGNSRNDQL
FT                   VGSVPANWTWSSF"
FT   CDS_pept        308983..309513
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582794"
FT                   /orf_name="CD36_16550"
FT                   /product="Succinate dehydrogenase cytochrome b subunit,
FT                   mitochondrial, putative"
FT                   /function="electron carrier activity"
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43435.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG734972"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR014361"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="UniParc:UPI000192D220"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL5"
FT                   /transl_table=12
FT                   /translation="MISRVGLLKRPTVSTLNNYVKLQSTLGLKRYTSTVSATSNQEQEI
FT                   LVAQRKNRPTSPHLQIYQPQLTWIMSSFHRITGVAMAGAFYGLTCGFAATSILNIPFDT
FT                   TTLISYFTALPIFAQYGLKAICAYPFVFHIGNGIRHLIWDFGKELTIPGVYRTGYVVLA
FT                   VTAVIGSYLAFLW"
FT   CDS_pept        complement(309913..312480)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582795"
FT                   /orf_name="CD36_16560"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43436.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG396089"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniParc:UPI000192D271"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL6"
FT                   /transl_table=12
FT                   /translation="MTIMVNKEPNKPSLSESSIQIKQELKTMNNSTIISGSKPISAPAM
FT                   KETPPTSALKSTPLTTPLPASQPNLMKTTSTSITPQPSKPKSNQPLQPPCKQIKTNPKL
FT                   LSNPQQNKTKSSTRPGVQPIAPKYHKIQPAIAPKPMPASMSQTSKFNPIPTGKLSLSMN
FT                   QSSFARPNDPSSLNTSRRWVLPPRPRPGRKPTHDSHGNITVDDKKMHKNGATTTNTTTT
FT                   TGTNNSAISNGNNNIPITTNITANTSNGIIKKKTKCKKDSSLEAKIALNSNAALLNQIK
FT                   SSGSNTTVISPEEINLNSGKSGSLKSITPSSNKTPSTSLPIPSSSPALPREPQQQQQQE
FT                   KPAITYSKSKTKASSRKSKAGSNKGTPSKTPEVPIPIPIPPIEVDPEKYLSNMQMSYLS
FT                   KLKEQEVIRNYIEVLTNQIKELSFVQNGVITFDALKSNVKYNNKKILSSTTTSTSTGTN
FT                   NGSNGGTSSSTSTLTSNSKSKYDQLEAINNLNDLNKFLNYLTKSSNIIQSVKKNPSISS
FT                   ETLNKQVDHYVEIRKKFKAIKRNEQNGKTLNNLGLQPIPPQYSLSIPSMTTGAATTTTT
FT                   TTMNSNPTTPIPQAMKNHAMFNNDKLSGILSGSTFQDMDLDPTTNNNHNHNNSGGDAFN
FT                   ESGMGQFVPDLLKPIKPVNLFSEFQDLQLQTETIEESSSQMSQLSGIGIGIDGGEDYDI
FT                   GTNSNNGNGNGNDSGSNTNTNSSGSGSNFTIPNSLDGDDIELFMDEHDFLNRLVLDDRQ
FT                   KMMNDEEEVFGKVQIHGNDSNDSNGNDNNSNNNESKNLNKDTNITKDNNNNNNNNNNSS
FT                   NSSNKNMDRLNNDLLLKKKFKFNCGFCTNDTPCLCFDTMFLER"
FT   CDS_pept        313325..313654
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582796"
FT                   /orf_name="CD36_16570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43437.1"
FT                   /db_xref="HOGENOM:HBG396090"
FT                   /db_xref="InterPro:IPR013183"
FT                   /db_xref="UniParc:UPI000192D272"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL7"
FT                   /transl_table=12
FT                   /translation="MSSSNTPNKQAITPNERQSILRTTITPPSSTTSGNHPDPSLSSSS
FT                   SSSVTQRKLSHLNSQMAQLNANLCDFNDLLVTTCSQYQSIEKLGKIHASIFMAGHTVFE
FT                   DENFN"
FT   CDS_pept        complement(313825..314223)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582797"
FT                   /orf_name="CD36_16580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43438.1"
FT                   /db_xref="HOGENOM:HBG398386"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI000192D273"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL8"
FT                   /transl_table=12
FT                   /translation="MSNYYNKNKKSYSDVDLPTNPNLPSWIITPKEEKAVFERWRKKAF
FT                   AKCDDLIKKYIECSNNYSNPMDGMKNCSKINEESLACVAKYQTKEYLDIEKDLFIKEKL
FT                   EKKKLYKLYLEKQNQDKQDKQQEQEKQS"
FT   CDS_pept        314404..315276
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582798"
FT                   /orf_name="CD36_16590"
FT                   /product="Kinetochore protein, putative "
FT                   /protein_id="CAX43439.1"
FT                   /db_xref="HOGENOM:HBG396092"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="UniParc:UPI000192D274"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAL9"
FT                   /transl_table=12
FT                   /translation="MFQNQNQNQNKPHTHIKYLNPFDTSHFIPTPLVMASSVEKLNKLI
FT                   EEVNNQDELQLIEEINLYIKTLYELRQIKIDQLSNIIHQLNQKIITSNKEINQLNKIND
FT                   YNYELIKVNNFNFIDGSWSQSFQFTNFDRISSSISDTSHHHHHHDNNIFQMINKRLNEL
FT                   DNLKVIIVKELNDLETNLNNLKYKQNNLYESMEDINDKLDKLLNDIDKSGIIDQDPSIL
FT                   RINLFRNLGIKLENTPHNNNNNNNNTTRSDGDTDDCVIITDDNNNVNILNIEPKLSDYF
FT                   ISNYIWDKL"
FT   CDS_pept        complement(315605..315949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166603" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582799"
FT                   /orf_name="CD36_16600"
FT                   /product="Large subunit ribosomal protein, mitochondrial,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43440.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG396093"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniParc:UPI000192D275"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM0"
FT                   /transl_table=12
FT                   /translation="MFSSLIRSGGYIWKFTSRLTSTQKYKLRNRMKQVDENINNIYQGL
FT                   IKIQENKSIGDLTNFKKIDYLKFQFPKENEMTTRDKYTTFNRHSKNYRKPIHRVPKWTK
FT                   LSFRENPKYF"
FT   mobile_element  317311..317624
FT                   /mobile_element_type="retrotransposon:solo LTR, nu D"
FT   CDS_pept        complement(319087..319650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582800"
FT                   /orf_name="CD36_16610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43441.1"
FT                   /db_xref="HOGENOM:HBG396094"
FT                   /db_xref="UniParc:UPI000192D276"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM1"
FT                   /transl_table=12
FT                   /translation="MSDFAFNNYCIHCDKLCLNNSVYCSEECKSIAYESSLNQLQHNHN
FT                   TTSTNGNTNTNTSASATTSTSTTTTGTTGSSVNSTNSNTPSLVSPLLTPALYIQLQQQQ
FT                   QLQQSQINTPLHLSSLTPTTDYNNEYHYEYDNDIVDNDDDELNYFDLNYSVQSNINYTT
FT                   NTTKSNNELINSTSDNYRKWLTAL"
FT   mobile_element  complement(321326..321463)
FT                   /mobile_element_type="retrotransposon:solo LTR, rho I"
FT                   /note="truncated"
FT   CDS_pept        complement(327761..328489)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232057"
FT                   /orf_name="CD36_16630"
FT                   /product="Hypothetical integral membrane protein, conserved"
FT                   /protein_id="CAX43442.1"
FT                   /db_xref="HOGENOM:HBG398387"
FT                   /db_xref="UniParc:UPI000192D277"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM2"
FT                   /transl_table=12
FT                   /translation="MTAITTTTSRLRKFDKSLIHESTSTSTSTSTSSTKSIHNIDLIDI
FT                   DDQINLIDQLTITNQINYKKSMKYLIYLYILQIILILSLSLTMAKTKRTSNPTNNNNNN
FT                   NNNNKTKKKNHLDQQLQYILLILSICLNIINVKFGTNSNNSHSFSKRLIIWIKWINRLI
FT                   TLQLIYNGYLTIITNTLSLPLPLPLPLPLPNVIDQYRGILFMILPGFNILMPWLFLYWY
FT                   KHMDESVQQLNELKYEYKNV"
FT   CDS_pept        333116..337186
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582801"
FT                   /orf_name="CD36_16640"
FT                   /product="Cell surface flocculin, putative "
FT                   /protein_id="CAX43443.1"
FT                   /db_xref="HOGENOM:HBG396095"
FT                   /db_xref="UniParc:UPI000192D278"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM3"
FT                   /transl_table=12
FT                   /translation="MLANVKLNLVTALYVLSYVSAVNAYQQKNEINQADNIDKRAGPIG
FT                   NFFRDFTNSIFGNQNSEDNQPSTHGTTPSTGNSFSFLTPSTQQQTPGETSNNGNTKPSV
FT                   ENQSPSTVAAAAVTSSSPVASTSPASTSEQKQQEGSTAKESSSPTTTATTSSNSPVSSS
FT                   SKDTPTTTTAQTSSSNNNNQQSSSNVEAPSTSVNQPSTSEVQPQSQQTSTTSSTPTSTE
FT                   TPNTPTSSPTSSPTSSTTPTSSEAPATPSTSEVAPTTPSASEVAPTTSSTPTTSDTPTS
FT                   PTTSTQENTTSSSSTSVSQQTTLTSSTSPTTGSTTSTSTPETSDSLKPSSTSVETPSTS
FT                   GIEQDPTTTSSTGTTSSETSKPTTTSESAVTSNSPTQESTSLVDATTSSLDSSNTPTPN
FT                   PSTSEDQPSTSASQAQTGTTSSAPSPEPTTSSAPAEPSSSNADYSDQVLHSSETTSLVN
FT                   PTDSQIDSSSTNDAVSQATTESTSENSSPTSSSVTASDVNSAQPSSVPTSNANADTSSL
FT                   VSEQSLATGSQTSLDTTPGASTTANEVSADTVSTFATDGSSDASQTIAGTTSNSPDESL
FT                   VTPAASTSPDVSTFPTGSESGTSLVTGSDTSIDTNTVASGSTINQDSSGILTQTPSQSI
FT                   VSPDTVTPTGSSSDVASDIPTGSATTNSVTGTETGTQPVSSFATDASEPAFSSEYNPSE
FT                   GTTSLVAPTNSELSSAVTDSETALTGSSQTTAETTPTAINSESVLTGSTDSAATVTPSE
FT                   SILSGTTESAATPIPSESVLTGTTESTGTPIPSESILTGTTESTGTLIPSESILTGTTE
FT                   STGTPIPSESVLTGTTESTGTAIPSESVLTGTTESTGTPIPSESILTGTTTTSGTTAAT
FT                   GTSVSEQSGVETALSTQATTGTEATVTSGVSQSEQTGTSAATGVTESSEQIQSGATTTS
FT                   AGTSTASDTTAVTNASEASAESQVTTPASGASTGSQATTTAATESQANTIATEASTGSQ
FT                   VTSDVTPATAPSSVTPADTAATSIITSPPASAEPSTEAAPIAASPATTSSTKNWLPSSL
FT                   VIAETPSSNPSKSTESIVQASATAASTSGLPRAITPETTTTPGIDYQVITIGFKSALNY
FT                   PFVVENSISSAQIFQYLPGVLKYPFNGDKSLQDVSVRRLIPYTASNIDYTITVAEVYFP
FT                   KDSVKALGSLITTPGSAIYRNPDSVLQALASLIDSRIPLTGLTTDDQQVSGSSSDNSPS
FT                   SNSYGSMDIVSNSKVADKGRIAGITIGAAAGCGLYMTLMVLLFRKFRKSNQALELPITD
FT                   SESNLGFTDEDSSMMESSSGFSAIFSRINHGGVLTGDPNGGDDMMMMNNNNNLRPNNIS
FT                   EPVQASNSLGWYH"
FT   CDS_pept        complement(338309..340222)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537652"
FT                   /orf_name="CD36_16650"
FT                   /product="Spliceosomal U1 snRNP protein, putative "
FT                   /biological_process="mRNA processing"
FT                   /protein_id="CAX43444.1"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG447632"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="UniParc:UPI000192D279"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM4"
FT                   /transl_table=12
FT                   /translation="MHHFYKHNHPCIHSLQLTSNMTTDDNNIEYVNPYSLAESTNSDLI
FT                   SILDPNGSTTSIIKPQLNYQIPIFKSIDVSNLIDLNNTKIQTKTNETRINKTKKSNDDE
FT                   NTNNTLSFKDDDNNNGGNIVEGIDDIVEDVKLYVSIDKLKPENFQNQLTTIIINRFPNN
FT                   LKINLIEQLLKMLMNSKPFVWSFINHELIDLKLIFIKFDQLIDLKWFLLTYNNYISQLI
FT                   PKVSIITNDKVDEYLNNNKDTSLMHVEPSKITDNLKAKISLIINNPINYTKGKKNSGTE
FT                   DLDQVLDSYSNYKVDNNDLIDIPNNMKENIIKDIIKFRSRMLLIEKEQQKKEIEMERIK
FT                   TKNKLKELFEGIKETSENSPDGITTTGTTSKTGAGFKIPHKVSYRDEYGDMNDKEYEEF
FT                   IANEERNKLNDEYIKKLKSFQNNQHDEYIKLTNKLRSLQNYESDLIDNKLKYIDNLKNY
FT                   QTNGLAHLYIHNYSDYLRMRSQKRSLEETKDAEDVKQELEEIKKNGGEVAAKTKSSTAT
FT                   AAASESTTTTTTTGATVEPSKSTSNTTADEPVHKKSKPSKEIIIVELSSSIKQSLQEKI
FT                   IELVENSLGIKDEFLIQVINENLETFNLNNKQELIDELIQVLDEDAESLVNELWEYIET
FT                   IV"
FT   CDS_pept        340345..342531
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537653"
FT                   /orf_name="CD36_16660"
FT                   /product="Spliceosomal U1 snRNP protein, putative "
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43445.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG396096"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="UniParc:UPI000192D27A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM5"
FT                   /transl_table=12
FT                   /translation="MSVTNLPKDLESQTITLFSKSSAISKLQQEVNSNPNNLQKWNQLF
FT                   TELNKLIDTSTTDTDNDELKKDIHNSYKALLSRFPYLTEYWKKWQSVESKLNGEETSQD
FT                   ILRMAVENYPNSISLWCQYLTSILINGKDKTDTAELFRNLYKQALIHNGYDFNSHPIWN
FT                   MAIEFETKQSKQSKELLELYLRVIKIPLYQYAQCYNQFSEINKQFDIQQIITSSDQLNQ
FT                   YVKEFGKNQLEDLSLLERHQIIDDFTASIFSNTQKRVNKNWQFESLLETQEFTLKVGSD
FT                   NSNIAKEKQIWINYLQQEIDTYWTDPNKDDQFELVCNLFHRCLIPNCYDSEIWLKYLEF
FT                   ISNSNLPKQEKFDKQQEIYININAKLIPLDNNETRLKYVELLIDHEKNQEANEYLFNWM
FT                   KLFSGGSKKYYKSSYLQITKELFSLWIKLLDHREFIIIAESMINKYFNIHEKQQKKDKD
FT                   EVNTKTTPNTEQNPNLSKLELTESLITSVISFLNDESICILTVLYLQQLQLQQQEQQQS
FT                   ETIKIRKFFNKFNHEKCFKTSIQFWKFYFQFELSNNHWKNLKSLINHIKFNTQLPKIII
FT                   DSFIEWMNEISNDNLINFLKLNDGRSDETIIMKDLEISNSIFYNKTTIKRHAMKNNYIL
FT                   INNNNNNNNNNNIDKKRNSNGSEEEFLRLTSKQIGHPGIFIDVVPQITNRLMLDNNGID
FT                   LTQENLSVPPLPVFKNVEKASQPIKYPSTTTQTR"
FT   CDS_pept        complement(342576..344519)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537654"
FT                   /orf_name="CD36_16670"
FT                   /product="DNA repair protein, putative "
FT                   /protein_id="CAX43446.1"
FT                   /db_xref="HOGENOM:HBG396097"
FT                   /db_xref="UniParc:UPI000192D27B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM6"
FT                   /transl_table=12
FT                   /translation="MARRQRSKPGSNSQSGVKGPNSALTEFLRNEGITDAFRQRRQREQ
FT                   EIVTNNDNDNENDNDINEQEQFTPSVEVTPEATSRGSRRSASISVQEDEDDDEIREMRR
FT                   AAKRKLRASRRGSTRQNRHRHDPNNSSDDDSSSSDNDGDPNFSEDEDDLGNANMRKFGE
FT                   QDDCVDCGQTFELTVSSRFIKEKNGYLCNSCNQLLKARERKAKMNQMNARKKRKRVAQA
FT                   LLNKTDVRIPKLQDVCIKKITENIEDVDVLGDIGQMNMNRISMILSKNRSLNDKTISLF
FT                   LSPDLKSLQFWDCSNVASDSLNKIASYCPQLESLTLFMCGQFHNDNLQYFASQLTKLTE
FT                   LSLNGPFLISDVMWQDYFEEAGSRLTKFEVRNTHRFGNDSLISLLTNAGRNLTSLKLSR
FT                   LDGLNAADVYGMIPHFLSPSKLTHLEISYPESEELINDDLIISILSITGDTLVSLNLDG
FT                   CSDLTEKFLIDGIAQFCPNLTHLSIQNLDQISDEGFAQAFKEYSKVNVGGLLEVYLTKC
FT                   IGLGDKAIYELLKHSGHTLVELSINSLDLLTKDFLSQVFTEDSHQFKKRLLQQMEESQE
FT                   KDVEYYNHIKLPLLTYLDSGFVRAIDNELLFLIGESCPQLKIIEVYGDNRCTSKARIRP
FT                   GLMVIGRQSDEI"
FT   CDS_pept        join(345209..345274,345476..346702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384910"
FT                   /orf_name="CD36_16680"
FT                   /product="UV excision repair protein, putative "
FT                   /function="damaged DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /biological_process="proteasomal ubiquitin-dependent
FT                   protein catabolic process"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43447.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0043161"
FT                   /db_xref="HOGENOM:HBG738030"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004806"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015360"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000192D27C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM7"
FT                   /transl_table=12
FT                   /translation="MQIVFKDFKKQTVTLDVELTDSVLSTKEKLAQEKGCDSSQIKLVY
FT                   SGKVLQDDKNLESYKLKEGASIIFMINKTKKTPTPVPETKSTTESTSQEQVQAQGSTNE
FT                   STSSSTSSTTTTTAAAAAAAAGAASTGTTTTSEQQPEQAVSNESTFAVGSEREASIQNI
FT                   MEMGYERPQVEAALRAAFNNPHRAVEYLLTGIPESLQHPTPPVPVPAPVPTAPTGQQTE
FT                   RNTSETGQQGANEEHGDGDEEGEESTQHENLFEAAAAAAAATNQGDSSIGGTTSGVGAG
FT                   AGAGAGGEGDIGGLGDDQQMQLLRAALQSNPELIQPLLEQLAASNPQIASLISQDPEAF
FT                   VRMFLSGAPGSGNDLGFEFEDEGAGGAGGATTGGDEEEEEGTIRIQLSEQDNNAINRLC
FT                   ELGFERDIVIQVYLACDKNEEVAADILFRDM"
FT   CDS_pept        complement(346939..347754)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000237286" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582802"
FT                   /gene_name="UTR4"
FT                   /orf_name="CD36_16690"
FT                   /product="Enolase-phosphatase E1 "
FT                   /EC_number="3.1.3.77"
FT                   /function="acireductone synthase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43448.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="GO:0043874"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG294242"
FT                   /db_xref="InterPro:IPR010041"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D27D"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WAM8"
FT                   /transl_table=12
FT                   /translation="MASTTNNTPIDTVILDIEGTVCPITFVKDTLFPYFIEKLPSILQK
FT                   FQYPLPTTTTSDNDDDDDDDPVLNILKQLPENIIQSWESIFNHFKNLVDQDIKDPILKS
FT                   LQGLIWKQGYENNELKAPIYQDSIKFIESFPTVKSKDNQRKIYIYSSGSIKAQILLFGH
FT                   VKNSSTSTTSSSIDNDTIDLNDKLNGYFDITTVGFKNQSNSYIKILQEINKSQYPQSVL
FT                   FLSDNINEVNAAINAGMKSYIVIRPGNSPINDEDKKFHKIIYSLDELDL"
FT   CDS_pept        complement(348101..350794)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582803"
FT                   /orf_name="CD36_16700"
FT                   /product="Transcriptional regulatory protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43449.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397122"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000192CD1E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAM9"
FT                   /transl_table=12
FT                   /translation="MNQDHPLPPVKRPKGRPRILPIPKRTKVSRACDLCKRHKRKCNGD
FT                   NPCLYCQEKSLQCTYLKLDGRSKKSKFQSNNERQPTVDGDNNNNNNNGRNEDGGLSTDS
FT                   NEIEPEIPSLPNTPNSNSHSNYNGSRSMETHSNNNNNNNNNNNNNNNNNTNNTRNESNG
FT                   NQRINNDNSNNLVYNKPQKFDGEEKEQEQEKEKAKDSDSDSIMKTSLGMICQSLQTALS
FT                   NDDSSNVISFFKKKKAQEARQERLSNLDGQHTRILTSETGVLRFFGESSALSLISECRA
FT                   LFYEVLGPSTFTNDPAQNFIHDESISFDRDTTPSSCGDRKEKNGGGGGSGGSGSGVAVQ
FT                   LPLKKDALIMIELFKSNINDTFYVFNMKYFMEKIVDKVYNNPIIANSKQLCLLNFVFAI
FT                   GSLFIEYSSSSSSNDCVNNDIDYLPNSIEFLQSGQLYMRNNVYDGKLWMVEANFLKYFY
FT                   YQACCNRSNSWINLGSAIRLAQALGMHRKIINDKIENQEISIHRRRLWRSLYVCDCVSS
FT                   VNLGRPLMINTYDYDDINYPVEKLLLPQDEKNDSIERIRIIAQNATSDSAVLNRSIVQN
FT                   LYNGGSINIKDSNSLALQLKLWSIELPNFLQLTSDMENQLRDPTNPNNYLFVFVHIGQL
FT                   YGIMALTRPFLVHVVNRKLRPNMYKPQVTDEKQLMPFCKASIKAAFLTIKLFKFYCTYN
FT                   KSRKEVFTIQSATFFASILLGFTLLEQINSKKPDYHYISVIKESIKDAISIFQLFNFNA
FT                   TCNRWAQHLIYMMEALNRPALPSLRQTPATATTTKTTTTTTPVPPTHHPITSTNLNHHH
FT                   HHQQQQLPPSSGNVKFPFQNNSPSSSSISSEIDRFNDELIRWNNDNTAFEQMVNFQQYF
FT                   VPNDIDVLNNNYLDAFNYTNTYKYNM"
FT   CDS_pept        354567..357938
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080716"
FT                   /orf_name="CD36_16710"
FT                   /product="Transcriptional regulatory protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43450.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396099"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192CD1F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN0"
FT                   /transl_table=12
FT                   /translation="MTGQIKIKVEKDNQNIISENVDSDVKVSTDTPTNNDKNNDNNNNS
FT                   NDEKSNPTKTNTNKSSSTNNRKDKPKAFTIKYKRPRGSRACTVCRSRKVRCDAEIHIPC
FT                   TNCITFGCDCILPEVKKRGNQSGESKAKKQKTASNSKTPSTTINNANTTGKSAASTSTS
FT                   TATKSSVKEKNYTKKKSSSTNTSDNGTLPVSENSSNISSTTATATAAATNNDNNNNNNN
FT                   NPITTTASALSSLSKSTINNSTSTTSANEPILNISQISVPPSLTSTYKNRPSMHKKELL
FT                   DSKAKTSLTFLGSSSIGVVPQRAGENHVELTTDIFDTMDVTLDSVELEILKIRGAFLLP
FT                   NKELSLDLINAYFEHVHPLMPVINRSLFMKKFHDPNDNPSLMVLHAVLLLGCRVSKNPL
FT                   LLDSRGTNDLASITFFRRAKALYETNYESDPISIIQTLILIGSYWDGPEDVTKNSFYWT
FT                   RVAVGLAQGFGFQRDVSKSQNLTISEKKIWRRIWWCLFEKDRNVSIAFGRPVVIDLNDC
FT                   DVPMLTIDDFDETDAELGIIDPYTVDETQALYFIHLVKLAEITGIIIKHQYSVKSESMK
FT                   RRNAFSIIEHCDMLMGIWFTNLPPQLSFSLADNSTQNFYACLLNAQYYNRLYLIHRSNL
FT                   VRMARSSSTNPNNYKYPSWGISFQSARMISIISKILLDRDLLQYVPVMFIYIAFSALIM
FT                   LIYHVDSTNGVIASTATDSLYVSRAVLKELQKAWPIAGVLLKLFDKYANDKLKRSKLIE
FT                   SSSKVADYKETVANEKLKNSSTSPLASDTYGRVKATPEVTTYQEPPPPHHHHQQQQQQQ
FT                   QPLPPQPRQGSSQLPLPQTKQQQGYGSVPHEDNFRKNIFSPGSNSTTSGISPGGNVYQD
FT                   YQTSPANVSHALRQLQDQQQQQQQQQSQQQSQSHYQQQDFVYNNNGNTNIQHNLRPPQI
FT                   EELVKQYKLPMKRAAQGETSDASDKPTTDTSPTSSTKSFPEISMVTDNLTNKQDFIDNF
FT                   EPTQLFPNFSIPPTRVQSPTPNYDEQSNNNNNNNNNNHDNGIGSNIYGSMNQEMTMRDA
FT                   PPSQSQEQFHGGNGNGNGNNDHHFNGGNNGGNGNTRDPHTPGFQTNFIDSAFNYLNLQS
FT                   GIDMNEDIHSLFHMMN"
FT   CDS_pept        complement(358083..359462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582804"
FT                   /orf_name="CD36_16720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43451.1"
FT                   /db_xref="HOGENOM:HBG447630"
FT                   /db_xref="UniParc:UPI000192CD20"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN1"
FT                   /transl_table=12
FT                   /translation="MTSNNDDGDNNLEELNLSVEIINEYDNGSQEQLDVLEAYQTNNDE
FT                   EEARDNKLDNQEINGEEKQVDTIKNNIEDGDNKLNSQDIKDEKDDDDDDDDDDDDDFDD
FT                   FNEASFQQASTTGSTNKEVSEANNNNNNEDDENEDDDEFGDFDDFQVSQQSSPPQLQQQ
FT                   QQQQSQSSSINQISFPTSIFNSPKEFSQQLTNILDEIFPTTIIKNDTSSSPILKDNTIS
FT                   SKQLLNERSQEIYQQLSTLPYLQPTNWIKSNIRHNLLIKLGIPINLDELNESTTTTKNN
FT                   FQNEFKVPNNNTSIGVGVGVSNSGFSFGFGSRRKSSISIDDINWKQLEIDLDLKIPKFE
FT                   SLNIDNNLKNSLIDSTLNKLNQFELDNLYHNNHNNTNSNSNNSQWIDEKLLKLTSNYNE
FT                   LLILSSIWINQIDLLHEEFEIYENVIQSFIGYNQKLHREEIFENLKKLKKKNKKKKIGK
FT                   K"
FT   CDS_pept        359812..360540
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582805"
FT                   /orf_name="CD36_16730"
FT                   /product="Peptidyl-tRNA hydrolase, putative "
FT                   /EC_number="3.1.1.29"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAX43452.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG396100"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="UniParc:UPI000192CD21"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN2"
FT                   /transl_table=12
FT                   /translation="MSYSHPPIIFFSIGNPGPITRHSVGHFMLKRLMEFSNSSIKQLHN
FT                   YSLYSLSIDSLNNIIYIKSNTYMNESSKAWNKFKSSKEYKSFLKQQVVTVIVLYDDFEN
FT                   NLGTIKLKQFKKNKSNKNNNESHNGLKDLKFAMIDNNFNDETIYLLGIGIGPKPSSNPN
FT                   GEIMKQWILSPFNKQSEKIKLELESFKLLQLYIDSMIQQISNDNDNDNDNNGMIKDINK
FT                   FNAKMTKLWKRKQELEISQT"
FT   CDS_pept        complement(361218..363704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537655"
FT                   /orf_name="CD36_16740"
FT                   /product="Lipid acyl hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX43453.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396101"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI000192CD22"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN3"
FT                   /transl_table=12
FT                   /translation="MTERIPLFEEDKDYIDEDHISEFAKALVWQDDYDYDANTPTPIND
FT                   EVPAIMSSMNSINDNNNNNNNNMNGGGGGGGDDDDDSSSITDDDIMNSSYFDKQQQQQQ
FT                   QQSDMKSNDSLISRPQTGTTANTSTISLSFSSKRPDLISSKSDWFPIGTSSPKKGTTKN
FT                   SHHHHHHNNKQKRSTTTKSTIEILKNEFRNSSTYTLLRWPILIFVFSWISILGIIYFMI
FT                   RIYVALSEYLITWRGERKKLRDKLRKSKTYKEWIKNALLLDKFLKLDKWSEIPKFSYYD
FT                   YKTIKLTIIKLQKLRYEKNLIELMVILQGCLKKNFAGIENRQLYSHRYYGTKNLVEEYY
FT                   QEVIKCLELIINDNNDKIDIERKWKFFKIVSKNYGKSALCLSGGACFAYTHFGIAKALL
FT                   DENLLPQIISGTSGGGLIAALLCTRTNEELKQLLIPQLARKITACEDPWYIWIPRFLKT
FT                   GARFDAIDWARKANFFTHGSTTFEEAFQRTGRKLNISTIPADPHSPVILCNDITSPHCI
FT                   IWSTLLASSAVPGILNPVVLMMKNPINEQVIPFSLGSKWRDGSLRTDIPIEALNTYYNV
FT                   NFTIVSQVNPHISLFFFAPKGTVGRPVTSSTKKTRSKQQYSSFRGGFIATALEQLLRLE
FT                   IKKWLQIIKSLDLLPHLLQQDWSNIWLQNFTGTITIWPKNKLSDFWYILSDPTELRMKE
FT                   IIEKGEKCMFPRLLFIKHRASIENVIERGKKLTLTKLKQTKNQQSGYNDDDDDDDDDND
FT                   DEGGISDYDAQSFQKVVGWSNEDKKLLDELDNDNEDEDEDEEEDEEEEDYDDDDSLSDS
FT                   FEITTEHLKQRRNTIF"
FT   CDS_pept        complement(364592..365653)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232058"
FT                   /orf_name="CD36_16750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43454.1"
FT                   /db_xref="HOGENOM:HBG396102"
FT                   /db_xref="UniParc:UPI000192CD23"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN4"
FT                   /transl_table=12
FT                   /translation="MYKSLSSTTSTTKLKHQPSKLDLIDDTTLTSLPLPPPPPLRRHLS
FT                   RSQSQSRSRSRSLTSSSQGSKLSQSNSINNSMRINSNNSNNNCQLKNLDANYSYEEIGV
FT                   DDIDDICYNDEEVGNYNKDKDYDYDYDYDCEYEYEYTFDEDSQDPIVLIEDYFQPQNIK
FT                   FSNNNRTTTTNTTITTNNNTLLDQQKLLRQQSLANFKQSLLLIHNYHNPLNSTNHTNTT
FT                   YNNESDLILKINRKEDLQAIFGEIPGSKLLKYCEFCEKPLYEISSIINNNNNNNNNNQS
FT                   SQQQYHYEFICGDCIETYDHYYNSEFANIAIGSDCGYGYGYGYGKDGDKDKDNRNKLWK
FT                   IFHSISYKYKIIE"
FT   CDS_pept        complement(368877..370994)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537656"
FT                   /orf_name="CD36_16760"
FT                   /product="Negative regulator of exit from mitosis, putative"
FT                   /protein_id="CAX43455.1"
FT                   /db_xref="HOGENOM:HBG448619"
FT                   /db_xref="UniParc:UPI000192CD24"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN5"
FT                   /transl_table=12
FT                   /translation="MNFHSTKPLSYDSSDNQIYNPFLVSNTNGEERKSPIIDKQQQAQL
FT                   QQLQQPVLKRAKSIVSSKSLSAFFTNPKSKHHHHHQNRDNNNNGRNRNRNRTRKRTRPR
FT                   PSRLRRTQSICSNDSNNSNNGQLIIHTGEFKLPDQDEFHFTMNNSDNSFSSSFLSSSSS
FT                   PSSSSSDLESVPDLTDDNIDELTPETTPIKPVGNFYFNTLFDNEENIGDGYKLNSQIKI
FT                   QNELQQQQQQEKLTSPSIFEIPEIVYKIISYVDEQNTILPQESTPIRRNPLSYNHALLI
FT                   HGDKKSAQTALQQTNKQINQQTSRKLISSPLYNCLLVNKLFYKITSEIISSKFYCHNEI
FT                   QLKKFIENKSQQQQQQQQQNSNQCLIQPKTFILHKLFQTKQIVFDQLIEFINFNQLSWF
FT                   ELYMCPKICLNKSNNNIFKKIFQSCTNNLTKLIITGSKTIDDEFLMKFCQYKCGENLQI
FT                   LDLRACELITDFGIYQLSLNCRNLTFINLGRKANNTGGSGGSGSGSGRFITDNSIIKLI
FT                   NNNRKLMTIGLAGCHITDKVVWEIANKLPKISRLSLNNCPKLTNSGINQIFTLINSNSN
FT                   SNSNSYSINTNNSNNNNNNNNCFFKYLSVLELRFNYQLIDLSSIIQFKRRQKFQFNIIL
FT                   LLELCESLMLKYRQQEFELDKLISLKIFQDISHWVNDYNDNDGDLSYNEIKQLINNNNN
FT                   NNNSRIISNNS"
FT   CDS_pept        complement(373794..376541)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384911"
FT                   /orf_name="CD36_16770"
FT                   /product="Arrestin, putative"
FT                   /protein_id="CAX43456.1"
FT                   /db_xref="HOGENOM:HBG396106"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI000192CD25"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN6"
FT                   /transl_table=12
FT                   /translation="MVKKSQHNTSKSTSLFEIRLKNLDHDVLVLKGNPQDAASALLSGT
FT                   IVISVIEPISIKKISLRLFSTLKLDAEVNTNSGGGNSSRTINFSKKTYEYIWNSQEFSN
FT                   YLNNNNPSNSRLSSGTNSPNNRSSTSLTSSSYNNNGSGGGGGNNHHGTFSKLTRNHSST
FT                   SLLGLRSKSSLSLSGLTGGSSTNLASAFTSNNNNKLNHSLSSTQLHNTTTNTSSSGGSH
FT                   LLVQGNYEIPFSVILPGNLPESIEGLPGCSNVYRLEAIIDRGKFHSSMIAKKRLRIIRT
FT                   LTSDAVELSETIAVDNTWPNKVEYSLSCPTKAIAIGSSTPITMTLVPLLKGLKLGDIKI
FT                   ELIEMYSFVGSYPPMKTDERIIAKKKIPKKRNHNNNNDDDDDAEEEEEDEVDMLDQWQI
FT                   DTIINIPSSLSKCTQDVDLSTNVRVRHKLKFNIGLINPDGHTSELRATLPIQLFISPFV
FT                   TVRGNNNSGGGADDDDDRTGDDILFTSDSYDALSTLNNNQNIDNSGGGGGDNTIGSNNS
FT                   SMTNLTGLLAPPMYERHIYDRLWSDVSPIATPLTSGPATPRSGIILGGNGNSSERFGNE
FT                   YGMSSLDSQALTENLRQLSLQRQKQEQVQQSDTTTNDGHGRATFNLMDNDDNNSIHNGT
FT                   TTGGDYFTNTTSRRPNLPRSNQSFLQDHVAMSPPTHISRVNSDINLNNTIPISSHMSPL
FT                   ELSQVPSYAEAMNSDPSIITNEELFSPAYEPPLPGSHINLQELNKNLTNLQQNSTTTNK
FT                   IGRHNSFKNSSSFKSQRSSSSTSRNSSQNSSPINSRNVSSNNLSSLLGHHHHNHNHHHH
FT                   HQHAGAITSPSSTTNLQRLTPANIARSSSTNQTLNIPSTTRTSSDDGTKFSLSTSPNNS
FT                   IIAHQSVGKLSNSAADRTNGGATPIRTSSSLSLHNLHFLSKKKK"
FT   CDS_pept        complement(378378..380162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582806"
FT                   /orf_name="CD36_16780"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43457.1"
FT                   /db_xref="HOGENOM:HBG626550"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI000192CD26"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN7"
FT                   /transl_table=12
FT                   /translation="MSFKAGYHTISFLFILVSFVFLLFATISYPVVDIFALSKTSDNKY
FT                   GIFGVCSTSNSNDCTVGYPLDFAGSMKDNSSGYLFINDTRTTLAKIFVLAPIALGFDLI
FT                   LLIVIFAIHFGSRITVLVGIFLNVISTIASIIACVVIILCFYPHVTWVPWTLVAAAAIT
FT                   FISLILLIISLTVVGNDDDDDDAKSNFDNEDFGRFTNYNRIDDKFNHIQTATFKTSNSL
FT                   DNDYEYKPHNNNSTNVNNTNFAGGAMNKFPNNNGTVNNSRGAVNGGSTTGSGVGSGTVI
FT                   SGMNPPGHKNGSLTSNSSSYYNNPQTATDFTQRNKPNAYQPSSLGAGSNNGNTASSLPY
FT                   PPGTPIVNNNNNSRNNYQPGVFDHHLGVEGHKPFTELDDDFDDEEEDLANNRREIVNTN
FT                   DSDNDSDFTSVSQRPPNPQYYGSNSGNGTVGGGGYLPSSVVNQYSNVQQYQPLHQQGMP
FT                   PGPPPPQQHRPTGQYSPSTNMGYNNMPLRSGGGVPPPVAGSYFPNQGPVPPPAPPSQQQ
FT                   QVRGPTISDNVLNNNPDFQFSRGGQQQKRRVNPGFVPVAARYNNNQTGPGSKNQNASAL
FT                   MGRRENTGPRNGPYGITR"
FT   CDS_pept        complement(381691..389556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582807"
FT                   /gene_name="FAB1"
FT                   /orf_name="CD36_16790"
FT                   /product="Phosphatidylinositol 3,5-kinase, putative "
FT                   /EC_number="2.7.1.150"
FT                   /function="1-phosphatidylinositol-3-phosphate 5-kinase
FT                   activity"
FT                   /function="ATP binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular protein metabolic process "
FT                   /protein_id="CAX43458.1"
FT                   /db_xref="GO:0000285"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0044267"
FT                   /db_xref="HOGENOM:HBG396107"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI000192D3A3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN8"
FT                   /transl_table=12
FT                   /translation="MSGSPPDTFKEMSNSKYKLPLLERIPSHTNNSDDEDSNVKGVVDY
FT                   VSFPTIPDPEVENSKSIAGLLTKTLRKVTTNASTLVQNYSQNYTSPKPNVLDTSPFTNR
FT                   VNELKATGIGGDVLSVPKNDEIVDTPISMEAPPMKADTRLRVKEDTSKRLSRTSSPLDI
FT                   KGETQGNKLEIVNSIIKSETNRNTPIDKVSIVTNETSTGSILKPSQPKQPPVSSTPALS
FT                   LRQNLIDEAHPPRVTSDNKTLRISTMQFPRMQSMANSTTSSVVNVTASASVDIDNVTSD
FT                   KSNLETKAIHKKESSIDLKSKDKGLQNKISSIFNNLPNDIELSDDSADESDSTQNEGSE
FT                   NSATPQSDIAYIENRSDSNLSSISKMNNHLQFELGARYGESVAKSAPIKAETKHSAIFT
FT                   PSFGQSPTVSTFHAIQNKDVSASKQRSSNTPSTLLDNARSIIHQNIEAVASSASSIIAS
FT                   KRRKKKKPTKTSENPLKNGGIPRKYWMNDAFVSDCLNCFRPFTAFRRKHHCRFCGQIFC
FT                   SDCTLFISYNQHKDERNNTRNSAKKPYNDKLRVCKPCYSDVIIYLSDDSSSANDSEGEK
FT                   DISAEEIELPKTKAENLLVPNHPLSRIRSMSMGSNNRESSRTDSLSRKPSLKESNNPES
FT                   SFSTSHSSSPSRSNNNQFIYPDESIKVHPRQAPRMAIPTTRTGEAVEIPLMRHSLMNSS
FT                   ILKTSGPPYNTNMSSLPQTFHQSNSQFYHNHHQQQQQPEHQQYGQKQNSLQQQQQQQQQ
FT                   QGGQFHNHYHNLYSQSNAQYNNSAGISESENANKTWIKNHLSPTLTNANLTSRSLDNLG
FT                   SVYNGFMNRTPSFNMRVLSGSSRDPSRFRRELSLEPGDIQSIRGKYGKEMTIGHQNGFD
FT                   DDDDDDDDDDDDDEDDENAKDEGVDLSDNEEDEHAMSIYTSLNETHGYGSTPLAHQPPP
FT                   MHSQSAVTVPTLGEFPIMKTGYPSFRGAMNRSAAANLANVFHNHSMGLNDEGSSKHQPE
FT                   NIRSRARAHASLQRMRSRRQAKATRNVSILSQSNLRLPSLEPSNHRPQYASSLTPIVSP
FT                   ASPGVNSSNLTTGIVASDEVSSSSANIDPEMSPIGPQISTSTHLERYHSGERNDYFGSD
FT                   DHLIGTNESRDLVSWKDGKTADNKDELYDETLDFVLRQSLKDGDIETDIERWVAVLRKS
FT                   LGYIDDIKLTDTLDIRQYVKIKKILGGKIEQTELVDGLFMTKNIDSKKMASRITNPRIA
FT                   LLMFPIEYLKQKEQFISLRIIHAQQSVYITNLVSRLVSMEPDIIVVGDSVSGLAEKLFE
FT                   DAGITVISNVKPQVIERISRYTKADIFQSVNDLFFKKGKLGLCENFAVKRYKYQNQIKT
FT                   FVFFTGCDIHSGFTISIRGGNTNVLNNVKYAAETLMPGYINARFEKSFLDNLSLSYVKP
FT                   IENPKIVDIQQKLQKIGDHATENDENGKLQDLKLDPAEVINYVKSFSERKLSLSPPVEY
FT                   SLPNPLVRTICTYYTVHQFAQQNTEIQKLSSIDEIKEEWLDELKIDYKLEELPGRESNL
FT                   ISILKFASDAHLKLLINDYLARSRIWSNCMKYPSYQLYPICHRNIHLLHSTVSIKHATP
FT                   CAGPAIIVIDYYTDNDKCFGLFLDQAFHESSKVCGECGETYLDHYKSYVHGKAKVDLII
FT                   EKYDIQCLNNGEMQGKNQRVMWSYCKECNYETPIIAMSDETYYLSIGKFFELNFYGESV
FT                   FGGCKHDFFKSYVKCFGFNNLVIRLEYSTIDNYEIVVPKKQLEFITNIDMKLKIDAYKF
FT                   IRAKADVFFDSVFKRLKRVKLDTFEKAEDGIQKIEELKIKLQEQSDSIYGRLQSIYDKI
FT                   IPTNYLALNVVLRDLQKLGVYWDNEFNDFEKTYLPSENEVNKITQFHLRKFLMDRYTDD
FT                   DDDNNKKVVDVTGNEPSNDSKETGTLDDGKLLSSKDCTDETTPDNSQNSIKADDDSNDI
FT                   RDKSTNELSKPFPEFVPKKPRELPLNRNLSDSNIETKMFPQSTLYESGSNISERINKWN
FT                   QTAETADKTTPIKLTHRESDSSLRSINTVIPSQNKVIHLANFFDKMYYDQISLEFSKQR
FT                   ERELKRKSKVKAQPIFDSKPIVEIYNKIEDVVGPGADDEKKKDIVVKKDEQDKGQVKES
FT                   QQESSQQQQQSSQSQSQSQEQLDIPEKQSLLKSLTNFWADRAATLWDPLNYPLESHEHT
FT                   FADSEVIVREDEPSSLVAFCLSSNDYKQKINNAFEKNRMGDSGNLYLNLKENKVYDDKG
FT                   QQNTTIESEVAKSGITTESASIITNVGDNAKLEESSSNHTSNNNKYGESLVASDNKKGA
FT                   QFAKIEKKFKKKLNKEGGIGGGGTGGGGTGANDNVNPLESILTRNKSNHLKYQFIDGNT
FT                   NLSCKIFYSEQFEALRKACGNNDNFIQSLSRCVKWQSSGGKSGSSFLKTLDNRYILKEL
FT                   SKSELESFVSIAPFYFKYISQSMFNTLTTAIAKIFGFYQVQIKNTTTGKIFRMDFLIME
FT                   NLFYNHKTTRIFDLKGSMRNRHVQQTGKENEVLLDENMIEYIYESPVFVGQQSKKLLRG
FT                   CLFNDTSFLSAMDVMDYSLVIGIDDSSKKLYLGIIDWLRTFTWDKKVENWVKGNNLIGG
FT                   NKRGKDPTIVTPKQYRIRFREAMERYILEAPDIWYEGSK"
FT   CDS_pept        390612..391634
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537657"
FT                   /orf_name="CD36_16800"
FT                   /product="Vacuolar sorting-associated protein, putative "
FT                   /protein_id="CAX43459.1"
FT                   /db_xref="HOGENOM:HBG329330"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniParc:UPI000192D3A4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAN9"
FT                   /transl_table=12
FT                   /translation="MSTTGLQRRRGAKQSTPKPRSSTSFDEERSPVSPNKPDHKIGYDD
FT                   KDIKDPSTLKQPLLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILLELTFRNKITL
FT                   VNDPARRRFELSDRLVEVIDAEPTGEVLLDEALKIMKNDESNLSVTNWIDLLSGETWNL
FT                   MKINYQLKQVRERLAKGLVDKGILRTERKNFFLFDMATHPVADKLSKEYIKNRILSMLV
FT                   SRNVDLDSVSNDQFPADTSFKYLRTVSLVCGAYAANVLENVLLSLNYEKRDQAFARADE
FT                   LLADFSEFPFNLSHQSPLGLGLNLGQEVGDEIEKSSATELQLELIAAVLSVFARMDSIL
FT                   "
FT   CDS_pept        complement(391848..393014)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582808"
FT                   /gene_name="CHT4"
FT                   /orf_name="CD36_16810"
FT                   /product="Chitinase, putative"
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAX43460.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG741095"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192D3A5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP0"
FT                   /transl_table=12
FT                   /translation="MCHKIMNKFQQRLHHAPSTPLFKTCVYFSNWSVYQKKHFPQDIPI
FT                   EYYTHVFYAFILIDEQTGKLKFSDEWCDLQMPQPPPNQSITGNLQQFYEMKKANRHLKL
FT                   IMSIGGWGTCHLFESVVCSNTKFDNFVNSTIEFVDKYGFDGVDIDWEYPKDSTQAAKLV
FT                   ELLARLRNKLNPKYILTVAAPGGTDNIDVLKIPEMDKYLTFWNLMCYDFAGEGWSSKTA
FT                   FHSNLFGNNGDNSLNASDIVQTYIKRGVHPSKLILGMPMYGRVFHGVDRPEIGVSFTKE
FT                   RKSGCIEGDVVDYNKFGETFDYEDFDPRKVGALKYDSRNKQLITFDNPQSARIKASFVR
FT                   SKQLGGGMWWDSAGDATVSNDRCLVKNFVDQLGGVELLEKSENNLHGC"
FT   CDS_pept        393359..395725
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162311" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232059"
FT                   /orf_name="CD36_16820"
FT                   /product="Putative uncharacterized protein "
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAX43461.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG746888"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016652"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000192D3A6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP1"
FT                   /transl_table=12
FT                   /translation="MTLELPSDIPSTIPANTKIYKDDCMYSFDTPENNLLGLDIDLKTY
FT                   RAYSRNKDFDYTKQNFEKTGNHLYLNIKKTLKPQEERNKLLYDDNGEKSPKIQKLEIKN
FT                   VSNDDYYNTEITIYDIKDDRSYSRSELSEEFNNLIDSILSANSSATEDEIKQWEQEIVP
FT                   CPHSIDVEQFDTGNLDLTKCSQCDLRENLWICLHCGALGCGRQQYGSTLKGNGHALAHY
FT                   ELAQHPVAIKLGSLSADSESCDAYCYQCNDEVKVPHLGEKLHKFGIDLNTAVKTEKSLI
FT                   ELNIDQNLNWEFKLDGANGERLEPVYGKGLTGLQNLGNSCYINSVLQALYSLNGYQEYF
FT                   KDKKFPDINNPAIDLTSQLIKLYDGLQSGRYSVPGSLKGDDYQLGIKPSTFKNLIGENH
FT                   PEFKTQRQQDAFEFLLYFLDKVDTELGLKLNEELKFLLGTKVICANCSHGTLSNDLVDN
FT                   ISVPLEAEVIGKDEDGKKTYKEVELIDSFKKYTAKEDIEGYKCENCHQQPGLAYKSTGF
FT                   KTFPSTLIVNVQRIQLENWAPVKVDVPITIPYNLDLTEFKAPVFETGEVGSKQKQPESE
FT                   NNTFVPNEEGMTTLLSMGFPEPRCLKGLYHTGNSNAEDAMNWIFAHMDDADIDDPFNPN
FT                   DSHASTNDSGPSQDLVDNVAAMGFSTQLAKKALVLNNNDISAAVEWLFANPDDDGVLDN
FT                   NQSNPVVNVNQEKSELITKLNASTQSNGKYELQSVICHKGTSPHTGHYVVFIKKLIDNE
FT                   YKWVLFNDEKVVVCDDANLQDIKNNAYVYVFKKVE"
FT   CDS_pept        396409..397518
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582809"
FT                   /gene_name="CaARO3"
FT                   /orf_name="CD36_16830"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="CAX43462.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D3A7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP2"
FT                   /transl_table=12
FT                   /translation="MIKTKVLTRTIFYFLLVRGYDPLTPPDLLQHEYPLTPESQKIIVE
FT                   GRNAACDILNGKDDRLIIVIGPCSIHDPQAALDYCEKLYQASEKHKGELLIVMRAYLEK
FT                   PRTTVGWKGLINDPDIDGTFHINKGLRIARKLFVQLTSKLPIAGEMLDTISPQFLSDLF
FT                   SVGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLGVAIDALRAASHPHHFLSVTKPG
FT                   VVAIVGTDGNQDCFVILRGGKKGTNYDAKSVQETQQELIKSKVVTESKPGPRIMVDCSH
FT                   GNSNKDHRNQPKVAQVVAEQIAGGDKTICGLMIESNINDGRQDVPPKEQGGKDALKYGV
FT                   SITDACIGWETTEEVLDMLANAVKTRRSL"
FT   CDS_pept        398003..401323
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582810"
FT                   /orf_name="CD36_16840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43463.1"
FT                   /db_xref="HOGENOM:HBG396108"
FT                   /db_xref="UniParc:UPI000192D3A8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP3"
FT                   /transl_table=12
FT                   /translation="MRSFIKSHRKTDSTVSSTLESQLLESNNVTSNHSHSNSATLISTS
FT                   DDYYPPTSYSNRSSTTPAPSPKIQQHLQFTPPQAGHSNSSSISSPKKLLTPIKNLFASS
FT                   SHSKSTVTTPSSSENLSNCINGVSPKDSKVKFLKHKKSKSHISISTDLTKLPEEPLNSL
FT                   YDNKTYTKLTSFEHTKPKPSKHLSSTIETSIQKPQLNEKRPNSTALVDNKRSSYQKGEH
FT                   FSDSNQSKSLLDPSTTSSGLGPPISLSQTSSYASSNTSIAESESKFNTKNVLLDAIPLS
FT                   ENDKSTKKRAHSERMVDFEFPSKDTYYTQNKEEQQQRYYDEDEDDEDNGDDDDDDDDNS
FT                   SQFSFVHDMKGGRNTSVKYYKTKNSKNTNSDEGLSNTFNELDLGYEVDEFSDYDYENNG
FT                   GDLDDGYDDFGGFEEDDNENYNKYFGSDLEGTNDDGEGIFQPNSINNHSPKEKLNAPDL
FT                   GKEIAQEFIQTPKELGQSFFPIDDDRPRTRNKFNQSFHLSIIGPKTQSPKASPTKSGFE
FT                   EDILENYLDKSDRSSSGSNSNLSDQNDFDTCNFELFALNSPIINGLTIGNNLHHRGGRH
FT                   KDFINTNRLIIHRKPVDFYDDNSNVSGFYLDNNERSTIYLHAFHGSIDDGFNKTIDEKV
FT                   KQFEEFTEKSINKIQHIKVNIGLGITTASETDHEKFKSTYAGSISTTGSATSKLTAPVS
FT                   DIASSSTGNSTIHTNTASKLNTAENAPLRQSVNDMMAFLGNLESKQETAEDGNLSEKAG
FT                   NDQRNSIIDMMGILGKLEDDINKQTGSTEKSKSEVRNSIVGMMDLLANLESKELDTRGG
FT                   KTEDKKKQGSNKLRNSVAGMMDLLANLETTTTSDKPKQDNRQSVVEMMSTLSALQEPLA
FT                   IETTNLNKQNNAPKSLEHEPKRKASFKRYSWFNSQESLSIKEKSSVKECDPTDDNDKYN
FT                   TSLDQDILDEINQIPDDFDFDQKPPETEKYKRLSQERSGFYRSNSYNRKPKKSVISNQY
FT                   LSNKIETLNKTVTFYNSSSPSSSLFDSRSRSVSRGPSTRSMNSFASVSEEVNEEDEIQD
FT                   DNGAGEYYGELNKEVNCDSNYRFQVTPSSYNSTDLRTIREIRNNRNSINRKTTTDSYR"
FT   CDS_pept        complement(401470..404934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080717"
FT                   /orf_name="CD36_16850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43464.1"
FT                   /db_xref="HOGENOM:HBG396109"
FT                   /db_xref="UniParc:UPI000192D44E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP4"
FT                   /transl_table=12
FT                   /translation="MSTQIAQGKSKDDLSIPTTNLTSIPLDSDRRTRSTSPVKNRYSLP
FT                   ATVSDYRLPTIPKIDDDIKSIISSSSSSNQERLRQAAKLPMAKKLHIIASNSNSPNNGG
FT                   KYTIPIPFTLKLPPKLSSVNTTRETSTPSSVVSSPHGSRAGSPTRSTESSRSNSPSKPK
FT                   QTKLVFTRNGYEKLDSSSDSDCEDVENSLLNMSLQYQEDLNKRIALSKRAVPPPSVSTN
FT                   NSKFASKAFLSRNTDELSIIEEVSNCGSRHSSVLSKLNSAKAESDAQTQKVQQQKPVVT
FT                   PIKVPEAKQIQTLISPFNNPKNKDHKSNQQEKSLPNLPTKDTTTPKQETVTFNKKKTPG
FT                   PIRVTAPKLKTHQYNKSLPDIPIHRSTTSGPNKSQVPKSQRETNLNRLTYASDPNKVLK
FT                   VHKRSFSDESHVSSVSSFSSVGDFMHIARLETMSPPAEKLRFFNMNHGNNQKQLKIQPI
FT                   NIDSKSKNEKSEKSKKLEKNDTRTLLIPPQNIRNVSSSSTSSFQSQGTSSSWDSLQKSI
FT                   DITLGSRPEEETINKKSIKPTPKSTKILGDNNVSDDGSWSDTSESASDDDEEEEDNNNS
FT                   NQTIEDYEHTKPLNIHKEVSNDQKDLNFIDVNNRGLDRDFYFPNTFENSTNSQEVKDRV
FT                   PQEVNRKARHSFYSSNGQIEIPDLSDKRFPDEYSSIAPSSYNGTTFSEIRTEISVSDVD
FT                   DESNTNLKVGVPGKDAIKHLKQQYSALGDDSDADYASNITSLYGGGGVLDKDHLKLAPI
FT                   QPQLECNLLLPGRSSPAKHTRHKSMFNINFGLGESNNNSAHTRNKSVDILSEMTTFGKQ
FT                   QLGVNSGNHLSRDYSDKSNESKSKMIIEQPVAPLVITRKPSSGNNQSDNNVSNNKQQEQ
FT                   NQEQEEILNIKVAEPPKKVDYAVDFKESNSQDDDFGTQFVTPRIGSRSIDTENGPNVGA
FT                   ITKSLKPKTRSIASNEDDSDTETESVVIDLTKDKYDIVHVIGRKDSTRSYKSTTETING
FT                   KDVEVVIVEDEDEENESDENYDELMSIYSKYRNNSWLFRNNSAASSTASFSSNSSSAVT
FT                   QKQRVIPPSIQTPKHPRDLNIKRTSGSVASSSMASYKSKRISPPAKTPSLTNNNSKITN
FT                   DKVQRKESQSRRKSMPALESHYFDYASNDQYDFNTFMQQRRTSEKEM"
FT   CDS_pept        complement(406156..407814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582811"
FT                   /orf_name="CD36_16860"
FT                   /product="Oxidoreductase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43465.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326751"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000192D44F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP5"
FT                   /transl_table=12
FT                   /translation="MSTITLTRESHKNPAKFRINHQDELDILGPHRKDRYAINDKLPTI
FT                   TTTSKLAIIGAGFGGMAGAIKTMEKYDEHDIQIFERHDNFGGTWYANTYPGCASDIPAL
FT                   WYSFSFALTSNWSRIQPPQYEMEEYLLRVADKFKLKEKTRFQTEINKVEWDDVNGQWTL
FT                   FAHDVKTGQRIIHKSKLLLACHGGLVHPLHFDAKGLDNFKGDYMHSALWDHSVDFRGKK
FT                   VVVVGNGCSANQAVPALLNDPQYSVGSLTQISRSKHYIMRPLPKVIYTLYRLFSFNYFT
FT                   MYFFRLMFIFFSELKVPLFKGGGVVSNFVRKVTTEASVQYIKEVAPEKYHDKLIPDYKI
FT                   GCKRLIFDYNYVPSLKDPRIDIKTEGVAKVVEDGVVLESGEHIEADIIVACTGYNLSKS
FT                   HFNFEIVGRNGADITQLWKEEGASAYRTLLIKHCPNLWTIGGTNSITGHASVVMGIENG
FT                   VDYFLKTAKPVFQGKAKSVQIKDEAYDNWLTTLQKEINKSVFGTPFGGCVSWYSGAKVN
FT                   SVSYPWSQLHYWWKTQFPTYSDLKYEPLTENKKRR"
FT   CDS_pept        409180..410682
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582812"
FT                   /orf_name="CD36_16870"
FT                   /product="Sporulation-regulated protein, putative "
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /protein_id="CAX43466.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG396110"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="UniParc:UPI000192D450"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP6"
FT                   /transl_table=12
FT                   /translation="MKSKVKESSASPTTANGISTQNSPCLNTFVVSTPETPHKFSNPID
FT                   IISKKSSIKSFGSVKFINTSEITSPLLNTDDKYVNRQSDHCTSEFEDSKKAGLSCLPYQ
FT                   CEKSSNLMGGKFSLMVAGARGTGKSSFVNCLFGSELLVDSYDTTNEEFLDVKNFELTEN
FT                   GFTLNLQVIETVNYGNSFDTGFKPESLCAFVDEKFKAFLYQSKQPRREGLIDLRVHCCV
FT                   YFLFQTVNPISDLDIQTMKSLSTRTNLIPVVAKADTLTETELHNFEIMVRTTLAKHDIE
FT                   TCQFFSNKELLQEIRLKIPFSIISSSFSPSLDNNNGIIERIRKYPWCLLDIENESYCDF
FT                   HYIRKLLLEENMLEFVASTEVYYEQFRSIFLSGDSIAVSADYYKNYDSNQSKNLKDKLD
FT                   RKNSNMKENFNYYQDQHDKLKAKKLYLIQQQKKLQNEIHSLANERTELQVFVNNYETSS
FT                   FESQDSQNAITGNGYNLFYQQNTLVNSLSVEMSSSSDTVISQ"
FT   ncRNA           411125..411228
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snosnR48"
FT                   /db_xref="Rfam:RF00471"
FT   CDS_pept        411786..412976
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248141" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582813"
FT                   /orf_name="CD36_16880"
FT                   /product="Nonsense-mediated decay protein, putative "
FT                   /protein_id="CAX43467.1"
FT                   /db_xref="HOGENOM:HBG396112"
FT                   /db_xref="UniParc:UPI000192D451"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP7"
FT                   /transl_table=12
FT                   /translation="MSLELSSDESEDNFRDELVDIPSRFSKESITIDTRQVRLILDHTA
FT                   FVRGIGNIKRWFNEDYINSNITRSNEIINLNIYIPTYTLHEFDFAKKGTSISATNAREA
FT                   IRFIDNYLENEVEMNSDKIHYNLILESAEDNVPSWNKCNHYKVHSPRIREFPNYKTKFD
FT                   SSLIGQTANINDDPEFNENFDNALTFNQRNKLNDIQYENSASYQNAIANSDNLAEMPVR
FT                   LRYLIRSCIYKRFIEATKPKIKNEIEDWKLVTEDPITKIWAKSYGIDCLNVNEAELLIF
FT                   QNYDVNSFRLYNLYANDGDNFDPSTNILQNTIDTTLYSYSRVQDDHVNPNYRGKNHRGK
FT                   NNRGRRGTKRREKWSLTTDSVVSEERNEAGTGFIKKEKFGAINYAPRGQGELWRPG"
FT   CDS_pept        413838..418829
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232060"
FT                   /orf_name="CD36_16890"
FT                   /product="Transcription regulatory protein, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43468.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG720361"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014978"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI000192D452"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP8"
FT                   /transl_table=12
FT                   /translation="MNRQPTREDIQKAIQRCHQLKQQYGDQVNVVPEFVRLSKFLNTLR
FT                   MHQQRFQQQYQQQQQQQQQQQQQQQSLNHSQQSPLLQNTQGQTPQQPPTPQQFSNFNQN
FT                   GYNGQQFSSQAHSPAIGGSLSTSGNGTPLVQNANLMTGKKNARTPNTQFANQAAVGTPL
FT                   QQQQPLPQGNNSNPMLNSMGQQQPQSQQRQQNQPPSPQSAFTNQQFQLLKSQLQAFKYF
FT                   VRAPGQGQGQIPQNLIAYVSNPSSAMANDMYLPAVNRPQTNGMDRMMQMPQSIPSQSPQ
FT                   FTPQQQNDLSNSKPKSAGGTPEVPEKKKGKRGPKPKNPKKPTKKQLREEEQRLALEKQR
FT                   QELEQNRIKNSAPQAFPPQTGLQGQTPFPPQQQQAPPPPSASVSSIPPGGLAQQQQQQQ
FT                   PSRPVTKPATPQPLFPDPSPPVNIKSVVPDRANNNKVIIPVTKPNIEVDTFELFDIISD
FT                   EVKDIPFNTLYAPQSRFQIPSFLPDGISMEDIYVNREGYMQITIEQEKERLRKEIESLD
FT                   DKDTEKKIELETQLSSLDLIPYQKDLRGKVLIQSWFGKSLLPNSHPNFLARFSSLSLDS
FT                   VHMTTDLYRLQLESLMKEQNQKHSKTIEEIISFSDRSSIKAARRSDRLSRFMTKINNFH
FT                   NQTAKEEQKKLERMAKQRLQALKSNDEEAYLKLLDHTKDTRITHLLEQTNQFLDSLALA
FT                   VQSQQREAKDNLANSGRAIEPTPAEPLDDDKREKIDYYNVAHRIKEEVTKQPSILVGGT
FT                   LKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLVEVKKITGPFLVIVPL
FT                   STVTNWNLEFEKWAPSIKKITYKGTPNQRKVMQHDIRTGNFQLVLTTFEYIIKDKTLLG
FT                   RVKWVHMIIDEGHRMKNANSKLSETLTQNYHSDYRLILTGTPLQNNLPELWALLNFVLP
FT                   KIFNSVKSFDEWFNTPFANTGGQDKIELTEEETLLVIRRLHKVLRPFLLRRLKKDVEKD
FT                   LPNKVEKVVKCKLSALQSKLYQQMLRYNMLYAGDPSNGSVPVTIKNANNQIMQLKKICN
FT                   HPFVYEEVEHLINPTIDTNDQIWRVAGKFELLDKVLPKFKATGHKVLIFFQMTQIMNIM
FT                   EDFLRFRDMKYMRLDGGTKADDRTDLLKSFNAPDSDYFCFLLSTRAGGLGLNLQTADTV
FT                   IIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEEMILERAHKKLEIDGKVIQ
FT                   AGKFDNKSTAEEQEAMLRALIEKEEERRQKGGTEDEEEDLDDDELNQIIARNENELVVF
FT                   KKMDEERYLATKNASYPARLFTEEELPEIYKKDPEELLKKEDVASEEYGRGARERRTLQ
FT                   YDDNLTEEQWLRKIEGMVSDDDDDDDDDNVDRSDSEMEAKPKKPKGRRGRKPKIARVED
FT                   EESQTESDAISIKRQLPEDGDDFVPPKRQKSSTPAGSTTASSGRGRGRGRGRGRGRGRG
FT                   RGRGSLLSRYTPSVDPLTADERSTLQNQIENILGLIINYKNEHDRKLSELFLVKPPKRF
FT                   YPDYYVLIKHPIALDVIKKRTSSKSYSKIREFLEDIHLMFTNAKIYNEEGSIVYQDAAF
FT                   LERLSMDKFKELAANLPQEEINKILDFTEFDEMFSLKPLVPSTAIKQPIEAKLEKIDKG
FT                   EAIDSPLLNASTTAGTEESTPANFD"
FT   CDS_pept        complement(419030..419593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582814"
FT                   /orf_name="CD36_16900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43469.1"
FT                   /db_xref="HOGENOM:HBG396113"
FT                   /db_xref="UniParc:UPI000192D453"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAP9"
FT                   /transl_table=12
FT                   /translation="MSISGAVLKSDFLKIIQTQPNELPFEVSSDGLEVLKYRSNTSRQS
FT                   LEITSITSTTTTTTNPNDRKVSIQAQDGFIYLTTKRLVFITATQGDIQSFVIDLNLAPL
FT                   LQLSHKIKAPWIGSNYWEFMFHSSSQNNNIATNGLPKNQYFIGKIKFHDGGLFEFCDIL
FT                   NKTLNDAVNNRDIDDTLPAYNEVQ"
FT   CDS_pept        420105..421160
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232061"
FT                   /orf_name="CD36_16910"
FT                   /product="Mitochondrial replication protein, putative "
FT                   /function="rRNA (adenine-N6,N6-)-dimethyltransferase
FT                   activity"
FT                   /protein_id="CAX43470.1"
FT                   /db_xref="GO:0000179"
FT                   /db_xref="HOGENOM:HBG396114"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="UniParc:UPI000192D454"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ0"
FT                   /transl_table=12
FT                   /translation="MAIITRAKAFNPNLVGMFSHKIPYYYSRTHLCDPDACQSIIDKLD
FT                   LKNKYNSSKLDIVDINPGYGLFSTMLNYELKPKNHILIENKERCVTSLSSIIDKLIEKT
FT                   GNNGNFKLYNKDSFIWSTYTDLIENDKLIQPQIKSFDNFHDELLIIANWTGNKEESVIA
FT                   QWIKCCGHRNWLMKYGKVRMIIFAPSTSAMKFLGEPGFRKRKRTGLKRDLFTDSKLIGI
FT                   LNSEKIPGLGYDPRVLIRDQPVLLEKSSAHKGGDYSIIELSPGKYTTEKIENIDHILSA
FT                   IYLTNKKLIDILPTLAPGAMYMAKSLPKEILEKCPYEFTREDILKFSQVYEEWPFKPSI
FT                   ETQYSYDLSYS"
FT   CDS_pept        complement(421404..423098)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080718"
FT                   /orf_name="CD36_16920"
FT                   /product="Conserved hypothetical membrane protein "
FT                   /protein_id="CAX43471.1"
FT                   /db_xref="HOGENOM:HBG396115"
FT                   /db_xref="UniParc:UPI000192D455"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ1"
FT                   /transl_table=12
FT                   /translation="MRILSIDFPTSLFHSTTQGWNQTPPPHEIKNPTISIAHTLKNFLL
FT                   WLIFINLINQYISNFKLYFGEIDIVLLLSNSLLFEPSPPPPLPPPTIGNVSSLSMIDIN
FT                   KFIINQDLENILRGIYIRNEDIYLNNINQTTILCQPIININNDNSIQILFIEKFFNDNQ
FT                   GYFNYQNLIKVDSILLQKFSNTKIKTNSNSIKKSDLIEQFLRIVLTRLYPRYFDHHIMN
FT                   TNNNNNNNNNGDGDGDGDGDGDGDGDGEMIQSSLNIDKIVKKIRNSLIPIMIGKIGLLI
FT                   NSIILFLLYILLHCCPKILIWHYINLGSLYFINIINLGFILMILISKIQLKIYSTIKDF
FT                   GYILIIFEFLSILSIMILFFYDHKSIMKRQLFVAYSCSSSIYSDDNDKPNMPKNNNNNN
FT                   NNNNNDDDDDNGKEINGNNNLSNIVQPTPRPPLFPSSISPPLSYYNPEHQSAYSIKPKE
FT                   QQQQQQQGQGQGQGQDQLHRISSIRAQSLQEQYSTPVPVSTPIINEQITNLKNDIDRRC
FT                   ITAPVQVVKKLDSTKLQQQHQQYQQNHHHQHHHHHHHHPGYLPNLKL"
FT   CDS_pept        complement(423434..425854)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384912"
FT                   /orf_name="CD36_16930"
FT                   /product="mRNA 3'-end-processing protein, putative "
FT                   /function="binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43472.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG396116"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192D456"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ2"
FT                   /transl_table=12
FT                   /translation="MFIPQNKSKRLSLDKIGQLEDDLELNPLDYNKWQKLIDQLIIKDN
FT                   QEQVRKTFNKYLKIFKFDGNSWCKYIKYELNRDEKEKVENLFQQCLSITDNVELCRLYV
FT                   DYVRSVTDFITGGEKARSIVIQAFEFAINKVGIDITSESLWQDYIEFLQNWNPNANWEQ
FT                   QQKIDLIRKVYKKFLTIPTENIEMNWSKYTKWENELNPITASKFISEKSSEFMLARSWN
FT                   TEFNRITDKNLNRNLNPGDHNDENIIKQLKYWFKWLELEKQNKLELKDEIVNDKRIQYV
FT                   YKQATYALPFIPEIWFQYIKYLLNQNEEGNLQESIRLLKEGGLVLNPKSMLLTFQLAEL
FT                   YERDNSFNNAKIVFKNLIDGLQKDYNSVTNQIVELKQRIDPTTTTTTTTTTTTTNEENN
FT                   EEQDGDKNGKDQIQKLNVNVNHNTVDQNGTNEEEEVSIKLPQVYRISLADSKQLLTFEN
FT                   EQKRLSNAITLTYIKFMIASKRSQGIKEARNVFKQARKFINIGYEIFIESALLEHYSDK
FT                   KSTALKIFDLGKKNFPTNGKFLLNYLNYLIMINDIDIMRTIIQSSDTNFTKEISNLQEE
FT                   LKLINLDPITRKKIEKKIILLKKYLKKLYKKYILFTSKFLSLDITHSFTKKCEQLFPND
FT                   DPIDLFTDRYKLDNINIIKKNELSKYDGGFQNGKRIINDYNDYEEEKEEEDDYDDDDEE
FT                   DEDELQQRFKRRKLSYNNSNSNGGGGGGSSFSFNEEESKSAVKNIEESKSRIEQEDEII
FT                   NKSKESFVGPSIIALMTALPNASYFGLPSESVFNSEKLVTLFANLSNIPTTIE"
FT   mobile_element  complement(426346..426536)
FT                   /mobile_element_type="retrotransposon:solo LTR, phi E"
FT   CDS_pept        426787..427884
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232062"
FT                   /orf_name="CD36_16940"
FT                   /product="Sorting assembly machinery (SAM) complex subunit,
FT                   putative"
FT                   /biological_process="protein targeting to mitochondrion "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAX43473.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006626"
FT                   /db_xref="HOGENOM:HBG396117"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="UniParc:UPI000192D50B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ3"
FT                   /transl_table=12
FT                   /translation="MLQLHVWGKDYEISIISPSCIASAILLNQILTPQNIEFEIIPSNN
FT                   TNLSNINQLPILIDTITNKQYNGYNQIVEFIEWEYLLSNDCFKNLQEQEQKQKQKQEKL
FT                   INKGLINLLINKFEYINQYNLYLNNKNYENYTRKLFSNYLPFPMMYNQPSKYYDQAKEQ
FT                   VKILGLSSKQKVGFFDFVNTNGNNEPRSGSELELEVAQTELFNDELSDEEDIEGNIAIS
FT                   SLHERQLLKKSKSKQVLKESRNSMRCLILINQYIEKFKEIFHLQQQQQDQQNEDKEFGF
FT                   IFNNLKPSSSEILFYGYIFCLINENIPDRFIFNYLKLKHKYILKFVEKFINNNKINENK
FT                   FRNPIGKEIPNLINEIKYWIGTIDY"
FT   CDS_pept        428968..430392
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582815"
FT                   /orf_name="CD36_16950"
FT                   /product="Hypothetical vacuole protein, conserved "
FT                   /protein_id="CAX43474.1"
FT                   /db_xref="HOGENOM:HBG396118"
FT                   /db_xref="UniParc:UPI000192D50C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ4"
FT                   /transl_table=12
FT                   /translation="MKVSILTTSLLFILLTNGATILDDYFPKETPAPTPTLTTKSNPEL
FT                   HISPSINLFKRIREVIINKDYAKNQAAKTQSSSSTITPPPKWVRTLNDGKVEIVTPTII
FT                   EGVTFNAQPPTTTNGLEYWVSLKDDGSPKTIKPQMKNGQIKNGRPDYSTWFQTATTIVY
FT                   NKEQLKAHNMADDEIFEEIKYIPESDLQDHLLNPIIRCTPDRYKKKGIGKDKSTEPFCT
FT                   PKDDARLTKDKTYFITWYSRFFDENKVNKVRIHLSNIKESLKQKGLKKRQSQQNNNNKL
FT                   IELIDKRSKVLEMGGKVEDFSFFSSDWISNDQGYYPLFIDENWFGSEYWKKILISIQPD
FT                   NIPNDQFNFLENSIVVEIWKGVKVSKDHLIDLKKLEEKYSNRNMHDFEIDQGIDFEKYM
FT                   IMMALPTCVLIFGIGMWLFVTINKIDLSNIKKRKFARENTTHKKIPFKSKKKINKDYDY
FT                   DHLPQFNTELDELKHD"
FT   CDS_pept        431287..433221
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232063"
FT                   /orf_name="CD36_16960"
FT                   /product="Vacuolar membrane zinc transporter, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43475.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG396119"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000192D50D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ5"
FT                   /transl_table=12
FT                   /translation="MIELFENLSQSWLLILISSSLCILGTLIILIDDIYYFCLPKFITS
FT                   KFKIQIKQNYKFLNGSLAFSSGCLIFTSLYRLLPSANEYLSNNNNNNKHNSTIIEFKNQ
FT                   QQQQPEQQPEQQPDIVNHQWNQFILIFSYIIGILICLTFNYILHLLTSESVVHCNHGGD
FT                   VNTAPTTENLDINGDLENQIGHDYHHHHHHHEDTLINDGYNGLERTITGETNNNNNNNN
FT                   VTETTPLINNNKTKTKTKTKITKKRKSIIELILKHDDIEDGLGGECKGYSSAELCTFHN
FT                   NNNNINNHHHHHHHLISNKLNNNECDSNISNECCDNYSEEHEEDEDEESDDNNNCDHSI
FT                   HQIQQLHYCEIPTLSQELIEHNNNNNNVNVNTCLYPPILQESSKNDIDDSPNTINEYNG
FT                   GSNYNNNNNNNGNDDDIDIDIDIDPLYSIHSKSSHSLHSHTHSHSHSHSHSHSHSKSHE
FT                   SHKIDHHHHINSPFSRLLTISIQTTLAITLHKLPEGFITFITTETNPQLGLSIFISLLI
FT                   HNFTEGFSICLPLYYSMNNSIKFPKLKSILISSILGGLSQPLGAILGYLFLLHNNNNHN
FT                   HRNDGDVDIDIDKLNRIFGITMAITSGFLTVISLSMYGSSVSFGGNINFVMTWCIIGIS
FT                   VIGITSILT"
FT   CDS_pept        complement(433834..434637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384913"
FT                   /orf_name="CD36_16970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43476.1"
FT                   /db_xref="HOGENOM:HBG396120"
FT                   /db_xref="UniParc:UPI000192D50E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ6"
FT                   /transl_table=12
FT                   /translation="MLAQQQPQPAQQPAQQQMQQSRKPKNKKKQSYYEEQVRTLPSGAP
FT                   VDFGHGKKSSSKPKSKSKSKSNSSTTTTTTTTNTTTTSSSNFKLTASPSLPSGAKPNFQ
FT                   PYKSTSSPLSPPSSTIPESNITSTTSKPSNGGNNNNKNHHNRHQSNHNNYDDKHPQLTL
FT                   PNGKKPNFFNNNNNNNNNNNNNNNNNNNNNNNNTIPFDSSINLIRKQYNNPNTKAIKEK
FT                   KIDNNINTYYAGSSFHSSPNALNLPKPSFKLNNGSPKQSTGLKDF"
FT   CDS_pept        437204..438736
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582816"
FT                   /orf_name="CD36_16990"
FT                   /product="Zinc/cadmium resistance protein, putative "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43477.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG317426"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI000192D50F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ7"
FT                   /transl_table=12
FT                   /translation="MNSKEIRIVALLILDSVFFLLEAIIGYTVHSLALIADSFHMLNDI
FT                   ISLIIALWAVRVKNTKPADGKYTYGWQRAEILGALINAVFLLALCFTIIMDSIQRFFEP
FT                   QEISNPKLILIVGIAGLISNGVGLVLFHEHGHSHSHGTNHSGDSNSNSNSTSHSHSHGE
FT                   VATTFTQGDEEEHIGTGSGDENEHTPLLYNITHTTMKSTPSEVFDYLPDNVVERYSNYQ
FT                   SSFVGQQQQQQQQQEQTPTNIENGQSLLNGNSTTTNYSASASSSSDNTNNTNNTMVNNT
FT                   SEPTRNKSQSKLQKFKQKSMNMEGVFLHVLGDALGNIGVIITALIIWKTNYSWRFLSDP
FT                   ITSLFITLIILNSALPLVGKASRILLQSAPPYIDSNLIVNQIKQLPLIKNIHDFHVWNL
FT                   NEDILIASLHIELNPNCEVNLPLKNGSSDNNNNNNNNNNSNNDNNNNIQTDSPSESIVE
FT                   NDQDLEIPSQIDRKLFLAAVSQVREVLHIYGINSVTIQPEFSNSKKICRSIF"
FT   CDS_pept        complement(438947..440209)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582817"
FT                   /orf_name="CD36_17000"
FT                   /product="t-SNARE, putative"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43478.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG736421"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000192D510"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ8"
FT                   /transl_table=12
FT                   /translation="MFRDRTNLFLSYRRTIPRDTLPIKRTRFSDLDNEEENEGLILSST
FT                   STTTSTTTATSNRKGRKNKSNRNSNSNNSGGSDYNDEEDIELRPMIPNIFDIAKELDSY
FT                   LNIINKNIEELNSMYKKLIIINKLNKLNLEKKIEELNYQILIKFEKCYILIKKFEYLLN
FT                   NYQKLKLNYNQQDLEILINFKKNYAVKIQDKSLIFRNLQNNYMKFLKNDDDDEEKNKEV
FT                   ENRFDTNNEQITLLNDLEESKSINTINSTNNNNNQQQQQQVQIQQQSNIQYLQQREREI
FT                   SKLAHGIIEISTIFKEMESMVIEQGTILDRIDYNLINTVEELNQANKELIKAHNYQKNS
FT                   TKCKIIFFLSLCVFALLMIFMLRPTTSKNSHSNSMSNNNNNNNNNNNDSNISDDQELMR
FT                   PNIDKPVNEVNPPSNVNKVFI"
FT   CDS_pept        complement(441768..443036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080719"
FT                   /orf_name="CD36_17010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43479.1"
FT                   /db_xref="HOGENOM:HBG396122"
FT                   /db_xref="UniParc:UPI000192D511"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAQ9"
FT                   /transl_table=12
FT                   /translation="MLSLIDLKPDFVFSQYEISIIKSIWRSLDLNNPIILKDFYYTVST
FT                   TINNTGTTINGVLNPQRDTFTPLIITQQDIMNIINDYQVEEFIKVATSLIYHLEFGKEL
FT                   PENEIVQLSKRNYRIYKLYYKQYLTLGNSLMETIENYTNLLMGNNKQIFSRFLSILLSA
FT                   ILYYSNDVTFADTTTTTTTTTTATPTTTHSNASIYSEHSYSMFSLNTDNTSSSSSAATT
FT                   TTTADVIALEEIFKPPQLADITPQDPQDPQNTTTDTDCSEDATITNSIYNNRLNNDDDD
FT                   DVDDNTIENINGSTSTFDSSYDYLNSFSFSPDDYDDYNDYGDNDDNDENFNGKKIDYKK
FT                   LESKSKIDKYKYNDDNDNDNDNDDDDDEDDFDDFDDTKSIVSTISNLSSSFKNWGINRK
FT                   KSNKDKFKSTKKFIHKNILRNEK"
FT   CDS_pept        complement(446725..449709)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537658"
FT                   /orf_name="CD36_17020"
FT                   /product="Putative uncharacterized protein "
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="CAX43480.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG626554"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI000192D512"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR0"
FT                   /transl_table=12
FT                   /translation="MSGLSLNKIELNQIKSSWSKINPKEFYPELYENLFELNPQLRSIF
FT                   NNDDSVINYHCDIFGDLFNFIINNIEDDLLLNEFLYQFVNENQRFSSMISQYLEPMGNA
FT                   LIQTFKNELSGQFTSVLELIWIKIFVFVANLLLQYEEDIVSEDSNSMDEDYYIPPLNIN
FT                   RERKQSIDTLPTPSPPLRKEEEEVKEEEEEIKEEEENIIPVVSPPIIGFDNSKPKQILD
FT                   KFNSIEIDLNSNNKYKGFRRSIDVAKSPIHVPIPQSPSFQKIQSNMSSSLKNILISTDN
FT                   DDNNNNNSNNSNFDCDFQTPRRRRKNLSFDPRRKNSSNPTTPKLDKSPFESPRLSAVAN
FT                   GKFASQQQKEHQGLEDVETDNEEFSTPRASRRGSFSENYSIGSLLNKLKKIQDPEEQEQ
FT                   EQEPVIVEDALSNKSEDSIDVGPFDPRIRRRRNEELNNKLIPSPESSEVDEQEEEEMFI
FT                   NKLSPPTSSNPTSTTTTTTTLKEQKQTVPERSLSRGGLTGGTFDYQSFGLKGLAPIVED
FT                   DDASSKYESDNDDDHDDEFNGNPVKNNNLISTKSSGQNSIEDVGEINSRTSSLSLNNSD
FT                   YKSSISSGTNDIDHYTIKGAGVRYHSRNLSTTSSSGNDFEFSTPISKSRFNDSPKQQQQ
FT                   QQQQQHNNNKQSSLYSIGKIQSASVSSINSTSRASMGFMRSSFVLKKEMQTQGYNEPEN
FT                   VCLSMPVTPRMNNNNNNDNNKPSINSLSAPPAIYMNKAASISSFGRPTSISGGGVATSS
FT                   TNSPKLNNSSGSTPYDSAYDLLNTFDTSLPPPPPLPIKDGIHNTSSRNSSISSQGSLKK
FT                   KGGLRNRLSSIFSSKSSSSSSSSKLAESSSLSSLSNTPATSINSSSRKASIGSSSNTLV
FT                   NSKPESQSGSNYTVSSHSTRQSVPLFSAQPSINHIPPIIKKVESSGIASSAASTRKPPS
FT                   IYGHKYGSVNDLTSIYSTDTTTSGFSMFKRRDKNDVKFVPPLTRNTRKGNKYNVKKVPY
FT                   DIWAT"
FT   CDS_pept        complement(452170..453981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384914"
FT                   /orf_name="CD36_17030"
FT                   /product="Hexose metabolism-related protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43481.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396123"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192D513"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR1"
FT                   /transl_table=12
FT                   /translation="MNSDNNPIREPDIKKRKIEPKTSNNNNNNSSQQTTSNTRNNDQII
FT                   EILSDEESAPPRPTTTIVNLDTESDDSTLTDVDYRDDNYAGDGGNEIQIVGVNTSNPTP
FT                   LSTPLSNINRGGVPSNTNINNNNNRTHNDNNDDDDEEDDDDLEILEVRTINNPQNERLS
FT                   TPVGDIPFVREHNDYRIFGNRPIRNSNPPIIRSQSEMGRRQPLPSPSQIQQGLMPTNRR
FT                   RSIRERYTGMVHSDYEPWITVPNPELYGGREAFDPARFFQSESTLGRSGLDIRVIELGS
FT                   RPEDYALIRERLRRDRETTALNSSRQRGRNTTSRAPRRSYLELAANETSNLSSFPHQPP
FT                   INSTEHSSHSRRGVGNRNGRVRRQQSRHIDSPPFLDDHPFLSDVTTPVPRELRFLGNTY
FT                   HDVGLALDNLMDSSYTPGGFNAAIERSIMQRIDEDNNRTIDRRLAQETNYNKKTKNEIE
FT                   KKMANQDEGHTSIIKSNENLVCELCNIILGEGVSEDFHGDSRYNEKFSHHCETYNCQAP
FT                   WFCVYPFTKVDIELSKRIFVAKCGHLFCGRCVKNIGNRPKIRRKSKTNGGGGDVSILNP
FT                   KFYAPSTCPELQCQKKFSAKSFTEVYF"
FT   CDS_pept        complement(454669..456039)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093603" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582818"
FT                   /orf_name="CD36_17040"
FT                   /product="Transcriptional repressor, putative "
FT                   /protein_id="CAX43482.1"
FT                   /db_xref="HOGENOM:HBG396124"
FT                   /db_xref="InterPro:IPR013927"
FT                   /db_xref="UniParc:UPI000192D514"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR2"
FT                   /transl_table=12
FT                   /translation="MTVPSISNSQLPPPPYSQTDNNPTSIHQSGLNGSVQDQGHQIQSH
FT                   AQSQAQVQGPELVSAAETLSSFTRNTTPPSDAETVAMDDASPPSVILPPIQHQRHPIVS
FT                   TVSMVARHPIVMNAVKYYETSKRNYPSFNYAAGIVESAAIPVVNNIEAKLNTRHQTRQA
FT                   SAVSSTDITPTNSNFGDYKIQHDGNSLQKKRRFSTSSQTTNISSYSSIDTRKRLQFCIN
FT                   ILKLANTNINSKVEFLQEKINETEIAVKEEREKLNAQKSNDSNSTTTDQATQKTKTEII
FT                   GTVKKIIHLISNFRPSSLGDTTTSNGLSPVSSNGSQSNSDFELKNAIRDIIMSLPQSLQ
FT                   HQQQQQQQQQQQQQGSSRNSQDDVIFKFAKESLVMISKLTQIFTEKLDQVEHWVNGDEE
FT                   QNLQSQSQSQSQSQSQSQSQSQSQSQSPEGLEKQQEDEKEEENLAAETKRMKLDGSV"
FT   CDS_pept        458573..460594
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582819"
FT                   /orf_name="CD36_17050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43483.1"
FT                   /db_xref="HOGENOM:HBG397940"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000192D515"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR3"
FT                   /transl_table=12
FT                   /translation="MTVVNNNEKNNIEFSLVSVFELKLDDFQSYKNSIESKFPKFDKTI
FT                   VQYPKFLPTTAEALTHLKLLKAFSVMKNKVIGDENNTDYYQINQWKSFITVAVRRFIIF
FT                   VSALKALYINEFGDANNKSFEDLNKTKGFENIMANLLPPLDVIMVWHAFLLNPKSFFDT
FT                   FSRNSFIDFAKYPLPLDRIYSCINNETFEFSVPESYEKNYINVLKKFINNNDTDFIYEI
FT                   KNFSMYQHLVIINCPNCKNTISDPIPLVTDSCTGFADSEFITKKKYQQGYCFDSSHCYC
FT                   SKIEDLTHEQLRKLQLFCDINSSKSLPGIEKYLSNTLTNPKFAKRNTISINQIIKLGVQ
FT                   KSWEYADSSISDIITRAAIDNGRSGRIIKVILREYLQFNLIHLTVPNAISIGEDLVGCV
FT                   LRQESFVKKMNAINWLGSSTVLENLNTARVRYQRFFSMLTDAKLKKMLVPTLDIDLIWH
FT                   THQLWMYGYFHDCLNSPCHSAIDHDDKVDEGKLDDGFEFTSKIYKRKYKEDYSICYCQY
FT                   CSEIRVTKMEKVMKLFKSKKSGDNPIGIKEETTSNVKLLTLENPSHISTHNSIQLPTKK
FT                   AEKRRSKNPVPWRNTGSDAGFFVVPPVTPVPIDDSKFYGDGLCCSVAASCATTNGTCCQ
FT                   ISGGACGGGSTGCGGGGCGGGGGGGCGGGGCGGGGGGC"
FT   CDS_pept        complement(460949..466096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167551" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582820"
FT                   /orf_name="CD36_17060"
FT                   /product="rRNA biogenesis protein, putative "
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43484.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG328193"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000192D5C2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR4"
FT                   /transl_table=12
FT                   /translation="MSDSSKSVLSNKEFSFPRGGSKPLSALEVKEISNEATKDVLFEQA
FT                   ESNKRSNSSKSEQPKKKHKKSSKNKSKNDKNDNDEETTQSVLIETFNFKNLVSGSSVLG
FT                   QIKTINKLDIGLALGDNLTGYIPITSISPQITALIEKFEEQEQEEEEEESDNADGNQET
FT                   KSATFKSKTEKEFPDLLKIFKLGSWLKAKITTSNEDFKNKKRIELTIEPESVNESLEVD
FT                   DLIVNNILQCSVKSIEDHGIILDTGKPEYSGFISNKELTNAKIDVTTIVPGLVILCSIA
FT                   TKPSSRTINLKPIVATISAKKSTVSTISSIDSIQPGVIVDALINDVTENGLVTKVYGLV
FT                   DGTIALSQIQNFDLKELKHKYAIGSTVKARVLAVLLKNGTKKLILSILPHVLQLGDDSS
FT                   QTQALEAFPIGHVFDEVKVIGNDKHYVYVSFGSSSLFGQIHQSKFDDNKTLLDYSIGST
FT                   HKSRVIGFNEVDNLLILSFESKVIDAEYLNVRDVPIGKLLPNVEILKVLEDGVGINVKF
FT                   FDEFKGFVPGNQMSDIKLVYPERKFRVGTKTKGRLLNYNGKRALITFRKALVNLEDDEI
FT                   LSNIDQAEIGFKTNAIVEKFVPNGCIVSFFGNLRAFLPKTEISETFVEDASSYLKVGQI
FT                   VKVRILDINKEQKRLVVTLKQSSELSNAQKNEINKLVSGKSIVKTVIVEKTKDSVLVEL
FT                   EGSHLRGVIYDGQLSDGNYEQNRALAKRLTIGESLEVLILDKDLKARTVIATAKKSLIE
FT                   ALKSKSFPVDFNDVTVNAVVKGYVKSVTSLGLFVTFTGRLTGLILAKYVTKNAKEDLSK
FT                   KFYKYQSINCRVLSVDKENERFLLALNNSSSSFTKDDEQLIKPIDTTKKIVADYQPGET
FT                   TKAVIRAVKGTQLNVQLADNLQGRVDITQCFNSIKDIKNLHQPLASRFQKGETVDVKVI
FT                   GVHDAKNHTFLPITHRKSNRTTILELSLTNPQINNKPLTDLKLKDFKQGDELLAFVNNI
FT                   INGMVWVSISPSIKGRISMLDLTEDGSIFQDIDNKLPIGNAINVKVKQVDLQHQILVLT
FT                   ARENFIEKFEDVKQDEIYPARIIKIKPNHVLVELGNNVIASSFLTDALDDYSEKLDHVF
FT                   NVNDYVSAKVLDIDSINKRISVSLRTNKPTSDKVINSVGDLTRGQVIKGFVKNISNNGV
FT                   YVSLGRSIYALVRVSDLSDSYLKDWQNFFKPNQPVIGKIVNCKQEGRILMTLKESEVNG
FT                   DLKIMKTFDDLQIGDIFEGTVTSTTEFGVFVKLDGTVNVSGLCHHSEISENDVDNVKSL
FT                   FGTGDRVKVKILKIDPVKRQLSLGMKASYFISDSGKEDNDEEDVAMEDASEGEEEEEEE
FT                   DDDDDDDDDDDIMDVDDGEENDSDEEEQFANESQEKSLSTGLSTNGFDWTASILDQVDE
FT                   DEESSDDDTDFTDSSKKKSKKKSKTIVEDKTGDLNTRAPQSTADFERLLIGNPNSSILW
FT                   MNYMSFQLQLSEVDKAREIGERALKTINYREEQEKLNIWIALLNLENTFGTDESLEDTF
FT                   KKSIQYMDSFTMHEKLINIYKMSEKFDQAKQLFNRMTKKFGKILNTWVLYGSFLLDQHS
FT                   QDEMHEILAKALNILPKREHIDLVKKFAQLEFQKGDPEQGRSLFEGLVADAPKRIDLWN
FT                   VYIDQEIKQDSKNSEEDDTNIKSKVEDLFERVLSKKITRKQAKFFFNKWLNYEEDKQDE
FT                   NMIARVKSKAAEYVQNNS"
FT   mobile_element  466281..466751
FT                   /mobile_element_type="retrotransposon:solo LTR, eta G"
FT   CDS_pept        complement(467037..468296)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080720"
FT                   /orf_name="CD36_17070"
FT                   /product="GATA zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX43485.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG396143"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000192D5C3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR5"
FT                   /transl_table=12
FT                   /translation="MNGANQNIPTTLPRLPSFQQLSETIRNPDFTESSQKTQQYHQHRF
FT                   QNTPIDCKSLMLFPINYTPVNDNGIVTSSNTIVTTTSNMNGNSTMEYSYGPTLHGRHES
FT                   YPNQYVFSNQESKTRIPISNRVSPVSMDRTKAHSLDSELTNHFNNTNNDKAYSKKYKVV
FT                   FDLIQFLKKFEIKYNELKHYTFDLENDKNSNVLEKMVTDLSIDDINEALVNTKKLANVF
FT                   ENIKSINENSSNKSNNDIRRNGLFVYENGNKKQQHTEKRKIRKKHQHQHQYQHQLVKTK
FT                   ALTARSETIPSQVGLNSSNGSIASSGSLQPSQPPSQLAQSQIQPQSQSHLQSQPPLSTS
FT                   NLTGGNLNTELSVKPEITCQHCCSQETPEWRRGPEGSRTLCNACGLFYSKLIKKYGLRE
FT                   ADKVMLHRKQTGTVNDRRIF"
FT   CDS_pept        complement(469434..471251)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384915"
FT                   /orf_name="CD36_17080"
FT                   /product="RING finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43486.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG604662"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D5C4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR6"
FT                   /transl_table=12
FT                   /translation="MIGTDSYHIIIDIQKSSPTTIEIIELDSKMALQPIEPLRAKSIGN
FT                   GVIRLYREFENEIPVTGEASSNQLINNPGDDTMVAILAVPTYFTATDLLGFIGEKNVSN
FT                   ISHLRILKSNKPNRFLVLIKFRDVMKAAEFQYHFNGKPFNSMEPETCHVIYVKAVQVTN
FT                   SHKDDSVVDSMIPFLLQDPFTSATTGGVHGSNSPSSSSAVLTSNLSDNYHLIELPTCPV
FT                   CLERMDATVTGLLTIPCQHTFHCQCLTKWKDDTCPVCRYSHNIANERVRRSTNRLQQLS
FT                   IRDTPIDTPLPRSLESQQQHAQISSLLEAENDDDDEDDDVGEICMGCDETENLWICLIC
FT                   GNIGCSRYAPEQHSLKHFVDTGHCFAMEIATSRVWDYAGDKYVHRLVTNESDGKLVELP
FT                   DKEDKINGGSWNRNDPSFDKVDEVGFEYSQLLISQLASQREYYESLLEQQQTAPKSRRG
FT                   SGNNNNNNNNLANKINQERLTELEIKFEDLKSTLSDFTNSLIPSLKEKIQSKDEKLNKV
FT                   MRELNISNSLNEALSKKVEHLTKVNNDYKTTIENLTGENKALNEQVTDLMFFLDSQEKF
FT                   KNESQEVKDGTIVIQQPPSVSRKNRRKKK"
FT   CDS_pept        complement(471652..472614)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582821"
FT                   /orf_name="CD36_17090"
FT                   /product="Ribose-phosphate pyrophosphokinase, putative "
FT                   /EC_number="2.7.6.1"
FT                   /function="kinase activity"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAX43487.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI000192D5C5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR7"
FT                   /transl_table=12
FT                   /translation="MSTNSIKLLVSDVHRSLAELVSKRLGLRLTPSELKRESTGEVQFS
FT                   IGESVRDEDIFIICQIGSGEVNDRVFELMIMINACKTASARRITVILPNFPYARQDRKD
FT                   KSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDVPVDNLYAEPSVVRYIKETID
FT                   YSEAIIISPDAGGAKRAAGLADRLDLNFALIHKERARANEVSRMVLVGDVTDKICVIVD
FT                   DMADTCGTLAKAAEVLLDNNAKDVIAIVTHGILSGNAIKNINNSKLKKVVCTNTVPFED
FT                   KLKLCPKLDTIDISAVIAESIRRLHNGESISYLFKNAPL"
FT   CDS_pept        complement(473069..474820)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384916"
FT                   /orf_name="CD36_17100"
FT                   /product="Transcription initiation factor TFIID subunit 7,
FT                   putative"
FT                   /function="general RNA polymerase II transcription factor
FT                   activity"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="CAX43488.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016251"
FT                   /db_xref="HOGENOM:HBG396142"
FT                   /db_xref="InterPro:IPR006751"
FT                   /db_xref="UniParc:UPI000192D5C6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR8"
FT                   /transl_table=12
FT                   /translation="MALKLKIKMPSSSASNSPQPAPAPTPRPDSHSPEHQPKLPKLKIK
FT                   APSMTPVSSTTDSSMTLKRPQNEQSDGEKPKKLKLSLSKTKENGRPKGLPRVRVKPTRV
FT                   PGEGYDSEAPDLEDDPLIEQGIIIRFLNDSNLDFVHNAVDSGDLTGLNVKWVTKEKAIV
FT                   NVNSTLYSARLVDLPTVTEIFKTVDRKNVFKTLDICQILLVLHVVDPAKLNIDTDFEVP
FT                   EEFLFNHPFYKYVKNNEIKKKRIVLKDGLLQPFQDVYRRFHPTKVDHRVILDIESKVDE
FT                   LIKLDNEADESHFELLDSKTAQQSRFAASATPSAVNSPTAMKMDGPEVEPERFNNAQDH
FT                   GNAEHDDEDEDEDEDEEGEEDDLQDDDMELHLEQELEKALDGELSESEVTIPTSMAGIL
FT                   RNDVGNGISMTNGEQSEEIEGEEQEEEEDEEEEEDEEEEEEDGEDEEEEEEENEEGDSE
FT                   SGKQHVKLLEEEISELEKAVAHHQKNLSTASSKMLRMKFQNTYTSLKASLDSKKRDLAK
FT                   LLDEQEQQEEHTQSKTTVDEKSQEAAGDADAEDEDIDQGDEINEENDNNGDSDIGEENV
FT                   DDLDDLF"
FT   CDS_pept        475311..479354
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582822"
FT                   /orf_name="CD36_17110"
FT                   /product="Cation-transporting ATPase, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43489.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG735026"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D5C7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAR9"
FT                   /transl_table=12
FT                   /translation="MVRNSVTSRRSSSIDRRRSRSRHNSVASTSSSANLLLDDNNYEMY
FT                   SGAASEIIPSSITSLHYPHSFGGRRVSRVSRETSPLLSADENDSDLQRVRSNASRNSID
FT                   TQANFRFFSPDEIEHAQGGSTLENPEDPVDYNTDWDYSIDKYLDEDEQYLEEAVAEEEE
FT                   GGEEQRGTAFYQQDGVNFRYQSPDVPDYGSVDLENRNRRDSGSSSKSSSDEENSIVEDD
FT                   QYEDFYKQFPTKLDYQRYYLAEEDLVIGIAGYADRWWKTTIYYFLCISTLGIAYLILRW
FT                   LPRYRINLMGTRCPLGKADWCVIENEFGELQIAHVEKQRFNERLSNFLVVTDDQYDFEK
FT                   DPVVPHIQSFVYRYIKFFYNPMEDMFKTNSNWFDTRLLNVKNLKDGVSHSVQDQRQEIF
FT                   GRNTIEIEEKSVLQLLTDEVLHPFYIFQVFSIFLWLADDYYYYATCIFLISMISIINSL
FT                   IETKSTMKRLQEISKFNCEVRVWRNGFWKQIDSNELVPGDLFEVDPSLNVIPCDALLVN
FT                   GECVVNESMLTGESVPVSKISATRETVKLLPENFVDPILSKSFLYNGTRLLKMKSANDE
FT                   PVTAMVVKTGFSTTKGSLVRSMLFPKPTGFKFYEDSFKYIGFMTLIAAIGFTYSTYNFI
FT                   KLGIDKKVMILRALDIITIVVPPALPATLTIGTTFAISRLKKLQIFCIAPTRVNIGGKI
FT                   DVFCFDKTGTLTEDGLDVLGLHLANNAQGRKEIVFEELVEDIDNLKTVRANDHDTNNGK
FT                   FLLGCLTTCHSLRYIDNELLGDPLDVKMFEFTRWNYREDSKTTNPVVFKGNDSYEVIKE
FT                   FEFLAPLRRMSVVASHNHKHYIFTKGAPEVMLDICQQDSLPTNFEELLHHYTHSGFRVI
FT                   ACAYKQITSTDVDRDNAESDLMFAGFIIFENKLKKSTTSTLKTLKEAEIRTIMCTGDNI
FT                   LTAISVSRECGLIPPSIEHIYIPVLDEKNEERYISWQEVNDPENKLDPITIKPIDIRQD
FT                   NNYKLAITGDIFRFLLTEVKNIGVIQNILMNCDIFARMSPDEKHELVEQLQRIDYTVGF
FT                   CGDGANDCGALKAADVGISLSEAEASVAAPFTSRVFEISCVLDVIREGRSSLVTSFSCF
FT                   KYMSLYSAIQFVTVTILYKTGTNLGDFQFLYIDLFLILPLAIFMSWSKPYAKIVLKRPT
FT                   ANLVSPKILIPLVCHIIVILLFQVLLWSWVRKEPWYIKPIPGSDDAVKSSDNTVLFLFS
FT                   NFQYILIAVVLSQGPPYREPMVRNYPFMINLVVATFLSACLFLIDGNSSLGDFMQLTNL
FT                   HGWFYWYIIIFSIINLSCMMIGEERWFPSLAKVYKRVFQRSKIGKSKKIFKNLKKEFNQ
FT                   LQSV"
FT   tRNA            complement(479480..479553)
FT                   /gene_name="tRNA-Val (AAC)"
FT   CDS_pept        join(480590..480934,481006..481440)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582823"
FT                   /orf_name="CD36_17120"
FT                   /product="Acetate transporter, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43490.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI000192D5C8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS0"
FT                   /transl_table=12
FT                   /translation="MVSASTADSKDVDSVGSPNCNNVTKVEVSGDGGEFVILGHKKYYR
FT                   HEIMAVLAQNSQSSSSKFATSTPLGLSAFAVTTLVLSLYLLQARGIKTINVAVSLATFY
FT                   GGVVQTIAGIWVTNRVTLVFTALTSYGAFWLSFAAINIPTFGILAAYQKDMTQLSSALA
FT                   FYLISWAILSFIFTLLTIKSTVILSVFFLCLTALFSLLSASYFVGSVALAKAAGAFGVV
FT                   AVVAALYETVALLATKQNSYFTIPVIPLPGSEAKQNK"
FT   CDS_pept        complement(481696..483882)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537659"
FT                   /gene_name="ERG7"
FT                   /orf_name="CD36_17130"
FT                   /product="Lanosterol synthase, putative "
FT                   /EC_number="5.4.99.7"
FT                   /function="lanosterol synthase activity"
FT                   /protein_id="CAX43491.1"
FT                   /db_xref="GO:0000250"
FT                   /db_xref="HOGENOM:HBG750669"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR002365"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="UniParc:UPI000192D5C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS1"
FT                   /transl_table=12
FT                   /translation="MYYSEEIGLPRTDISRWRLRTDDLGRETWHYLSQSECENEPQSTF
FT                   VQWLLGSPDFPSPSSSDSHTPGEAAKKGADFLKLLQLDNGIFPCQYKGPMFMTIGYVAA
FT                   NYYSKTAIPEPYRIEMIRYIVNTAHPVDGGWGLHSVDKSTCFGTTMNYVCLRLLGMEKD
FT                   HPVLVKARKTLHRLGGAIKNPHWGKAWLSILNLYEWEGVNPAPPELWRLPYWLPIHPAK
FT                   WWVHTRAIYLPLGYASANKVQCELDPLLQEIRNEIYVPSQLPYESIKFGNQRNNVCGVD
FT                   LYYPHTRILDFANSVLSKWEAVRPKWLLNWVNTKVYDLIVKEYQNTEYLCIAPVSFAFN
FT                   MVVTCHYEGSESENFKKLQSRMNDVLFHGPQGMTVMGTNGVQVWDAAFMVQYFFMTGLV
FT                   DDPKYHDMIRKSYLFLVRSQFTENCVEGSFRDRRKGAWPFSTREQGYTVSDCTAEAMKA
FT                   IIMVRNHESFADLRDEIKDENLFDAVEVLLQIQNVGEWEYGSFSTYEGIKAPLLLEKLN
FT                   PAEVFNNIMVEYPYVECTDSSVLGLTYFAKYYPDYKSELIQKTISSAIQYIIDSQDNID
FT                   GSWYGCWGICYTYASMFALEALHTVGLDYESSSAVKKGCDFLISKQLPDGGWSESMKGC
FT                   ETHSYVNGENSLVVQSAWALIGLILGNYPDEEPIKKGIQFLMKRQLSTGEWKYEDIEGV
FT                   FNHSCAIEYPSYRFLFPIKALGLYKNKYGDKVLV"
FT   CDS_pept        484351..487860
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384917"
FT                   /orf_name="CD36_17140"
FT                   /product="Nucleolar protein UTP22, putative "
FT                   /protein_id="CAX43492.1"
FT                   /db_xref="HOGENOM:HBG396138"
FT                   /db_xref="InterPro:IPR005554"
FT                   /db_xref="UniParc:UPI000192D674"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS2"
FT                   /transl_table=12
FT                   /translation="MAKRKLEENDISTIEEDEFKSFSDREEQIEEHSNGRAKHVEDKAQ
FT                   GSGDDSASEDEGEEEKEEQPPNKKQKKQLSAQDVQVARETAELFKSNIFKLQIDELMKE
FT                   VKVKKAHEETIDKVLHRLHDLIKQVPPVEDLTLQQAEQHFNPKKLVIPFPDPKPTKVNY
FT                   KFSYLPSEDLSLVGSYGLKTAINQPHGQSIEVALTMPKELFQPKDYLNYRALYKKSFYL
FT                   AYLGESLIHLSKKNNLPIKVSYHFFNDDVLNPVLKIESIQTENPEDLTFTKTKIAINLI
FT                   VAFPFGVFDSKKLLPDKNCIRVQSDTETLPPTPLYNSSVLSQTSYDYYLKYLYTTKKSA
FT                   DAFKDACVLGKLWLQQRGFNSSLNNGGFGHFEFAILMSALLNGGGLNGNKILLHGFSSY
FT                   QLFKGTIKYLATMDLNEGYLSLSSLIGENIVSKYKSDGFNVPTIFDKNTKLNILWKMNK
FT                   SSYKSLQLQAQQTLELLNDVVKDRFDAILLQKSDFDPMRYDIVFKLSAPEELYDSFGPL
FT                   EKIAYITFENYFKSRLFAILNKALGERTQSIVIRNEHPSNTFAIHKRKPSHASSTFVIG
FT                   LQLNPEECDKLVTKGPNNEDKDAGIKFRSFWGNKASLRRFKDGSIQHCVVWNIKDQEPV
FT                   VMNIIKYALDTHLQSEISQHLASSICYFDKKLPVPLLPSATNQVVTSLGSFTALRNSFE
FT                   NLSKVLTNLELPLSVKTVLPASSGLRYTSVLQPVPFAASNPDFWNDCVLQFETSTRWPD
FT                   ELSALEKTKSAFLLKICEELAETEYNSFITKDESVPFNENITLLNILTPEGYGFRIRAF
FT                   TERDELLYLRAVSNADKQKALVQDVYLKFNEKYMGSVKHTRSVTHLAQHFHFYSPTVRL
FT                   FKQWLDSQLLLQHFSEELVELIALKPFVDPAPYSIPHSVENGFLQILNFLANWNWKEDP
FT                   LVLDLVKSSADDDVKLSDKLTIQAHRIIEQNFEKIRKTDPSGIKTQYFIGSKDDPSGIL
FT                   WSHNLTLPISTRLTALSRAAIQLLRKEGITETNLDLIFTPALQDYDFTIKVKANNITTS
FT                   SGILPPNTFKNLIQPLTSFPDDITTKYDLVQGYVDELNKKFGNAIIFSNKKFTGLCKNN
FT                   ENVIGGIFVPTNLTKKKFRVNLGINVKPFEDKGDEVIINTSSIYDEIELLGGDLITAFD
FT                   KRK"
FT   CDS_pept        complement(488125..491235)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248251" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582824"
FT                   /orf_name="CD36_17150"
FT                   /product="Vacuolar assembly protein, putative "
FT                   /function="small GTPase regulator activity"
FT                   /protein_id="CAX43493.1"
FT                   /db_xref="GO:0005083"
FT                   /db_xref="HOGENOM:HBG396137"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI000192D675"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS3"
FT                   /transl_table=12
FT                   /translation="MVMNIDVIEPLDRIRISSNEIKSNKIAAIYKHSVDQASEQQQLFV
FT                   GLTNGDLLIYNAVKDTSLDESGQISLADTRTISVSSAISISTHSSYQDIKRLFRGHENR
FT                   SYKLANLFSNITKDGSSINKIESLPISTTKLIILITTLTSLEIFEIVGSHINQIYHVPE
FT                   SKNALSFYVLNNDRRLFFVGIKKKLSVFQIVNKSRNIFQFNKLKEIVMKDKIRSIDKFD
FT                   EDSIIIGLINNYVICNFVDFSISPLVIENNDNMLSSGTSFGYFGLSSSAPSMWTIQISD
FT                   DYFLLVKDTQIVKIDRRNGPGMILSSIKLSGIPTEVLFIYPIYLFVVYPKKIEIVDVTS
FT                   GDLIQKLGHSINSSHSSVILTNSVISIGSGTDILQFSILPFQAQIDQFLSISGKGTLGN
FT                   IRDPRNDLKFVGIEKAITLVSNIDEANSLFNDAKNKLMKLRYLYSLKATLLFESYSKYH
FT                   EALVDISSEWLVSFTDVLSLFPTFVNGQLRSRGVTSDGNGNENKKNSSLNVIKRITVEE
FT                   LELNNYSESEYDTDNTSKKAMASKQSHGQSVKAQNIRKFIKAVNNLIIYLTDQRRILST
FT                   FMDKDVLAWKNIEINPSDIYPEFDGNLETVATVIDTSLFLCYFYCKPMLLGPLLRLPNN
FT                   YCDSKVVNECLLSNIHNHVQQRNSKQPNFIKELLDFYYARSLHEEALEMLYNLAHDEGT
FT                   IEHSNEEDNKFDDFIKGPDLTIQYLRKLTDENLYLVLKYSSWVIDQDKNAARLVFMNDS
FT                   YECESYDNTKVLQFLCKKDQDLGIMYLEWLLFASDISESLKKSKLYSQLETKLCLLYLK
FT                   QLKSGKNQNDYYNKLQNILKTSQTFEPWSILKEMPTTQDKYLRLTIYIYKKLGEHEKSI
FT                   DVLFNQLNDLDAAMEYCLEIYNRHQSSALGSGLFYKLLEDLLMNYHENCELIVRLLSEH
FT                   GTKIPILKTLSVLPRSFPMHKLKTFFTIEINNTNENVKDSHLVSQLYKVGSTNLQYKVM
FT                   TLQNEGYKIGSSKQPCAICNKRLGYSVFTVTKDHEVVHYGCAQNRKK"
FT   CDS_pept        complement(491569..494397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582825"
FT                   /orf_name="CD36_17160"
FT                   /product="WD repeat protein, putative "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAX43494.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG735132"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D676"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS4"
FT                   /transl_table=12
FT                   /translation="MTETVMEKKRKIESNSSGIAKQPKASKIFSPFRVLGNVTDSTPFA
FT                   MGTLGSTFYAVTSVGRSFQIYDSATLHLLFVSQTQTPSKITCLAAHHHFVYASYGGRIG
FT                   IFRRGRLEHELICEGNSTVNHLLVFGEYLIATTIEGDICIFKKAEGKKFPTELYSTIRV
FT                   INSLIEGEIVGLIHPPTYLNKVIVATTQSVFVINVRTGKLLYKSRELQFEGEKISSIEA
FT                   APVLDVIAVGTFNGNVFLFNIKKGKVLGQKIITSGTESSSKVTSISFRTDGAPHLVAGL
FT                   NNGDLYFYDLDKKSRVHVLRNAHKETHGGVANAKFLNGQPIVLTNGGDNHLKEFVFDPN
FT                   LTTSNSSIVPPPRHLRSRGGHSAPPVAIEFPQEDKTHFLLSASRDKTFWTFSLRKDAQA
FT                   QEMSQRLQKSKDGKRQAGQVVSMREKFPEIISISSSYAREGDWENIITAHKDETFARTW
FT                   DSRNKRVGRHLLNTIDGGIVKSVCISQCGNFGLVGSSSGGIGSYNLQSGLLRKKYVLHK
FT                   QAVTGLAIDGMNRKMVSCGLDGIIGFYDFGKSVYLGKLQLEAPITSMIYHKSSDLVACA
FT                   LDDLSIVVIDVTTQKVIRVLYGHTNRISGMDFSPDGRWIVSVALDSTLRTWDLPTGGCI
FT                   DGVILPVVATAVKFSPIGDILATTHVSGNGISLWTNRGQFKPVSTRHVEEEEFSTILLP
FT                   NASGDGGSTMLDGFLDEDTNEDGTINESYTSTSQIDRSLITFSSEPRSKFNTLLHLDTI
FT                   KQQSKPKEAPKKPENAPFFLQLTGQAVGDRASVAEGKTLEQPDSVVEESGSKLRKLDTN
FT                   GNYTFESEFTKLLREAGESGKFEKFLTYLLNLSPAVLDLEIRSLNSFVPLIEMTSFIQA
FT                   LNAGLKSNANYEIWETLYAMFFNMHGDVIHSFENETNLHEALEEYRQLNDEKNNKMDSL
FT                   VKYCASIVSFIS"
FT   CDS_pept        494586..496427
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000240610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232064"
FT                   /orf_name="CD36_17170"
FT                   /product="tRNA-dihydrouridine synthase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAX43495.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG521382"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000192D677"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS5"
FT                   /transl_table=12
FT                   /translation="MIVPEKRTLEEPEVRSESKKPNTSTYVKGIAAIKAEYLVPTSSFT
FT                   VVEYDDDEAESGNREGESKPRNKKKQKGQNHKRDLKQKKDIIKLCPSLIDPEDDRICQV
FT                   GSDKCRFHHDIASYLESKPHDIDGICPVFEALGYCPTGIKCRWLKSHYNPETSKLIKDL
FT                   EKTEIAKTTNYEVNHIDKDQKMEMQKKKYFFKISQPVIKYLDSRIQNDENLAKQKEERK
FT                   DNEASYVEAPFTISEKKKLHLRNAKIVSPLTTVGNLPYRRLMKTLGADVTYSEMALSVP
FT                   LIQGHNPEWALPKAHISEYPGFGVQIASSKHWAAAKAAEAIYRNTTHVSELNLNCGCPI
FT                   DLLYKQGQGSALLDQPSKLLRILSGMNASSGDIPVTVKIRTGIKEGKNTAVNLVSRVLD
FT                   EGNAAAITLHGRSRQQRYSKEADWNYIAEVGTVVKNWNEQQKEDKEARDRDPVYFVGNG
FT                   DVYSHEDWYKHVNTEGIDSVMVARGALIKPWIFEEVEAQQYLDKSASERLDILGKFAKY
FT                   AIEHWGSDEYGVGLSRRFMCEFLSFTHRYIPVGIMERLPPRLNERPPKWVGRNDLETLL
FT                   ASTDYKDWIKITEMFLGKATDDFQFTPKHKSNAYENK"
FT   CDS_pept        complement(496497..497066)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232065"
FT                   /orf_name="CD36_17180"
FT                   /product="Endoplasmic reticulum transmembrane protein,
FT                   putative"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43496.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG717354"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI000192D678"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS6"
FT                   /transl_table=12
FT                   /translation="MALYYNLVFGLLVFEMVFFGVLSLPYPRKIRRSVLSTVSAPFRNE
FT                   QFQIAIKCILGFVLVLFIDSVNRVYAVTSELHSSTASPGSTAVVDRSEIQARRFYAQRN
FT                   MYLCGFTLFLTLILTRTYSLVAELIATKDKVDDLKSTETVAEDSATVAKLKKELAQKDE
FT                   DLEILKNQAKSLSSEYEDVSELKERK"
FT   CDS_pept        complement(497445..499085)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582826"
FT                   /orf_name="CD36_17190"
FT                   /product="Extracellular matrix protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43497.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG396136"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniParc:UPI000192D679"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS7"
FT                   /transl_table=12
FT                   /translation="MSDSSSLPLGLVIYSAVKPIFKIYFIIAIGFYLAKRNILSVSTCR
FT                   DISDTVVTAIMPCLIFNNIVSNLKSSDIKNIGIIVFTSALLFVFGGLLAYGIHIITKSP
FT                   KRWLGGLISVGIFPNISDLPIAYLQTFAKGGVIFTTAQGEKGVAYVCIFLMAMVMCQFS
FT                   FGLFRLIEYDFRDELKVDEENKECSDSESSIRRQIEHEKSTNPSATGIGAEESRATPNN
FT                   TNSDSDSIISQAVVSDQLDIDEEEQDQHNQFLKTKAEQADKTRSRSSSDGSEGSVVRRR
FT                   TSNTSELSVPYTITSVLSRTSDLRRQRSQNVQDVINEYSEFDALRNNEVQRTRTATSEI
FT                   AAEPSVKSESKVTNYLKQLFKNITTPCSLSLILSIAIAMAPPLKALFVTSNFYIPNAPD
FT                   KLPPLSFIIDFTSYVGAASVPLGLILLGTTLARLQVKKMPPGFWKTALLITVARLIIIP
FT                   IFGVGVTTGFNQGGWYGGDSLVRFVSVLEFGLPNATSLVYFTAFYTDPLSEEHLQMDCL
FT                   AICLICQYAILWITLPFLTTFTLKVSMRL"
FT   CDS_pept        complement(500525..501058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582827"
FT                   /orf_name="CD36_17200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43498.1"
FT                   /db_xref="HOGENOM:HBG396135"
FT                   /db_xref="UniParc:UPI000192D67A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS8"
FT                   /transl_table=12
FT                   /translation="MSQINLLEFQDYLLYSESLNILIESEFISMSSDTTAFQPPPTIVP
FT                   EASMNPDTIPKRSPARLFQRWRSSSKDKPAFSEKILPKKQNITPEPIAITKQEAPTKQI
FT                   VTSEPSSPLSVASSHDHSCTESSAASIFSDSKNNSSMQMLLTDDIEDILEDIDDAEIYD
FT                   AEKVTVTYISSKSC"
FT   CDS_pept        complement(502852..504468)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582828"
FT                   /orf_name="CD36_17210"
FT                   /product="FACT complex subunit, putative "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43499.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG592027"
FT                   /db_xref="InterPro:IPR000969"
FT                   /db_xref="UniParc:UPI000192D67B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAS9"
FT                   /transl_table=12
FT                   /translation="MVNTDFEKIYLNQSKSGGRMRIAESGLGWKASTSSGSVSQPFLLP
FT                   REGILIASWSRGSKGYELRVQTKNKGVVSLDGFDQDDFTQLKQELTRNFHINLEHKEHS
FT                   LRGWNWGKTDLARNELIFNVNNKPAFEVPYADISNSNLTGKNEVAIEFNLDNNKNGDEI
FT                   VEMRFYVPGTIENETTIVKSENNGDVVEEAVINETSAAQQFYEQLKDKADIGQVAGEAI
FT                   VSFSDVLFLTPRGRYDIDMYPSSLRLRGKTYDYKIQYEQIERIFSLPKPDETHHLIVLQ
FT                   IDPPLRQGQTRYPFLVLQFVKDEETELELNVSDEDFEKKYKDRLKKTYDAPTNVVMAHC
FT                   LRGLTERKLITPGAFQSRYLQAGVSCSVKASEGYLFPLDRCFLFVTKPTLYIPYSEISN
FT                   VVMSRTGGGVSASRTFDLEVNVIGSNQSHVFSNIDREEQEFLESFCKEKGVKVKNEEKI
FT                   AKARLAKALEQEANDDDDDDADMGSAGDDDEDEDDDFQSGSDSDVAEEFDSDAAPSSDD
FT                   DEEMADNNETDDRPPKKKAKN"
FT   CDS_pept        505060..506157
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076768"
FT                   /orf_name="CD36_17220"
FT                   /product="Aspartate-semialdehyde dehydrogenase, putative "
FT                   /EC_number="1.2.1.11"
FT                   /function="NAD or NADH binding"
FT                   /function="NADP or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX43500.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG518238"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D67C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT0"
FT                   /transl_table=12
FT                   /translation="MSVKKAGVLGATGSVGQRFILLLSKHPEFEIHALGASSRSAGKKY
FT                   KDAASWKQTETLPETEQDIIVQECKPEGNFLECDVVFSGLDADVAGDIEKSFVEAGLAV
FT                   VSNAKNYRREKDVPLVVPIVNPEHIDVVENKVKQAVSKGDKKPGFTICISNCSTAGLVA
FT                   PLKPLVEKFGPIDALTTTTLQAISGAGFSPGVSGMDILDNIVPYISGEEDKLEWETKKI
FT                   LGGVNAEGTEFVPIPESEMKVSAQCNRVPVIDGHTECISLRFANRPAPSVEEVKKCLRE
FT                   YECAASKLGCHSAPKQTIHVLEQSDRPQPRLDRDRDSGYGVSVGRIREDSLLDFKMVVL
FT                   SHNTIIGAAGAGILIAEILKAKNII"
FT   CDS_pept        506338..507180
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076769"
FT                   /orf_name="CD36_17230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43501.1"
FT                   /db_xref="HOGENOM:HBG396134"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000192D67D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT1"
FT                   /transl_table=12
FT                   /translation="MCHWATVIKQLELIQHDNIEDHIFELYSERQLQNNLGYVDRTANE
FT                   ITVTLPRNKIDLNITQSLTSLANQKSNPSSTGYICWKSSIHFTDWLISSECPFKLSKKF
FT                   TILELGSGTAAVCASVLSSKVQHFIATDQKHVLKLLRQNIENNVSSFTNSIISKNRGGK
FT                   HHQVIDVIEFDWENIDMGKLNIQSLNLQKQYPDVIIACDTIYNEYLISHFIKSLNTLMA
FT                   DSQKTVALVAIQLRDPITFEVFVTEVVQDRNLSLYNVPDHLLSDDLKNGYVVYCILKS"
FT   CDS_pept        507548..511180
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228145"
FT                   /orf_name="CD36_17240"
FT                   /product="Leucine permease transcriptional regulator,
FT                   putative"
FT                   /protein_id="CAX43502.1"
FT                   /db_xref="HOGENOM:HBG396133"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR017173"
FT                   /db_xref="UniParc:UPI000192D726"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT2"
FT                   /transl_table=12
FT                   /translation="MSLFGSSTIANGTPSGNIFANQSNFGNFLGGSQPNGNKQSNFKTA
FT                   LVFNNDKNTINTGSSEKNAHTPETWKQSSITPQKEQSTISAPKQISKLQVFKESDIVAA
FT                   GTLFEHPERLGFNHRRPTEVRAIPKCFLTQPKLLCTPPFVPNAWDQENQNKLNLMEAEN
FT                   GGRDYQGLYEEMQKLREIERTKMEELGLVDAENVAKDLTEAISFSGSCLDMCPVFERVR
FT                   RQLENNVKALEKDPISNKISRERAVKAFSRPAAGQPPPLPSDVRPPHVLSQTLNYLVDN
FT                   ILQQLPEAHSFIWDRTRSIRQDFTYQNNFGPDAVDCNERIVRIHLLSLHIMAGSDVEYS
FT                   QQQELEQFNKALQTLMEIYQDVRNNGGKSPNEAEFRAYHLLSHIRDPDLERQIQKLPDE
FT                   IYNDKLVQLALRFRKITTQNNVVERGVPNLVGALNLYTEFFRLVYSDETPFLMACLLET
FT                   HFNEIRFYALKAISRSFHTKTKPYTIQRLQQVLGFDSIEKLQKFLNYYDIDIINVNGEV
FT                   LVDLFNKEKLETTYKLNSFHEKAKYSPPYSTQLDNKYKGLDWKFFVNSGRPNTGIELNS
FT                   QPPTVEVVSNPQSSDFANVTSFKKPETINTFGSTGLQSQSQPQPQSFKVPNNGPERSIF
FT                   NFKSDTTSTPESIKPSNVNSVLSDTEQVKPVFSFPSNVTTTNSILKSNVPQQPLQSFGK
FT                   AAPNIAIPKESNLNKVPLKASPSLSFGITQPQNEKKKVKPSEQESAKVSTPALVKNSLP
FT                   AVPEKVKLTQSKMFPLALQQVFHQMLQDTVKSELQVVLSKLLTRYHSALERRKVIHSLG
FT                   FELYDAFLREVMYECVLEARAAQFYDFHLKKRKIKAIIRNSKKAVNKLREKKMKMYELK
FT                   SVNFEKLKKNKRRLSISSFESNSSFSKRKRHDSFDVSIISEKQLEVHELWAPFNLSIFL
FT                   RNCSENLKMKIYQNNLDLKFLLIVENWNSPYSKWLNSKLGLKANVKLSVLENSISNDKI
FT                   NLLITSMPNKEHLNEEFFANASFVLFECGLTLSNAISIHEKLQADGKILKKIISLIDKY
FT                   SCYKVSIIINFWDVSGSNITTSEVASLLDLTQYTTVSNLKSLVLCDMTTKNGNINTILS
FT                   QAFNKVSLEFNGELSSTGSKYEYNETKSKSKSKSQSQMLQKLSHKIANHKIRDMANLSY
FT                   NSSIIEESTPQTSPKRKKVDDNRANTSLSQLQDLTAEIRRKYKK"
FT   CDS_pept        join(511760..511834,511930..513192)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380925"
FT                   /orf_name="CD36_17250"
FT                   /product="Epsin, putative"
FT                   /protein_id="CAX43503.1"
FT                   /db_xref="HOGENOM:HBG396132"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI000192D727"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT3"
FT                   /transl_table=12
FT                   /translation="MDLLKDAAKNLNLYEVKAYVRKAQNVAMNLTEMESKVREATNNEP
FT                   WGAPSTLMAQIASGTYNYREREEIVAFIFRRFTEKAANEWRQIYKSLQLLDYLVKNGSE
FT                   RIIDDVRANISLIQMLKSFHYIDSKGRDQGINVRNKSKNLIAFLNDDNLIRSERKKARA
FT                   NAKKFGGVSSAAYGGASSMGTGFGSGGSTFTGDDEDFANRVYGDGGVYGERFDDPASAY
FT                   NNGATGNDNFEEYDVQASSSQATSKPTTSSSRVNAQASKKEPQNDLLGDLLSFDGDGQQ
FT                   KNTNTATPSRVTGGGVAANDDDDDDFDDFQAAPSQPQKPANLSNSLNNLYNTSSQQQQQ
FT                   AASRQNYNVSYQSSQSTGPAKTTSNNDAFSSLFSSAKTKSKTSAGNTSTSSTATPTAST
FT                   NASNHTTGANDDFFGGFSSSSSNTKPATNGNGTNNTNSGDIDLLSF"
FT   CDS_pept        513672..514247
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380926"
FT                   /orf_name="CD36_17260"
FT                   /product="Peptidyl-prolyl cis-trans isomerase C,
FT                   mitochondrial, putative"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX43504.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000192D728"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT4"
FT                   /transl_table=12
FT                   /translation="MFKTALTKPLSLNSARFFSTTPRAFGTKVFFNTSINGEKQPPITF
FT                   ELYDDVTPITAENFRVLCTGEKGVGYKGSIFHRIIPQFMLQGGDFETGKGYGGYSPTHN
FT                   NDKFNDENFIKKHDRPGLLSMANAGPNTNGSQFFITTVPCHWLDGKHVVFGEVVDGFDV
FT                   VKKIEGCGTSSGTPRASVVIEESGEAEK"
FT   CDS_pept        complement(514497..515243)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533794"
FT                   /orf_name="CD36_17270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43505.1"
FT                   /db_xref="HOGENOM:HBG396130"
FT                   /db_xref="UniParc:UPI000192D729"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT5"
FT                   /transl_table=12
FT                   /translation="MKFTFKFPISTLFKYKPQKFNFGLEQEIRSKLNSLPSVTKIYTNP
FT                   DGSPRVPTDEEFKTIAELQNLYYKRNYSEWNWILPGIPKEQLQLFKDNSQDLTHFGFVS
FT                   KDSGKIIDKIPYKDASTGELKWKIIRETSKAEGWEIPYFYIVLPVFAYIFYVKYTQQTK
FT                   LRELEGPDWAEKELRLRAMEDYFHGDTAKAKEFLSNEGKSKREIQDRDDLVVARILAGD
FT                   YDKLAELKKKLPKDLIKTEEDPVFKY"
FT   CDS_pept        complement(515625..516350)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567222"
FT                   /orf_name="CD36_17280"
FT                   /product="U4/U6.U5 small nuclear ribonucleoprotein
FT                   component, putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX43506.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG396129"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D72A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT6"
FT                   /transl_table=12
FT                   /translation="MTNESSEKELDKISTDQYGRKKWNVDLYEKEAKDRTNQSTEPSNA
FT                   TTTNQINDHSSSLEYIEHRNKLLNDSINAVKQYSLINPQTSTSTITFGKNKRFGFFCPI
FT                   CDVSFRDNLLLIDHLNSPQHVSKARQMNTDAENSTEEVFLENGIRRASLKEVISTMEKL
FT                   VAKSISEKGNSEDGATGLTFKQRVEKRREYENRKRSKRAERKQVQRQRKKHKKSDDTET
FT                   NAKINDLMGFNSFGSTKLT"
FT   CDS_pept        516496..517290
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093606" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567223"
FT                   /orf_name="CD36_17290"
FT                   /product="Polynucleotide 3'-phosphatase, putative "
FT                   /EC_number="3.1.3.32"
FT                   /function="polynucleotide 3'-phosphatase activity "
FT                   /protein_id="CAX43507.1"
FT                   /db_xref="GO:0046403"
FT                   /db_xref="HOGENOM:HBG396128"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR015636"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D72B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT7"
FT                   /transl_table=12
FT                   /translation="MTKKNVQRDILSMFGNSISKNSKIKKPSVTKNTPNTISKELLRQN
FT                   LNNSNPTFASNWTIKQTFLIQNISIKYGDTKAVSLIKVAAFDLDGTLISTKSGGTFSKG
FT                   PSDWKWWNDKVLDKLKDLYNNNYLIVIFSNQGGVVATPSSKSYLNFTAKLNSIAEELKA
FT                   HNILERISIYAAPKKPSVKSRNSSISTISEEMHAKMRKPETGMWDTFLLDLKKNGITQD
FT                   IDYMDSFFVGDAAGRSKDFSDSDVLFSKNINLKFITPEELFT"
FT   CDS_pept        complement(517308..518189)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228146"
FT                   /gene_name="AIM36"
FT                   /gene_synonym="FMP39"
FT                   /orf_name="CD36_17300"
FT                   /product="Altered inheritance of mitochondria protein 36,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAX43508.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG396126"
FT                   /db_xref="UniParc:UPI000192D72C"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WAT8"
FT                   /transl_table=12
FT                   /translation="MFTRLAPRLQPQLLSTKRVLTTRYPTLVRTPIFHQTPIQIIKRNY
FT                   VIVHKERKKEPVIRYLFYMLVASWVAIYFVANRVDKKKPPKQSFTEREFQSYEEETGLK
FT                   RRNKLISHHMNSKYKFYVIPYVHDEEELNRVANLLQHKDENATVKIIDPAQLIEEQKKD
FT                   EGMKYHYLLEDLDEQGKPYPPGLITAVIKQEIYKILNTREGTFDTNFLIKNYPQTTNEA
FT                   IKFENDISDIQKCLILHYDMLNELPKNKTDEEQRAIKNVDGYFSSVGKSKTLVEKFDPM
FT                   DKEFEDIILEDI"
FT   mat_peptide     complement(517311..518108)
FT                   /gene_name="AIM36"
FT                   /product="Altered inheritance of mitochondria protein 36,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WAT8 "
FT   transit_peptide complement(518109..518189)
FT                   /gene_name="AIM36"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WAT8 "
FT   CDS_pept        518450..518917
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567224"
FT                   /orf_name="CD36_17310"
FT                   /product="Mitochondrial 40s ribosomal protein s8, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43509.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG735443"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniParc:UPI000042E93A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAT9"
FT                   /transl_table=12
FT                   /translation="MSLVSLSKFCAHVKNCLNVTLSKTSVPYNRSNLQVAMALYQQGFI
FT                   SSIQRGSTVGPDLKPTEVTPDNINSRRLWIDLKYRNNQSVIRQLELISKPSKKIDLTTE
FT                   EIKALASGLKVRNIPALQPAECIFIKHDKDILEVQEAAKKGISGQALFRVR"
FT   CDS_pept        complement(519011..519754)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228147"
FT                   /orf_name="CD36_17320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43510.1"
FT                   /db_xref="HOGENOM:HBG396125"
FT                   /db_xref="UniParc:UPI000192D72D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU0"
FT                   /transl_table=12
FT                   /translation="MSDSERDLTIEDTNVSDTELSKEERLEAARKKFEELKKKNKKKKS
FT                   KKSKKSETAEIEESAEGTPVPEDKTEDKKDDEDIENAKETKEEIAEESQTEKEDQSKVS
FT                   KEAISESLSSTSELEKQIEELKQTVDQQKSTIKKLRDENTDLKLSKMDLNDKISSLEQE
FT                   NKGLKALASSASSVPGASPIVTYKETFKPAKPVFTKNDYASSSQQSFSKSNATEDFREK
FT                   LMVWKSWQVDMTNWNGSGTTQKVAL"
FT   CDS_pept        join(521079..521675,521741..522805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076770"
FT                   /orf_name="CD36_17330"
FT                   /product="Ion transporter of major facilitator superfamily,
FT                   putative"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX43511.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG396144"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D72E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU1"
FT                   /transl_table=12
FT                   /translation="MFDQEINKIPEYEMVPGTIQLVDVTGTLEVEKNGDKSNIILQPPP
FT                   SKNINDPLRWSKRKRRIQFFLLFIWSFLQSSTSNFTGPLYDAFVEALDVTYQDISNTAA
FT                   LCFTGLGLGVIIIQPCAAKYGKRVVYLTCTLIAIIGCIVGGTGKNLASLYIFNFLSGLG
FT                   ASPVDSIAEVSANDLHFQHERSTALSVIIMALYFGSFLSPVAAGYITENPHLGWRWCFY
FT                   IQIIIYAVLFIVMFFVLEDTTFTRDLKREDEFEEQILHQVQSMRSKDNVDVILSSSASV
FT                   KSEENESIDESSIPKKTYWERMKLIHTEYGDHRSWLLIFVRPAFLAYFPAIIWSSCAYG
FT                   AQMMWLSLMGNTQTIFYASEPYNFTADKVGLTNLAPFVGVVLGMLYGGRFVDCFSLQKA
FT                   KRNYGISEPEHKLWTMVVPLLFNAAGLIAYGLGPYYGAHWAISVIIGQGFLGFAMAASG
FT                   TLCLTYGAFDCYHKLAGESVVLILFIRNMFGMIFCFACQPWLDNSGVFWTTITMCILSI
FT                   VINGGFAILLVWGKTFRKWTAGPYERYSNSNYGNIF"
FT   mobile_element  complement(523001..528815)
FT                   /mobile_element_type="LINE:2B, complete Zorro4"
FT   CDS_pept        complement(523330..526887)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093608" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380927"
FT                   /orf_name="CD36_17350"
FT                   /product="Polyprotein of L1-like non-LTR retrotransposon "
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAX43512.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="HOGENOM:HBG398389"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR015706"
FT                   /db_xref="UniParc:UPI000192D72F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU2"
FT                   /transl_table=12
FT                   /translation="MTATNYLNHFKIASRNIGSRLSSKTVAPIRDIILELTTSNPEVDI
FT                   WMIQEIRLYNQLQLQQLKNTLKSKNIMVIMHHYSDLTAFIVFSPYQELKFDLLELTNEE
FT                   IINVAHRVSSLSIRLFSGESVLLLNFYLPSGNYNAQKTIMESVSAQLSNLQKKNERYLI
FT                   LGGDYNHVLDPQKDVLVPKDRVLAPIYRPEKDIIEFMTQFIEKFQLQDGFRLKNPTRVE
FT                   PTNQQGPDMIQRRLDRFYFSLNLNSKFHGYSLLQENRCISTHVTISMLFRINKKSPLTV
FT                   GPSRFCLSRTLLGDSDFMQYLNRPISSSNRSGFQLWDFQMNYIRQQVGIFKRALRTIRN
FT                   HSQNEIAPSVSVGAEDHDWTLEKKLKFRLRGPDLQEYIINMVSASGQQLTTTEDMLQEA
FT                   TCFYKQLFSSMPSHRIQYDFISSFEPTLNLLEQNKLEAPFTENELYQQLQQIKKYTATG
FT                   LDGISYYGLVSLWETLGPSLTMAANYILETGTLPLSMQKVIIRLIKKSPKSAGTIGDFR
FT                   PISVTTCALRLLSSCFETRLKSSATTLIDAAQTGFIQGRSIDNTINMVGMVMTELTKPS
FT                   TDIDDYACFVALDFHKAFDSVSHDYLNELLAHINCGHRARNFLMAITTQQTAQVTINNC
FT                   LGEEFVLNSGTRQGNPVSPFLFILSLETLLSKINQNLEGASFLGHRFRLAYAAYADDVI
FT                   IFCKNQQDQQRLLQLLETFGQDSGLVINKHKSKIFYYRTPPLEKILPFPAQCLDLESFS
FT                   YLGIPMKEADENYDPWKKKLRDLLAQIYLAPTSDLSIMVTIKLMNVFIFSQLYYMDLHS
FT                   PISAAAIKEIYKKIQGCLPFRIAIDRLLTPKHLGGFGLINIASQVKGKRGKQIYHLFTH
FT                   SHDPLVRAFKFKLQLTINEVLQPFIKQDSSLEGTSIFPWFRFLCDIKPLCPLGKKQFQQ
FT                   RVFSKLSKSALSWLKAWFDITSYHGPYIYETISHMSGQEYESLFEEDFTYILQHVEGVD
FT                   GKALTEGSFHHLSQKLSSKLPIIPKGWSSNTELQFITSLQWKRFWSRLSDLQTENLGSL
FT                   QTYHLFVLGYYSHYPFYKPVSSTSSNRSSATFFLGNIAREALSQVENNQEASQNSEDVV
FT                   TNQSTHIPSCRFCQMDASDHIGHHAFECQDTLSLWPFGQFPQRSYSFVIGNSQNTDEQY
FT                   FLINKYLGVLLNQVKRRQR"
FT   CDS_pept        complement(527130..528848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076771"
FT                   /orf_name="CD36_17360"
FT                   /product="Retrotransposon protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43513.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398534"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000192D730"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU3"
FT                   /transl_table=12
FT                   /translation="MCLKRENKKKKKKKKNFFSMSKRPKGLEITAQNFEDGSPKDPPSH
FT                   SLPSQSQPGRLDIPSNSQMGHPVAPSSPNFVSSNLNSQNKSSQQTIGPVHDPALIPSQQ
FT                   STQPEPNHAKVVDYAAFARSIHAENSKHPKYRELKRLESAHCPIDLYDLANRNNNINVP
FT                   KTQLTADISPMYEFATSEQVVNTIYFTLNQARDIYQEQLSELSASFLAEIANYERDPQR
FT                   YLQDHESIPKWSDDYTLDNFYESRAMSEMLHACTYFEIDNDHRLYLEAFDLTYIKKAEF
FT                   EHLKQLLIDEIERLNFVVGDHSFQIQVDDKVEHMYVASFRLPSISLRSCVQYFREFLDP
FT                   KDEIVHARIPVFSHEVMSMNPGYVNAYFILKLKGDKVPPKRKVILQRNYSVRILTNLSH
FT                   CVYCHSKSHTRLQCPEAGECNACGQLGHRALNCESRKRRGPAAVPMNGPVKILTKPSVE
FT                   TSQKVSVDGQSKEHNDSAPSGFVDTIFDSDGQEIFHIDPNKSWNDIMEETEDGFIDGSQ
FT                   LNRQQRNLYKNKLRQIQKRKASPSPRTSSPAIDSIMVDSDLVGNDLVVSGDATQS"
FT   CDS_pept        528933..530465
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567225"
FT                   /orf_name="CD36_17370"
FT                   /product="Transporter protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX43514.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG396145"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D731"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU4"
FT                   /transl_table=12
FT                   /translation="MTSTNTLENVTLSNQPHDSDHYRSNIELQSLRKSTEDSIAVIENE
FT                   VPSTPVEEPSEYMLRRREGSHVVPFTESPGDSPRYDSRALMYGSEKDHASFPDGGTQAN
FT                   LVLLGSFIGLIADFGIANSLGAIESYVSSHQLKDISKSQVGWVFSLHLGCMYWFGVFFG
FT                   EFFDKFGAKRPLIAGNFFMCLGLLCTAESHSLYQFILSFSIVTAIGTSLAMSPLIGVLS
FT                   HWFLKKRAIACSVATIGGLVGSSCFTIMLQQLYGAIGFKNAIRILACICFILMAVSTIL
FT                   VKERKVVNESEESEGKPSIFTKIAQFFQGALDFSALKDMKFVSLCFAIFLSEVISMTTL
FT                   TYLASYALTYSIDETKSYLMLTLVNVCGIPSRLLSGLLADKYGRFNVMCFSATLTTVFI
FT                   FGLWYPANNMALLFAFSILFGISSSAVISLIPACTGQICSAERFGKVYGTLYFFLGFLT
FT                   ILGMYLATLVIAEGTPESYSHFVLFEGALSALSIVVWIWARFSAVGWKWCKF"
FT   CDS_pept        531835..532947
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533795"
FT                   /orf_name="CD36_17380"
FT                   /product="Zinc-regulated transporter, putative "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43515.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI000192D7F0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU5"
FT                   /transl_table=12
FT                   /translation="MNSDSISRVFEYLNKRDECPTDNDYNGNIGTRVSSIFVIMVTSAI
FT                   GTLLPLLSSKYSFIRLPPMVYFICKYFGSGVIVATAFIHLLEPAADSLGNECLTGPITD
FT                   YPWAFGICLMTLFLLFFFELLAYQGIDRKIAKESQLDNQGAHTHSHFGDASMYVKKDDV
FT                   EEDLENQDEKNTDSNPYPSHFAHAQEHQDPDVMGTAVNDQSKEQYYGQLIGVFVLEFGV
FT                   MFHSVFIGLALAVSGDEFKSLYIVLVFHQMFEGLGLGTRIATTNWSRHRYTPWILAICY
FT                   TLCTPIAIAVGLGVRKSYPPGSRRALITNGVFDSISAGILLYTGIVELMAHEFLYSGEF
FT                   KGPGGFKNMLLAYFVMCWGAGLMALLGKWA"
FT   CDS_pept        complement(533339..534226)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228148"
FT                   /gene_name="PLC22"
FT                   /orf_name="CD36_17390"
FT                   /product="Phosphatidylinositol-specific phospholipase c,
FT                   putative"
FT                   /function="phospholipase C activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX43516.1"
FT                   /db_xref="GO:0004629"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG396165"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000192D7F1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU6"
FT                   /transl_table=12
FT                   /translation="MVDYKTWLKDIDNNTKISKLSIPGTHNSAACHTALPSVQCQGASV
FT                   TEQLEHGVRFLDIRVGKLFVGNDVKDLQVIHGKFPVKIPFPLKLNDTLEEVYKFLAHNS
FT                   SETVIVSIKQEGSDDWDNSQDEFGKLIWDKYVNPNKDRWYLNTDIPKVGDARGKAILFR
FT                   RFGVQDEQLKKQFGFSASSWAYNTTNDDRGQFVVQDFCEVNSADDLPKKIDYVKDLAKR
FT                   AQDYTSNSDDKVFLNFTSASNFFDQSCWPQPIAEAMIKGNIEETFHKGVGIIVLDYAET
FT                   DNWKLPEALIDTNF"
FT   CDS_pept        complement(534610..536121)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533796"
FT                   /gene_name="HGT20"
FT                   /orf_name="CD36_17400"
FT                   /product="Glucose transporter of the major facilitator
FT                   superfamily, putative"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43517.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG396147"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D7F2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU7"
FT                   /transl_table=12
FT                   /translation="MPSTTSKHNFLDKRHSITPLLGWSTFIICLSALQFGYHLAELNAP
FT                   ADVLSCNFKKPGPLPSYKDTVWSHFHFNQCINMTEQGVALITTMFTIGGLLASIILGIT
FT                   SISTNYGRKHLCIISALFYVLGSFSMSFSQTVWQINLGRIFSGVGAGSSLIVSPILINE
FT                   LAPLNHRGLLGSLMQLAVSVGIFVAQIVSYVYSNDQQWRLIFLVAGLIGVVQFVGLLTV
FT                   PESPKWLTMAKNDVERATFILKGLRSDESTVNHEIQHWGNLTTNSSPDDEVSSLLSDGS
FT                   SSSQNLPSIPTKDFFMERKYRKQMIAVVLIMTGQQLVGINAITYYGVKILNKLFSGSNT
FT                   GNLVLVLNCVFSGTNVAASIAVAPLIDKWGRKPLLMTSITMCAVCTTILAVGIPNRYDI
FT                   AVVTACIGFVTGWALGLGPLPFLMISEFTGHDVVATAQSLGTVMNWGSNMLVAILFPVL
FT                   TDTFGIGMVFWVFVINSLVYGFGFYHYVPETKGFTHSHDVWERFS"
FT   CDS_pept        536938..537348
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164754" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567226"
FT                   /gene_name="FMP21"
FT                   /orf_name="CD36_17410"
FT                   /product="Hypothetical mitochondrial protein, conserved "
FT                   /protein_id="CAX43518.1"
FT                   /db_xref="HOGENOM:HBG738918"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniParc:UPI000192D7F3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU8"
FT                   /transl_table=12
FT                   /translation="MLARIFKHPLNLGTLRANTSSIRYFSPPSKFDFQPGPPRLPKEQQ
FT                   KEFEKLQSIANSQIAIEEYNDQIAQQQAEGSMQEPKAPIVNSEIGSFSSLKLVPDFEGD
FT                   VNPKTGERGGPKQEPLKHTKDEWSFNGRVIDF"
FT   CDS_pept        538014..539327
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380928"
FT                   /orf_name="CD36_17420"
FT                   /product="RNA polymerase I-specific transcription
FT                   initiation factor, putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX43519.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG396148"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="UniParc:UPI000192D7F4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAU9"
FT                   /transl_table=12
FT                   /translation="MSRQDWFTGPVCGTDNCRSRIYRNQDGLTICKFGHVLEGAVEYND
FT                   DPEAGGIVQTRRLNTISFDERGQLSSAVISNSQNIKPRSDRLYGEDAVTLYYRCFQILL
FT                   KKELDIFIDLFFSEGIRHDLTLIVKNNWAKVLSTDELQETHPKRQVLDTLDLICMIYIS
FT                   ALQLQAYPIYIPDLIDNIKSNAIPYIRTLHLIPKHMLDQLPTVYHNRLQPYSLPENGQI
FT                   YKRLQTAGSRTVGATLKIPTSFYFPFMFRVLSEHFLLVNAVDLFLSAFNLLKSASYFEI
FT                   SFRTKKFIQKFPEIHISSVLIILIRENFRSNDDLKSWLYELNKYEQNNEYNSGGTSLLN
FT                   WSDNKVEKYCDWIYDNLIPKKAKLNDDNTEALNTMEKRLFQIFSLENDIESTPQKTNET
FT                   SLYLALRNIMKGSELKERGDFQALDVKLDAKLSNLLGL"
FT   CDS_pept        complement(540031..541392)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567227"
FT                   /orf_name="CD36_17430"
FT                   /product="Aminotransferase, putative (Biosynthesis of
FT                   nicotinic acid"
FT                   /EC_number="2.6.1.-"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX43520.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D7F5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV0"
FT                   /transl_table=12
FT                   /translation="MLKRIAPIRQLYRTSRAMATKSTDPTSLHNPYFHQKPGQKDIWSL
FT                   INETAAQAQQESGEPIVNLGQGFFSYNPPEFAINAVGEALTKPQFNQYAHARGNPNLLK
FT                   QVAEHYSRSYGRAVGIDEVQITTGANEGMFAIFFGFLTPGDEVIVFEPFFDQYIPNVEM
FT                   TGAKIKYVEIKYPKKFDNEVVAGQDWEIDWEGLNNAITDKTKIIVINTPHNPIGKVFTE
FT                   EELYKIGKLAVDHNLILVSDEVYENLYYTNKFPRPAALPQLPELAERTLTVGSAGKSFA
FT                   ATGWRVGYIQGPANLIKFVTAAHTRICFSTPAPLQQAVSQGFEQAEKTNYFETTRKEYE
FT                   HKYKIFTKVFDDLGLPYTVAEGGYFVLVNLSKVKIPADYEFPETISDRGTLDFKLAYWL
FT                   IKEIGVVGIPPTEFLTESNRKGNGLENCVRFAVCKDDAVLEDAVERLKKLKDFL"
FT   CDS_pept        complement(541726..543399)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380929"
FT                   /orf_name="CD36_17440"
FT                   /product="Uroporphyrin-III c-methyltransferase, putative "
FT                   /EC_number="2.1.1.107"
FT                   /function="binding"
FT                   /function="uroporphyrin-III C-methyltransferase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="siroheme biosynthetic process "
FT                   /protein_id="CAX43521.1"
FT                   /db_xref="GO:0004851"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019354"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326453"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D7F6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV1"
FT                   /transl_table=12
FT                   /translation="MTNLLTSNTTAGEIHLLIGYSAVSNTRITSIIESGANPILITDSQ
FT                   PQSFPPNMTQYVTNNRLEVVVDEDFSTKILHYLSTLGRPEVDHIVDRVFVSLSNSRLPL
FT                   KQEIYQRCCKLRIPVNTTDSPDLCTFTMLSTYTSGDFQLGVTTNGKGCKLASRIKRELV
FT                   NSLPRDIDVICKQVGQLRRQIQLEDKSESEHGEHEDDAINNHKFNTFVPEFNKTQEDLK
FT                   LQRARWLSQIVEYYPLKQLGSISIKDLSSAYKLHKRANELEEGSKTGQMTLVGSGPGSV
FT                   SLLTLGALQAIQTADLVLADKLVPQQVLDVIPTTHHTRLFIARKFPGNAEKAQEELLAL
FT                   GLEALKRGEKVVRLKQGDPYIFGRGGEEFNFFSQHGFTPVVVPGITSALAAPVLSNIPM
FT                   THRDVADQVLICTGTGRRGAVPSLPDFVPSRTTVFLMALHRVVELIPLLVNNKRWDENL
FT                   PVAIVERASCPDQRVIRTTLSKVGAAVEACGSRPPGLLVTGYSCDVIWKRKISESLPWV
FT                   VEEGCSSRDDSDLKRIVELVNGNCKESSVVGLNLQKEIAA"
FT   CDS_pept        544160..545422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567228"
FT                   /orf_name="CD36_17450"
FT                   /product="Hypothetical nuclear protein, conserved "
FT                   /function="binding"
FT                   /protein_id="CAX43522.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192D7F7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV2"
FT                   /transl_table=12
FT                   /translation="MAKRTLGLAKAAKAKKQKKEQVHQESSDEESSSENQLTIELPEEI
FT                   DANDEISQLKGLHKTYLESERDNELLVNGLIHECDRLLRENDTENKSPLPPVFHAIYAT
FT                   ALAELSKFHTEELDKVKEYFTAALERVELGLQQNPNDITLLVTKTKILLDQISLQYIAP
FT                   LTLESDTKELDREIDELLDATLSVYESVEARAKELNDYSIFDDFETLDILEALDDILDI
FT                   VDNFGRKNQGDDDSDENDDDDEDEEEESVELSENHPLYKIKNSDKYDQWWRDHTHLYLD
FT                   NLEKLENGSSELKREVCQRLGQSYLQESEVPYSVFTTLKYDDEYDGIEELEGLTEKQAQ
FT                   EISQELITKALDYLKRAKDEEDPETWVGIAEAMISLGNLYEVDSKQQDDLYVEAEKILK
FT                   KANNVTNGKFKEELDNLLYKE"
FT   CDS_pept        complement(545778..546332)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567229"
FT                   /orf_name="CD36_17460"
FT                   /product="An1-type zinc finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43523.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396158"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000192D7F8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV3"
FT                   /transl_table=12
FT                   /translation="MKVTIRLSTESSFSVTIPDNATVDDLKQSIKVGLPADITLPPDFK
FT                   VIYNGSKLQPYYAELQSFGMQSAEDSSYTVIVMSDNVDTPPITPQQSIESSATSNNSTT
FT                   TTTTATTIKKTKKKSRCAFHNCNSVPLRMVGTCTHCQGKFCAKHRLLEDHMCTGLQYCK
FT                   DNAHEKNAMKLQSERTIVNRV"
FT   CDS_pept        complement(548580..548927)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567230"
FT                   /orf_name="CD36_17470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43524.1"
FT                   /db_xref="HOGENOM:HBG396157"
FT                   /db_xref="UniParc:UPI000192D7F9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV4"
FT                   /transl_table=12
FT                   /translation="MHSQPLPLIESPDSIELDPINHENLAIYGYLILISTWILFIISVN
FT                   SIFEIWRFIIQPLQLSSSSSIVLHDKLTSFFETIDSYIIKLWCIYVVCWWWAIVSWSGI
FT                   KLFRHSKGIQG"
FT   CDS_pept        complement(549593..551758)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567231"
FT                   /orf_name="CD36_17480"
FT                   /product="Glycerol-3-phosphate o-acyltransferase, putative "
FT                   /EC_number="2.3.1.42"
FT                   /function="glycerone-phosphate O-acyltransferase activity "
FT                   /protein_id="CAX43525.1"
FT                   /db_xref="GO:0016287"
FT                   /db_xref="HOGENOM:HBG324690"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI000192D7FA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV5"
FT                   /transl_table=12
FT                   /translation="MSRETPDSLSSSFSSTTTSQPHPHKHGKKKSMLHYFQLIIRSITY
FT                   DLVLFFFDCVVHTFFRDIRSTGNFNIPQNGPVIFVIAPHHNQFVDGLVVMTKVKEISNR
FT                   RIAFLIAKKSYDRMIIGQAAKLCGSIPVERAQDFLKSGQGKVFVDPSDDCILIGENTAF
FT                   TKQCQKKGLIGLPNSLGNCQIASIEDDTHLTLTKPFSSKNTEIQSRIDKTLRDGTSFKI
FT                   APHIDNHVVFENVFNHLNDGNILGIFPEGGSHDRPDLLPLKPGVAIMALGAIAQQMEEY
FT                   EDNDNNGNGKYEIQPISVVPVGLNYFHPHKFRSRVVIEFGKPIVVDQSMGKEYMEHHRN
FT                   TVDKLLKVVTFGLKQVTLTCDDYDTLMVLQAARRLYTSTNREQIPLPMVVEMDRRLIKG
FT                   YQQYKDEPDVKKLRDAVYHYNRKLMRLNLHDHQVESLDKFDKLKTFQMFVSRFFKFSLF
FT                   MGLSLPGIILFSPVFITSKKISARKAKEALASSSVKIKAKDVLSTWKILVALVLAPALY
FT                   IFYSIIGTYLIVKSQLVPHLSTIIIFSICYGWAVLTTYASLRVGEIGVDYYKSLKPLFI
FT                   SLISYEKDQLQIRELKKTREELRQRVNLFCNNYGPGMFEDYDEFYRNYNQMETETDYDE
FT                   YNPPPPHKALRRQNSWNSLDLTLNNLSDIPIFSAADLEQSNDISTSESSDEVNNEKEVE
FT                   AEDVENHSNEISLRLRKAMRAKRQNSF"
FT   CDS_pept        552970..554250
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228149"
FT                   /orf_name="CD36_17490"
FT                   /product="NADPH dehydrogenase"
FT                   /EC_number="1.6.99.1"
FT                   /function="FMN binding"
FT                   /function="NADPH dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43526.1"
FT                   /db_xref="GO:0003959"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D7FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV6"
FT                   /transl_table=12
FT                   /translation="MRRVSTFSLIYNPVFPPQPTNQQQIWSFFFQQLIMTISNSNLFKP
FT                   IKVSNKTIKNRIAHLPTTRNRATDDHVPTDLMKKYYTDRAKSGSLLITEATLISLDQGI
FT                   YSNVPGIWNKQQKDAWKEITDSVHSVGGTIAIQLWALGRVGNAKLLKDEGLPLTGVSPI
FT                   YENEKAEQDAIEAGNPIQELTQDQIKDIIYNQFAKAVKLADEAGFDFIELHGANGYLFE
FT                   QFVHPGTNKRTDKYGGSIENRARFLFEVVDHVSTIVDPAKLAIRLSPLNKFQVPFINPE
FT                   GQQDYSYIVEGLQRRADEGKGFAFIDVVEGRFTSDGGTEGCNVDFVREIWKGPLLRGGN
FT                   YTYDRKNDWKTIENDANADDRTLVGFGRYFIANPDLPDRIKKGNELNDYDRSTFYNKDD
FT                   YGYNTYPFYGEESKADPNVKVLGVPLA"
FT   CDS_pept        join(complement(555137..555190),complement(554538..555059))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567232"
FT                   /orf_name="CD36_17500"
FT                   /product="Transport Protein Particle subunit, putative "
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="CAX43527.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG381378"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR016721"
FT                   /db_xref="UniParc:UPI000192D7FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV7"
FT                   /transl_table=12
FT                   /translation="MSKKTTGDDIWKNSVDKINSELFTLTYGSVVAQLCRDFQNNYLEV
FT                   NNQLDKMGYNIGLRLIEEFLAKTGIRRCQTFKETAEVVSKLGFRIFLNIQPTVENWSND
FT                   GKSCSLVIPEPNPLTEFVELPITTDSKIAKELWYSQILCGVLRGALQMVQLDCDVNFVK
FT                   DVLRGDDRTEIRLKLNRILKDEVPAGED"
FT   CDS_pept        complement(555581..556609)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203350" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567233"
FT                   /orf_name="CD36_17510"
FT                   /product="Syringomycin response protein, putative "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43528.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319731"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000192D7FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV8"
FT                   /transl_table=12
FT                   /translation="MNTFKPPANLSRVLSQPTFFEKITITEQPSLINGIPDGILALIVP
FT                   VVAYWSYSMFFHIIDVYELAEQYRIHPSEEEKARNKVTLYEVIRDVIFQHIIQTIAGFA
FT                   VYCIDPIPKTGYEMYAMWNLKYNHLPSFVPDWAIYYGYMYGWSIFRILIAFCIIDTWQF
FT                   WLHRIMHINKALYRRFHSRHHRLYVPYACGALYNDPVEGFLLDTLGTGIASLVTGLSHR
FT                   ESIFLYTFATLKTVDDHCGYRLPYDIFQIIFPNNSVYHDIHHQMWGIKNNFSQPFFTFW
FT                   DVLNNTQYKFVNEYKDLQKHITLTKYKEFLAKKSSSKSKSKQELEIEEEEEIIDKETKK
FT                   DI"
FT   CDS_pept        complement(557819..559453)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228150"
FT                   /orf_name="CD36_17520"
FT                   /product="GABA-specific permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43529.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324420"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D7FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAV9"
FT                   /transl_table=12
FT                   /translation="MRSITSRTEDHLHNVISHRSEVRSIDPQHNAGDVELLAQIGYKQE
FT                   LRRHYSTFQVFGIAFSIMGLLPSISSVLSIGLEGGPAALVWGWISASTFILCVGTSLAF
FT                   LGSAIPTSGGLYYYTNYYCPDAFRVPLSFMIGCSNSLGLIGGLCSISYGFAVQVLSAVY
FT                   IQQDGGFEITNAKCYGIFVACVVSNALICCLATKQAALLQTISIVVNVFLVMLFLIAVP
FT                   VGTGHGFNSAGYIFGTLINNRDYGTVWSFFLSWMPAIWTIGSFDSTIHCSEEAKNAQRA
FT                   IPVGIIESISACGILGWAICIVCAACIKDGDVSRVLESDTGSAMAQIIYDALGKKWAVA
FT                   FMSLIAVGQYLMAVSEMIALSRQIWSFARDDGLPVVYNFVKYVNPRIMVPIRASIFAGA
FT                   LSTLVGLLVLIGDAGSGALFSLAIASLQLSWGLPVLLVLLPYGRKKFISGPFHFGPKTN
FT                   SVINVITICWSVYAIVLSMFPDTRKVNKESMNYTVVINVGVWLLALVYYFVWGYRFYSG
FT                   PKSNLDTDDDVVFGTEPEVFAINEEKK"
FT   CDS_pept        561075..564644
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076772"
FT                   /orf_name="CD36_17530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43530.1"
FT                   /db_xref="HOGENOM:HBG396156"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000192D8BA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW0"
FT                   /transl_table=12
FT                   /translation="MTSTYKSISYLPILHNPFLNCIFNNPQYFKSPLKGVVDELQSNHT
FT                   NFTILVPPAHVLNEYYDPTTESSNSKTPLKELCYNNEDFIRSHIINTASPVSCTITPIS
FT                   KEQSVIYNTLNNKQVLIKNRIIYTGKGFRRSLKLKTLSIQYFSSFCDYFPKRSKFMIIY
FT                   IESTLFGGIPPRKMLPPLPQVRESNETKKDIDSVTFEKLLRSFPLLSKAVSDKFYRLFH
FT                   HNNYQFRVLRYKNRKKLSHIKLEFQKILQEAFSIISDSVNVDNPNSEQTYNLINHIISM
FT                   YPGIDLNKLVHEYVELNLYDVLWSQLIFQFNCPNDDKETYDPEAFLILTKEKYEKLSCL
FT                   SLNQLDIPVNEPWLMNELHERISLGVQEFEKLTDSSIMNSAAKTQVVYNTFRILTQRKS
FT                   GTVDPVINADTLIGLLIMVIIHSKIDNIEAHIYYIKHFNSIDNTNDGQFNYIMSNLDAV
FT                   LFHFSKKESGYLDLIENSKKNYETWNAIKNNDLEKVESILKLVKNEYPDTELPENHFIK
FT                   SKNINGESCLMFAVKAKRYDIYDCLINSDPNWIPIDSILFEKNVMTNQNLLMCALIEET
FT                   DDKIIDDLVDIILENATLDEQIIYFNMTDISGRSVGHYLFHNYKLISKIGPLIDWEKKD
FT                   NNSHTPLFSLCRCYDHPEYVELIEAGFDCVYKKYGETGVDYDKHVDKSGNTLLHVLLRG
FT                   IPESKMLSNRDNLVNVNQLNQRCLSPLMVYVKYNRLENLKEVLKDSRLDFLGEDFKNHY
FT                   NVFDYLSFSALKSTKSEKFQNIENVVFDYYLQNYFPHGATENVVALNAKYDGGKKDWLI
FT                   FFKNGDGFCNYKSLRNIKQILYLTKLRQPLSAFPSEEAFWKNYGFGISTSPMFHKVRIN
FT                   RLIDDFNLLFEGLTFQESINRSEFFKTFLTEYSQETSILESKRKISEQLDMNKQSLGEI
FT                   TYKLSQIQEIEYFLEYSLSNFQKYAYLFSRLAKLVCIGDSKQVDCKNVLDTIIYRLNVT
FT                   TVFDDIFTYPEVNNQAGTLGVAREYFYWIQTHGDELLNGIQKLVSDINSWKQMYYAICH
FT                   INSELRQMEPHDTVLHDSQENSNGQEPLSRRDSSLSIHPIPEEELEDDSLGFLSNFVGT
FT                   SKKARYKKLVVEKSETVKNIMKLNSEIKWSHELIAAEISDFLKFRTEFLRFGMKRYIVE
FT                   EVKKLKQRNTELSKFIFLVRKDK"
FT   CDS_pept        564944..565978
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380930"
FT                   /orf_name="CD36_17540"
FT                   /product="Small glutamine-rich tetratricopeptide repeat-
FT                   containing protein, putative"
FT                   /function="binding"
FT                   /protein_id="CAX43531.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG736033"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192D8BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW1"
FT                   /transl_table=12
FT                   /translation="MSSTITNKDIALSIIDFLKQSVAKKEVAEDYAESMDVAIDCIADA
FT                   FEVNKDDDSKILKDVFNGKSLPELLKSTVSSNSTSEKSESVPAVKEIDADTKAKADELK
FT                   VQGNRAMALKDYTEAIAKYTEAISLDPTNVVYLSNRAAAHSSSQKHDKAVEDAEKAIKL
FT                   NPNFSKAYSRLGLAKYALGDAKAAMEAYKKGLEVEGETKSDAMRKGYETAKKRVEEELE
FT                   NSISTTDKSGESSGSRGSGADAGAGADAGAGGLPDMSSFLGGGGGMPNLAEMMNNPQIM
FT                   QAAQEMMSNPAAMQNLFNNPAVKQMAQQMGLGGENGPDLSNIMNNPMFNQFMGGKGSQG
FT                   DKSE"
FT   CDS_pept        566492..567544
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567234"
FT                   /orf_name="CD36_17550"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43532.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396155"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000192D8BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW2"
FT                   /transl_table=12
FT                   /translation="MFSRSGVIRVRQLILIRYTHQTSSTNVLTPTFSVDEIRDLPYSDH
FT                   VDLAWKQLIPYKVKINKQKTPVLFLHGLFGSMSSFNSIGRSLSAVVKHPVYAVDLRNHG
FT                   DSPRALPHTYTIMARDIHNFIRTRKWDECILIGHSMGAKVAMMVSLLYPSLVSKLVVVD
FT                   NTPHSRPLNDQFYKDLLGMCEVEVNGQKYKTANKKTVGKLSEIDRFLSQYEKDQRVRRI
FT                   LTSNLMTCLKHFKNRKDIDHEKEVFKIPVMNFYKYDILGTLGGWPQLPEVKKFDKPVFV
FT                   MYGNNSDFVLRKYHKYFLKYFSNVKFQEFDSGHWVAMDQPERFLKKLARFIDYDEYIRF
FT                   KPYKVRYVKW"
FT   CDS_pept        568340..568789
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567235"
FT                   /orf_name="CD36_17560"
FT                   /product="Transcriptional repressor, putative "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43533.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D8BD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW3"
FT                   /transl_table=12
FT                   /translation="MSEYSGSNSEDLSLPKATVQKIINEILPKDIGIAKEAREAITECS
FT                   IEFIMMLSTQSNDIAEKEAKKTIASDHVVKALEELDFKIYLDIINKILDEHKELLKGKE
FT                   KRNNKFQNSGLTEEELLRQQEELFKKSRARLQNQSGSPTIKPEAK"
FT   CDS_pept        complement(569032..569322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380931"
FT                   /orf_name="CD36_17570"
FT                   /product="Integral membrane protein required for ER to
FT                   Golgi transport, putative"
FT                   /protein_id="CAX43534.1"
FT                   /db_xref="HOGENOM:HBG607174"
FT                   /db_xref="InterPro:IPR013880"
FT                   /db_xref="UniParc:UPI000192D8BE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW4"
FT                   /transl_table=12
FT                   /translation="MFGLGKLFYVIALIINGIAVLSEDRFLNRIGWGSTTGQQNNGNIQ
FT                   AQFNQFNSGLDNSDGSVKTKLINLISAVRTLMRIPLIVVNITIIIYELILG"
FT   CDS_pept        570790..572424
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380932"
FT                   /orf_name="CD36_17580"
FT                   /product="Gaba-specific permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43535.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324420"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D8BF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW5"
FT                   /transl_table=12
FT                   /translation="MNIIKSRTEDHFHQLSSIRSPTRDIDPQHNAGDVELLAQIGYKQE
FT                   LRRHYSTLQVFGIAFSIMGLLPSIASVLTTGLESGPAGLVWGWFLSSIFILCIGISLAF
FT                   LGSAIPTSGGLYYYTNYYCPDAFRVPLSFMIGCSNSLGLIGGLCSISYGFAVQVLSAVY
FT                   IQQDGGFEITNAKCYGIFVACVVSNALICCLATKQAAFLQTVSIIVNVFLVLLFLIAVP
FT                   AGKGNDFNSRSFIFSNFENSRNYGTLWSFALSWMPAIWTIGAFDSTIHCSEEAKNAQRA
FT                   IPVGIIGSISACWILGWAICIVCAACIKDGDVSRVLESDTGSAMAQIIYDALGKKWAVA
FT                   FMSLIAVGQYLMSVSIMIALSRQIWSFARDDGLPVVYNFVKYVNPTIKVPVRATMFAAA
FT                   LGVLLGLLVLINGTAGSGALFSLAVASNVLSWGLPVLLILLPYGRKRFIPGPFYFGSTI
FT                   STLINIVSVGWTGYVIVLCMFPDSMTVDKNSMNYTVVINVGVWLLALFYYFVWGYRFYT
FT                   GPKSNLEEDFVEGVSTANVDEVLNEKV"
FT   CDS_pept        572839..573783
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567236"
FT                   /orf_name="CD36_17590"
FT                   /product="Mitotic check point protein bub2, putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="cell division"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43536.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG329998"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000192D8C0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW6"
FT                   /transl_table=12
FT                   /translation="MEQEVLLKGRKKDSIEQFIGGSQLFLENGLSQLRYMVLVEGLSTP
FT                   EGYDQCPYRSYVWSILCRVPPFPTEQYLQLLETSSQTLPDELLIKIKNDTFRTLMNDKK
FT                   FHSKVNEESLIRILSCIGITTEVGYVQGLNVLLAPIAYVCHKSEPQAFAILHNLITKQI
FT                   PLYITPNMEGVHTGLQLVDVVLKIIDPVLSDYLDSKFLKAKIYAFPSVLTLCSCTPPLK
FT                   SVLKLWDFLFAYGTHINVLFVVAQLIICRSSILESEQPMKILRTWPSLEENEIIKLSLS
FT                   FIPELPEKLYDLIARHGYDKKVPKELARFLDEK"
FT   CDS_pept        complement(573819..576068)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076773"
FT                   /orf_name="CD36_17600"
FT                   /product="Splicing factor U2AF. large subunit, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX43537.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG448579"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D8C1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW7"
FT                   /transl_table=12
FT                   /translation="MSSSSQRQSSSYSRRVPFNDDTNKKSSFRNQPNQNVPPLNRGRGY
FT                   NEHQARGGDAVPSRGDPRHTDNRNDGYNGRGNDVRADNNKREQPRHFGRGNRDSPQYQP
FT                   SQSQRHDPKKHTGREEQGPSGSNRYDSERNRNDHRSDIRANHGNRDNMAGYDPRRNDSR
FT                   TGNNSSYYNKNRANDTPIEKRGMKRPNQEHGGGPFKQQKNSEEYIPRSQRQQTQQQQQQ
FT                   QQQQQQQFTSRKPYNNKPHQKNGFNRRPDSKHSQPKFEKSRSSFQNRGRDNDSDQSGEA
FT                   YTPSFKRSDDATFSGQRKFEPQSTLARARTMSITQPKSINEILKEINRLQTHVQELQSV
FT                   QPIEEVKVIDSKWNRIPEGFENLSAARAKLSGLFPLPGYPRPIDFTKLEGAIKNRLNNS
FT                   DDILNETSRIDPIDSKVARTLIIKNDLSQINYLKLVEFFNDYLKAIDFEKGSATNIQKH
FT                   RKAADNKYAIIEFNNAECATIIYSLNETELLFNAYKEEKAPERQKEKFKLLIARPGEYV
FT                   VQDLEPAKSDEIEEVVRDSSRKISLTIAPNSRPNKVIEALEKNVAELQGIQFLRQKGTK
FT                   ELLGLVFVEFKDTPMDVIGKLRRMPFITRAFHSCVLPDKTPIQHGPVDFHSLKNLVGNK
FT                   NVTPHPSSRVIRLLNAVSESELTDNATYSFIKNDMYNEASKYGEVVSIRIPRPPRSHTP
FT                   GILQFNTSTGLGTIYIEFKDERTALAAMMELAGKSYNDRTVLATFYDFDDFLTLI"
FT   CDS_pept        complement(576394..579192)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567237"
FT                   /orf_name="CD36_17610"
FT                   /product="Heat shock protein 70 homolog LHS1, putative "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX43538.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG396154"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000192D8C2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW8"
FT                   /transl_table=12
FT                   /translation="MKGYPFIFYILSVVFCAILGIDYGQQFTKAVLLAPGVPFEIVLTD
FT                   EGKRKDLSGLCIRKVSDNDLERVYGSQMGSLITRFPHNCILDLKQLLGKSIDDPSVNQY
FT                   LKSHFVKLIADETRNGIKFDLGFRNSTLEFSVEEILAMNLNEIKSRALNDLEANPHAAA
FT                   LVEDVAVSIPPFASQAVRQAYLDSLALANFSNVLGLVEEGTSVALNYITNKKLDKDSYD
FT                   NVKHYYLIYDVGAGYTTTTLFSFTPKSIGQSVLEIESIGYDEMLGGKALTNSAYSLVLE
FT                   KFLNQFNLEESDLTDKIAARLQDTAEKAKIILSANTDFQTTLESVYEEKDFKLSITRQE
FT                   FEDINADIMSHITDPLLKTVAEAGLKVDDIEYVILNGGSTRVPFIQKHIATLVGENKIS
FT                   KSVNTDESSALGTTAKALRLKAGVSNGKDIILLEKSFSNFEVGLNDQEETNVVFYKGAT
FT                   IGNTTRVHLGKISEDNIGISLYENGALIKSYYFDDLLSKTKKLDCKSKEDKNIFGKFSL
FT                   DNNKIFDLIGLEIECSSGKEGSLFDKLMKKDYSDNNQASADQVDSNTDNSTNSTINTNA
FT                   SKKVKSPKVINVSLPKPSYPHIKPIGRITKQSLLDKLAYLNAQDELKIATDHVKNELEG
FT                   QCYKLREFVEGHHSELLQELSEQELDEVTTFIGDLIEWLDFESDDSTLDELNSKVEEVN
FT                   NKFSEMKRYSEIATTDLSKKGLKKLYDDSSNLIMKIQTSMLEFGTKISEVRKKYEDAGL
FT                   DFDKANERIIQKLTGKGEDKLLSFDKTLKSYKEVITEIAKVLEYDDKDFSKIAKTQLYS
FT                   YHEKLAKGVADMFGDIISIESLHLDRMELFDKHFEQLLERRKQQEHRKKLREAQKAAKE
FT                   EQKEQETNPEEVEIIEEDDEDVEETPDQTRTEVSSEEIIDSVGEDSSNKSEEKPDVEHD
FT                   EL"
FT   CDS_pept        580081..581382
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567238"
FT                   /orf_name="CD36_17620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43539.1"
FT                   /db_xref="HOGENOM:HBG396153"
FT                   /db_xref="UniParc:UPI000192D8C3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAW9"
FT                   /transl_table=12
FT                   /translation="MSEPKLKRTIKEPIATLMVNSTNGSNKKDADNEVSNNSSSNIQGK
FT                   KTGSNDSAFSTPPKRSLKLEDATSKKVFAELSNKTVDRKSENGSSSSSINKSDTSKKRE
FT                   ELKGNADVLTKPKQHFKKPENKNTEKNIRNKEKENLVSVSNGPPQQGSQIQAVVSQDTT
FT                   VVDLGTNTTPSNLTMIKETIDAASSENEANKYEHQSVDAISNERAVSSSEESFPRATTI
FT                   MASSLPKKKNWSNSLKSLLCFNSIADGDKSGFEESGVYEMQKLPEISTQYRLKEINGFG
FT                   VFPATQSLTPGQQKMYQILVTTALELNLEFCRYLEILNERSMKQDIKDSFSIQFGRIHS
FT                   GLPFTANHTASGSTREELSHLGELFDEVFNNNNTVWIANKFEYNSFGRKFRKAIAETLE
FT                   SDYHISISRRRDLFPRQIIAASLFQWKKNMHLSE"
FT   CDS_pept        582044..582685
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228151"
FT                   /orf_name="CD36_17630"
FT                   /product="Xanthine phosphoribosyltransferase, putative "
FT                   /EC_number="2.4.2.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAX43540.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG327482"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI000192D8C4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX0"
FT                   /transl_table=12
FT                   /translation="MSESEKMYISYNNIHQLCQEIAPKIKEFKPDLIIAIGGGGFIPAR
FT                   MLRSFLKEPGQPNVRIMAIILSLYEEIESENGIEKPGTQVVRTQWIDYHQSKIDLVGKN
FT                   VLIIDEVDDTRTTLHYAVSELKKDVEEQSRAKGADPKDTKFGIFVLHDKQKQKKAELPD
FT                   EIMKTGNYFAARSVPDSWIAYPWESTDIVYHQMKAEEQGNDVFLPSTTLG"
FT   CDS_pept        complement(582786..583877)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380933"
FT                   /orf_name="CD36_17640"
FT                   /product="Ubiquitin fusion degradation protein, putative "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAX43541.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG622162"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI000192D8C5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX1"
FT                   /transl_table=12
FT                   /translation="MFSSFGSSIYGSAFGSSGFPSNKFEEYFRCYPIAMMPDLIRKDDA
FT                   NYGGKIFLPPSALNKLTMLHIRYPMLFEIKNEQNEKLTHSGVLEFTAEEGRTYLPQWMM
FT                   NTLELSPGSLIKITNCDLNLGKFVKIEPQSVDFLDISDPKAVLENVLRKFSTLTVNDVI
FT                   EVNYNDAIYGIKVLEVKPESPSKGVCVVETDLETDFAPPVGYVEPEYKPKTVEPQSTPI
FT                   DPSKVNKSAGAATMAKSINYAKLVAEGGKTTKFSGSGQKLSGKSIDMDKDQTTKNYRID
FT                   DLDPDAVPVPLTLPENQLFFGFPVVLPTQEEIDEGTKEELRKQEAFSGSGQSLRQSKKR
FT                   KDKNTNYPPLKNHTRSPDVIEID"
FT   CDS_pept        complement(584257..587265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567239"
FT                   /orf_name="CD36_17650"
FT                   /product="Nuclear transport factor, putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAX43542.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG396152"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D97C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX2"
FT                   /transl_table=12
FT                   /translation="MDKQTLLAALTGTLASDQQIRKHSEQQLHAFEQQPGFTAYLLDLI
FT                   ADATENQPGVKIAAAIFFKNRVVNYWIVPENKQQTAFYLSETEKSTIKEKLVSTLFATY
FT                   KIQQIRLQLSTALNTILSFDKWDELTNIIQKLLSDESNIDHVFTGLICLFEYTKNYRWA
FT                   GFESNNFINPILEEIAQKLFPQLENLANKLIESDNKVADEILYLIIKIFKFTTYSSLPT
FT                   YFQDSNNLGKWCQIHVLIISKPLPKEVLDEDHIETRNSNPRVKTVKWCFANMNRLLSRH
FT                   GGGYLTKSKETNQFAQMFISNFVPELLNAYWKIIESWSNKTVWLSEISLYHMISFLEQI
FT                   IETPAWSLINDKLDAIIRHVILPTLVATPETVELYEDDTDEYIRRFFDINREQSTSDVA
FT                   SINFIYRLSNKKFKSTIGMICQLINEIFTERRNNLDSSDTAMKVEGGLRILSTISYKLD
FT                   SKFSPVTGQVDNLLFTFVYPELSQDCASKTPWLTARACDTIAMFHDHQYTDMKILQDIF
FT                   QSVVTCFSNDAQFPIQLTAADALSTLVKEDSVSQLVADQAPQLMGVLLEKSKQYESDIL
FT                   TNVMDIFVEKFAKNLEPYAVELGSKLVEQFIKIASEILETNGSGHTDKEIQAAGILNTL
FT                   TTLVISMSNAPNVALQLESVLKDLINFIFENAMIVFLTEVIEILESILFVRSEVSPVIW
FT                   NIFKVAIESFETYAYEYFDSFQPFFESIINKGFGQPDITIADERVQVLMNICFNILKDE
FT                   DADPVFAHSAFEDIELTILALNQRFASFLPQFLPEIFDIFTKLESQDAFDGYMLHHLSI
FT                   LKILFACIYVDPAVTIQFILSKGFLVDFYKLWIKYSSDFQSVYGCKLQILASMSILKND
FT                   NAVSSIPEDLIGETVDLLLSNIATLPNAIKAKNAILSSETSQKTQQKNTEDNGEDDGEE
FT                   FADFEDDFEVDEAELEAMKETPIDVLNAFEYFVQNFLSLQQQQNKYEVLFGGIDSNKKE
FT                   MIQELIRITQQTR"
FT   CDS_pept        587686..588528
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567240"
FT                   /orf_name="CD36_17660"
FT                   /product="Ribosomal rna-processing protein, putative "
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX43543.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG717393"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D97D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX3"
FT                   /transl_table=12
FT                   /translation="MSPTEIKGFYVLPLKLTGTKSIHYIYFKKHESKSSSNDNRSLFIC
FT                   NLPISTDLSTIKKFFQKIAIGSTIESFINSLLTDYPEDIWINLTKLTSDLDLADVVDEQ
FT                   ASKLPKNCGIVTFIDKASFTLAFNSLKKLSSSLTECEWPIQQFTSNYYLNKYQKQILDP
FT                   KSLTEEVSQALTDFDKAEQQSIEELQSQRNLVDEDGFTLVVGSHRKTKAGILGKQKLAS
FT                   TVGVVKAQSKMKSKEKQDFYRFQLRQRKKEEMNELLNKFKLDQEKVRMMKEKKRFRPY"
FT   CDS_pept        588725..589618
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567241"
FT                   /orf_name="CD36_17670"
FT                   /product="4-amino-4-deoxychorismate lyase, putative "
FT                   /EC_number="4.1.3.38"
FT                   /function="4-amino-4-deoxychorismate lyase activity "
FT                   /protein_id="CAX43544.1"
FT                   /db_xref="GO:0008696"
FT                   /db_xref="HOGENOM:HBG396150"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniParc:UPI000192D97E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX4"
FT                   /transl_table=12
FT                   /translation="MPPTLNNELVRKIHRDYIEKNFPSSHNNTINPQDFEILSTIRYDP
FT                   NLSPISPLNYDDITPQNFFLLPEHTSRLQFSMNFFHLLYGTTPDFEITESFLYEQLVQA
FT                   MEKLKKSVLCSYKVRGLFKLDGSVTFEMYEVPSRHNLLSGIFPDLGTFPEELEFLNHPD
FT                   DENGDDVNWNVYINNSPTLISPFTSFKTTKREVYNEARKLLPGTNPGHEEVILFNTQNN
FT                   VMEGSITNIAVKRESDGKWVTPLLSSGCLCGVARHFLLRKNFIEEDNVTLEQLKPGTKV
FT                   LLMNGIMGVFGGTIVG"
FT   CDS_pept        complement(589686..590591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231114" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228152"
FT                   /orf_name="CD36_17680"
FT                   /product="Phosphoserine phosphatase, putative "
FT                   /EC_number="3.1.3.3"
FT                   /function="phosphoserine phosphatase activity"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /protein_id="CAX43545.1"
FT                   /db_xref="GO:0004647"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="HOGENOM:HBG645339"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D97F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX5"
FT                   /transl_table=12
FT                   /translation="MSYVLTAISHGDSKFETETLNSIREFIHNKFTLISSKELSPRAID
FT                   YTISINDFESSKEIVKEFSISKSFDLVIQPESSRKTKKLFIFDMDSTLIYQEVIELIAS
FT                   YADIEDKVAEITTRAMNGELDFNQSLAERVLLLKGIDASSIWDELKLKIQVTKGVPELC
FT                   KALKKLDIVMGVCSGGFIPLAEFLKEKLGLDYAFANTLGVDDSNRLNGTTVGPIVNGEK
FT                   KAELLLEIAKKHKIDPLDAVAVGDGANDLKMMSVAGFGIAWNAKPKVQKQAPACLNTKS
FT                   LSDILYIMGYSDKEIKELID"
FT   CDS_pept        complement(590949..592037)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567242"
FT                   /orf_name="CD36_17690"
FT                   /product="Phosphatidylinositol transfer protein, putative "
FT                   /protein_id="CAX43546.1"
FT                   /db_xref="HOGENOM:HBG327719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000192D980"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX6"
FT                   /transl_table=12
FT                   /translation="MNFFKKRAEDDRGSSSSSLPRDDTASVSSKATSTSSTSKTELIKC
FT                   YIPFEQPVNPIKAPEFDLDKEQIEKYEKLVDYFEDYILKEVPVNDQHNAITHPLIEEEL
FT                   AWLTKECFLRYLRATKWKVDAAIKRIEDTIIWRRTFGVVNLPNHTDPKKFITADLVSDE
FT                   NETGKQLIVGYDNDNRPCLYLRNGYQNTAPSLKQVQHLVFMLERVIHFMPPGQDSLALL
FT                   IDFKAAPAELNLSSKFPSLSTSKQCLHILQSHYPERLGRGLFTNIPWIGYTFFKVVGPF
FT                   IDPYTRSKTIYDQPFENYVPKEQLDKEFNGILDFEYIHETYWPKMNEIADRKRANYMEN
FT                   FRRLGSKIGLSEYDLRLEQVAL"
FT   CDS_pept        complement(592599..593357)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567243"
FT                   /orf_name="CD36_17700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43547.1"
FT                   /db_xref="HOGENOM:HBG396149"
FT                   /db_xref="UniParc:UPI000192D981"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX7"
FT                   /transl_table=12
FT                   /translation="MADDNTTKASKKRKLTFDNEILSPLNLQSIVNKQKISTTVIEKFW
FT                   QPLDSVNAQSMDDIMNIALLKTLDESHSKVSRSITNVWFNSANPESFKSRLLQTKLPPP
FT                   SSMYSSKLRIRANEVADVLSYDSLTRKRTVLETYLSAELKQLQELENHYNQSLLAYKSD
FT                   LEYLKKFKSTVKNNEMKYNDDLERKHEELNLSVQDKNPDDIYLLSTDNDFDPETDDDIK
FT                   FILETIQEKLLRSKLKTLNDKLEVLCNILA"
FT   CDS_pept        594050..595723
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567244"
FT                   /orf_name="CD36_17710"
FT                   /product="Uroporphyrin-III c-methyltransferase, putative "
FT                   /EC_number="2.1.1.107"
FT                   /function="binding"
FT                   /function="uroporphyrin-III C-methyltransferase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="siroheme biosynthetic process "
FT                   /protein_id="CAX43548.1"
FT                   /db_xref="GO:0004851"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019354"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326453"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D982"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX8"
FT                   /transl_table=12
FT                   /translation="MTNLLTSNTTAGEIHLLIGYSAVSNTRITSIIESGANPILITDSQ
FT                   PQSFPPNMTQYVTNNRLEVVVDEDFSTKILHYLSTLGRPEVDHIVDRVFVSLSNSRLPL
FT                   KQEIYQRCCKLRIPVNTTDSPDLCTFTMLSTYTSGDFQLGVTTNGKGCKLASRIKRELV
FT                   NSLPRDIDVICKQVGQLRRQIQLEDKSESEHGEHEDDAINNHKFNTFVPEFNKTQEDLK
FT                   LQRARWLSQIVEYYPLKQLGSISIKDLSSAYKLHKQANELEEGSKTGQMTLVGSGPGSV
FT                   SLLTLGALQAIQTADLVLADKLVPQQVLDVIPTTHHTRLFIARKFPGNAEKAQEELLAL
FT                   GLEALKRGEKVVRLKQGDPYIFGRGGEEFNFFSQHGFTPVVVPGITSALAAPVLSNIPM
FT                   THRDVADQVLICTGTGRRGAVPNLPDFVPSRTTVFLMALHRVVELIPLLVNNKRWDENL
FT                   PVAIVERASCPDQRVIRTTLSKVGAAVEACGSRPPGLLVTGYSCNVIWKRKISESLPWV
FT                   VEEGCSSRDDSDLKRIVELVNGNCKESSVVGLNLQKEIAA"
FT   CDS_pept        596057..597418
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567245"
FT                   /orf_name="CD36_17720"
FT                   /product="Aminotransferase bna3, putative "
FT                   /EC_number="2.6.1.-"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX43549.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D983"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAX9"
FT                   /transl_table=12
FT                   /translation="MLKRIAPIRQLYRTSRAMATKSTDPTSLHNPYFHQKPGQKDIWSL
FT                   INETAAQAQQESGEPIVNLGQGFFSYNPPEFAINAVGEALTKPQFNQYAHARGNPNLLK
FT                   QVAEHYSRSYGRAVGIDEVQITTGANEGMFAIFFGFLTPGDEVIVFEPFFDQYIPNVEM
FT                   TGAKIKYVEIKYPKKFDNEVVAGQDWEIDWEGLNNAITDKTKIIVINTPHNPIGKVFTE
FT                   EELYKIGKLAVDHNLILVSDEVYENLYYTNKFPRPAALPQLPELAERTLTVGSAGKSFA
FT                   ATGWRVGYIQGPANLIKFVTAAHTRICFSTPAPLQQAVSQGFEQAEKTNYFEITRKEYE
FT                   HKYKIFTKVFDDLGLPYTVAEGGYFVLVNLSKVKIPADYEFPETISDRGTLDFKLAYWL
FT                   IKEIGVVGIPPTEFLTESNRKGNGLENCVRFAVCKDDAVLEDAVERLKKLKDFL"
FT   CDS_pept        complement(597688..598908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567246"
FT                   /orf_name="CD36_17730"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX43550.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG396161"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000192D984"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY0"
FT                   /transl_table=12
FT                   /translation="MDFDPLSLYTPSPSQNEEVVIPKCQDIYESKESRNLSETAEDDSH
FT                   LEPIHILDLPLLQLKPPYEVLISILKLLSPEETLNFGGSLEHSNNIAVNQETIFQEKDI
FT                   TELDIKAMTWLQLYCPRFDTIEKLAHLPSLSSSLKLSFAAEYNAYMTNLISNPLSWITN
FT                   QKHIDTLQKLACLRLSENCGRTAQPEIIRRIVLPNLDQWMKTKTGHLKLREPSLTNDNL
FT                   GLKTWGSALILSQRLLTHDYKKYLYKSVLELGSGTGLVGMVSSLLGYHTVLTDLPEIVP
FT                   NLQSNVDLNKLINATVSELDWTNPQSFLKSFPDTKFQTILVSDPVYSSKHPYLVVDMIN
FT                   LFFDDSDPKAKVLVQIPLRPKFENERQVLWDLMKANLYLEIEHEIEEGFDDFGEMKFCF
FT                   KVFKKKK"
FT   CDS_pept        complement(599289..600788)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567247"
FT                   /orf_name="CD36_17740"
FT                   /product="Aldehyde dehydrogenase, mitochondrial, putative "
FT                   /EC_number="1.2.1.3"
FT                   /function="aldehyde dehydrogenase (NAD) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43551.1"
FT                   /db_xref="GO:0004029"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000192D985"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY1"
FT                   /transl_table=12
FT                   /translation="MFKKALPLVTKLTTPKGITYNQPLGLFINNEYIHPKQQKTFEVIS
FT                   PSTEDKITDVYEALEEDINTAVDAAQAAYHNGWAQGPPEQRSKVLFKLADLIEQNAELL
FT                   AQIETWDNGKSLQNARGDVALTAAYFRSCGGWADKILGSQINTGNTHFNYTQRVPLVCG
FT                   QIIPWNFPLLMASWKLGPVLATGSTTVLKTAESTPLSALYLSQLLVEAGMPKGVVNIVS
FT                   GFGATAGAAIAKHPKIEKVAFTGSTATGKIIMKLAAESNLKKVTLELGGKSPNIVFNDA
FT                   DLDKTIQNLIVSIFYNSGEVCCAGSRLLVQSGVYDQVVKKFKEAAETVKVGNPFEEDTF
FT                   MGAQASEVQLSKILKYVESGKSQGATVVTGGARADGKGYFVKPTIFADVKKDMDIVREE
FT                   IFGPVVTLIKFDTVDEAVELANDSDYGLAAGIHSTDVNKCIDVANRVKAGTVWVNTYND
FT                   FHPMVPFGGFSASGIGREMGEEVLHEYTQVRAVRMKINPPN"
FT   CDS_pept        complement(603323..605077)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567248"
FT                   /orf_name="CD36_17750"
FT                   /product="D-lactate dehydrogenase [cytochrome] 1, putative "
FT                   /EC_number="1.1.2.4"
FT                   /function="D-lactate dehydrogenase (cytochrome) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43552.1"
FT                   /db_xref="GO:0004458"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG553036"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniParc:UPI000192D986"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY2"
FT                   /transl_table=12
FT                   /translation="MFFRLSKNCGRFSKRFVRYNSSISRNSSKSSLLAYTFVAIGFSGA
FT                   GYLIGKSLVKKSSPTSADRSTSPLSTLSSPQYANEKDFQAGLSKIVDIVGQENASFDKD
FT                   VLLAQNDSFYSTHHPPNPDVQKPSAVIYPTSTEQVSEIMKVAHQYRIPIVANSGLTSLE
FT                   GQNIHTRGPYSISLSFQNMNQIVAFHPDDLDIVVQPGVGWQELDDFLVNDPKGKNLKFG
FT                   PDPGIGANIGGMVGTSASGTNAFKYGTMKENVVNLTVVLADGTIIKTRQRPRKSSAGYH
FT                   LTRLFIGSEGTLGIVTEITVKLHVRPKYEFITVAAFPSIKDAASAAETIIAQGIQPNAM
FT                   EILNETMMSFVNDTSDSDKKNLETPTLFFKLGGPTLESTEEQANLVDEIAKKNNVMKLQ
FT                   RSTNDEENAELWAARRNGLWSTYQYGTKVLEDKNDVQVWTTDVAVPISKLSLVISEIND
FT                   YLIEKGFKDRFSVMGHIGDGNCHFIILYNSPDYDKVHHVVDHMVERALSHDGTCTGEHG
FT                   VGVGKRKYLPSELGVEAVDTMRQIKLALDPRRILNPDKIFKIDPEENLDEQLDKGSVKE
FT                   KPSCMHNH"
FT   CDS_pept        complement(605536..609447)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533797"
FT                   /orf_name="CD36_17760"
FT                   /product="5-oxoprolinase, putative "
FT                   /EC_number="3.5.2.9"
FT                   /function="5-oxoprolinase (ATP-hydrolyzing) activity "
FT                   /protein_id="CAX43553.1"
FT                   /db_xref="GO:0017168"
FT                   /db_xref="HOGENOM:HBG285674"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI000192DA3B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY3"
FT                   /transl_table=12
FT                   /translation="MSRTKKGIQIAIDRGGTFCDVIAKIPGQPDYVFKLLSVDPQNYKD
FT                   APVEGIRRVLEKATGAKIPKGKRLSLESIQSIRMGTTVATNALLERKGAKVLLVTTKGF
FT                   KDVLLIGNQTRPHIFDLTAKKLGHLYYQVLEIDERVTIAGFSEGGGDNLKVDVESDPEL
FT                   RESVTGDIVRVIKEPDYTKIAADLREVYYQGEIKTIALSLLHAYAYPQHEAKIAEIAKK
FT                   IGFNVSVSHELQPMLGFVNRTSSTVADAYLSPVINEYVRNFGAGFEGGLEAFGNKLLFM
FT                   QSNGGLCPWYKFTGLKAILSGPAGGMVGYGETCYDGISKKATIGFDAGGTSTDVSRYAG
FT                   NLDHIYETVVSEINLQTPQLDISTVAAGGGSMLFWKNGMFVTGPESAGSDPGPVCYRKG
FT                   GPLTVTDANLFLNRLLPDFFPKIFGPTHDQPLDYELTAEKFRALADEINKDKAEEGIIL
FT                   TPEEVANGFLKVAIESMARPIRNMTEAKGFETASHNLASFGGSGGQFAVSLAKNLGISH
FT                   VAIHKYSSLLSAHGIQLADIVIEKQSPASFTYSQKNFAAIDNKIKHLIAAARKDCEEQN
FT                   LLGFKTRWETLLNMRYVGSDTHLLIPVTKGEYDADQKFITRHKNEFGFNLDRKVLVDDV
FT                   QVLLHVESDDKAKYNPYEDFAKLENKNSYLAPSKIQKNVYFETEGWLESSVYFLPDLQK
FT                   GSIIKGPSIIIDNTQTILVEPRSKAAILTDHILIEVEQEKKLELSKTTIDPIQLSVFGH
FT                   RFMSVAEQMGRTLQQTAISTNIKERLDFSCAIFDSNGDLIANAPHIPIHLGSMSYAVKA
FT                   QIELWKGKLHHGDVLVSNHPKAGGSHLPDITVITPVLDKSNNPLFWTASRGHHADIGSI
FT                   AVGSMPPNSKTIYDEGAAIITHKLCNKGVFDEEGVIKILVEEPAKHPGGSGTRTLSDNI
FT                   SDLKAQVAANYKGITLLNRMVEEFTFEVIDLYMKGIQSTAEISVRNLLKLAYKKFGGNK
FT                   LKGVDYLDDGTAIALTVDINPETGSALFDFSESGDEVYGNLNAPRAILYSAVLYVLRCL
FT                   ISTDIPLNNGCLRPIEFSTREGSIVNPSYDAAVVGGNVETTQRIVDVMLKTFQAAAGSQ
FT                   GTCNNFTFGTNDPTKGISFGYYETICGGSGAGPTWDGQSVVQCHTTNTRMTDTELFEKR
FT                   YPVLVHEYSVRQNSGGRGFHKGGDGVVRDIEFLYPLEVSCLMERRSLAPYGLLGGGEGA
FT                   RGINYWYQKLDNGRYRKKSLGGKCTVKVGAGDRIVIKTPGGGGFGESLPGELNFPIESS
FT                   RPSVLTGSVGVRKITQQTN"
FT   CDS_pept        complement(610040..611080)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567249"
FT                   /orf_name="CD36_17770"
FT                   /product="Uncharacterized metal-binding protein, putative "
FT                   /protein_id="CAX43554.1"
FT                   /db_xref="HOGENOM:HBG527152"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="UniParc:UPI000192DA3C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY4"
FT                   /transl_table=12
FT                   /translation="MAKGKNKSNDERSSKSRTSNGHKSKQHHIRKGRQEISASSATSKS
FT                   STSFPTKLAMWDFDHCDPKRCSGKKLERLGLIKNLRVGQKFQGIVVSPNGKSIVCPDDK
FT                   EIVETNGAAVVECSWARLDEIPFSKIGGKNERLLPYLVAANPVNYGRPWRLNCVEALAA
FT                   CFAIVGHTDWAELLLQNFSWGLTFLKINQELIELYQQCTDSESITKAQEQWLEKIAQEA
FT                   KERKNQAHNEDVWMMGNVNRQEDDKEFDSCSDDEVATDSASDKEYDNLGNIIEKRKYDS
FT                   LGNEIIESEAKYDSLGNIVASDEGTDEEDNDGVSISEKERDTVCDNLGNAVVKENITKH
FT                   MNSLSI"
FT   CDS_pept        complement(611504..612745)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076774"
FT                   /orf_name="CD36_17780"
FT                   /product="Ribonucleoside-diphosphate reductase small chain
FT                   1, putative"
FT                   /EC_number="1.17.4.1"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /function="transition metal ion binding"
FT                   /biological_process="deoxyribonucleoside diphosphate
FT                   metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43555.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0009186"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG418082"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniParc:UPI000192DA3D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY5"
FT                   /transl_table=12
FT                   /translation="MSAQETPTKGLTGKISDLDMSSMKGKSLTDKLAADAKSKDEAQTI
FT                   HEVKQAVASTDKATEEKDDSFKKHQAFLAKHKVHRHKLKQLEAEEPLLVENKRRYVMFP
FT                   IRYHEIWNFYKKAEASFWTAEEIDLSKDLDDWNNKLNENERYFVSRVLAFFAASDGIVG
FT                   ENLIENFSTEVQLPEAKSFYGFQIMMENIHSETYSLLIETYIKDPQEADYLFNAIANIP
FT                   CIQKKADWAIKWIQDDEALYGERLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNE
FT                   LICRDEGLHTDFACLLFAHLQNRPSPEIVEKIITEAVDVEKEYFTDALPVSLLGMNCNL
FT                   MCQYIEFVADRLLLALGNKKVYNVTNPFDFMENISLAGKTNFFEKRVSDYQKAGVMAKT
FT                   ENKEADAFTFDEDF"
FT   CDS_pept        complement(614207..616267)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567250"
FT                   /orf_name="CD36_17790"
FT                   /product="Uncharacterized protein Skg3p homologue, putative"
FT                   /protein_id="CAX43556.1"
FT                   /db_xref="HOGENOM:HBG396162"
FT                   /db_xref="UniParc:UPI000192DA3E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY6"
FT                   /transl_table=12
FT                   /translation="MSGSTPPASPTYRRVRSPLAQPPATLNEDTPAFATPSPPPLPPKD
FT                   FAIPSPVGFLVNSDKSNDSSIDESKPSYTLPKINTTVSSNQGSESSSYNETGLHRRTLS
FT                   DRIKTTPSSFVRQSRIFSNEDADSIYSSHSVTGRSLLLQNKIQTESLPPEFHPIVSLIN
FT                   AQKLRTYCIGSLQIPGVIGSERVWLEVEAKLSGNELAIWRPSTDEYTLEEGNEFKPKYI
FT                   NLIDAHIEVVSNLQIKIYQDYRDDASLAIQFHDKPSFDKWMSAIVLSKFEYVKLSEAFT
FT                   AVLLSSKGSKLSDIHVLLGNKKRFPQYEWCHIRLPEVSTKWIKVYMAVLPGDKGHVGRI
FT                   EFYPSDKKLQNKHLIAYISDLSGVFNVYPEQSNMIDYNSIMRAAGEIYVNRNYEYLFPH
FT                   NSDEQLDPRKLIAKNHGVSRSDSNNSLSSLSNQTPSTPRNRSRSSSLHSTNSFFNQPSS
FT                   LSPKQTNGHTRNRSLSNLSKSPANPSHTQLSHKRTNSSFFKKHTENFVLTNSVYIMPSS
FT                   HPGVTAVETMIRNFIPIVDAFKLYGRPKRLISDKSDTASMLFGLPSLPHYQYLSHKDAE
FT                   KAFAKNFKVGSNWFEWPEIIANEIKQLQSSNAKGYRGHGDIAKLYENLDLNYGEITSPV
FT                   FRFGKFEDDLPSLSDSIEFGGKIETPPPGISSPISFAEDGSPYESLPKIVV"
FT   CDS_pept        618662..621448
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567251"
FT                   /gene_name="CaLIG4"
FT                   /orf_name="CD36_17800"
FT                   /product="Dna ligase, putative"
FT                   /EC_number="6.5.1.1"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA ligase (ATP) activity"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43557.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003910"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG396164"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniParc:UPI000192DA3F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY7"
FT                   /transl_table=12
FT                   /translation="MTYFLNDIHPPSPNDITPTFTLLTKELFDKFDGVRKDSLGDFRTV
FT                   TEKKAFIIKTFLNTFRTHIGNDVYPSAKLIFPEKSGRIYFIKEVALARLLIKVYKIPKE
FT                   SEDYITLHDWNKSYQRSRRFSIDEKKIRDLPLQASRIISKRRPIVDNVEEYTIPQINSS
FT                   LDQLALEKSSQGQIDILKPLFDNLGIPEVRWLIHIILNKSILTNMERFFFNTWHPDGYR
FT                   VFSICNDLQKAFQFSTNPDLRLEPSQLAIHPCFKFKPQLSERLTTSYKTLVKKLQRKHE
FT                   MDVPYEKKFQELGLENKFYIEEKMDGDRMLLHKDGDSFKFFSRRLKDYSYLYGESFQFG
FT                   ALTKFLAHAFAGNVQSVILDGEMVAYDYERNVILPFGTLKSSAIQESVRQFTTIDQYEQ
FT                   QTAYPFFLVFDVLFLNGKDLTNYPLFFRKNILSRILRPIPNRFEVLDTRLGSSPEDIER
FT                   AIREVVSSRCEGLVLKNVQSKYEIDGFRNPDWIKVKPEYLEKFGENLDLVVIGKSPAIK
FT                   NSYMCGLKSVTDGVYYSFCTCANGIEIEEFDKIERLTHGKWIKTDTTMPPESLIKFGTK
FT                   IPTFWIHPSDSLVLEIRARSIDTRAGTSYAVGSTLHNNHCRKIREDKTIDECVTLQEYT
FT                   HIKANYINDLNKAQTALGKKRESMYSLDNESKLKKVKVESDLFDGMEFLIMSDKREADG
FT                   EVTTIEEMKAMVKSYGGKIVNSIDLATNYQIVVITERELPVSSQYLSKGIDLVKPIWIY
FT                   ECIQRGCVLQLEPYFIFASKNWDNFRNMVDQYGDSYIIHHPLNIVVPNLSESELEELRN
FT                   SFDWGELKPLIYLFKGLSFYVCGNNLSAQFLKERIKRFSGDLSKHYTECCYIVIPDKHS
FT                   RPLILSEIDKMSNQISREMVIDENGRSSRIPYFVTEAFVQTSIKMNYIPDPEDYKFR"
FT   CDS_pept        621878..622765
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228153"
FT                   /orf_name="CD36_17810"
FT                   /product="Phosphatidylinositol-specific phospholipase c,
FT                   putative"
FT                   /function="phospholipase C activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX43558.1"
FT                   /db_xref="GO:0004629"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG396165"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000192DA40"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY8"
FT                   /transl_table=12
FT                   /translation="MVDYKTWLKDIDNNTKISKLSIPGTHNSAACHTALPSVQCQGASV
FT                   TEQLEHGVRFLDIRVGKLFVGNDVKDLQVIHGKFPVKIPFPLKLKDTLEEFYKFLAHNS
FT                   SETVIVSIKQEGSDDWDNSQDEFGKLIWDRYVNPNKDRWYLNTDIPKVGDARGKAILFR
FT                   RFGVQDEQLKKQFGFSASSWAYNTTNDDRGQFVVQDFCEVNSADDLPKKIDYVKDLAKR
FT                   AQDYTSNSDDKVFLNFTSASNFFDKQCWPHPIAEAMIKGNIQETFHKGVGIIVLDYAET
FT                   DNWKLPKALIDTNF"
FT   CDS_pept        622824..624494
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533798"
FT                   /orf_name="CD36_17820"
FT                   /product="Mitochondrial inner membrane protein, putative "
FT                   /protein_id="CAX43559.1"
FT                   /db_xref="HOGENOM:HBG396166"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniParc:UPI000192DA41"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAY9"
FT                   /transl_table=12
FT                   /translation="MPIITNFKSEPPSGAIGPLLVRKKKCVKNLSVALCKKKKKKRNQY
FT                   QHKLFAPYLRPPTDTTTTGTCFMLSTCLIRNCVLIRPRLFVICLKAIRCQSKKSDFPDF
FT                   TKINDPKLREIIEGSNFGTEAILKKQREDQDKKKKMEQEKKRLEQEREVERRREEKRAK
FT                   EEAESNKTDNNNEANHNNDDKLATVNAKLESDFSKTESGKLRGENTGTRETVVETEEEE
FT                   LKLKAENKIIATSKDSVEESDIPNLAKEINETIQKEIAGLPSQKAKNQSKLAKNLTKYL
FT                   DSAHDTILTATRALNDVTGYSAIEKLKKSIETQEVDLKKAKETVKQCKIAYGEAIQRRS
FT                   QSQREVNELLTRKHNWSSNDLERFTELYRNDHENEIHEQEAERKLDEAESKVDGVQLKL
FT                   TQSILTRYHEEQIWSDKIRRSSTWGTWVLMGLNVILFVVATFIVEPWKRNKLVFAFEDK
FT                   VKQVLVGISQENEQILDPIIDKLEPTDGQVPIKSSSFDFKFVANSWHGLKAALVRNYEA
FT                   LMSSEITNLEFDKFEFELFTMTVAIVAFSMGSLIVSIFK"
FT   CDS_pept        624782..626017
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380934"
FT                   /orf_name="CD36_17830"
FT                   /product="26s protease regulatory subunit 6b homolog,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="peptidase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX43560.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000192DA42"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ0"
FT                   /transl_table=12
FT                   /translation="MEDPVSLDNVNSVLSKLNNVSATNTNETDVYLKLKKLEKELDLLL
FT                   LQEEYIKDEQRHLKRELVRAQEEVKRIKSVPLVIGQFLEPIDENTGIVSSTTGSNYVVR
FT                   ILSTLDRELLKASSSVALHRHSNALVDILPPEADSSISIVGEDQKPDVTYADVGGLDMQ
FT                   KQEIKEAVELPLTQGDLYSQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTTASFIRING
FT                   SEFVQKYLGEGPRMVRDVFRLARENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLE
FT                   LLNQMDGFDQTSTVKVIMATNRADTLDPALLRPGRLDRKIEFPSLKDRRERRLIFSTIA
FT                   SKMSLAPEADLDSLIIRNDPLSGAVIAAIMQEAGLRAVRKNRYMILQSDLEEAYTSQVK
FT                   TGTEHDKFDFYK"
FT   CDS_pept        complement(626102..627622)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567252"
FT                   /gene_name="CaSMP3"
FT                   /orf_name="CD36_17840"
FT                   /product="Gpi mannosyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAX43561.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG398390"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI000192DA43"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ1"
FT                   /transl_table=12
FT                   /translation="MCLRSSSVMIKINFNWRTFYLLTIVFRFVFTLSDSYIHPDEHFQS
FT                   LEVLTNHILNYSTNIPWEFRDDPARSLAPLYFIYGPLLYLIKIFKLNLTPLQIWYIARL
FT                   QISILSWIITDFCLYWMPPSKPERIKAIFFTSTSYITLVYQNHLFSNSIETVLLLVTIL
FT                   LIDDLRYIQESKDKDVQDLNKDKSLFYIGMLISIGVFNRITFPAFLIFPGWFVIKYVLK
FT                   HYVSGLYLIMGVSSTTALLILVDTILFGNIDKISTEPFNTSNYIIAPLNNLLYNTKYEN
FT                   LAQHGIHPYYTHVLINLPQLLGPGLIFFVSKSYAKTTPFLTVISGLLFLSVIPHQELRF
FT                   LIPLLPLACCCFDFTLKWVQPWMLYTWYIFNIFMCLLIGKLHQGGVVPVLDHIKSEASV
FT                   QVWWRTYTPPSWILGSNSTETIRLGEKLDDNKFVNIIDCMGADSKEVEQVLQTISTDKP
FT                   VYLITPVASFKHFNELRFSPVWNYTFHLDLDHLDLGNIQPGLGVYQLL"
FT   CDS_pept        628740..629849
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533799"
FT                   /orf_name="CD36_17850"
FT                   /product="Isocitrate dehydrogenase [nad] subunit 2,
FT                   mitochondrial, putative"
FT                   /EC_number="1.1.1.41"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NAD+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX43562.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004449"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI000192DA44"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ2"
FT                   /transl_table=12
FT                   /translation="MFRQVTKSAPVIRASQRLFARSYIAGQFTGTKGSDGKYTVTLIEG
FT                   DGIGPEISQAVKDIYAAADVPIHWEPVDVTPLLIDGKTTLPQPAVDSVNKNLVALKGPL
FT                   ATPVGKGHTSMNLTLRRTFNLFANVRPCKSIVGYDTPYENVDTVLIRENTEGEYSGIEH
FT                   TIVPGVVQSIKLITKPASEKVIRYAFEYAKSINKPHVLVVHKASIMKLSDGLFVNTAKE
FT                   VAQEYPDVSLDFELLDNTSLRLTADPSQYKNVVMVMPNLYGDIMSDLSSGLIGGLGLTP
FT                   SGNMGNKVSIFEAVHGSAPDIAGKGLANPTALLLSSCMMLRHMSLNADADKIENAVLKT
FT                   IASGPENRTGDLKGTATTKRFTEEVIKNL"
FT   CDS_pept        complement(629997..630665)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567253"
FT                   /orf_name="CD36_17860"
FT                   /product="Phosphoribosylglycinamide formyltransferase,
FT                   putative"
FT                   /EC_number="2.1.2.2"
FT                   /function="methyltransferase activity"
FT                   /function="phosphoribosylglycinamide formyltransferase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAX43563.1"
FT                   /db_xref="GO:0004644"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG649382"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniParc:UPI000192DA45"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ3"
FT                   /transl_table=12
FT                   /translation="MTLNITVLISGSGTNLQALIDAQKGNQLNGQITQVISSSETAYGL
FT                   KRAEQASIPTKTHILKNYYKGTTKDQTEVRKQRREQFNVELANLLINGQIEGSDASYTK
FT                   PDLIVCAGWMLILSPSVLQPLEKAGITIINLHPALPGAFDGTHAIDRCWKAGQDGQITK
FT                   GGVMIHRVIAEVDRGTPILVKELDLIKGESLEEYEDRVHKVEHVAIVEGTNIILDELSK
FT                   "
FT   CDS_pept        631601..634093
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380935"
FT                   /orf_name="CD36_17870"
FT                   /product="Elongation factor 2, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="CAX43564.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192DAFA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ4"
FT                   /transl_table=12
FT                   /translation="MDKVTNVRNMSVIAHVDHGKSTLSDSLVQKAGIISAAKAGDARFM
FT                   DTRKDEQERGITIKSTAISLYASMSDEDVKDIKQKTDGNSFLVNLIDSPGHVDFSSEVT
FT                   AALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQTTKEDLY
FT                   QTFARTVESVNVIISTYCDPVLGDVQVYPQKGTVAFASGLHGWAFTVRQFANKYSKKFG
FT                   VDKEKMMERLWGDSYFNPKTKKWTNKDKDADGKPLERAFNMFILDPIFRLFAAIMNFKK
FT                   DEIPVLLEKLEIQLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQAYR
FT                   AETLYEGPSDDPFCTAIRNCDPNADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKV
FT                   RIQGPNYQVGKKEDLFLKSIQRTVLMMGRSVEQIDDCPAGNIIGLVGIDQFLLKSGTIT
FT                   TNEAAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHI
FT                   VAGTGELHLEICLQDLENDHAGVPLRISPPVVSYRETVEGESSMVALSKSPNKHNRIYV
FT                   KAQPIDEEVSLDIENGVINPRDDFKARARILADKHGWDVVDARKIWCFGPDGNGPNLVV
FT                   DQTKAVQYLNEIKDSVVAAFQWATKEGPIFGENCRSVRVNILDVTLHADAIHRGGGQII
FT                   PTMRRVTYASMLLAEPAIQEPIFLVEIQCPENAIGGIYSVLNKKRGQVVSEEQRPGTPL
FT                   FTVKAYLPVNESFGFTGELRQATGGQAFPQLIFDHWQVMSGDVTDENSKPGAIVKEKRI
FT                   RAGLKPEVPEYTEYYDKL"
FT   CDS_pept        636040..636918
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093625" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533800"
FT                   /orf_name="CD36_17880"
FT                   /product="Hypothetical transmembrane protein, conserved "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43565.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396167"
FT                   /db_xref="UniParc:UPI000192DAFB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ5"
FT                   /transl_table=12
FT                   /translation="MNIQETIAKYPYCAVNLSASLLLGVAHFLRKDYHLGLLASWNLLI
FT                   LLCTPIQSLNLKNSLVCDSQIALIFLTSIVISYTVLKEENRKSLFSRYTYVSSFIIILI
FT                   SVVTFIPDRMLLSSLSTIYDRIKFDHIYIALTLIYAVDAITKFTFTSDFSSILIQGIWA
FT                   YNAIIIIISMWFIIYSKDTLFSILKILEKEDGQNISFVTSFIISSISQLENDYQLCSQG
FT                   ETALETCLNERHTDNLQSYFLIVKIMVTNCWSILNLVSFVLIPSLVSFIYKRRQLLSDL
FT                   KQYDAKVDSVV"
FT   CDS_pept        638550..640679
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533801"
FT                   /orf_name="CD36_17890"
FT                   /product="Peroxisomal copper amine oxidase, putative "
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43566.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325455"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI000192DAFC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ6"
FT                   /transl_table=12
FT                   /translation="MERLSQLAIQTTNSSAAPAAPGHPLDPLSPAEIKSVSNIVKSKFP
FT                   EKSINFNTVTLKEPIKRAYYEWKEKNGPLPPRLAYYVVVADGDSGVHEGLVDIGAQELI
FT                   EIKHTNGVQPILTPYDLQVTEEIIRNDPEVQKQCELSGVPPNSMHQIYCDAWTIGYDER
FT                   WGASRRLQQALVYWRSHEDDSQYSHPLDFCPIVDMNAKKVVFIDIPQRRRKVSKHKHSS
FT                   FHPKHVTDKYGTKENPSGYRQDDFPINITQPEGVSFKLDNHIMSWSNFKFHIGFNYREG
FT                   IVLSDITYNDHGNVRPLFHRISLCEMVVPYGAPDFPHQRKHALDIGEYGAGNMTNPLAL
FT                   GCDCKGVIHYLDGHVVDRSGDAATIRNAICIHEEDDGVLFKHSDFRDDFQTTVTTRGKK
FT                   LIISQIFTAANYEYCVYWILRQDGTIKLEIRLTGILNTFICADDEDIGPWGTVVYPNVN
FT                   AHNHQHLFSLRIHPRIDGDNNSAATSDAKPSPFPTGSTQNMYGNAFYCEKTTFKTVKES
FT                   ITNFESATARTWDMYNPSSVHKYSGKPATYKLWSTFCSPLLAQEGSLVRKRAPWAASHT
FT                   QVVPYVDDKLGYGRLYPSGDHVPQWSGDGLRGMREWIGDGTDKVENTDILLFHTFGITH
FT                   FPAPEDFPVMPTEIFDLQLRPRNFHTENPVLDVKPSYARTTSEVKAGAKGVDTCTLNVD
FT                   KSSRLAFDDGSCCKK"
FT   CDS_pept        640926..641546
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228154"
FT                   /orf_name="CD36_17900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43567.1"
FT                   /db_xref="HOGENOM:HBG507886"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniParc:UPI000192DAFD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ7"
FT                   /transl_table=12
FT                   /translation="MKYIIEHMEEGFSEWVILEYTQIIKDIGKDNLVLTSLPPSTTEKN
FT                   IPKSLLELGLQWTTKECVDIDGGIDKSKVCLLDPAAETDLTPEDKSKFDYFVFGGILGS
FT                   HPRIDRTGLLREKYGFSGRRLGSLQMTTDTAIRTTQRIIENGMEFENIKFLDYPEIKYN
FT                   RYESTEMPFRYITDNDGNPILPEGMLELIKNDAEQSIDDLLIE"
FT   CDS_pept        complement(641770..644016)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533802"
FT                   /orf_name="CD36_17910"
FT                   /product="Phospholipase, mitochondrial, putative "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAX43568.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG396169"
FT                   /db_xref="InterPro:IPR004177"
FT                   /db_xref="UniParc:UPI000192DAFE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ8"
FT                   /transl_table=12
FT                   /translation="MKVPLATFANPFGYTTIRHSWILPYKFLRLFSTSPALRSTKEPTP
FT                   QTVKHKVRWFYASDVPISKPEWYKYEKVKEPESFIPFSEYDSKQLEREFSKTERNLIEV
FT                   NEDKLFQVDLKSLELSPIYWDGPIYEVRRGLWFSSDGMPLKAEITKEIEDGFQKLKPYT
FT                   YENANEEYKKTTKSNKEKISAFNKLKQGSQTETKVDLDKQKDVIRLSNGELVLYFNKDQ
FT                   AVIFPGDYDSEFQIDVIRYFGPKPVSLLGVNHIQRGYSEELKESFFDKLSKTNPLPGIS
FT                   DAFKEDFGSIIGGEKESNKSSEDEMSDVNDLDDINMQKYLESDYDLETSKLKSNREIDH
FT                   LVLCIHGIGQVLGTKYESVNFTHSINVLRNTMKSVFEQNEECQKLAGEHNRTNNRVQVL
FT                   PISWRHRIDFNPQQEFDAQSPSRLPTLSQINVEGISALRDVVGDVVLDVLLFYQPRYLK
FT                   EIITTVTSELNRVYKLYLKRNPDFKGKVHILGHSLGSAIAFDILSQQSGSLDGPLDINK
FT                   DLAFDVDSLFLVGSPVGMFKLLEEKGIVGRGYKSSVPSQDDTFASPKCVNLYNIFHPCD
FT                   PVAYRIEPLVSPSFGDFKPVDIEFAVKGLNTQFKELSNFGDELSEKISSATKWLTSSKS
FT                   DGTEKTVEEKANKENALGDIIKGVVMPEDTSQDHKGLKKKIISGQALSKMTSLNMTGRM
FT                   DYSLPLGVFDVSLVSAISAHVSYFDDVNTAGFILKELLTNRSTSVEETTVALKK"
FT   CDS_pept        complement(644303..646324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000969" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228155"
FT                   /orf_name="CD36_17920"
FT                   /product="Hypothetical transmembrane protein, conserved "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43569.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396170"
FT                   /db_xref="InterPro:IPR004043"
FT                   /db_xref="UniParc:UPI000192DAFF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WAZ9"
FT                   /transl_table=12
FT                   /translation="MDLELTTFSSRNMTGSSSTNDSIDSAIEFHFPQHNSWKSRIKHCF
FT                   YLIWTGPSEPRDEPAPQIASLDFLESIPDKFRERISSRYRKALFIFYILFWFGLCYNIL
FT                   VPYFTVPPHISTDLNMHIYTLSCASSQEFWKGKNGACGLNGSLCPEIINMENQKNIEND
FT                   ILIRCPALCDRSSWTYSLIPIGDQRIKYRGYYIGGGDKVTKEIDDDQITNPYRADSYPC
FT                   GAGVHAGVISPFWGGCARMSYKSGEQSYFKASKGYYGVSDSIEFSSFFKFSFIFKNLKL
FT                   GGKVTFDQCYDPRLIILLINIILGIPVVYLASGSVAYWTISIVGFWTICLATDPPVDVD
FT                   PNKATDFSRLLSVAMERFLPSCCVLFVLWHVSAKRTLSDLPLNSNTKISYMSRILLWYP
FT                   LFWLGVLNNMTFDRLPVDRLTISDLKEQPGALLAVGSIILTITTCAFIQAYKIWLSGRF
FT                   KKYLFVYSLFILGLVFLAQLPGLTLRVHHYILAMLLIPGCATRGRTALMFQGILLGLFL
FT                   SGAARWGLAAIVETAESLRRDDPRGNIIPPIFTGYNNATGILEWTSIPAELELTKIKSK
FT                   LYEKYSSISLLVNDIERFVGNKAKSINLKELLTSSNELAEEIKRALVDGVKDENGDIVV
FT                   YLRIGRKIPNTHYYSDFSNAATLKWPSGELKLPLPGIT"
FT   CDS_pept        complement(646884..649448)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567254"
FT                   /orf_name="CD36_17930"
FT                   /product="Ribonucleoside-diphosphate reductase large chain
FT                   1, putative"
FT                   /EC_number="1.17.4.1"
FT                   /function="ATP binding"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /biological_process="DNA replication"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="ribonucleoside-diphosphate reductase
FT                   complex"
FT                   /protein_id="CAX43570.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005971"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG296647"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniParc:UPI000192DB00"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB00"
FT                   /transl_table=12
FT                   /translation="MYVYKRDGRKEPVRFDKITARVQRLCYGLNPNHVEPVAITQKVIS
FT                   GVYQGVTTIELDNLAAEIAATMTTIHPDYAVLAARIAVSNLHKQTTKQYSKVSKDLYEY
FT                   INPKTGLHSPMISKETYDIIMEHEDELNSAIVYDRDFSYNYFGFKTLERSYLLRINGKV
FT                   AERPQHLIMRVAVGIHGNDIPRVIETYNLMSQRFFTHGSPCLFNAGTPRPQMSSCFLLA
FT                   MKDDSIEGIYDTLKSCALISKSAGGIGLHIHNIRSTGAYIAGTNGTSNGIIPMVRVFNN
FT                   TARYVDQGGNKRPGAFALYLEPWHSDIFDFIDIRKNHGKEEIRARDLFPALWIPDLFMK
FT                   RVEQNGDWTLFSPNEAPGLADVYGDEFEELYTRYEKENRGRQTIKAQKLWYAILGAQTE
FT                   TGTPFMLYKDSCNNKSNQKNLGIIKSSNLCCEIVEYSAPDEVAVCNLASIALPSFVESD
FT                   QSNTWYNFDKLHDVTKVVTRNLNRVIDRNHYPVPEAERSNMRHRPIALGVQGLADAFME
FT                   LRLPFDSQEARELNIQIFETIYHAAVEASVELAKEEGAYETYPGSPASQGLLQFDLWNR
FT                   KPTELWDWDTLKQNLAKHGMRNSLLVAPMPTASTSQILGNNECFEPYTSNIYSRRVLAG
FT                   EFQIVNPYLLKDLVDLGVWNDAMKSSIIANNGSIQALPNIPDEIKALYKTVWEISQKHI
FT                   IDMAADRAAFIDQSQSLNIHIKDPTMGKLTSMHFYGWKKGLKTGMYYLRTQAASAAIQF
FT                   TIDQKIVETAGHTVANLDKLNIKKYVNKGRVDAENTSDTPYKSPSTEPTSLESSVADLK
FT                   IKDEGEKPAEDKSIEEIENDIYSAKVIACAIDNPESCTMCSG"
FT   CDS_pept        650904..651614
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567255"
FT                   /orf_name="CD36_17940"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43571.1"
FT                   /db_xref="HOGENOM:HBG396171"
FT                   /db_xref="UniParc:UPI000192DB01"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB01"
FT                   /transl_table=12
FT                   /translation="MFTKTLKYIILAFLISTHKTLPFAYVIRFYYQAFRGFFAHRFHYN
FT                   ATKKNSFGYDSPKDLFTWVTLNSYVTPLEIDMYMHKSNSTYFLDLDIARTKLLTRLFQT
FT                   YWWSCYDNENGKFKKSHTLANVPYVPVGTVQCQFKRELKPFEKYKISSRILAWDRKWLF
FT                   VISKFVTAENKVNAIAITKYVFKVGRLTIAPEEYLRHCNFLNEENERINEKNFQLVKYL
FT                   VDVEDIEKIAEAAT"
FT   CDS_pept        complement(651751..661632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228156"
FT                   /orf_name="CD36_17950"
FT                   /product="E3 ubiquitin protein ligase tom1, putative "
FT                   /EC_number="6.3.2.-"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43572.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG398391"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR010309"
FT                   /db_xref="InterPro:IPR010314"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DBA3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB02"
FT                   /transl_table=12
FT                   /translation="MIVGKRDHHQRLEMAKPLRSLIDKLTACDINELPQYLQENLVWQR
FT                   PRGDLFHWIPLLNRFDEIFEQKIEKYGLDKEYVKLSLVSSEDEHLIVSCLRFTYILLDH
FT                   CFDKQVYSSSERIYALINSSSLEIRLRALEVGIVLAEKFVQTTSSRFSAPKPARNKILE
FT                   IAKAFPPLVPIDSALKQLAENNNNNNNNRGDNDEKPSIIGDHYNFVYTLDPEKKYPSKW
FT                   KSINYQYYKSIPNTVTLNKNTSKSKANDKKKEDTVTEGLHIFHLPEESVRKLTVQQLFE
FT                   KGMEVLPPESWFRFGIHAQVTKAFNSTSTDAMQLREKLIQIKCLAVGFTCCMLSSQVTS
FT                   TKLFETEPYIFSFLVEAISPENSSLVSRNVYFAAIRALECISFKKVWGAELIRTMGGNV
FT                   SHGILFQCLRHIWKMVKDQNEDYFEEGYIHFFNLIGNLISNKSLVPRLTAGGILDDLMP
FT                   FLNLPTKYRWSCSAAVHLITMYLASAKDSLDEFVANDGFNLLICNIRREVDFALENPDF
FT                   GGGAPKDATVYYSITLRQANYIRNLMKLVADLIQSDSGDRLRNLFDSPLLESFNKILTH
FT                   PHVFGPLILAATIDSVFFIIHNEPTAFSILNEAKVIDTILDNYERLFLPSGPLLSILPE
FT                   VLGAICLNNEGLNKVKEKKLIQIFFKSFYNLDNAKELVRTESSTNIGCSLDELGRHYTS
FT                   LKPIILQQLQKLIESMSEYVNQRLPGIEFYTSDSGTLFSGKEDDSPVKVENGKEITSWE
FT                   NEDSAYLLDNVFNFLGGLLQDSGQWGTEVIQKMSFKSWIKLLTLRNAPWDYSMSNGIVS
FT                   FMGILKYFDDEKREYGLPVIVEELDKTLRLDSVLSYIKFKGEVSYFETIEPGEATILMQ
FT                   NLNIINVLLYALTEIYINLGSLFNERLGQIVSLFSNSELLINLVALLERSIIEETIIAS
FT                   NTPDEVLKMTHNFPNDSPPLQINVCDPLEIKPDTKGTSAKFKNTLQLRTGSYYFRGYIP
FT                   LLLACVVRSCIPKRQDHSEGQARQDAVEILLLLGRGLTDSIGRKFNNSYYEESFILNIA
FT                   YIALYMLNQKERSKDQVYTPFAVSLLQNGFFQVAETTCISLWNKLLSIDPELASATADL
FT                   KYISTQESSIIKNALGQILMIFAKTVNQDNIPNMPFAKFYFYQGYETNIESSLTSALLL
FT                   QIRSVALSLVENTVGSKSQLTGTDKHPENIPNPLIEQIAVIIKDIFLGKKELSNSEFIP
FT                   FDSRNISPPSDQFAYLISLGMSEDQAAHFFEHGSNLSDIASGKFLRCIEIELKEEQWQS
FT                   IAESIRNDKIDFSIDFEKFKPAQDILEERKSTDFVNIWINIAKMFPKALPLISEFMILV
FT                   SYKELYDRVLYYIPKIKWPVEDKELFGINLYIMALLLRTGRPNIHRHNIMQHSQNLISP
FT                   DIISNERMSETFFPNLLLVLERMIIILEEPDNETAPDLPFTVQKKMEFEAATKETKAKT
FT                   FDLLMKLELKNHLESVNSIARILVLYAKDKRYADRIAGSQILKDLLKLVGSNIKEKAIA
FT                   EPLKTSVVLIFRFCFETSKIAENIMNIELTTLFNNPIRQVKDLHTCLRDCAPSVFRDLD
FT                   MSIGVICNHILLDGYTADDFTYSSRIPIRKRKNDELVQDVEMSEPGESKPLVFTSIINQ
FT                   LLAELMSAVKTDWLSDPSTVEEKKDTKKVTTNLFANEKFAYMHFLLQTITELVGSYKQA
FT                   KLEFLTFSKKTQEEVKPRATALNFFIHQLIPTHSLESSSGPEFERRCAISSIAKMCLFS
FT                   LVSSTTSGDDDSSKTDKEDVDLALIRRFVVDLIMKILKDVSQMNTSGLIKYGKLLDLFE
FT                   LSGSLISTKFRDTVGPLLYKQATQYDQYHLTKIYVEKQVPNLLTNLIAEFDLNFPQIDK
FT                   VVKAALKPMTFLGKNKVEYKELFAGDTNQGDHNDEDDNLPEDVDYHEETPDLFRNSTLG
FT                   MYDVESEGDDEFYDAEDPVDAMMTGEDLSDASDDDDDDDNDGDDDEDVDDMSSELSAID
FT                   SDLDGDDNADDIEMEIEVDPFDDERSSEDIDEDPSDMDDIEIIDDLDLVSQTEGEDDDD
FT                   GDDDHNDESDGSSLDDDEASEYDEDELDGWIEQLDDGEDSSDEVQNRRRPRDPFTSLNN
FT                   NSNSGLRQRLFLDGEADFYDDNVNESDGELSEIDSRSDFEVRMVTPSRGGRRRVFDQAE
FT                   FTELERTSPALSVLLDGLFRDRSFGSIEISRNDHINPDATTIGRLFENMMQLGRVSKYS
FT                   DQDNKFHIKSTVERWTDALKMFYPRDCGELVFSVTGTVVERIREESKAIADRKKEEQEK
FT                   AQKEREEKRRKQLEEEEKRRQEEARQRQESAANIPEREPVMVRIGDRDVDISGTEIDRD
FT                   YIEALPEDMREEVFASYVRERRANASSTDADVREIDPDFLDALPDNIRAEILQQETMAR
FT                   RFANFESSSAQDEFELDDAGEDDAFEDADSNVRASGSRHSSTITAAAAVTRAQKKSPGK
FT                   VYFSPLVDKQGIAALIRLLFSPLTISQREHIYHALQYMCYNKQSRIEIMSLMIAILNDC
FT                   FTNKRPAQKVYTQVCNKAGGNKDSKQQYKLPVGATQISVGIQIVEAVDYLLERNNHLKY
FT                   FLLTEHENNFILKKDKKSVSKESRFPINYMLKILENKLVTDDQTLLDILARVFQVASRA
FT                   LHAIKNNQNTVDNDKDKEEEKEKEKDKPHVPPPPVIPDSNYRLIIKILTGNDCSNTTFR
FT                   RTISAMQNFSVLPNAQKLFSLELSDKASELGQTIITDLNNLTKELIAGGGSDSKSFSKF
FT                   SAHSSDQAKLLRILTALDYMFENKEKTKDQGKDDEIEELTGLYKKLALGSLWDALSETL
FT                   RVLEEKPQLHNIANALLPLIEALMVVCKHSKVRELPIKDILKYEAKKIDFTKEPIESLF
FT                   FSFTDEHKKILNQMVRSNPNLMSGPFGMLVRNPRVLEFDNKKNYFDRNLHQDKKENRKM
FT                   LVSVRRDQVFLDSYRSLFFKPKDEFRNSKLEINFKGEQGIDAGGVTREWYQVLSRQMFN
FT                   PDYALFTPVVSDETTFHPNRTSYINPEHLSFFKFIGRIIGKAIYDNCFLDCHFSRAVYK
FT                   RILGKPQSLKDMETLDLEYFKSLMWMLENDITDVITEDFSVETDDYGEHKIIDLIPNGR
FT                   NIPVIEENKHEYVKKVVEYRLQTSVEEQMENFLIGFHEIIPKDLVAIFDEKELELLISG
FT                   LPDIDVSDWQNHTTYNNYSPSSLQIQWFWRAVKSFDNEERARLLQFATGTSKVPLNGFK
FT                   ELSGASGTCKFSIHRDYGSTDRLPSSHTCFNQIDLPAYDSYETLRGSLLMAITEGHEGF
FT                   GLA"
FT   CDS_pept        662487..663827
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205412" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533803"
FT                   /orf_name="CD36_17960"
FT                   /product="U4/u6 small nuclear ribonucleoprotein prp3,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX43573.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG396175"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="UniParc:UPI000192DBA4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB03"
FT                   /transl_table=12
FT                   /translation="MKRAFGDNPRPDVKKAKLHQDKELVHNNDNNDKTGLDVEIHPLLR
FT                   NIGSTHIPKLPKNHNPLRQSDQKWFDPLALNPYLDQSDMVISNKKSSHIPQPLRFIPRG
FT                   KYVAQGEKLREKLRIEHEQTRELEAIKQQGLIPDETIGEQLYQLEGQPLIEWWDRPYLR
FT                   DNNYTHIDDDSRKILDDETQPVTSYIQHPVLINPIWETGDLSAPVQPVYLTKQEQKRIR
FT                   RNERQIRQQEKQDRIKLGLDPPPPPKVKLSNLMNVLTNESIKDPTAVENRVKREIQQRV
FT                   DKHLAQNEARKLTKEQKHEKLWNKQEKDLANGIHTTVYKVEKLVNPKHLFKINISAQEE
FT                   NLVGVCLKNPKFNLVIVEGGEKSVGHYKKLMMKRIKWTENVSQSVTGSPTEDLSNNKCS
FT                   LVWEGSLPEVHFQKWSMMYSRDDKEALAVLKKFGLENYWRLASSLNE"
FT   CDS_pept        join(664074..664121,664239..664387,664455..664482)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533804"
FT                   /orf_name="CD36_17965"
FT                   /product="ATP synthase K chain, mitochondrial, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43574.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG756506"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniParc:UPI000192DBA5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB04"
FT                   /transl_table=12
FT                   /translation="MAGAYTIFGKQVPAHILSIITLGSVAAGIAIPKFLPKDESKKEVA
FT                   KPVAPIVQSKEDDFDLEKFINDLTKEESK"
FT   CDS_pept        complement(665987..667141)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076775"
FT                   /orf_name="CD36_17970"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43575.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396176"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DBA6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB05"
FT                   /transl_table=12
FT                   /translation="MLSMAVNPSNSLPSQYSTKQDNYNQNYCSIKSPSPTSTSTSSSLA
FT                   MTTPPHLHNPHASITLPSIHSLDIPAFPHYEKEYSRASVFQNYSSNSPTPSNSSYSPTL
FT                   LIPNNDRPASSSAYSNSSSTLLLSPGVSSTPNLNSIAPVSRPRSTSNLTENSEQSFASP
FT                   QLQSQPQPPVLSNVTITSPQLHVKSENEQQQHRLQNSNGILSPRQNKKNWKPRKKKQCP
FT                   ECNLYFSNLATHKSTHLKPNNRPHICKYCERGFARPNDLFRHVKCHWKEIGSDKGQFKC
FT                   PFKNIDSSNRDNQETITATGNGNGIPDHCCHNTGIFSRCDTFKNHLKAIHFQYPNGTKK
FT                   EQRNQVNGKCRMCQQEFRNVDDWMHSHIETNQCPYAINLIKKEH"
FT   CDS_pept        complement(670689..671567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567256"
FT                   /orf_name="CD36_17980"
FT                   /product="Elongation of fatty acids protein 2, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43576.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG331215"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniParc:UPI000192DBA7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB06"
FT                   /transl_table=12
FT                   /translation="MSLPIPTWETPFGIQLWPIFDLVASKLSQGKFVPSEFLFINGVTP
FT                   LSTFPEAAVIIVIYYTVIFGGRFVINTLNLPVIKLNGLFQIHNLFLTSLSLTLLILILE
FT                   QIIPIFHSGGSYYSICSPNAYTSKLVVLYYLNYITKFIELIDTVFLVLRQKKLTFLHTY
FT                   HHGATALLCYTQLTGYTSVQWVPIALNLAVHVVMYWYYFLAARGIRVWWKEWVTRFQII
FT                   QFVIDLGVVYYSTVTHFVYKYSGKMRDCSGTETAAIVGCSILTSYLILFISFYITVYKK
FT                   SGNASKKVKKA"
FT   CDS_pept        complement(672581..676714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567257"
FT                   /orf_name="CD36_17990"
FT                   /product="Rho1 gdp-gtp exchange protein 2, putative "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43577.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG332685"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000192DBA8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB07"
FT                   /transl_table=12
FT                   /translation="MSSNSSWSNNDSYQSRNDPNNGNNPNPHTMSQQHSQSVNIPAHLL
FT                   PQAFIEQQQQQQQQQQYQQDSETHNKNPPTSNRFYQSPPHQQQSRQQYNSSKQEQMQQP
FT                   YPTSAQNNQHYRPPTQERSYSFSSTMDPGSPSQIMPPNFSQRNQSFSGYQQQYPPSPNR
FT                   AYSQQTHAHQGGLQQPYVAQRQHTSAGFNQNPYSQQNRSVSSLTQDRTGAPVQHPPYPV
FT                   SNDDSGYQLQPSALQSQHLPPQQQQQQQQQQQPHPQTRRQLRKAPSSNLPPIQTDQVYY
FT                   GPDARRIVSTPTHQQNFPTPIPHEARTKSLTSASLKHQKQPSQSQQYYQQISESPGKDS
FT                   NARSSSSSSLHHTFSLTSKSRSFTSISKLSSLSTKKFGSSSSVNTNKLDRYQSSGTIRN
FT                   NHNHTNHTNHNIHYAKPSVYPAILSEVAKLFKEAIILTINTKDGLEYHDTFTGKMAVDI
FT                   LCRIIRTNDRNLALLLGRSLDAQKFFHDVTYNHRLRDSVHEIYAFNNVYNDVDFYNEEN
FT                   GGGGSTSNGENSALNSKHGSFLDSSTQLQNALNDHISDYHTSQSSGSLTKVASSATGNG
FT                   SASVAGKELSASQQTGVNGVFTILTECYSPTCSRNSLCYSIACPRRLEQQARLNLKPQG
FT                   GLQRAVSKLSLHDQEETETLWHKTVPQSVLDKLDKHEKTRQELIYEFVYTERDYVKDLE
FT                   FMTDFYIMPLRNPANNIIPDYQRETFIQTVFGGVPDLLRLAKRFSEALTRRQQQQKPVI
FT                   ETIGDVFLDYVGDFEPFVTYSGNKVFATFEHERQQQVNMKYARFLDAIEKKPESRRQDL
FT                   SSFLIKGVQRPARYQLLLSGILKHTKPESPDYKYLTKAKEEIEKLLVKINIQTGECTDR
FT                   HKVMVLHRLLGKQTLENRYNFKLSYNNRIIYQVTLNRKRDNEKIDLYLFEHALLLVKHK
FT                   IQNKREQHKVFEKPMYLPLLFVNSGMEIPTNRSIMPHRYHGSLVSDTSIRPQRAESNYI
FT                   GNTLNSSSTPKFQLNFLGLGSNQVHASLFAEDLTIQNQVLQQISTQQKKLIDANDIFSL
FT                   CKFETRRFTGNNKINCAVPCYGGKKLLYGTDSGVWVSTVRSISATSNEKICSDPTMVIS
FT                   KTYVTQIEVIVEYSKLLVLSDKSLYEFDLSCTDSLDHVKNTKSGKLLLSHVSFFKVGVC
FT                   DGKLLVIGARTGSSHSICIFEPVNPFDKSNKNKNKRLEIQEINFSSDPISISFLKTKLC
FT                   VGCAKGFEILSSQTGTKESILDEADPSLDFATQRESVTPLAIHRLGRDFLLCYSEFVFL
FT                   INRNGWRTNHDWGIFWEGNPQNVAIFFPYLLSFEPGFVEIRDLHTTNLLRALTGENIRF
FT                   LHSNEHEAMFACEENGYDIIISIDFLNLKPRSPT"
FT   CDS_pept        679080..680402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567258"
FT                   /orf_name="CD36_18000"
FT                   /product="Vacuolar amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43578.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG332582"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000192DBA9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB08"
FT                   /transl_table=12
FT                   /translation="MPSIDHDAGASTISSSISLVKTIIGAGLLSMPLAYSTDGILFGTF
FT                   IILLAAFTSGFGLFLQCYVSRYVPVKHATFFNLCSITYPHLSVVFDFAIAVQCFGCAVS
FT                   YLVLIRDLMPTIVTYVPYIDEKHYPSFWLLVSTVLTIPLSFLKNLDSLKYSSILGLVAI
FT                   FYMSILVIGHYFAGDIERQGQITLFPTSVTGVFSTFSIIVFAFTGHQNMFSIINEARDK
FT                   SLTSLTKLVNFAIGISSLLFIVVGLSGYLTFGQDVDGNVILSYPNGPTTTIGRFCIVFM
FT                   VTFSFPLMIHPARISINNIYHWITTTYFDKEDVNESTSLLRNDSETRQIAEDEEQGKTH
FT                   LSHVVPFPHRNFVIVTTSLLIIGYFLAISIKSFALILAIVGASGSTSISFILPGLFGYK
FT                   LIGSESDDPSTLEIAFKNLSLGLTFWGVAVMILCLYSSLTL"
FT   CDS_pept        680648..681349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567259"
FT                   /orf_name="CD36_18010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43579.1"
FT                   /db_xref="HOGENOM:HBG618397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI000192DBAA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB09"
FT                   /transl_table=12
FT                   /translation="MSCEDEHHNHDHDHNHNHDHVAPIPTTPGQTLNRKIDTSKVTALN
FT                   MANPADDLAKLFKDSTTKYEIKPIIKSDSDEQMIINIPFLNGSVKLYSIILRTNGDLYC
FT                   PKTIKLFKNDTSIDFDNVNMKKPIQILTHPQIGVANNDSNDLPEFLESNNDDDFVEHYV
FT                   SRHKFTGVNQLTLFIEDIYDEGEEECHLHSIELRGEFTELNKDPVITLYESAANPADHK
FT                   NLTVVENQNLA"
FT   CDS_pept        682199..682945
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076776"
FT                   /orf_name="CD36_18020"
FT                   /product="Phosphoglycerate mutase 1, putative "
FT                   /EC_number="5.4.2.1"
FT                   /function="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAX43580.1"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0046538"
FT                   /db_xref="HOGENOM:HBG658938"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000192DC4E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB10"
FT                   /transl_table=12
FT                   /translation="MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKE
FT                   AGIKVDVLHTSKLSRAIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLET
FT                   YGQEKFQIWRRSFDVPPPTIDPKDQYSQVGDRRYADIDPAVVPLTESLALVIDRLLPYW
FT                   QDEIAGDLLAGKVVLIAAHGNSLRGLVKHLDNISDEDIAGLNIPTGIPLVYELDENLKP
FT                   TKPSYYLDPEAAAAGAAAVAAQGQKK"
FT   CDS_pept        683406..685670
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228157"
FT                   /orf_name="CD36_18030"
FT                   /product="Nucleoporin, putative"
FT                   /function="structural constituent of nuclear pore "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAX43581.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="HOGENOM:HBG591578"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="UniParc:UPI000192DC4F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB11"
FT                   /transl_table=12
FT                   /translation="MFGGQQNNSGSNAFSGFSTNNNKNNNSNSQQSSAISLGASKPTES
FT                   NAFGALGNTSKPLFGAGAQQQSSSTPAFGTAKPSSPFGNASTNQPNAFGSAFGAAPKTG
FT                   GLFGSNTASSTAQPSSIFGQKKDDATSGSTATSSTGVFGAKPTTTNLSTGSAFGAPTSS
FT                   ATNEKTEEPKSTGAFASRATDGTASTGTTGASFGAQNQAANTSSGGGLFGAKKDQSPAP
FT                   TGGLFGSTTVNSDAKSADNAAISNESNTTTNMFGSSSTTTDNKFGGGTSFSTTKNPIFG
FT                   NNKEDNKPPAVTFGSKPENNDTSKASLFGANNVASKPASSGFLFGAKKDDDKDKPASSG
FT                   FSFGAKKDDDKDKPASSGFSFGAKKDDDKDKPASSGFSFGAKKDDDKDKPASSGFSFGA
FT                   KKDDDKDKPASSGFSFGAKKDDDKDKPASSGFSFGAKKDDDKDKPTTSGFSFGKKTEEK
FT                   KEDKSISENAAPTSATSTATTTTATAQPNLKPTKIEPIPVSIDNKTLDDLIVKWSKQLT
FT                   TTTRIFDSYTNKVKEWDQKLVESGDDITKLNQESLEAETLQTKINQQLLFVENQQDELE
FT                   KILDNYEQQADILLNNMELNNNAVANASSLIHAVEGSNKDTTTKDASAGVSSSNAAISG
FT                   GSSSSLSITDKLRENAYHNAELLDERLDNLGANLGTLINEINSVSDVFNKNLINELANK
FT                   NEARDSTSKKDDTKSDENNPIEEIVRLLNLHLENLKYIEKAEEELKSKLEKLNKTKKIS
FT                   H"
FT   CDS_pept        686064..686912
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533805"
FT                   /orf_name="CD36_18040"
FT                   /product="Mannose-p-dolichol utilization defect 1 protein
FT                   (Suppressor of lec15 and lec35 glycosylation mutation
FT                   homolog) (Sl15), putative"
FT                   /protein_id="CAX43582.1"
FT                   /db_xref="HOGENOM:HBG396178"
FT                   /db_xref="InterPro:IPR016817"
FT                   /db_xref="UniParc:UPI000192DC50"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB12"
FT                   /transl_table=12
FT                   /translation="MASPIIMLIKLLLDPDVSKKVILQMAWSQVKAIGIGKVVAALLSA
FT                   LTVGVSSFIRVPQIRKLLINSEQDRIAVAKGLSLTSLSLDTLNSLIHVTFNSQNRIPFI
FT                   QYGESLLLGIQNAIIILLIKFYRGQETQGVGKWQGLSCEDKFATIRGAITKPLVIMVAS
FT                   AIFFNKLAPSSLISMLEILNIPISIVAKFPQIKTNYELKTAKHLSDTVLRANVVGSLIR
FT                   VYTSFTDYSTKKQRHKNTVDETILLAGYSTSLILNSILLGQSIVYDKMGEKKVEDEKKN
FT                   E"
FT   CDS_pept        687427..688452
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567260"
FT                   /orf_name="CD36_18050"
FT                   /product="Delta-aminolevulinic acid dehydratase, putative "
FT                   /EC_number="4.2.1.24"
FT                   /function="metal ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="CAX43583.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG285270"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192DC51"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB13"
FT                   /transl_table=12
FT                   /translation="MVHQAEFLPSTGNSISSVLQGGYNHPLSREWQQERQLTKNMFIFP
FT                   LFITDSPDEETEIPALPNIKRFGVNRLIPYVKSLVEKGLRAVILFGVPLKPGVKDALGT
FT                   AADDPEGPVITAIKKLRENFPDLFIMCDVCLCEYTDHGHCGILNEDGSLRREESVQRIA
FT                   AVAVNYARAGANSVAPSDMMDGRIKDIKTGLMNAGLANKCLVMSYAAKFSGNLYGPFRD
FT                   AAGSAPSHGDRKAYQLPPGGAGLARRALMRDMGEGADAVIVKPSTFYLDIVSDAAKLCR
FT                   DYPICAYHVSGEYAMLHAAAEKGVVDLKGIAFEAHQGFLRAGARLIISYFTPEFLEWLQ
FT                   V"
FT   CDS_pept        complement(688635..689276)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567261"
FT                   /orf_name="CD36_18060"
FT                   /product="Vacuolar protein sorting protein, putative "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAX43584.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG592869"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000192DC52"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB14"
FT                   /transl_table=12
FT                   /translation="MGQQPSTPKITAQDKAIFQLKQQRDKLKQYQKRLNTIIEKQTDLA
FT                   KKAVLNKQPQKAKFYLRSKKQQESVINTTFDQLNNLEKLIGTIEYKLIEKDVVYGLQQG
FT                   NRVLQKLNNEMQVEKIDALIDQLEDEKLKVDEVSELLGGANQLNRSEEEEVDQEFENLQ
FT                   KEIHGKNNQAKEEGNELPKIPDTKPMPDAPNTEIGEYEPQNKTSHEPIAI"
FT   CDS_pept        690409..697812
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076777"
FT                   /gene_name="CHK1"
FT                   /orf_name="CD36_18070"
FT                   /product="Histidine kinase osmosensor and regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43585.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG396179"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192DC53"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB15"
FT                   /transl_table=12
FT                   /translation="MSMNCFNSHENARDCEKETITTTEYHESEQPDVKAIRNFKFFKMD
FT                   EAETKNNSNLQISNLSPLDSQSEPPSVLSLNHSTIPEQYERSQGTPDPLHTPEISLSDY
FT                   LYDQTLSPQGFDNSRENFNIHQTIASLFEDNSSVISQESVEDTKTTLSSETTDNLSLSN
FT                   ASYLTNINFVQNHLEYLSQNFSGNPSSNGLSPSSSSSSQIDFDAANLTPESIPGYILNK
FT                   KFGPVHQSTDSVYNAIKVAQNKTNDFHSNAVASQKPLDLNSKVIVRLSPNIFHNLSLSR
FT                   FLNEWYILSGKHSSKKHRVWSNESLTNEYVQKKTIPIFDKEDARFRPTLPLNIPGVLYP
FT                   QEILNFRVNSDDYPLKQASPSTNQKRFAMVYPDNDYKTFKQLSMLAVYEQQTRQGSFSS
FT                   DEARRKSSSGFNVGVNAPTIEAGSLDSLGTLMQNHHLGTNSTNGDPLHSKLAKFDYEII
FT                   KSPMKLIEVLTDIMRVVETISVIHELGFVHNGLTSNNLLKSEKNARDIKVTGWGFAFSF
FT                   SENCSHGYRNKHLAQVQDLIPYMAPEVLAITNSVVEYRSDFYSLGVIMYELILGTLPFK
FT                   NSNPQTLIRMHNFEKPIAPSMLAPSWISEKLSSVVMKLLEKNPRNRYSDCHSLLHDLTE
FT                   VKNMYISKLLESGESGQTGNLNLSDQQYYLAKEIVPHPEKMGVIPVLGLREHFIGRGDF
FT                   LQNVTETYNSNQNGVDLVFISGESGRGKSLILQDLQAGAVLKHNFYYSWKFSFFGADTH
FT                   VYRFLVEGVQKIITQILNSSEEIRNTWRDLILTHIPIDLSILFYLIPELKVLLGKKYTS
FT                   IYQHKVGMGTSRNTLKENQTLRLEIKLRQILKEFFRLIAKQGLSIFLDDVQWCSEESWR
FT                   LLCDVLDFDSSGEAKEGVSIKVVVCYALNADHLENVDTEHKKVSFCRYAKQSNLNLHEF
FT                   NIPHIPLEDAIDFLCEPYVKSDYRLSGEHLNLVDNLNDTNKNPNDNLKAIPTIIQELYQ
FT                   SSGGNVLLLVFLTRMTKLSGKVPFSHFSNRDSHLYDYLSNNNYGSTRNEILANYLNMGT
FT                   SSDARALLKIAALISSGSGFFFSDLIVATDLPMAETFQLLQICIHSRIIVPTSTYYKVP
FT                   MDLIASDQTPFDLTDDNIWKLATLCSYKFFHDSICTHIIKELNASGEFKELSRLCGLRF
FT                   YNTITKERLLNIGGYLQMATHFRNSYEAARPEENEKYVEVLVQAGRYAISTYNMKLSQW
FT                   FFNVVGELVYNLDSKTQLKSVLTIAENHFNSCEFEQCLNVVENAQRKFGFDRLIFCIQI
FT                   IRCKIELGDYDEANQIAIECLQELGVPLNDDECVGKNSFETFSGKIPLSVAEIRGILKI
FT                   KKCKNSRTLLMYQLVSELIVLFKVQGKDRMRKFLTAYAMSQIYSQGSSPYCAVILIDFA
FT                   QSLVNEHTTSGMLKAKELSVVMLSLVNRAPEISLSYVQSIYEYYFSCHAVLFESIEKMS
FT                   DLINPGNASSDCTRSSFYSSFHLMVHVSKIFFSCMNGEGLKMFSASRAKSYLLGDSHTT
FT                   EMDNFLYDSEMLLCGHSKLNEFMIKYQSFNQTSVGKFCYYLIVLCVMARDKRFDDAASL
FT                   ILQVVEDLSESLPVSFLHHQYYLICGKVFAYRQTKMPESDEQVEHILERQFVRYELWAS
FT                   TNESILLPRYLLLNAYKQIRENNVDKLEILDSFEEALQTTQRYHNVYDMCWINFECARW
FT                   LINIKQKRHRISRMVKQGLKIMRSLELKNHLRLSEIEFGEYIEDEHQKNKWAGLTDNLV
FT                   LDSVATSQQQNMESRLSSNDDKQSVRGKHYTKKELDNHLLRLHLDGHGTSIDLNSAICE
FT                   CLAISEALDENSILTKLMASAIKYSGATYGVIVTKKNQETPFLRTIGSQQNIHTLNNIP
FT                   ISDDICPTQLIRHVLHTGETVNKAHDHIGFANNFGNEYFQATDKKYSVVCLPLKSQLGF
FT                   FGAIYLEAGEGSFGHEDLFNERKCDLLQLFCTQAAVALGKERLLLQMEVAKMAAEDATD
FT                   EKASFLANMSHEIRTPFNSLLSFAIFLLDTKLDSTQREYVEAIQSSAMITLNIIDGILA
FT                   FSKIEHGSFTLENAPFSLNDCIETAIQVSGETVLNDQIELVFCNNCPEIEFVVGDLTRF
FT                   RQIIINLVGNAIKFTTKGHVLISCDSRKLTEERVEINVSVQDSGIGIPKKSQNKVFGAF
FT                   SQVDGSARRQYGGSGLGLAISKKLTELMGGTIRFESEEGIGTTFFVSVIMDAKVYSTPP
FT                   FSSNKKCLIYSKHRLTAKSIAKILKYFGLTVEVTNDKSDFLASVASNDIVFIDRGMETN
FT                   ASGAAKVIPIDAKPFKRNKLISILKEQPSSPAKVHGTNEFDLSKKYPLRILLAEDNLLN
FT                   YKVCLKHLDKLGYKADHAKDGVIVLDKCKELLEKNEKYDVILMDIQMPRKDGITATRDL
FT                   KTLFHTYQKESWLPVIVALTANVAGDDKKKCLEEGMFDFITKPILPKELRRILTKVGES
FT                   VNI"
FT   CDS_pept        complement(697954..699087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567262"
FT                   /gene_name="HOG1"
FT                   /orf_name="CD36_18080"
FT                   /product="Mitogen-activated protein kinase hog1, putative "
FT                   /EC_number="2.7.11.24"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43586.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192DC54"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB16"
FT                   /transl_table=12
FT                   /translation="MSADGEFTRTQIFGTVFEITNRYTELNPVGMGAFGLVCSAVDRLT
FT                   GQNVAVKKVMKPFSTSVLAKRTYRELKLLKHLKHENLITLDDIFISPLEDIYFVNELQG
FT                   TDLHRLLSSRPLEKQFIQYFTYQIMRGLKYIHSAGVIHRDLKPSNILINENCDLKICDF
FT                   GLARLQDPQMTGYVSTRYYRAPEIMLTWQKYDTEVDLWSVGCILAEMIEGKPLFPGKDH
FT                   VHQFSIITELLGSPPADVIDTICSENTLRFVQSLPHRDPIPFSERFASCTHVEPEAIDL
FT                   LAKMLVFDPKKRISAAEGLTHPYMEPYHDPTDEPVCESKFDWSFNDADLPVDTWRVMMY
FT                   SEILDFHQTVGVANETEGSEHPDQQSDQNNLDSSNGA"
FT   CDS_pept        699910..701631
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228158"
FT                   /orf_name="CD36_18090"
FT                   /product="Reduced growth phenotype protein (Protein rgp1),
FT                   putative"
FT                   /protein_id="CAX43587.1"
FT                   /db_xref="HOGENOM:HBG396180"
FT                   /db_xref="InterPro:IPR014848"
FT                   /db_xref="UniParc:UPI000192DC55"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB17"
FT                   /transl_table=12
FT                   /translation="MPGSPSSSSSNSPYVKVLNEKLSISLQYLDCERSCQTCVLTFINT
FT                   ADQDININPTKQTSSGGWLSGLFGSSPPLDESLSKVNVDANLPIDLFLGYIQLFGYVVL
FT                   NYKFEIDTASLEVNKKSQWWNNTEYWNQYLETNEKKDDRIDEYLKLDTVPFIEENYSEK
FT                   FTIGGKLGGVQDLVVNDDRILTDNGYLLHDLIGNFNSYSSSKESQALPLQSLTDTIVPF
FT                   YTTPQSLLFTDLTISKNSSRSFCLRIPIRDDLPPSYNTCSTGPACDQGLITIRYSLIVS
FT                   LIEGNFSNKTKSVYFPLKMNSKRYGGAHRYLQKRHFDSSIRLDKNWLVEIVSDKEETKH
FT                   QEKDKSEKGSFLQDLSTLIDSDLYNMPKVSSMERRKSSVNGMSDEINSEGYISQLPEHL
FT                   KTQFRLRVNNQELCTIGLSKPYYHPGEDLNYVINLNPNASNTTKVIGLSTYLEAHEVYH
FT                   LPENGKKIHKYKITGNVKLNTLAPSIINTQLSESSPCFLNDYLNIPKFVTPQFQSSRFL
FT                   NLEYHLVFQFNLSEDDLHEQKANEENYATVFAKCDLYKSETIASSYKFTIPVYILQ"
FT   CDS_pept        702245..703906
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076778"
FT                   /orf_name="CD36_18100"
FT                   /product="Hypothetical GPI-anchored protein, conserved "
FT                   /protein_id="CAX43588.1"
FT                   /db_xref="HOGENOM:HBG396182"
FT                   /db_xref="UniParc:UPI000192DC56"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB18"
FT                   /transl_table=12
FT                   /translation="MKFSTVFTAAFAMGTVVSAQQVVTPASDPLALELTERNLDGLYEL
FT                   QERDLFSVVEGLFSSINYTSILDSIDFESIAGWTNNLLVENNNIEYLDDILNFLGDTDL
FT                   VPFAISYLLSNNETRGIIGEVVIDALPLIKDIDPTPIFVALKNSGLAYVLVADLIKNPN
FT                   TIPFVKQVVVDLLDEGSFGLGDLFGGSSDATTTAVAIDSLTTINTNIDLTVAAAPATVA
FT                   QSIGSIDTSSLAVLFSEARTANGNGATKVANTVSVTAQVTNVATNAKATTAVATGEINY
FT                   SGITGPAYESVPPTQFGAVPTSINYSALSQITGALRKREYNDAVESALREMQKREEGID
FT                   DVEIALRKMKRDNIEDLLTTIFSSVARSNLLNTTIQYLVTDQRFESTVVEILQGVFENI
FT                   GSTLTGVLDTDWSALQPLVSSLLNSGLLTDFISRAFNDDELKAALWNDISSIFKRDMAF
FT                   RDEIVKRSNGTITSLPVSDFITGAATATSALDGANGTLSSLDVTAFINTVSHSFTTSNA
FT                   SSSAVITIQSDNAGSSFGSGFYSTIFAVFGLFAMMI"
FT   CDS_pept        704635..706968
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000092200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380936"
FT                   /orf_name="CD36_18110"
FT                   /product="AMP deaminase, putative "
FT                   /EC_number="3.5.4.6"
FT                   /function="AMP deaminase activity"
FT                   /biological_process="purine base metabolic process "
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAX43589.1"
FT                   /db_xref="GO:0003876"
FT                   /db_xref="GO:0006144"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="HOGENOM:HBG713563"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR016297"
FT                   /db_xref="UniParc:UPI000192DD11"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB19"
FT                   /transl_table=12
FT                   /translation="MTGKSTLSMSLENSHQLDDNENVLYSMSDEDDDYQHHFHQDSDED
FT                   ELPKSFNSAHFSISEDRFMKDHDLKVKAFEALHNNSSNNNNNSQTQTFSPQSPKLTTIR
FT                   RRSSIIDMPQRVNNFNPTSPQNKFGQNFATDPNALPEEYPSDELIEFYQNVKKCLDFRH
FT                   KYLDLSLQTPESSNPKNQPDWKIYPPPPKPTYKSKNRFNQIPRESDDDEEEEFDFNKCE
FT                   IPNIIDSPYYFGLDDEDVYQVHEKKTDKTLVKIPNLHDYYSDLNTISKISSDGPSKSFA
FT                   YKRLQYLEAKWNMYYLLNEFEETKQSKRNPHRDFYNVRKVDTHIHHSACMNQKHLLRFI
FT                   KYKLKTEPDKQVIFRDGKILTLAEVFKSLNLTAYDLSIDTLDMHAHTDTFHRFDKFNLK
FT                   YNPIGESRLREIFLKTDNFVDGKYLAEITQQVMEDLESSKYQMNELRISIYGRSIHEWD
FT                   KLAAWVIDNKLFSHNVRWLIQVPRLYDIYKKNGNVRSFLDIMKNVFEPLFEVSLNPKSH
FT                   PKLYVFLQRVVGFDSVDDESKSEKPIQSRKYPPASEWNSISNPPYSYYLYYLYANIASL
FT                   NNLRMKNNMNTFVLRPHCGEAGDPEHLISAFLTSYGISHGILLRKVPFIQYLYYLDQIG
FT                   LAMSPLSNNALFLTYDKNPFYNFFKKGLNVSLSTDDPLQFSYTKEPLIEEYSVAAQIYK
FT                   LSGVDMCELARNSCLQSGWEANIKKHWLGKNYMKGGVEGNDIEKTNVPDIRVAFREDAL
FT                   QSEKNLVKYYNGLHRKSSDANSAT"
FT   CDS_pept        707265..708989
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380937"
FT                   /orf_name="CD36_18120"
FT                   /product="Phosphomethylpyrimidine kinase, putative "
FT                   /EC_number="2.7.4.7"
FT                   /function="phosphomethylpyrimidine kinase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAX43590.1"
FT                   /db_xref="GO:0008972"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG734716"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI000192DD12"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB20"
FT                   /transl_table=12
FT                   /translation="MATKIIQLKEPVLSLPKVDLKAVMTIAGSDSSGGAGIEADLKTFN
FT                   AFGVYGLTCIAALTAQNTTGVRRFDKTSQRLIKEILAANLEDMLYGYTRETAPLKVIKT
FT                   GMLTNESIAELIDQMPRINEYNVKLIVDPVMVSTSGSKLSDDKGMKLCVEKLMNQAFLV
FT                   TPNFPEALALYELTNRVDRKITIHSMYDFIDFVISLQKSLGCKNILVKGGHIPFTENNQ
FT                   PATDYNNNNTQIRDVLYESEHERVTVFESTYIDSKDNHGSGCTLASAISANITKGLSLE
FT                   DSILISIDFIHRGMISSENKLGFGSGPLNHTIAPAHVASSIIKTTESIVGQMANQSGKF
FT                   LDYLINHPDVKNNWRKYTEHRFVKDLAENNLPFNKFLYFLKQDYHYLVNYAQMHGLAAS
FT                   LAPTYQQTHAQATIIAEIVEEIERHKQKLSATYNINYETDLDLDLELSPGPACLAYCNY
FT                   LLEVGKKEDFLGLKVALAPCLHGYSEAAIKGQKIRRHQVNFGVVNKEEAAVYQTWLDDY
FT                   TSDWYTHAESEGRMALQSLIKSMSPNEKRVEELVQIFNKVTLLEIDFWNEVLNIENS"
FT   CDS_pept        709353..713525
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567263"
FT                   /orf_name="CD36_18130"
FT                   /product="Protein Pan1, putative"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX43591.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG396183"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000192DD13"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB21"
FT                   /transl_table=12
FT                   /translation="MYNPYQQQQGMGYNPQQQTGYGYNNYQMPQQPQFNQQPMYPQATG
FT                   FVPQQPNLYGSNFQASGAGGMASQQTGFTQQQTIQPQQTGYIQTQPTGFGGAAPIVTEN
FT                   SELKIPSIRLSFISAEDQKKFEHLFRTAVPKGEQSISGDSASGILLRSGLSAVTLAEIW
FT                   NLSDLDKTGSLLFPEFALSLHLCSMAKRGESLPGVLPEKWLNEVRSFVDQINFTVPDDP
FT                   SKILANTPFANFAPKRESDWLAPQSTGYLQNQMAAPPMTSFQPQVTGYGGQGLVSQTTG
FT                   GVPMPSTTFGNTAPGLTAQRTGGGTLIPLQPQQTAGLIPAQKTGPLNPQSTGFNQPILQ
FT                   QQRTGGLPQQLTGYQSQQSQQQRTGGFPQVRSQPTGSFVPQTSFQQPQLVSQRTGPLQG
FT                   QPTGPLQAQPTGRPGEWGFVSMPTGGIPGLNAMQQHFLPNTQLPTSNLHSAMDNKLKEN
FT                   VTWAITKQEKQIYDGLFQAWDSQKKGYVDSNVALNVFTKSGLSRSDLESIWTLVDTDDT
FT                   GKLNKNQFAVAMHLIYRRLNGYDIPLRLPPELIPPADRTLKDTMDSLKNSLKGGVNNKP
FT                   TKPPKPQSKPDGTRFKNDDNNFGYVSNARHRRKSTADESHKSSVKSSSDYDLSIEDMKK
FT                   LIHEKRILLDALDTEDQANNYSRSSSSVHERQIIENLKKEIMAVQTKLDETGSTGPSTD
FT                   ERNKLLATLDHLTRDIVPKLISDIHKVNQEISRKKTEVFKLELMKKNPSWNPEDNESQI
FT                   QGTGPNGEVTDYDRIKYQSRQKLKQRMAALTGKSTGGNSDLDLELKQATEKAQNEASRQ
FT                   SEMIQDIATGIKTMEDECAAKLSSSVTADVGHEKWEQGKGISAEVAKFVRELEAFSKEQ
FT                   RRNITQSQNQQQTREPLSKQNTDTSSVSDTSKVKPAYTTPEERAAYIKQQAEKRMNERL
FT                   AKLGITRKNKSAESKPTSESGYARDHSPVPKTESKPVIRDSNPIEEQKPKLDSEPVDQQ
FT                   RSKSDTNDVVPQKVPSNTNDETSGDDDDDEEYQAILKQKQEMEARERERKLRKQKAKEE
FT                   RLAKIKKEMEEMKKREMEESDDDEEEKEANQVADVRVSRAQSNNDSSNSTSQVGTSTQS
FT                   AKQVSEATSTGAARHPYHPHESNPFSKMNNNVAQPQTVNHTGTNPFFKSTSQEPKIDPQ
FT                   KAEAQRASQRGVASSGGWSDSEEEESEEESPNRAGAAKLASLLFGGMPQPPTKSNSSLN
FT                   NDVEKVLKSEHENAKSMAPISSSNNDNGKVDSSSSEVVEENGLSLNQAPPLPTEAPPPP
FT                   NSVPPPPPPPQFLNEAPPVPDSIPPPPPPSVPSTAPVLPDSMPPPPPPPPPSFATAPVP
FT                   DSNSTSSSQQASGAPNMGALLGQITGGTSLRKVETKVSSGATVGRVL"
FT   CDS_pept        complement(713672..716116)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076779"
FT                   /gene_name="HSP78"
FT                   /orf_name="CD36_18140"
FT                   /product="Heat shock protein 78, mitochondrial, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX43592.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI000192DD14"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB22"
FT                   /transl_table=12
FT                   /translation="MLSFRIPKSKLLKQSPTTSSLSLARSIPSIPTTTARYRPNQYYQN
FT                   VLAKPNVFTLRSTPCFSQVRSFHSSLPRKLQMQQTEQGDNRPALEKFGSDLTQLAKEGK
FT                   LDPVIGRDHEIRRTIQILSRRTKNNPVLIGNAGTGKTAVMEGLAQRIVRGEVPDSMKDK
FT                   QIITLDLAGIISGAKYRGDFESKLKSILKEVEEKNGKVILFIDEFHLLMGLGKAEGSID
FT                   ASNLLKPALARGKLSMCGATTIEEYRKYVEKDAALARRFSPVTVNEPTVEDTISILRGL
FT                   KERYEVHHGVRIMDSALVTAALYSNRYITDRFLPDKAIDLVDEASSTLRLQHESRPDAI
FT                   ATLDRQIMTIEIELESLRKEEDQLSIDRKLKLEKELEVKKSELKELTDQWESEKRAIDA
FT                   VKNAKSELERAKYELEQATREGDYARASRIQYANIPELQAKIQELSKNESAAKSSNLLH
FT                   DSVTSEDIAGVISKMTGIPVNNLLKGEKDKLLDMNILLRQSVVGQDEAIDAVSDAVRLQ
FT                   RAGLTSENRPIASFMFLGPTGTGKTELTKSLAQFLFNDKNAVIRFDMSEFQEKHTISRL
FT                   IGSPPGYVGYEESGELTEAVRRKPYAVVLFDEFEKAHPDLSKLLLQVLDEGSLTDSHGK
FT                   KIDFKNTIIVMTSNIGQEILLADKNTYEDGHINNEVKQQVLENLKHHYAPEFLNRVDDI
FT                   VVFNRLSKTALREILDIRLREIGDRLIDKRIVLQLTDEAKTLLCDMGYDPTYGARPLNR
FT                   VLRKKLLDPLAMRMIKGQVQENETVKVEVKDHKIYVVPNHTEGTVIEKEEDYFKEEEND
FT                   DK"
FT   CDS_pept        complement(716723..718435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567264"
FT                   /orf_name="CD36_18150"
FT                   /product="Protein dfg16, putative "
FT                   /protein_id="CAX43593.1"
FT                   /db_xref="HOGENOM:HBG396184"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI000192DD15"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB23"
FT                   /transl_table=12
FT                   /translation="MTCSIYHLNTGVISFLDYYNETWVNRSTTILPAYYITNCTVSDML
FT                   SYNNITTDPKYLAFDYSPYNKRDNGDTYVALLFVLSGSCVSMWMLSLLLYLSPKYKRKP
FT                   FLTQLATVFYAIITTFFLNKLTRASEKQYYNDILDIVKLHTILYNNVEYRVLIIVFQVF
FT                   LLSSWFQIIQKLAKQKYKRIVAIVTSILMAAFIACFIYYQVEYNTEGRIHTETISGLYL
FT                   RWKVVRSVSKLVLVLWLAGNLLYYTTVLKNPRKICYCKKLLPLAIFNWFLIILHIILSI
FT                   LHISLFEDNWLIRTWMVLIPYLIEAILITTVWEWIFNIWVIEKRIELMGVLGRRISIDD
FT                   VLSIQSHRGSNNTNNRKLEKTFTKHGTSTKSDSFPGWSGTRESLAKFQNWIMNRPKKVA
FT                   AESEVLSNNDMNELKEFSTFSNSSSNNDTSQRNTSISPQNQVHQVNNMQRNSDEPLQQH
FT                   INSHLQNHDVGSTASSLQSQPLVSHTEYDDVEYDDEYVDDYEIWDDEEEQESLHDQRVL
FT                   STHLEASNSDENEVHLGSSNNRHESDCNNEPPPSFQPHPGFEIGDYWNDRKEG"
FT   CDS_pept        719256..722282
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380938"
FT                   /orf_name="CD36_18160"
FT                   /product="Sed5-binding protein 3, putative "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAX43594.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG396185"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI000192DD16"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB24"
FT                   /transl_table=12
FT                   /translation="MSYNQHHQPYTGGLDNGVNTAVNGNKLSESLHALNLDQQHSLGSQ
FT                   QHSSKKKTKRPIRAFHTEFNSPIPTTSSSPALPSSPSVAGYPPNFASDGGSPLVNSPGQ
FT                   FQQSSFVSQAQDHSHSQFTTVSNSTEVDQAILQDARNFHQNHDLSLQEHRFNSQREYST
FT                   PDSEGVFKSFQTFADTVPPEAGTQFHAIDQGNSSSKFMRSTMYYVPESEQLRSATKLPM
FT                   SITVRPFAPLLPTEEKVQTVDFSMNDPNNTPEDPLSIGPIRCHRCRAYVNPSMQFTHSQ
FT                   RFVCNICQFANNLVPSEYASVLDGRGYRVDKFVRPELHKGVYDIVVPKEYNFGGPDKDS
FT                   NPLHVVYLIDITENSIKQNLPVLITDAIRATLFSYNHSSEDVSNGHDRDSPCKTKVAII
FT                   AFDKRIHFFNLSSSLESAQISISPDLEDPFVPFSEGLFVDPEESRFVIEDALNYIENLA
FT                   SQDRVPDLEPCFSVACRTASMCLDLFGGGKIISLLSNLPSWGPGGLKYKDNKSIGRTAA
FT                   PEVEKKLFSSDNEYYKLLAMEFIEKSVGLDVHVVSHTPVDLSNVGWLASVTGGEVTRWA
FT                   NFDFERDGRALTAKIYNSVKNISGYQGQLKLRCSNGLQVTQYYGTSSCISDTSIVGNIQ
FT                   DPVIPVLSKDSTFTILLEYDGKLSPKLDCHFQAALLYTDPNGVRKVRVINLVLAVSKSL
FT                   EDVFHFTDENAVVTTIVRDTLSFVGQQSLLELRESINNKLVDIFTHYRAMNEFGHNRAK
FT                   TLTNKMLFPDSLKHLPLYMLSFLKSTIMRASAGLTADARLADMYQMLTMPIERLMYHLY
FT                   PALVELHSLQPEDGTLDEATGFSKLPLYKDLTLKNLDRGIYILCNGERVYLWIDPETNP
FT                   MLLEDLFGTNVDDIKNIDPMMDELPELPTDISKQTRGIIEYFQQEINGISYPNYTGVYI
FT                   VRKTIDAAEFLFKEFLMEDDLGNAVKTANGPGFAEYLTSLHKAIRVKLDSDKSSQSIKQ
FT                   LVSNVEHGNETLAQRYIHF"
FT   CDS_pept        complement(722338..724665)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567265"
FT                   /orf_name="CD36_18170"
FT                   /product="Protein she4, putative"
FT                   /function="binding"
FT                   /protein_id="CAX43595.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396186"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DD17"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB25"
FT                   /transl_table=12
FT                   /translation="MSDEIFIQIIENENIQDKSTKDVLLRFLCSHELDKADGHKLIDQL
FT                   AKISHNPQYSKILYQLLMEYPDQVIKCFERVNDEAAIIITNILGVNSESEEIMQKLYSS
FT                   LRWIMKSGVNLPFYLNVYSSLITHSKITNPEHLNLFLTFVNEQNEDVNRGVLVLVIQNL
FT                   QLQKKKTSDIISDYLEMVMDEDDLSYNNFVNFVSVQAMCFPIAPEICAPIYQHDRTRNH
FT                   LLQRINYIIKGEDIPLAIPILKLIAASCIVENCRNYTVSNYLKFLTQGCTINNDQIQVI
FT                   SSVTISKLLKLLEVEKKDTEISTLDLAEILINYFKHAEAFDEYVEFSVEGLMYLSLYWK
FT                   VRELIRMDVSLIKLFLARLKETSTDSTTINTSFQYGVLSIISNLTKTRDVNDKELNSNT
FT                   RYRLKTAASPKYGSNDEKENQEGITLFNRELLNTNKIISKIASLKSYKSGSNNSLAEVI
FT                   KIIYHLSIDQMKQGRTELVKQGAMTIVLNYLINFSEMKRQGNLITALPKPKDEIVQQCR
FT                   TFASRSLARMLIVVDPQTAFTKYDSRVAIPFLKELLGPDISQYQGGDSDSYLHDMSLLD
FT                   HFECLLALTNIAATAKPELKHYMVTQLFDSYLDNFIISEDTKIRKASWELIANLSTEIP
FT                   LLVKFFNWDAEAARKRFDLSMQLLQSGEVNLQATIAIYLLHSTDIEPLAAQIVSDDDKF
FT                   KTLIDILTDIFSTQSHEKSLILPMEYVLLNLAIATANHSEKNLSSLSTNTRLKNCCGNI
FT                   LRSGGEEEREVIIEVIKTCQFK"
FT   CDS_pept        724833..725729
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228159"
FT                   /orf_name="CD36_18180"
FT                   /product="Chromatin modification-related protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX43596.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396187"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000192DD18"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB26"
FT                   /transl_table=12
FT                   /translation="MDTSTVLEKYTQDLSNLPLEVRHLLEEIKSKDVQVSEARKRYQTR
FT                   DHQLHKFIRTNGTLTKHPKEDQLYAKIEEDMKLVQKLQKEKILLANTALFLISKHLYHF
FT                   ETDIAKLERDELLPPLEHPIDLTEVPKDEHTKSLNGFSDSASATPTPRNGSSATPVAET
FT                   VKKVQKKKINTKGASSSSAQSSSASRQVKRLRSEEIEEPLPYEGGSLAFNGNAAMGTNG
FT                   AADVNGPNGEDADNNLYCFCQRVSFGEMIGCDNDDCKYEWFHWSCVGITSPPKDDEIWY
FT                   CPDCASKMEKRKKKRKN"
FT   CDS_pept        726112..726888
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228160"
FT                   /orf_name="CD36_18190"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43597.1"
FT                   /db_xref="HOGENOM:HBG398392"
FT                   /db_xref="UniParc:UPI000192DD19"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB27"
FT                   /transl_table=12
FT                   /translation="MRGIILLSFILTSCLAADAVPAAAAAPADDAAGVAAAAGAGAVTT
FT                   TTPAGAAAAAAATTATTAKTNTATTTNAAAAAADTLATKGTTTGTVKTTGVTTGTAKTT
FT                   AATAVTADTAVAANPATMNPSELSVYSLTVTMNQAQLQNFLATHTGAAAAAATTSATGT
FT                   SAASGASLDDSTTAAAAAGGDSNGAATIDDTTKGLTFVTSRTLKPSSSATSQASAQASG
FT                   SGSNAGQANSAGVYSTSSILVFISICISFIGGSLGI"
FT   CDS_pept        727372..728592
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228161"
FT                   /orf_name="CD36_18200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43598.1"
FT                   /db_xref="HOGENOM:HBG396188"
FT                   /db_xref="UniParc:UPI000192DDC4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB28"
FT                   /transl_table=12
FT                   /translation="MLRPVRLNSRVVGVRSFSITRLNFNINNIARTPPSSSSSSSFAYI
FT                   HDYNTLLEKVKSTITSKSSELDILGAINGIKNLQNNYPIQDQINDNSKLTKESISIINT
FT                   IFKNDDDDRKFSSKLLHDILILNLPSSLNIKVIKHYYKYNPTDVVSKEVALIPLRNAIF
FT                   NAEFMKAIKLTDLTVGHENYINHMNQILKSGVFKLISTAAMITLFTKLGVSSLIDAGVI
FT                   SQSWQSIGAINSIILTYLINSSFFISIVKLGRTLINAGGDYLTWQKGTFYTHWFKHADE
FT                   MLFSSKIIEADRELNQGESNPDIIEELCRRPPDDRDSMRGLKPGFDRDGNKIRLLQLKD
FT                   DLNKVTFQAYWMTGGDGFEWIEPDQDPADIQWRKHLELYNKPALKQGEFGALGWADDLI
FT                   QKSTKDV"
FT   CDS_pept        complement(728700..729809)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093639" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076780"
FT                   /orf_name="CD36_18210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43599.1"
FT                   /db_xref="HOGENOM:HBG396189"
FT                   /db_xref="InterPro:IPR013911"
FT                   /db_xref="UniParc:UPI000192DDC5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB29"
FT                   /transl_table=12
FT                   /translation="MGVYIPPPNDKDDGDKKKQDTNSNSNQPTSPSSSSSSSSGSTTIY
FT                   IPNPASLIPRNPKVGLIWGPLTPASDNLPALYSMIGLQFAIGCGFFKYARTLSRLRPIG
FT                   GFQQPQSHMAPKLVRTGPIWKIAMSVVTGSLLSFGSGLELCRVTLPYDPWYDEAQHYRR
FT                   MAIKNGDKPSSWFGAYRYYKPMDFKTWIDKVGDWIENVEKEIKIDDPGNFANLSLELGK
FT                   NSNVINVQRQPQANGGVLSKLNSKGKYLEIYTKLNENNRKRWGKLLREDLNEVTELNKA
FT                   PRLDLMLEGKSDLINPEFTKSAIILGNHTMDDDDQFEMVWLNFEPWDELKLDTEYDIRL
FT                   VPSYSGTTDEIETENQESPVTDKVAAKQT"
FT   CDS_pept        join(complement(730742..730907),complement(730389..730675))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567266"
FT                   /orf_name="CD36_18220"
FT                   /product="Cytochrome c oxidase polypeptide VI,
FT                   mitochondrial, putative"
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43600.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG381551"
FT                   /db_xref="InterPro:IPR003204"
FT                   /db_xref="UniParc:UPI000192DDC6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB30"
FT                   /transl_table=12
FT                   /translation="MFSATVRSALRSRLSAQVPRTSNALRAVTISKPLTSQIRSYSSNH
FT                   HEETFEEFTARFEKEFENAYDLFEVQRILNNCFAYDLVPAPAVIEKALQACRRVNDYPT
FT                   AVRTFEALKFKVETPEQYQAYLEELKDIRKELGIDLKEDLYAEDKI"
FT   CDS_pept        complement(731918..733210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380939"
FT                   /orf_name="CD36_18230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43601.1"
FT                   /db_xref="HOGENOM:HBG396191"
FT                   /db_xref="UniParc:UPI000192DDC7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB31"
FT                   /transl_table=12
FT                   /translation="MCPIDFEDEYSILTSPQPAISQSFASFTNVPIISNTNTSIAANNN
FT                   ARTQRRTSNFFPPTNDNSVLSTPSFQVSTDSYQFPDISCSTTTTAITESAISPFTAFNK
FT                   TALSEPPQSPFYTKTPSSITTSNLGSPVINKLSQANFNTINYQLTNSLNDLHLQSSLDS
FT                   SLNSITHQQQHQQQQQQQQQQIHDIYQNSNLHNCLPNVSHQENLYNLEQRHVLNQQNSY
FT                   YERPQNHTQELGNGFMLNTNPIDTPKLSPVLSQSIWNSEITPELPKIQKRQNRYSNKVN
FT                   NPVFIPSDQPIDTKSIDNNSLSPKNKTIVTDDQPSEPLNRRIKFPKQVNYTPKHNYFVE
FT                   DMLKYDLTNRYSEGYSTTFYKRNKHGYMFIREATNTLHVHQNSWVQLKIKLPTGSPPST
FT                   TGNRNNSSSRKLLSKKLKVNIKELPIWKPKP"
FT   CDS_pept        735110..738193
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228162"
FT                   /orf_name="CD36_18240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43602.1"
FT                   /db_xref="HOGENOM:HBG396192"
FT                   /db_xref="UniParc:UPI000192DDC8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB32"
FT                   /transl_table=12
FT                   /translation="MLGRLFKQNNNTTQPHNAHHQPPIQSSSNPTTPPALTSSYEDSYT
FT                   REILYGTHNANQLKPYQFNSKLFRIIISQDGGNLRTKQVLYDSANDENNHYSPTKSQSY
FT                   SCLMQHQQQQQQQQTQDFSNFKRPVSPKTMKTGKIYHNASDLNDYMFGCGLPSNENHSA
FT                   TKLHVLPPLTNSMYGPYPAVLITRLFSISDGEFIDSSLFSNTETKEWQPHPALTIKESS
FT                   IRKVSLKDDTSKNNNVNSRFAIGIVIPLESLGSLIDIVFNNWHEIIHYTINFQKLIYKK
FT                   LLVHLNQGLTYDSTHNYTGCQYLINKRIQFPNYILQHDNEIGIQLLKLIKTVHYNYNVP
FT                   KLINSNTLMKSSVTKDLFQYNPMLVNWVLELLNWLEFKDGRYSDHSNSFLGSLFAILTP
FT                   FKKSLSMKPFYNSCCAKKEVTRVVVMTGNPVVARKLVFILNGLIPNSQPVKISEAADNL
FT                   HENTVNGGDDIVKPITIRKHCHSQKIQNQNQNESQSQDHYHALPPQPGSCSISESSSNN
FT                   SLTKSTPSFKGWEIPNKGSTSITMEPCQVETTLSSSCASGIPIRGTSSPGSLSMAYLSS
FT                   SLNSSYSSSNYSLSKLGGSFMEKWKNSFGSVSSTSGAAMGGTGIGGGTSGSINNGFSNN
FT                   ANGGSGQNYTTTTTTANSGYFDDVYNFNKRTSPYSLRTPSPAVEFDEYNFSSTKPINII
FT                   NNSLSSNFQSSLSMTPSRLSRTQSMYDLYGNKPAGMMNVMNEEEDMSEGEDLHQKSEFN
FT                   SNATTNNNAVTGMSTLELKRTKTSVFIPLIQDNMIKNISEHNQSLIKEKCKLIMEHKLK
FT                   MSGVIDDNILQVESPSIHKGTRHNEHIVFRNKTLIPVVAFSDEFRPEFNVQSCPINPKL
FT                   EQQVMTGMKQDLLFYQNNSNYDEIVSRTIFISLRAREIKLIEMNINNKDNKGFSIPSSP
FT                   SKQMVNNGTISSTTNNTYKTKIKKIYTPSKNNGNRELINKIETAFSEIGQLFAIQQQLY
FT                   QQHNNNINRTNDSTYNNSEVTKREFHEKLCKLVLQIIN"
FT   CDS_pept        complement(746998..748668)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567267"
FT                   /orf_name="CD36_18250"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX43603.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396193"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000192DDC9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB33"
FT                   /transl_table=12
FT                   /translation="MVYSSEASKWKAYQFNDPFAAGSFFVCNKVSQIYCRPDCDSRPTT
FT                   NLKSEIKFTDTNEEALSLGYKPCETCDPIHSYAIDVNLLIKCVATVNERIGFIQPLLDE
FT                   NEESNTRKIKENIIETRKEEDGLRSIHNFGDLKSSHHRGSVPNITSKDLSLSKNDSDHY
FT                   RLVDLACRHLALAAAINVFQPKQQSNSTEEPSSPTANGNGKRRRRRGGVLGFKELAAKS
FT                   KLSAWHFHRVFKSVLGLTPKTYGDKCWDFIKKVKESGEYTTFEVYSTPKSSTSSSLTSP
FT                   QLSATTAAGSSNKKKHHHHSASDSVFSPHDDTASNPSIPLTPISQTIPSLSNPNTAVSD
FT                   MGTISYPTTLDDQLLNMNFADESSLPMTKMPSYSDYNLLPNNNSVNNNDDKLQYNILPS
FT                   QQNYQHQQFSVPSSTAPVFSEMFDSVPSSSSTTNISVTDSISNNNTSAPMFNTDMFKDL
FT                   DYSQPIQSHTQSSSIDYGLGEDLGSYSSMFDENMFTTTSVNPYNNASNNNGFNSMFSFG
FT                   AGVDEDTTTTNITNDDTIAAGLFLPQLASIATPTGTHHN"
FT   CDS_pept        753485..755098
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380940"
FT                   /orf_name="CD36_18260"
FT                   /product="Ferric reductase transmembrane component,
FT                   putative"
FT                   /EC_number="1.16.1.7"
FT                   /function="electron carrier activity"
FT                   /function="ferric-chelate reductase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43604.1"
FT                   /db_xref="GO:0000293"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396194"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniParc:UPI000192DDCA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB34"
FT                   /transl_table=12
FT                   /translation="MEEVVVPRHGDHHNINIKYGFFIFALTIIQTIFFLQVKFIQIKRW
FT                   NSTGRFSKFWSQITNPPIWLMVTVWLLIVIFTGGHKISDFSEEYIISAKRYGRMAYCLI
FT                   PLNIYLVLRPTNSPLLKPGYYLENMSLHKWTSRIIVFCSTIHAAGYVYKWIKEGAILNK
FT                   PFRFLNLLGVVVFVFLVVLAIISIRPFRRKVYSTFYLIHNVTAWSMVILITFHARPGVT
FT                   VFAVISLILLGYQLYLRYYSSYMVNSLKVIDIPTSTLQIIKIPQSNKFPNWLPGSHIRL
FT                   NYTISKFKSWTTASHPFTVVTIPEDSTNNLTLIVRKPNSFVINPLDSYLVTGPYPSLAP
FT                   PFFTTANIVNIICGGSGISLGLPIYHHFKSINSTVPVKLVWTIRNQNDTFIMNQLDMTG
FT                   VQVYVTSIGDTNSEQQENQQQAVPLFVIEEEEEEQGHGLLNNDNENGIELQNMPKTNEE
FT                   SSEANSTNSKNNKDNQERKEYFKFGRPKFDEVFAIDDPTTTYDLDNSWVIACGPDELIS
FT                   DAKRWSKDRGYRFYYEKYEM"
FT   CDS_pept        756037..757965
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076781"
FT                   /orf_name="CD36_18270"
FT                   /product="DNA polymerase eta, putative "
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX43605.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG396195"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI000192DDCB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB35"
FT                   /transl_table=12
FT                   /translation="MAVKQETLPLTIPLATNPEVTTTSSKFAYQNLDDLNDPRKAYLSP
FT                   LAVIALIDLNAFFAQVEQIRLNLTDQDPVVCAQWNSVIAVSYACRKFGITRMDSIASCK
FT                   SKCPNVIIAHAAVYKKGESHWAYIEGLPTINNHKVSLDPYRRESRKILRIISKSFDLTE
FT                   KASVDECYIDLGREIYKRLIDLFPQLSRSSRDNPENGYANLPLIPSILPLDLKWEGEII
FT                   NSEKEKTMDNGNSSPPPPVIEDWDDICFIIGSQILLEVRKDIFAELGYTTSAGLARTKQ
FT                   VAKLAAGFKKPDAQTIIRNSAINSFLTNFELTDVTGMGGKLGESIINKINVPPQINSIS
FT                   FIRENFSIDSIKEKLGGELGLKVYNICRGTNAIELQSLIEVKSMTSTKNFTSFSVNNLF
FT                   DAYDWLKVFAGDLHNRLIDLDNENIELSSTELSNKSKGIMKRPKTLTLGVLSQNGTRQT
FT                   RQMQIPIHKDLDKMKDIFFENGCVLLREFLEFNTHVSLLNSRTPVKELFIWNPKKVKIV
FT                   ELINISLTISKFVSVEDRFSLLKTTDTQFNKEEHIAKLFRDYEQAPETMRYSPPPPPPP
FT                   PPQKKRSKNGQLDIFESLKKKSKPDDLLEELIKTKKCSRCKLSVDDPIEHNDYHIAMDL
FT                   SNKLNNH"
FT   CDS_pept        complement(758045..761143)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076782"
FT                   /orf_name="CD36_18280"
FT                   /product="Nonsense-mediated mrna decay protein, putative "
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAX43606.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG396196"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR007193"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DDCC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB36"
FT                   /transl_table=12
FT                   /translation="MTIELDKRRKELHILNVKSWAGEFTYETAAKLDSSLKKNSTFIKK
FT                   VKSISNESSSSILKDIQTLSIEKYLSEVLTSLTEALSKVSKSDDILAAMEVVSALHQRF
FT                   TSQFSPMLLVNMLVAISNPGPNEVTDEKEDTSRILRQRNLLKLIMEFYIIGIFTNLKMC
FT                   SKDIIPDEILVKYAKSASEPIIIVVLKDLLTYKIKSGNTLAIVQSFLKRFKHIIYDSTN
FT                   ELLQFEVRNVLQQIFTIYTRTIFETSVELKKRVHQVTEKGKKASIRTGRILEENQIEIE
FT                   SVTKLFEKFKSTSEFVSSILDVPLPNELQADDQDKEGEEPTNAVVEVVKSKSMNEDDLN
FT                   GVWEDIKEKNFYTVIPSVGELIEAHPNTDKESRTSQSRDGERIQAFLQKLENINSYELD
FT                   QLVVEFNNLNLNNKATKNRIMKFFVDTASIDSLKYYTRFLKINEVNLSDLIEELINYLD
FT                   KGFRSQLYQNKLNFKNILFFVEMIKFKMIPTHIIFHKIRKLTLNITSTNNIDILSVFYE
FT                   HVGRFSLNDPDYKDLMREMIDMLKETSKRPNLKINDKLAINNLLLIVEPPTTKVKSLQT
FT                   KPELSPKSQFIQRLIRVELDNTSLPLVVNLLKKIHMKQEEECCATILDCFAHPELINYD
FT                   NITALAAVLEVYFTKYKKIVVYTVDTTIENIIRGLELNDYRMNRVRMAQVKFVAEMYNH
FT                   RVINFKLVNDLLYRILCFGHPNNQPLPNNWDVEIDLPDNYFRIQLCCSLLNNLKSIFID
FT                   TDVLSKKKAHNRAVELKKRNDINKDLLGVFITFLQYYLFCKEKPLPVELDFKLNDLFTK
FT                   YKSIPTVKRYDTLQEIGKRLQESIQRKREAESYLDNSDEALVVDDDDDDEDVTEDYDNG
FT                   EDIDSDEDDEDDEDDEDGESEEDNDEESEREDDISDTESEGVSEEDRLRLEAEKKFMDD
FT                   LDKEYQKILIDSYDLSSSQNSSNRNKLLMPTPRKLFVEKNLVTPSTDKSKVSFGLLTRK
FT                   GKATDIKKLQLPSDTKFAESVLKEKEHQRQDRERIMKLVSNME"
FT   CDS_pept        complement(761457..762605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380941"
FT                   /orf_name="CD36_18290"
FT                   /product="Mitochondrial ribosomal protein of the large
FT                   subunit, putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43607.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG396198"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI000192DDCD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB37"
FT                   /transl_table=12
FT                   /translation="MTYTMLRRTIFRQFQRNQSTSTKGIWSDFSKRSPSLRIQNENIRK
FT                   GLFEGIDEQGPASITNPNIRGIYHSPIAIDETFSEAYKILEDDASKKYGRLEKLQEEYT
FT                   KMTDKSSTKANSIKREIKELQIETELRNPEVLYNIEYYSSDIIDKSQPIYRKLLKEKWK
FT                   EHDLLLTMQRLEQLHVIPDTLPTLVPQADVKVKFTHNVEEEFKDWITPGSILPTFAVEK
FT                   PPVVQVQEFDKVEADERLYTVLLVNPDTPDLEKNSFSTTLHYALTNVSLNNVDNTIDVS
FT                   KLLNEGDKITLKDYLPLTPEKNAPTQRACLWVFRQKDQLQPIEIARENFDIRSFVESNN
FT                   LLPIGAHVWRQHFDRSVNEIREKYGLDKGRVFYKERGLAPMP"
FT   CDS_pept        complement(762891..763607)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228163"
FT                   /orf_name="CD36_18300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43608.1"
FT                   /db_xref="HOGENOM:HBG396199"
FT                   /db_xref="UniParc:UPI000192DDCE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB38"
FT                   /transl_table=12
FT                   /translation="MSYNHESFKEHTNFQSVHSFLNSFQSKDFNDSIIQLEVPSIDSSR
FT                   EVSASPSNTKNSTRPHFDSKQYYHPLEQLPQAQAQLQQQFPDQFQFSNLNKDFSEKNDT
FT                   VRANKKKLRTAGNILAPDQISRTPSTSPPLMSPIFTNDLLSSSPEMDLLEFEEDDDDDD
FT                   EDDDEEEAIFGDSYNENSNRVKRWNQDDIFQSHDSANANSNPPVPGLFPRMNLNAHDNF
FT                   MDTKELPLDPVVHKRQ"
FT   CDS_pept        complement(764355..764885)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21076783"
FT                   /orf_name="CD36_18310"
FT                   /product="AP-1-like transcription factor, putative (Basic
FT                   leucine zipper"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX43609.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG396200"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI000192DDCF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB39"
FT                   /transl_table=12
FT                   /translation="MNIFTPWTKNNKAESANGHETPQFASAITQSNSTNSRPTGKELMG
FT                   PSYSRVQDLSAHAIASQAQINPSTGSMDVKVDPELPKAHSHRIVSTTKRAEQNRNAQRA
FT                   FRIRKANQFKELESKAKEVDQLKSKIESLEARNRSMANYICELQRQIIEFNNNKTPSKS
FT                   DDNGKENNTPSGN"
FT   CDS_pept        765663..767747
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228164"
FT                   /orf_name="CD36_18320"
FT                   /product="Hypothetical wry family protein, conserved "
FT                   /protein_id="CAX43610.1"
FT                   /db_xref="HOGENOM:HBG396201"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000192D2F9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB40"
FT                   /transl_table=12
FT                   /translation="MKFPKLRKRTVYWAVLTVSILFIIHLVFQYKEHNSYETYPIVLIP
FT                   KTFSSSISDAFETQNNEAFPIKLLKNCQIIHSYHAGHEENIKSMAQEPQSNFHKFNFTV
FT                   FNSAKPIGLDLKQCQLLRSSSQIEVNDAVRMDASLHDILSKLLQDIQHGKLEYFREIAP
FT                   FFLPELQLQLNLNIVDRFWYRFSGSSIWLEQYDMYFMISRIAYSPHGVKNQPVVSLTYG
FT                   QLFDRNWNEIKNINLLVPSNEFTKDDGQGSFRIISFPYFLPIPFWHDIDSTDGNYFGPE
FT                   DPRLILVKNKQGYEEPLLIFNSYHRKFVHYDDDEDSIMGQTVKFQRSMFMCWPWQYQTG
FT                   KSNVEGTSNPEYDNKVYNRVVELKVKLLADMKTQKNWTPFISNDGINNFDSYIFFVYRW
FT                   ANLDVLKCNLLGDAAGNCVFDYRVDETLVPQNKVGPLRGGTQLVNLRQIIPPSVYHRLL
FT                   PPHRELFVGFARTHLDECGCGKVMYRPNLAILVKDKTDRTYYKVSHISSSLSFDVPIIG
FT                   WNVYKPDDLCFDSNVLIPYSVSNWNITSLELDREGGKWVSDDQLTVTLSISDSTVHRLD
FT                   IRGLFQSILDLTDHNLFMPIHADDIGNDKWKNSLQIPGSDSHIQDMMQFGFNNDNIVCA
FT                   LHASVEFCFEYGVKFGIPKQEDFYEVEQQEFNEELIDPKKHQYFKILSKYLYDQAVANS
FT                   "
FT   mobile_element  complement(768455..768730)
FT                   /mobile_element_type="retrotransposon:solo LTR, rho H"
FT   CDS_pept        770012..771670
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567268"
FT                   /orf_name="CD36_18330"
FT                   /product="Thiol-specific monooxygenase, putative "
FT                   /EC_number="1.14.13.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43611.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326751"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000192D2FA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB41"
FT                   /transl_table=12
FT                   /translation="MSVITLTKESHKHPEKFRIKHQDEVEILGPHRKDRFAINEDLPTI
FT                   TTTSKIAILGAGFGGMASAIKTMQKYDEQDIQIFERHDNFGGTWYANTYPGCASDIPAL
FT                   WYSFSFALTSNWSRIQPPQYEMEEYILRVAEQFKLREKTRFQTEINKFEWDDVNGQWTL
FT                   YAHDVKTGQKIIHKSKLLLACQGGLVHPLQLQAEGLENFKGTYMHSALWDHSVDFRGKK
FT                   VIVIGNGCSANQAVPALLNDPKYSVGSLTQLVRSKHYIMRPLPRILYILYRLLSFNFIA
FT                   LYIVRLIVVFGAELRVPLFKGDGLLSKIVRWINTTASVSYMKGNAPKKFHDLIIPNYKI
FT                   GCKRLIFDYNYIPSLNDPRVDIKNQGIDRVVEDGIILKNGEHIEADIIVACTGYNLSKS
FT                   FFNFEIIGRNGANISEEWKQDGPSAYRTLLVKQSPNLWTIGGTNSATGHASVVMAIENG
FT                   VDYFLKTAKPIIEGKAKSVRVTDKAYDNWLTTIQRELKKSVFGTPFGGCVSWYSDAKVN
FT                   STVYPWSQFHYWWITHFPDYKDLIYEPLNEDKKRR"
FT   CDS_pept        771881..772630
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093650" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567269"
FT                   /orf_name="CD36_18340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43612.1"
FT                   /db_xref="HOGENOM:HBG396202"
FT                   /db_xref="UniParc:UPI000192D2FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB42"
FT                   /transl_table=12
FT                   /translation="MPIELILSPLMRPAVHAKSILFAPHRNASHYVPKIKELPPPETIS
FT                   QYAVIRRIGTGSKVFDVFDTQRGKFPTGPKDPNERTFWFKRSRAAKGGYTMFSQDILHT
FT                   GPNGEDEPIANVRAGLRGNVLLIRAPQAPAAELGWHIINHRVDAIDTYRMFTLCDGNTY
FT                   QWTYRGQWLEKVSNVGEKESEVRERIGRVVPNGDFGFTLFIDESKMIREMALSTALCSY
FT                   IDQWNTNLEVGGIYYGRQKGQVRWKRD"
FT   CDS_pept        773162..774637
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567270"
FT                   /orf_name="CD36_18350"
FT                   /product="4-aminobutyrate aminotransferase, putative "
FT                   /EC_number="2.6.1.19"
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="gamma-aminobutyric acid metabolic
FT                   process"
FT                   /protein_id="CAX43613.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0009448"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG483813"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D2FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB43"
FT                   /transl_table=12
FT                   /translation="MMQRTIINTSLRQVQKRFNSTSVTASYFPEEPKNPTFQTETIPGP
FT                   KSIALNKELGEVYDNHATYFVTDYFNSLGNYISDADGNKLLDVYCQISSIALGYNNPEL
FT                   IKAAKSDEMVNAIVNRPALACFPSTNYKQILEEGLLAAAPPGMDKIWTSLSGSDANETA
FT                   YKAAFMYQHAKLRGDKPFSEEELISSMENKTPGASDMTILSFDKGFHGRLFGSLSTTRS
FT                   KAIHKLDIPAFPWPRAPFPQLKYPLEDFETENRDEEQGCLYQLESIIENSLSKIAAVIV
FT                   EPVQSEGGDNHATSFFFQGLRDITKKHDILFIVDEVQTGVGASGKMWAHEHWNLTTPPD
FT                   MVTFSKKFQAAGFYFYNPDLQPKLPYRQFNTWCGDPSKAILAKAIYQEIVKSNLVERTA
FT                   VVGDYLFEKLSSILSRFPDKVFNLRGKNYGTFIAWDCSSADLRNKILAASREQGLNMGG
FT                   CGDQSIRLRPTLLFEKEHADIFLGILESVLSKL"
FT   tRNA            775125..775196
FT                   /gene_name="tRNA-Glu (CTC)"
FT   CDS_pept        776514..777605
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18533806"
FT                   /gene_name="SAP99"
FT                   /orf_name="CD36_18360"
FT                   /product="Aspartyl protease, putative "
FT                   /EC_number="3.4.23.24"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX43614.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG396203"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192D2FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB44"
FT                   /transl_table=12
FT                   /translation="MLLNVLSFICLAIITNAAVVKKNEPKVIRMDVKQGVSNLVKRGDA
FT                   TGTSGLTQNYYAFTHLEVGSNKELTEVIIDTGSWLTHIFDVNITCSGCQGTSEYNSSQS
FT                   STVVKSGKKGQSFFGPDAYYIGELVSDSIQIGDLTIPEVLFNDVHNSSGFGYGILGLAK
FT                   PSTENESVAWVARNHGLINKAAYSIIIQNLDGSDGNLIIGGYDAAKIDGEINWTSIKDS
FT                   NIHALLSQVEINGETIPVNRNYTLDTGGGNGYLPEDAYNRVVANLPEDPDFGSDHSYIR
FT                   CSLLEGKTFTYNLNGIDYKFPLRSLYAPGESYGYCHLALYKGDVAQLGGSIFRNLFLAV
FT                   DLEGDLFGLASLKNTAETDIKSF"
FT   CDS_pept        778861..779958
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19380942"
FT                   /gene_name="SAP98"
FT                   /orf_name="CD36_18370"
FT                   /product="Aspartyl protease, putative "
FT                   /EC_number="3.4.23.24"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX43615.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG396203"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192D2FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB45"
FT                   /transl_table=12
FT                   /translation="MIFKILAFISLAIIIDAVAVKSNPKVISFDFEPRFSNPVKRDAGT
FT                   GTGTVASVKDTYWFLTVKVGSNQDPVTIAADTGSWLTQIIDANATCSSCKKYGVYNSSD
FT                   SSTVVKSGKSAKSFFGPHEHYIGELVSDSIQFGDLQVPQVTFNDVYNSSGFNDGIFGLA
FT                   RPPTDKNQSIAWTAKYHGLVDKAAYSIYLQNLDGTPGAFTIGGYDAAKIDGDISWTSIK
FT                   NANIQALLGHVEIGGEIIPINRNYTMDTGGGYGYLPQEAFNKVLAHLPDDPKYGKSHWQ
FT                   VSCSLLEGKNFTYNLNGVDYTFPLRTLYVPSENTDHCYIALRNGTTAQLGSYVFRNLFF
FT                   AVDFEEDLIGLAKLKNTTETNIRPF"
FT   CDS_pept        complement(780222..782744)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567271"
FT                   /orf_name="CD36_18380"
FT                   /product="Positive regulator for mannosylphosphate
FT                   transferase, putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX43616.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG398393"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniParc:UPI000192D2FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB46"
FT                   /transl_table=12
FT                   /translation="MRRSRGVLLVVSIVVFNLIVLSLFQFTPIDDYVIGNKYIDSIKQL
FT                   LIKYQPDSPSSLFSSWSLSNDAAFALSMNHEKEISFHNEVATAVDKDKSSNALYDQLDS
FT                   TTTKASQFDIIDIPNDIPLAYQPFDPRFTLGLLLKYVNEQDNRVLELPSFHWSDFVDMS
FT                   PLENQLFHNTNNLDNNQQERLNCKDFDATKKNPRINQKNMLLPTQQYCIDDDQIDTILN
FT                   DQESYSKYDSYVIEQLKEIKQQNSPISIGFHIFNFPGRNAKKYRPILGKAYVYEFMKNP
FT                   STLTMLLPTTDQEQQGLQMMYQMPVNQQTRNKISNTNQIFKSGITIDLKQELNKLINSN
FT                   KPEKLTTLTYEKHLSHDSFVDNTPAIIMSMEQQSQAQPLNQTDTNYLNTLKFSLSYENP
FT                   EKYFHEANILTREANFALGGHYDWRFMNGIINNTPQLTVSINQLIKSWFRLTNQFGLNT
FT                   WIAHGSLLSWYWNGLQFPWDSDIDVQMPIMDLHKLSRHLNQSVIVDFGHDINNIRLGRY
FT                   FLDCSSIISQRTRGNGNNNIDARFIDMDTGLYIDITGLALSNTKAPARFNKLLHSSPNN
FT                   GELARENSRDATISELTRNEFLQVYNCRNNHFTRLEELSPIRLSLVEGEFGYIPNEFES
FT                   ILKTEYNEKSINNKDYNGFVFLPKLRIWVKKKPIINFVAAKEEKEQQQEQQQQQQQNES
FT                   PKKTISIITIDLSDEEYSQYLLENQSELISYLITSNVTLFHQDELVHYFNGRSAKSLFF
FT                   TEKELQQQQEDQQSQVILKKGLIQDLSQDLFKFNSFQSNYNYIDKLKEIKLLLGEKQEK
FT                   QNSDDNNSDGYGDNDDPLNRNEIVNGIN"
FT   CDS_pept        785597..786703
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567272"
FT                   /orf_name="CD36_18390"
FT                   /product="Protein N-terminal amidase, putative "
FT                   /EC_number="3.5.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAX43617.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG734807"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI000192D300"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB47"
FT                   /transl_table=12
FT                   /translation="MKLKVALLQLNPRIGKINENISNVYKLLSSSTQQQTTITTTKQQL
FT                   NNKFDLIVLPELAITGYNFPNSTAIKPYLESIDKFGPSLNLGRELSIKYQSMLVIGYPE
FT                   FSHGDNKIYNSCAVFNRCGQLIYNYRKTFLYETDEIWGCNENPIKGFPSIELDFSLNNN
FT                   NNNNNNKKKIDKNVNENSKSTSLLITTNIGICMDLNPYKFEAPFNKFEFSMSSYSQRAK
FT                   LLICPMAWLNPSSPSILDKEEFDKSDKLELAQELELELKNSDFVEPNWSTINYWILRFF
FT                   PYLSHKYSIMPKWFNKIKDNNDEKITVICCNRVGVEEDVVYAGSSCILQFNNHDKYNDA
FT                   TDLTNKSVELIGNLDQINEGILIKEIDI"
FT   CDS_pept        789097..791703
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247958" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567273"
FT                   /orf_name="CD36_18400"
FT                   /product="Positive regulator of mannosylphosphate
FT                   transferase, putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX43618.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG396204"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniParc:UPI000192D301"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB48"
FT                   /transl_table=12
FT                   /translation="MARLKRVLLSPRSYIKSILLVTIIYTIYLSTSTTTSVYLTTTQSK
FT                   LNIYKNQLYQKINHQFNQWYYNILASDYDFFSDSNFQQQLTAIKSEKLHDENHKLDLWN
FT                   LDDSFKLPLSVKVPNYLLSSSSSSSSSSTDEKPLIQPFDPRLTLSVYYNYIETHINKQS
FT                   HDSSNDLKLPFHWSDWVDFSKLNKYILNPLKTDLCSNLFDLSHDDKLNEDSEIKSVDKY
FT                   CQFMGNTNNDNENKATKMLGYKIFAPAHAQTGDNHELIGKSYLYTQAPSPKRLVFLTNT
FT                   NDNYQFDIDNYNVNNVTNSILYNEKLTSDLESKVTKENEQSSTLNVLSSYISLIKNSPP
FT                   SLLPTKQQNNQNNQNNPNDNEINSHVIDIPEEYFINDPRSIINQLESSNSQLSNSEQDF
FT                   LSSIKYSVDCNDPPKYFYEAKFVKAMKENWHGEHYDWRFFNGVTIHNAQQQSIILHRLL
FT                   KNYLKFTQSNNLITWIAHGSLLSWYWNGINFPWDNDIDVQMPIHELYQLARFYNQSLVI
FT                   ENVGTKHLGNNKQQQNAGSDKNEEFEFDGMGRYFIDVGSTITHRTKGNDNNHIDARFID
FT                   IDTGLYIDITGLALTSEQSPDRYDDLLTINQNSAEARQKLDQLKQNQKDGNNNNNHSFK
FT                   NQQLKIYNCRNNHFSSYDELSPLIQTVVENQPGYIPKNFMVILNDEYNLESLTKKNHRD
FT                   FTYFNNFNLWLNTKDVSNYLAYKHSPSDSSPEGNNQAYSLIKFNKLSKSDHINLLNYNV
FT                   LMMKEYLETMNFTNYHNLELNQLLKIGNYNHNHVNTNLSNTSIYRESYDLFNYYRDNYK
FT                   LGYSLRPDHFINFIIHDNSRWDYQLQVDDLIKLQKQLNDDPQQQQQQQQQEKEQQN"
FT   CDS_pept        792792..793100
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17567274"
FT                   /orf_name="CD36_18410"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43619.1"
FT                   /db_xref="HOGENOM:HBG396205"
FT                   /db_xref="UniParc:UPI000192D302"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB49"
FT                   /transl_table=12
FT                   /translation="MRVFQIVYILIISNLIYATSGGGGGGNTHHYHKDDNSIADNTNNN
FT                   NNNITNATTTRTVTTSTKTKTHTGGGVAGIGGVLGQDGWLSGDGGLMAVIIGAMLLL"
FT   tRNA            793458..793530
FT                   /gene_name="tRNA-Arg (TCT)"
FT   tRNA            793539..793628
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        794726..795814
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228165"
FT                   /orf_name="CD36_18420"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43620.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396206"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D303"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB50"
FT                   /transl_table=12
FT                   /translation="MTLSIPELNFKAYTYKNRSTPVHLTDKSIKLVKDPLNPDSYIAPP
FT                   GKILLKINYTSLNPVDVKLHHLATSLVSLLFNNQNGFGRDFSGEVLSIGDNVKTNVKVG
FT                   DLVQGIYHKVYFQGTASQYLLVDPSEVDMIAKPDNISLAEASSWPTVFGTALLMSSDLK
FT                   YKDSKVLVIGGGTSVGRYLVQLAKQGGVKEVVVTCSPRTEDVLKSLGADTIIDYTKHKN
FT                   IVYPVLESVKSTGKFDYILDTYGGHDLFPEINNILTDKIGRYYSIVGDYPGSSFYNLIS
FT                   TLSAISWRKFLGAVGLLSFNYKFIMFDNFRSTIENARDLIGRGNLKIFVDSVYPFDQLD
FT                   QAIEKLDSGKAAGKVVIEVAKE"
FT   CDS_pept        complement(796033..798897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568254"
FT                   /orf_name="CD36_18430"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43621.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396207"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000192D304"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB51"
FT                   /transl_table=12
FT                   /translation="MDIPLKSKPKVSTVNLLADSKFEIGSTTNSLSSASLDIDKKDSDE
FT                   PSQLNPDYLKIRHSSKNQQQLEGFPPNYTFSRRYSETEKNNFDPDTGHRIFADGKIRPH
FT                   QIKHEHLGARNTFTNINNFNNSGDVGRNNVTNRGTNSINDNNDNNNQLHARSHDSNIGY
FT                   KDETGYEEFIPGLDFSSLVSKWNSNSNSNLDLTRNTTNVSLYTTHSNTPRSRDGSYLDL
FT                   NLLHSKVAPQPIKTSTDQQRNLSYSKLHEFMKTKQQRNAYNNKNNDIEDNDIVSLTKDD
FT                   FSRSSSGLGSSPSSAKRETSAGAMAESSKARKKQKSAIDPATGEINYELIINSLPPNFN
FT                   DMPYSQRKKLVKSFSESIDYSQFSLFAKNYLGSSVGSAKTLKGSSSGTGIASASSSLSR
FT                   RNRVGSLNTLAGRLLARTSTSDFKKLQEAMKPKYNVDEKGAIVLGHELGKVIGFGAWGT
FT                   IRECTDQEDGIVRAIKIVKSTRDFDGGSGNGNHSSGNLNSKTDLNASMKSKNPRVLEVF
FT                   KKEIQIWKQLHHDNILPLIDYYETEDAIFCIMNRINGGTLFEVVDSWGQFNARVNVMCG
FT                   PLEYSFEEQRQRLLKVIECARQIVQALLYMHEEKGIVHGDLKLENVLVEREKGHCKMIL
FT                   CDFGMSRVYSSRISRKSSKRHIHYKGNSKLSIDGDLEDTLMMRSRSSNIEFRKPYFGGD
FT                   SPNTRKLEFDIRDDSRVGLANFFRAHGPSMQSIHLTPVVSENGHSPSDGYFDLTNKNDN
FT                   FDNSKPIFSRYQQSHNDGKEENGLDSGLPHSHIGSLPYASPEILQPSPPPLGPSADVWA
FT                   FGVLIYAMIVGRLPFQHHYEPRLRAIIASGKFNKLDLRKACLLEWVLKEDTKQKHQNQQ
FT                   QQNCNSADNSSSSWTNELLNSNSLIDMNRQNDLIKLEDEWSKYKDKREFEWLYDIVIGC
FT                   LEPDITKRWDMEMINDQICTFSSI"
FT   mobile_element  799152..801503
FT                   /mobile_element_type="retrotransposon:omicron AB, Tcd20,
FT                   LTR"
FT                   /note="Gag ORF flanked by inverted LTRs, each LTR followed
FT                   by PBS, one LTR truncated"
FT   CDS_pept        799728..801101
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077015"
FT                   /orf_name="CD36_18435"
FT                   /product="Gag protein, putative"
FT                   /protein_id="CAX43622.1"
FT                   /db_xref="UniParc:UPI000192D3A9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB52"
FT                   /transl_table=12
FT                   /translation="MENGFTDMKSQLAQIITNFQTFAQDQNKEMEYIKTEAAKGINELH
FT                   ERENQTQDRELHLEDVEAKLESREAKLEQKTAFHEQQEAQNFKEVDDELLWLKDYIEKT
FT                   EATTACLEAQLENSVPKGAIDNRDSIDFKLKRFLPDADFSDGDPAGAVTKQPFVSDDLI
FT                   ISGSNDEEALTKFTALQSHFRGNLLEKRIWFFAARPYIRDNLAHSYHALSPAQQNWKGL
FT                   ATLIVNAQDCERVNGNKTLEKNRLTPQPGESVVSFIQKAQNFSQATISYRNSFINDKIN
FT                   LIFILNKNFAYLVAHAKLDLINTADEFYSTAITRFTGLNFPTTTAVNAIEYDTEETPFA
FT                   DEFIQDEESDDDEYELAYIRRFNNYQSKPKYKSNYQSNNYQNSNYPRSNYQQPNYQRFN
FT                   NYHSSNPFYQSNNTSQYQPRNNYYNNSKDNKFNQTKKFNPHRHDNNRQQHRRETISES"
FT   CDS_pept        complement(801571..804039)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534053"
FT                   /orf_name="CD36_18440"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43623.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396208"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI000192D3AA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB53"
FT                   /transl_table=12
FT                   /translation="MTEINDSTENIARIDRNDAKELKHWLVKANCQHHYSKFIENGITM
FT                   DLLPELDTGSLKELGITKLGDRLRLEIAISNLKADNLKELISVDEIYQLLNLNTRTNGS
FT                   LTNLNNNNNSLLDVSNSNEGTLTQLSQNNSSNNLPISSMNSSTNNINGNTNNSNTGNVV
FT                   GSGTSSKDASKNITFILQDGSTKRVNVTGCFNAQAIKRRVLKKLGFKPDEVQFDTYVHS
FT                   VPHGVENVLYGKTEPTITLLYDVELVTICYSPERLEKYRIMLVPKNEPPTPAAIETSKK
FT                   IMSKYKKQVSGSKAELQEEVNQLHTKDVQAHRSTLRNFFGQRPPSELISSNLAEYFPDT
FT                   RQKDLEQTVRNSVRHSVRLSRRFNLPAGAFSSSVYSLNKRQSILSNSTGFPSNRTMSIS
FT                   SGEQQSGIFNTSGGGSGGLRRAQRTIGDVMVNSITAIDEVVNSNDTFSVFNKPSTSFSH
FT                   QSTQPLNNHDSRSIISSKSLSGGTALHRISISPNYNDNPAHDRHSTIELLNPSDSEGED
FT                   GEEYGEFGTSDFAGLSSSSGENGPPENWLKGARIGSGSFGTVYLGMNPFTGELMAVKQI
FT                   PLVNENGNNNTENMQKSMQEQQREMMLLKELNHENIVRYFGSTTDENFLNIFLEYVPGG
FT                   SVQSMLNSYGPFEEPLIRNFIRQVLIGLSYLHGEDIIHRDIKGANILIDIKGTVKIGDF
FT                   GISKKVSAIDEEDEDFKKTGKRASLQGSVFWMAPEVVKQTTYTKKADIWSVGCLIVEMF
FT                   TGRHPFPELSQMQALFKIGNHITPQIPEWCTNEAKEFLKKTFEINFEMRPDAIELLAEQ
FT                   FLNPLIMSKQ"
FT   CDS_pept        complement(804498..806687)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077016"
FT                   /orf_name="CD36_18450"
FT                   /product="Phosphatase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43624.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396209"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000192D3AB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB54"
FT                   /transl_table=12
FT                   /translation="MLLPKRLLRSLIYLAFFLAVSLFLLLLANKHQIIEINKYIPFDIF
FT                   GTAAPLFFQPPSDSFIVDISFNNCFKLGFNNKRCGLPDVSKGLLGDKAQWYRLKKDICL
FT                   GSSWSKRQYLNYKKIKHDEFEKYLSAGKKNKENVVDEVIIDIAVADPVNDVKIKGNEKL
FT                   KLPKYIIQTFHNVQVYDDDTHASFMEQNNDNRVNAAPVDDKIQAELESDGNKDIESAEE
FT                   NRKEEESKKEQDDERKEAAQEDAKEKGKEADQLKQSSEQNDNDHPKEFEENIKPESPKG
FT                   DDKKDKREIVTNRNDLNRVLYVPKMDAVLKSGWRYKSNGIWLKYGPHNSKNTVSAIDLL
FT                   FGYEAVDPRPNWNLIKIPITGVSNPSNLPAYITFRRGPKIDYKKEFETTLAMNSEDKFK
FT                   ILQIADLHFSTGYGKCLDPQPPSSAKGCKADSRTLEFINKVLDLEKPDMVVLTGDQIFG
FT                   DASPDSESSAFKALNPFVERKIPFAITVGNHDDEGSLKREEIMGIYTDMPYSVAAMGPD
FT                   SIDGFGNYVVTVQGKSSKSTALSLYFVDSHAYSKTPKITPGYDWIKENQLIYLKQEAES
FT                   IQDSVEKYRKSNKIPLAMAFFHIPLPEFRNLNQPFIGENREGVTAPRYNSGGRQVLREI
FT                   GVSVASVGHDHCNDYCLQDTQQSSSSADNKMWLCYGGGAGLGGYGGYNGYIRRMRVYEL
FT                   DTSKGEIKTWKRSEDNPGNVIDEQVLVTNGEVVNW"
FT   CDS_pept        complement(807036..807446)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568255"
FT                   /orf_name="CD36_18460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43625.1"
FT                   /db_xref="HOGENOM:HBG396210"
FT                   /db_xref="UniParc:UPI000192D3AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB55"
FT                   /transl_table=12
FT                   /translation="MNRFLFNCLLFIGLLLIYKYSFMSADGKKEDSFETGEKIDGELYV
FT                   KLGDKMVPISRINKPHAVVHPADHHANIGANKFPDVEPEQKQKEDLKEFSQQILKPDTN
FT                   KPKIDPNSFPDIEPEAKEREAKLEAERVKKSE"
FT   CDS_pept        complement(807837..809921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228407"
FT                   /orf_name="CD36_18470"
FT                   /product="CASP protein, putative"
FT                   /biological_process="intra-Golgi vesicle-mediated transport"
FT                   /cellular_component="integral to Golgi membrane "
FT                   /protein_id="CAX43626.1"
FT                   /db_xref="GO:0006891"
FT                   /db_xref="GO:0030173"
FT                   /db_xref="HOGENOM:HBG396211"
FT                   /db_xref="InterPro:IPR012955"
FT                   /db_xref="UniParc:UPI000192D3AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB56"
FT                   /transl_table=12
FT                   /translation="MSNTEAKSKKMEGGDTSSHVFGNALQTWIEIDLPSLQKKLDEQGI
FT                   ELKEDQKASLLSRKNLASKTKEFKKLEDSEKLNQFKSLLKLYQNEIDNLTTKNKMVESY
FT                   FFGIYRSLAEAPDPRPLLEMSLDSVIESKETLSLRKEVDRLTDELAKRADYDNLKQRLL
FT                   QNEQKAAELLSLKLNAKEDEFKSIIDEKESNWLEKENHLKDQIKIAQRQIEELRTSNEV
FT                   TELKLDNQNKQTGRDGVSASTLAELEIVTRDAEASKKRVFELEKRNEDLRRELSKSQND
FT                   IEIKSIKEDYSKRVSELEGENVLLVANLNQTRKKLQDSDKEHALKTDSLNRDISSMELE
FT                   IKNLKLQLDKASDYEEIKGELQLLRQIEFGHGDEDDETGNANAKVDSILIERNKSLTQQ
FT                   LADHRAQHDDLNSKIVSLEAQVESSLAEVNRLKELNEKLENDLANLQDVASSNRFNDNA
FT                   SLISGMSRMTRPNGRSGSIISGHPGNNSFGSGLGIVAEDSPSILPIITKQRDRFREKNN
FT                   ELEEELRKQFNLVNELKRQNNSLKKDNEELYERTRYLASFQTPGTRNITTTSTGRKFLN
FT                   PKPNTDLESNPYQQSYELKLHPIEQFRMREQERINSRLSPLERLFISITRAVLTTRTTR
FT                   MLFLAYCLGLHIIVMFVTIYAMNLSTTLIPEVGKNTSTGGIASSKVVNDVSSGKVASPL
FT                   "
FT   CDS_pept        join(complement(811112..811122),complement(810326..810797))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381215"
FT                   /orf_name="CD36_18480"
FT                   /product="60s ribosomal protein L21-a, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43627.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG497499"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI000192D3AE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB57"
FT                   /transl_table=12
FT                   /translation="MGKSRGYRSGTRYAFQRDFKKHGTIPLSTYLKVYKVGDIVDIKAN
FT                   GSIQKGMPHKYYHGKTGIVYNVTKSSVGVIINKVVGNRYIEKRVNLRVEHVKHSACRQE
FT                   FLNRVKSNAAKKREAKANGETVYLKRQAAKPRGSRIISTEGNVPQTLAPVAYETFI"
FT   CDS_pept        join(complement(812673..812679),complement(811626..812191))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077017"
FT                   /orf_name="CD36_18490"
FT                   /product="40s ribosomal protein S9-B, putative "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAX43628.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG588353"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI000192D3AF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB58"
FT                   /transl_table=12
FT                   /translation="MPRAPRTYSKTYSVPKRPYESARLDAELKLAGEYGLKNKREIYRI
FT                   GFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKMKLDYVLALKPEDF
FT                   LERRLQTQVFKLGLARSIHHARVLITQRHIAVGKQIVNIPSFTVRLDSQKHIDFAHNSP
FT                   YGGGRAGRVKRKNQGKGGEEGAEEEEE"
FT   CDS_pept        812978..814861
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247962" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568256"
FT                   /orf_name="CD36_18500"
FT                   /product="Endoribonuclease, putative "
FT                   /protein_id="CAX43629.1"
FT                   /db_xref="HOGENOM:HBG396212"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192D3B0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB59"
FT                   /transl_table=12
FT                   /translation="MKFIGLISGGKDSFFNIHHCISQGHELVALGNLYPEKSDEIDSFM
FT                   FQTVGHDVIDYYSQCLDVPLYRQPILGKSANQHLEYSVTENDEIEDLYKLLSKIVDAHP
FT                   DAEGVSCGAILSHYQRTRVENVCDRLGLTSLTYLWQRNQYDLMKEMCESGLDARIIKVA
FT                   AIGLTKNHLGKSISELFPTLIKLNQMYEVHICGEGGEFETIVLDCPFFKKKKLVITQQD
FT                   IVEHSSDVFYLRIKVELADKDDTFEFKPLESLPLLEEEFEDIANSCPKADIGLAGLSID
FT                   SKRIVPKMEFTSTMSTLYISNLTSLKSTIEDQTEDIFQQLDKLLGEHNLTVNDIQHITL
FT                   LLSDMSNFAKVNKLYGAVFKDIYLPPSRICIETDVESIQLSCIVLKQIQPKTGIHIRSR
FT                   SYWGPQNIGPYSQSIVNTQPSYKTATLSGQIPLIPATMNISDKSIVFDSALSLQHLVRV
FT                   KNLVNVKQFASIVCFISDESYVPIVRSCWDDLENKGNLVIVTVRGLPRGAKVEWGGLSL
FT                   ENITDLYDDYCSDSESEACDVQVSQFEKFDESCIVQVGKKGDFSVITLFTSDSDVVKSL
FT                   STFKGYRQLICHPKDYIDSRGDYLPVKTVFDHKGKNHKYAVILKIETDRIS"
FT   CDS_pept        join(complement(815329..815460),complement(814987..815247))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568257"
FT                   /orf_name="CD36_18505"
FT                   /product="Protein INO4, putative"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43630.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG398395"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000192D3B1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB60"
FT                   /transl_table=12
FT                   /translation="MSSHSSSPDTTTIPEQNTTSNETGSGKQGRKKTKSSVLSDEQKKA
FT                   HHIASEQKRRENIRAEFDKIVSLTPNLNESENRSELNILTKSADYIDYLRDENIKLIEA
FT                   CRQKGISIPPNLIYSGPKNDGSDIAK"
FT   tRNA            816228..816300
FT                   /gene_name="tRNA-Arg (TCT)"
FT   tRNA            816307..816396
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        816895..817344
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228408"
FT                   /orf_name="CD36_18510"
FT                   /product="Glucosamine 6-phosphate n-acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.4"
FT                   /function="glucosamine 6-phosphate N-acetyltransferase
FT                   activity"
FT                   /protein_id="CAX43631.1"
FT                   /db_xref="GO:0004343"
FT                   /db_xref="HOGENOM:HBG736206"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D3B2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB61"
FT                   /transl_table=12
FT                   /translation="MSLPQGYTFRKLKLTDYDNQYLETLKVLTTVGEISKEDFTELYNH
FT                   WSSLPSIYHPHVITNASGIVVATGMLFVEKKLIHECGKVSHIEDISVAKSEQGKKLGYY
FT                   LVTSLTKVAQENDCYKVILDCSPENVGFYEKCGYKDGGVEMVCRF"
FT   CDS_pept        join(complement(817894..817920),complement(817677..817823),
FT                   complement(817579..817611),complement(817480..817497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568258"
FT                   /orf_name="CD36_18520"
FT                   /product="Small nuclear ribonucleoprotein G (SnRNP-G),
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX43632.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000192D3B3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB62"
FT                   /transl_table=12
FT                   /translation="MVSEPELKSYMDKKLSIQLNGSRKIIGILRGYDIFLNITLTDALE
FT                   VDSKGEKMNIGATVIRGNSIVSIEALESI"
FT   CDS_pept        818011..819210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568259"
FT                   /orf_name="CD36_18530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43633.1"
FT                   /db_xref="HOGENOM:HBG396214"
FT                   /db_xref="UniParc:UPI000192D3B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB63"
FT                   /transl_table=12
FT                   /translation="MNQKKHEGVFIFSFGVCFDFVNLSSSKTMSSSPGNSNSEFETLSD
FT                   VLQTSSPSNQTSRQVQAAGTAAALNLAEAKIVTHEDNLIQLQSLKIQLSEKRDELIKSR
FT                   TSSNNELNDLRVRHHQLTQELSKTRKETNINNLLDSNTKQYIKNLEVKNLQNDDYILNN
FT                   LNVLPSTDWDLRLSYIKRFVPYLEVDKIKTFNECDTEGGNTMLRIIEFQLILPLIFQTN
FT                   FKLSVDCENDSLKGIEIDDLFKISMLSNSFYQVVIKNYIPNKKISTLMFGLNSFSKLLH
FT                   KRMSIINKLVKHFQNNLYNSEKYQDLLDTSDNKKLFAILQTLDQIELIFQKNDRQFKII
FT                   LNWEIVLGDPLTGTCNSRIKLYLIDILDNTTKNLSQVFQNLLLQHDIVTSLTTIIKTIF
FT                   "
FT   CDS_pept        complement(819253..821625)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534054"
FT                   /orf_name="CD36_18540"
FT                   /product="INO eighty subunit, putative "
FT                   /protein_id="CAX43634.1"
FT                   /db_xref="HOGENOM:HBG396215"
FT                   /db_xref="UniParc:UPI000192D3B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB64"
FT                   /transl_table=12
FT                   /translation="MSYDPIHDTYTASTSSQQQQQQQQQQQQQQQQSSPPLLSTHIHAT
FT                   GSSPPSISQLISPNMQPSHTDLNQPQHQLAEQEQTIPSLMLPQPDEHKPTVHTSGGGGG
FT                   GGALSISNLVSSSTNEVPSSAGIPPITSTHTSSHKMNSISSLINSPPEQNDDTGDDDYD
FT                   ETDVNSSVVGDDEEYVATPPPSTKHSKSHKSSSSKKKKKNNIANAKLSLKRADGEAFWR
FT                   KDIQYDFLKELFDDETACFTNTFPESNIVNCNNNPKITFGELYIRTLAESNKSSRVLKE
FT                   KLIRDNELGKAVAKVCILVNVGRMNTTINFVPEMKSTLRTYHSIPSLQTCREGGTVKQL
FT                   QDTPRLKSILKAVCEGEENNLNFLDDMMKNPPNEKPNTNVIQLLFLLSNAVHGVPFLTD
FT                   QKNSHLLDFFINTKIHPANRAKRLLWLLYTFLETDFSESALHGNPFGADTIPPIQWLDE
FT                   SEIKKFDIDPDYERYYADEMFKARMQYLANPDDEQYKEHSRRSHGYGHLKKRDAEDHDA
FT                   SEGEEFDDKKKKPVVPLKKKLKRNNPGTPSPLSKNVITFHDKRNRNIKSGDILNFDLED
FT                   GIHFPVKGLKELTARYQSPKFMNHSPDELESVKHRREIVELSKPMVQEVRTSSKASTAS
FT                   FNKKITILGNWLYRYFKYKKSIGNRLVGIEWEDIRYDLVHGVESYLYENFGKSLILDKM
FT                   LSTHYTGVEGKDGSDKNGVVANGGNTTGRFEEEENEVYFDYVPSRDYDKANEKQSFILH
FT                   LTSFVNDWFILRLKKNASLTQASKISIDLDNETVHMS"
FT   CDS_pept        complement(822081..824591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534055"
FT                   /orf_name="CD36_18550"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43635.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396216"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI000192D457"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB65"
FT                   /transl_table=12
FT                   /translation="MLFGVFHNYIFLVIILSLKVILIHAYSPYNSSFTPDHIRYLQNET
FT                   QALFDHAWQSYMKHAFPFDEITPISCEPLGPDFDNYENTVRNDARGNISSMVLDNIDTL
FT                   IIFERWDELEYILQYLSDNKQDFFNQDTIVQVFETCIRHLGGLLSGHLLLTDITNKPIT
FT                   LSNKYQPLHKISEKYNGFLLEMAHDLGLRLIPSYQTSITNIPLPRINLAYGLKKVPPKL
FT                   QRDACTSGVMTPVLEFTLLSRLTGDRQFEYYSQLSFWKLWSSKSALNLLPMTIDPIANQ
FT                   WKDSITGVGASIDSFYEYAAKSAILFNDDYMWTVFKSSYRALLTHSAQGGKGTMIFPNV
FT                   GIYDGVVFSPWIDSLGAFWSGLQVLTGQLQDAIKTHVVYLKIWDFFDSIPERWIYNHEH
FT                   YQKNKAKRHKKRFKAEDSIDLEWYPLRPEFIESTYYLYRATKDPMYLQIGERVLNLLRD
FT                   RYQAPCGLSGLQDVRTAERQDRMESFVVGETLKYLYLLFDTKDEIFLHNTTIMQNKNWI
FT                   FSTEAHPLWLNKKIDLIGDSLTQSSNEISSKLGGKPFHKNSLKSEKELLKVPNSAFIRN
FT                   ITLPQPELVDIEGITEDVSHIAKKSPFAGRFDTCQLNPWHKSPDSFLESSYYKWPYLFN
FT                   ADYAFENSLKKPRYLSQTNLDGSYIELTKEFYNKFTMFTSAANLICPRTSTTTVYEVFW
FT                   GDIKQCEYTEVSEIYHTRFSNESLMAPGDIWIPTLNGLRVVLEELVPGKVDTFNNVVTE
FT                   EQLLALQDSNDENDNDDDGIRLINSGLRIKRVNGVVIEEGMILWTLPFEQPEESNEEGM
FT                   IGITEDARVVIQGKVVENLFVWYG"
FT   CDS_pept        complement(825158..828211)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568260"
FT                   /orf_name="CD36_18560"
FT                   /product="GPI ethanolamine phosphate transferase, putative "
FT                   /EC_number="2.-.-.-"
FT                   /function="transferase activity"
FT                   /protein_id="CAX43636.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG396217"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000192D458"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB66"
FT                   /transl_table=12
FT                   /translation="MQQDDDDSLTNRSSPPLASKDSRLQPPTRTRIRQQKLKYSFIGYI
FT                   IVLIFLAITQFIGVGFFKEGFLLSRTVLPNISNCSQQIDCMTPRFEKAILLVIDALRFD
FT                   FVIPIPESNEYYHNNFPILYDLASSSSSQNNAILLKFIADPPTTTLQRLKGLTTGSLPT
FT                   FIDAGSNFDGDAIDEDNWLLQLHKINKTIAFMGDDTWKALFNEYIDPNFNFPYDSLNVW
FT                   DLDTVDNGVIEHLFPLISLKEENCTKWDILVGHFLGVDHVGHRFGPNHYSMKDKLNQMN
FT                   QVISKVIENIDDNTVLIIMGDHGMDSTGNHGGDAPDELESTLFMYAKNKNFLKKDQSFY
FT                   NISELGKNYRSVNQIDLVPTISLLLGLPIPYNNLGFPIDEAFGNLDELSVASQKTINQI
FT                   KAFRDDTPNLSGSLIEQYQSYMSNYSTFGNSREHYLHLIEQAKKYQSLSLEQCKTLWAK
FT                   FDLRFIGIGIGILFLALTFMITYARSIPAVRVSTMSFEFIGSVIAMTIMGLVLSFSIYI
FT                   VLKPGDFTLKICLAIGAALGMVIGFWAPIMDRFSVGFIWHQTVDFFLYNFNTWSLMGIL
FT                   FVSFHCLIFASNSYVVWEDKMVSYFLITFGVCCVYACFINNNLSERPKILAISHAITFT
FT                   LCTRVVSMVNLCREEQRPYCEPNFINSWWSILLLHFAAYLLPACIKSFYMLSDSYHSAA
FT                   PLWIGTGLKFLLFMNAVYWTFEYVSNSEYFNKLNLVIGLSLIKSLKLAIARLVLFISLI
FT                   LANFSWSRGPLCVKLELSDTSNTIDIEESDDISTNNNNNSYTNNKTATILGYGNVYGSS
FT                   YFLLVLNFTVAIMLTTKPLGSLSISLLIVQILSLLEILDVLSIRRNLITPIVFGLLGYQ
FT                   HFFSTGHQATIPSIQWELGFMTTETIVFPFTHLNIFLNTFGPFFIPALAIPLITIWKIV
FT                   PSSKPITLLSQIITNITTLITYHLFTGLSSLIFAAHFRRHLMVWKIFAPRFMLSGLLII
FT                   SLNVFLIFVALWFGTAKILTQINRIFGK"
FT   CDS_pept        complement(828889..830757)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228409"
FT                   /orf_name="CD36_18570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43637.1"
FT                   /db_xref="HOGENOM:HBG396218"
FT                   /db_xref="UniParc:UPI000192D459"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB67"
FT                   /transl_table=12
FT                   /translation="MYGVCNIGQKLFFSRTHSKKKKKKTFGKKPTKRKIINNNNTKQYN
FT                   TLTSSNIISFEKIIILNTMAHPGRPRGRMNKKTLQAQAELARAQQAQAQAQAQAQAQRA
FT                   AVGGQLVPGGNGGGIPPPHQNGQSQYSTKEESLGVQLHDEADLISFRNDALFRYITNHE
FT                   YIENVTSKLIHTSKIIPPSLYPIIPKPNVNSSNNEYENLKPEDVYFGDLGAMKYMEKKL
FT                   TTKLQQMEKNLDPNYNKYLLNDDDDNKNNNSGNNEFQYHRENTMKLSKLQENLIYKESL
FT                   NNLELQLDQILNDYKTKFNKIYKESPSIYQYSISIDKISSMMEVTSAPENYNPKSINSF
FT                   VNIGGNTNANINGDISNASNSDGAGAGTGTDTGAVSEMGNFNNIDDDGLSGFQFSNNID
FT                   TSKFNGINGVSMNQFGNNFQVSANNKPDTININNNISTNKSNLDVNNNNHNPTNKVEST
FT                   TNNKSQGLSENVNSTNNSNTSNTIQSYNSNINTNGSNDDNIEQEDIDIDDGNNIIPHDN
FT                   YNNNNNNNNNNNADDDLVVEGNNVGPNRIDDGDGDDDGVDNDNGTNGLDMNQLFEDNGH
FT                   GDIDHSEMVNDDIGDLYNFETGGGGDDDDVDNGLMDGLEFEQDFLN"
FT   CDS_pept        complement(831530..833992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568261"
FT                   /orf_name="CD36_18580"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43638.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG330930"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000192D45A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB68"
FT                   /transl_table=12
FT                   /translation="MVDFAKSLFGFGNYKKESSSSTSQSPTPPPSSHSSQVQQSSNIEE
FT                   YHQSHLSQEQQQQQQQHSHHYQPPHMSEQSQHLPQQQQQQPGTNKFFPKTLVSAAPTTA
FT                   VANHSSVYGTTSTTSNNYSEAYLNQTFKNNTYNPQQSQQQQQQSQSQQQQQQQQQYSAP
FT                   YQYSSNIQQLQQPYGNQWEPSQDQDANIITIDKTGNKLSPTSRDSPIKGKLKVTILEAK
FT                   DIFATQPYVVCSFESSEFVTNAPDSYGKSPVSSFGHNNSNNNNSTNNNSQGHTNGPRNM
FT                   YNSNHGPSPKALPMKNSGGNLFGQRPSMYQRQLSTPHLNLPNDSSNPIWNHDTIFDVVG
FT                   SKSELDISVYDGARDDAFLGHVRISPSIDKNNKNESEWLQLGARITGETVSSGYIKIKW
FT                   EYTLFDNKIKRSYGPDDFHFLRLLGKGTFGQVFQVRKKDTNRIYAMKILSKKVIVKKKE
FT                   IAHTIGERNILVRTSAASSPFIVGLKFSFQTPSDLFLVTDFMSGGELFFHLQKEGRFNE
FT                   DRSKFYTAELILALEHLHDNDIVYRDLKPENILLDANGHIALCDFGLSKADLNMDGTTN
FT                   TFCGTTEYLAPEVLLDEQGYTKMVDFWSLGVLIFEMTCGWSPFHAENTQQMYKNIAFGK
FT                   VRFPKDILSPEGRSFVKGLLNRNPKHRLGATDDARELKAHPFFADIDWDLLRAKNIPPP
FT                   FKPHIISETDISNFDTEFTSENTSALKKQMEMATTPLSPGIQANFKGFTYVDDSTMDDH
FT                   FAARSYRANAFAFRPPGSFIPGDPNLPPDEEVLAEQIEEEDDNDDEMEVDNDDQHMDDE
FT                   FVNGRFDL"
FT   CDS_pept        complement(837259..838122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534056"
FT                   /orf_name="CD36_18590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43639.1"
FT                   /db_xref="InterPro:IPR018289"
FT                   /db_xref="UniParc:UPI000192D45B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB69"
FT                   /transl_table=12
FT                   /translation="MDATHNVAKGYKVGTVKENVFLYTIVVFDPQTGQGVPAAWLLTNT
FT                   QGSYPLYLLLQDLKTKHEFKPSLICIDCSDIERKAIRAVFPNEKDHEILYCFFHLNRAL
FT                   KRKINDHISLKSSTNNFEMLLKKGIITPDVVEKRGDLQGCNDMSYQDTPVFSDEEFCAF
FT                   LDSIESQTRGGLENNPIESLLHNPNDDLSVEKHIDEIRDIENFLAYNNFEIDGQIEDAN
FT                   NKDVKIEIPKASPKTPDDINKVGELAAEGFYLIISSKSEEEANQRIDDYTAAFLEYPYY
FT                   ITYIQY"
FT   CDS_pept        840552..841364
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247967" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381216"
FT                   /orf_name="CD36_18600"
FT                   /product="Ribosomal protein, large subunit, mitochondrial,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43640.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG396219"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniParc:UPI000192D45C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB70"
FT                   /transl_table=12
FT                   /translation="MNVFRGLVSIPIPRISCAPQIYSIIRFRQLSTTLPLSTKRTYDKF
FT                   YKITKQLQPIDKTVYEIGQERPDHIRIPKDLPKFPKYEYEPRFFKRQNRGLYGGLQRKR
FT                   SKSCSEYLNKTLRVHRPNVQWTKLWSETLNKRLRLRVATRVLKTISKEGGLDQYLLKST
FT                   PARVKTMGLKAWQLRYRILQEREQDKRGNITLSDGTTKKIQYINSDGLKFHATKDALLS
FT                   ELYEAVQRDSYYPIKPFHFERDYSWWSYEQIVKKLEQYNWDFTGLATK"
FT   CDS_pept        join(841748..841759,842208..842495)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000155312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568262"
FT                   /gene_name="RPL36"
FT                   /orf_name="CD36_18610"
FT                   /product="60s ribosomal protein L36, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43641.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG324276"
FT                   /db_xref="InterPro:IPR000509"
FT                   /db_xref="UniParc:UPI000013401A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB71"
FT                   /transl_table=12
FT                   /translation="MAKSGIAAGVNKGRKTTAKEVAPKISYRKGASSQRTVFVRSIVKE
FT                   VAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMTQVIAESRRH"
FT   CDS_pept        join(842945..843536,843623..843681)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381217"
FT                   /orf_name="CD36_18620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43642.1"
FT                   /db_xref="HOGENOM:HBG447952"
FT                   /db_xref="UniParc:UPI000192D45D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB72"
FT                   /transl_table=12
FT                   /translation="MIRSTIAKSFHRFLTTNTPAPAAPPPPSHFSNPKEIPEPFGAGTD
FT                   TNAVYQQQQQQQATPVPNTKPTQDGSIKEITALIAMFALAYIAIDNYTERIRLEKLHNE
FT                   TSAINLKALQIQQLNHQREKKQKDLTLLQERREIAKRDFKMSLHIAMLRKQLMDLGVSP
FT                   IELDLAIKEFEKNVKLDNSIKNVTGQYLWLDDSSDLKQYLPDPMEYDKARKNK"
FT   CDS_pept        complement(844201..846147)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248246" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568263"
FT                   /orf_name="CD36_18630"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX43643.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG396220"
FT                   /db_xref="InterPro:IPR019680"
FT                   /db_xref="UniParc:UPI000192D45E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB73"
FT                   /transl_table=12
FT                   /translation="MPGTKSALDKSLQLLYNYSSNFHVSIELIQKLAQQLKLETFIDSL
FT                   GFNLDDSKPGVKTQIQTQKLSIAGSSILLDIDFETDNKIVGLSLSVNASESIEQQNIIQ
FT                   REIDPDHKNTNGPSSSSHISIDIDELGIHHVKLNCNNNPISFLNKSSKLNDANKTHVEQ
FT                   ILLRNLQKTSKLGNFPINLQRLATIDKFTNYNSDLFIYIESIALLFNTIFQIENQLNSN
FT                   NWEIENGLSNSIGKVNINNEDRLGVSLDFWKDYRFINHEYEIIKNQSQNGILVGNCYTI
FT                   QVDVVEASKQIDYLLDNQVQEWDIFTNKYKFEFDSNSLKPLILDGDEFLAWSLQFKLNH
FT                   SIYIPVYVLEYFSLRSNNYTLGTGDHDSRNVFGKINEGESFEQSLNIDCNSNSISSSFQ
FT                   LINDIPGKFVPLKSFQINKLVDISKLIPILRNFLVLINLCRTVIKSKSTQLPIFNSKGG
FT                   RRRRRSSRFLGIPTTEKELTEEFKLKLKESLKLPDDVTDEEILGLSAISETANYSTIPP
FT                   TNKDDIDLESFLENEDNTNNNSGENDGQMNDNDVDANVNRGIEFPENGNNYFSLKLENI
FT                   DLTSRGGDLQLAFEAQFKSQEIYIPLRISNGEIVSVQNNDDMETDDTLSSKFIKALNLT
FT                   EDIISSYKAVYSN"
FT   CDS_pept        846394..847485
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228410"
FT                   /orf_name="CD36_18640"
FT                   /product="Translation initiation factor eIF-2B subunit
FT                   beta, putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX43644.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG318268"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI000192D45F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB74"
FT                   /transl_table=12
FT                   /translation="MSKLLTPEILALIDPVVSSLKRHQLVDDKEIALTIAQLLMKVISA
FT                   ARWSNTYDLIELIRQVGVIFNEAYPRKVIPGNIVRRVLALIRDETETDAETEQTDNIPM
FT                   MSSMFSLLATHNKNETIKEQTQSQSKKQTSDMRAIIIQGIRDLVDEISNVNDGIETMAI
FT                   DLIHDDEILLTPTPNSETVQHFLIKARLKRKFTVVVTENYPNDIKAAHKFVKTLAEHNI
FT                   ETILIPDTTIYAVMSRVGKVIIGTNAVFANGGCLSNSGVANVVECAKEHRTPVFAVAGL
FT                   FKLSPLYPFTRNDLIEVGNSGKVLNYDDFKLVQNVDVVTNPLEDYIPPHHIDIFMTNIG
FT                   GFSPSFIYRIVLDNYKAEDNKLE"
FT   CDS_pept        complement(847516..848115)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381218"
FT                   /orf_name="CD36_18650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43645.1"
FT                   /db_xref="HOGENOM:HBG396221"
FT                   /db_xref="UniParc:UPI000192D460"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB75"
FT                   /transl_table=12
FT                   /translation="MSNNPVLVKQYVQNILSKLQNFLNRCSIPHTTNNILEQNRLFSRE
FT                   GLVSCLEDSIDEIPNHLTTTSTSIDLGTSEFYNSSTIDTSHNENPNQSVSIEQICSMID
FT                   EELEIINEHEINNRLESESRGSFLTISKQMNMSGFPTLSRSQPCRGYQSMNQDLWNVKA
FT                   SALFLNNAAVTAKKKKKMIKVVKSKKTTKQRVQTAY"
FT   CDS_pept        complement(848394..848963)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534057"
FT                   /orf_name="CD36_18660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43646.1"
FT                   /db_xref="HOGENOM:HBG396222"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI000192D461"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB76"
FT                   /transl_table=12
FT                   /translation="MSWFGFFDPDFDDFFGRPRKYATEVPPDFNPRKIAQGDNGKGQQV
FT                   SRYGGGAGHPHRALARRDDFFDDFWKNFSSGKYFVGFDDNVKTTEESDKYLVSYDQENL
FT                   SPDEVNVDFDKQENELIITITQEKEEAGTKKSSTFHSNLKFEKPVNFDDISAEIGEQGV
FT                   KVTLPKVHADHEKIVNIPISKAAAKK"
FT   CDS_pept        complement(849376..850497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568264"
FT                   /orf_name="CD36_18670"
FT                   /product="Protein phosphatase 1 regulatory subunit,
FT                   putative"
FT                   /protein_id="CAX43647.1"
FT                   /db_xref="HOGENOM:HBG526095"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000192D462"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB77"
FT                   /transl_table=12
FT                   /translation="MPIQETNKDLVENPAGILQGEEKEEPILSHTEDEDDDDDENDDDD
FT                   KNQQGNSAVQYPGTVLPDNHPQEIEADQDLTVGYDLDTDYIDLVHLKISSLEDLHLERF
FT                   KKLESLCLRQNLITSMVGVKDLPESLEELDLYDNRINHISSSIKHLVHLKNLDLSFNRI
FT                   KNIKNIETLVELENLYFVQNKIREIKNLDTLTKVTNLELGGNKIEVIENLDKLVNINQL
FT                   WLGKNRIHKLQNMDNLVNLRVLSIQSNRITKIEGLENLKNLEELYLSHNGISEIENLEN
FT                   NTNLQVLDVTANKITNLKGLSHLVKLTDFWCSYNQVSSFEEIGKELGKLPDLECVYFEG
FT                   NPVQLQNPSAYRRKMKLYLGPTLNKIDATYVHA"
FT   CDS_pept        complement(851006..851338)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568265"
FT                   /orf_name="CD36_18680"
FT                   /product="Acyl carrier protein, mitochondrial, putative "
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43648.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG755218"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniParc:UPI000192D463"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB78"
FT                   /transl_table=12
FT                   /translation="MFRLAFRSIRAPVARASFVKPIRFYVAPPISKEEVTTRAIQALKT
FT                   VAPLQESNITLDSSFQKDLGLDSLDTVEALVALEEEFDLEIPDKISDEIKTVGEAVDYI
FT                   YKEESK"
FT   CDS_pept        complement(851610..856892)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568266"
FT                   /orf_name="CD36_18690"
FT                   /product="DOCK-like protein, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="CAX43649.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="HOGENOM:HBG396223"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI000192D516"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB79"
FT                   /transl_table=12
FT                   /translation="MTWTPASCFLKGVVIKPFKPKNKRLSSQESEPLPLKNLYPGDKVY
FT                   VFETNNSRWGRGYVIHPSIGNDLKVTSIRLNEVDQSPVVFPMNLVKIIDKIDFHKTTDG
FT                   INSENEINKPNTPELPRVDNQCLTIMNQIGYAINELNGLVFASYACGELNIFGQLKNVY
FT                   ITLYDYYMRYAHNLFNEIETTETITKLLNDVTKILTRGPFKTSSSSGSLMWREVASKYC
FT                   YMLARDKSNGEILNLGNSIPPTIATAQEELVLTNNASVKNSVQSQLVPSPNNFKEYKNS
FT                   HLLVNITDVQGDASNQSTGLHNLFLHVYLRSENKRLTEPFIFKTKSIDDLQKVETISSI
FT                   LFRNLPEDQFDRNVFMVFVLTEEISLMRRKTFANLKYIKKGVAAGVVNISNVFAQNRPE
FT                   FHFDIKIFGAPLGSKKASKSTFSWGLLVDQLVRQNMEGLAVCPTVQRITASVKLIKHAP
FT                   FGLSTKTRFSKQHSNLPITMVKPMFFDPFTETSERLYILLGQMVLKKKKYSTDLYSVEI
FT                   SAPNNETIKFSQGTNQKDKKTLQLVGVTSSESFGEFIKIDNISLKNKDKKLPIDDYLQL
FT                   TVYINGVLSGQGHLHYKSGNKLVEYRPKPHAVEIFSTSKGNQIATIEVSSTYVGKSFNS
FT                   EVTIDNILEYESLYHSGISGIDGLSSSLELFQKVKKKHLVRRFPELLTSLFGIIIISGA
FT                   DNDSVNLQKLQDNTFKAIVFLLNSVLIKPHQHGHFLQCFENIFINQPRIAVFLWTKLHE
FT                   VYYRGETIWDSYSKSVANVQEMLIRFATKSIQGSWEFEEYNESVVQSYRAMVHFLSMKS
FT                   SLLVEDQMNLLGIVDLMLTNTMYFDKRVVLNWYETFVDAIRLRSFGGHEKLMEEYEHKM
FT                   QISKLLLILRVLGTEMNRDKDTRSTILLKSIEWAVEGFPDVTDIESVRLACSILNKCCT
FT                   IIYELLVEGETDIIEVCHFLFKLLPALSRTFLKYNHIGNFASERSVVTQLFPQTYPFET
FT                   VAIDRSFRDINFCEVLVELAVVIGFIARIDKEIAVDNDARTLHLADLYSRDDIYTVIIA
FT                   VNEIFKYEYFPSQNWFSLQATIAESSLCVLELLSPVIFQKYIIGVSLDINLCGEFLSTL
FT                   LKLAILDTVASERLPVLARAACTSITCSIGERVELLIDKVWGRLGDYVNKQERESSLAT
FT                   LVLDYDLIHNVVLYTLKCTPTRKTGSKLLISIMTNYNQIEVERQCIISLFDIYCNGLYE
FT                   PCESDEMGFINNLKGLSINQPETEQGVLLDFVAYLSRFIRVLNRLIRVPDTAEFNDDKV
FT                   VYKIQALLYLVNVGEPEPLREFVTDLYKEIIAQKDYIQAGLYLELLASTFPWSHGEYVN
FT                   ASLIPELPIQTNFERREALLELSAEHYISGHNLSKAIDVYNFMLNSFKNETYDLLRLSR
FT                   LHGKLSLRYMELEYQDTIQHSYCRVVFLGNGFPEVLRGKQRIYEGQPFEHFTSIQQRIL
FT                   SKFPGSVLYKEDGTEGKNLTGKYLDITLVYPNKSENGHDKKSFSVLKKVPGSSSIFDLW
FT                   TEETTYETKSSFPTLMNFNDIASYKVIKLSPLDNASRTINAKTSELLRLERAIHRSMTD
FT                   QPKSQGLFLDLSRELAGTVDSPINGGVGQYRLFLEYIGESNNNQAGKIKTLQNAFDELT
FT                   TILKRCLDLHGRIVPESMRQSHEALVELFEKNFNDRIEAAYSSRDESDSSSSVPSTRPV
FT                   SGGISRSHSMTPSVATMPEPKLTRSVTSTTGSSDTSYTSGKSSFLSNSLSLKRKFRWRK
FT                   NANN"
FT   CDS_pept        complement(857756..863497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568267"
FT                   /orf_name="CD36_18700"
FT                   /product="DOCK-like protein, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="CAX43650.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="HOGENOM:HBG396223"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI000192D517"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB80"
FT                   /transl_table=12
FT                   /translation="MTWIRTDFLIKGKIIKPFLPNDKHPNLKNDNFKNLYPGDQVFIFE
FT                   VKDTKWARVHAVTKPLPTDYIACTAFLHDLLVDKSQVVVVPLSYIKILKEMPSEDIRVS
FT                   KKFNNINENSEIPTIRDTELARQEAVNGTISNEFIKKSVPPKPTKRDHSRDTLLDEIRY
FT                   SLELLNAHIFAVYSKSEFRLFEKLTTIYYSLYEIRTKLNHHLLTSEEAQVARETATFLL
FT                   NRIPKILASKASRLGKDVIELDYSDTDVSGYKSILARDAETGEVLSLKTALPPRIALNN
FT                   ELGALVPNYPINIHDNFHNYSLKPPTNKKFYHDPPSHILVDFKSVTGSSAYQPPGFAGM
FT                   VAYMYIRNSKKRLTEAFAVHTNSVEDFVHVEKISAALFRNLPASEIENNRVYLVAVLTE
FT                   EVDLNIKTSGHSPTIKRVKKGVAAGVADITRIFPRAEGSLQSGEAHHFSIKLFGSYLSK
FT                   KGQKNMVEDLRGLSNNGWGELVDRIIAGSSQGVAVNPRAEKLVITVKEFKHQFQGNTAN
FT                   QLSSSAPISRIKPIFFDPLAENYERIYLKMGKITLLGSNAREDLLTFEVSTPNNELITF
FT                   AKASNQQEKRYWQFISVFPGESIGEIVKVNGVALKNSSKKLPKDDYILLSLYVNGVLAG
FT                   EGRLLYKSGNRLVEFNKKKTHTIEIISSTHNVPMAHIELSTEYVGKVYNSDVSIDNIFQ
FT                   YERFFQNGQKGIDELSNSLVAFTRLDIAQVVKYFPELLSSLYGIIGFASHHSGPSIEIL
FT                   EDNTFKAVIHLLDTVFGKQDQYLYLLDNFIAKYKSSNQIGIFLLTKVEQIFNRAGSSWN
FT                   SVSRSVCRVLSIILRISVLSMNSPNEQELYLQTLNNLFKSIAYLLTLDSTNMIDDQVLV
FT                   MDTIDYVFAFDVNFKGSELVQIIINCIDSIGLKGLGVDEPNLESGPAARSNKDHKIIIG
FT                   KLLLILRLLNSDLIKDESSRCILIPKAITWSVDVFLALTDIDATRLACSVLNAACTTLW
FT                   NDGAIGKYQGDMEICYSLAKFLPAISRTFIKYNKFTRGNGWFKKKRVFTQLFPSTYPFI
FT                   EFSIDPVVNDESMVEVLVELAITFSFVARVGKEAAGNEGYIKILDSPIENDFFIPEKYL
FT                   ACNFHSEDILTLLSGIRYMRLGKYFPETKWYSTYSVIIEGCLCAIELVRPLVIVNQLPA
FT                   LDDSESFDRTLWGNYLRSLFKLAVLPPVAVEHLSDVPKSACAKITQDVRKRAAFLINEA
FT                   WDSLAWDATDEDMLRFNLKKFGGYQVEFINDEFGILPDLMLLGLQRDSECQSVAIKILW
FT                   SIMISEYILSDTLQDVERQCFLGLHEIYHNNSYKPSSLDQENFIERMKMTVRLDREDEA
FT                   FDLIYTFIQNLSSFFGTLNYYISVPFGPEYEEDRIFHEIKLKAQIKNAGKPELFNSYIH
FT                   QMYEKYLSQNDYVQAALSLELLASTYSWDHHVLVPASFRPKFPEQSSFERKEILLKMIA
FT                   NNFVKGNSLEKAADTYNELLDSYNEHTYDLKSFAYVHNKLAQLYLDMESSDKLTPTYFK
FT                   VEAIGGGFPAYLTKVTQIFQGLPFEHITSIHERFLKVFPGAKIISDDAEAISLKEKATN
FT                   GRYLYIKTVEPVYEFSDKLINTSLGVRQYARNKDLRFFTSLKKFPGATSVFDLWTEETT
FT                   YETWLSFPTLMNRSFIKDSKTVKLSPLDNAVRTIAAKNDDLIQLEAFINSALKEKTDYS
FT                   HYFNDLSRQLAGTVDSPVNGGVGQYRAFFSDSKYQINEESIAKTELLRNAFNDLAIILH
FT                   RCLNLHGSLIGPSMKSSHQALVELFRKNFQEEIVALRLGEEATITAPSSSRVSIFHNRR
FT                   ANGLMTERTNSISNMSGTGSTYSGSRLARSPTNASSVSSNNSSITRSGRASNTSGYPGS
FT                   IIQPGYTGLKGSSVKNGNGSVASKSMNGSHKANAVNTKW"
FT   CDS_pept        complement(864787..867408)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534058"
FT                   /orf_name="CD36_18710"
FT                   /product="Amino-acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43651.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396224"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D518"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB81"
FT                   /transl_table=12
FT                   /translation="MTDPEGSESDSSSSLIHENILFPSLGNGRNKNHRNKSAKLRDDVC
FT                   SLDSDSNSVNHLRNTFIAQERQLPSADDYALEEVDLSDVSPLNSRRHLVSPFSTSSSDN
FT                   VSLDSSIMNKIASSISKNGDDVVEQTGKFKYLRLYEKWRKAKSLDQRSMNSADFGSNGQ
FT                   DIPLQTMGSRASSVFNLSQLDDFTRYVKETSLNDRIFHDLQKRLPHKQGDQSGEESLQN
FT                   YLDVVDEKDLADKFYPTQEEEEEQGDRNKRRLFSKRSKKKSLGMSMESRTGTSDVLDSS
FT                   SSSDVVSDDPRFLQRKLSVRHLQMISFGGTIGVGLFLNSGKAIAMAGGFGASLAFTIVG
FT                   TLVLCTIMSFCEMVTFVSVIDGVSGLSSRFIDDAFGFAAGWLYFLSFSTGVAGEIVAGV
FT                   IMLSYYPHLSTATSTASTAGFVTLFLVLILGSNLVHIQFFGELEYMSSLVKMIWAIIMM
FT                   IVMIVLNRGGFPNTPVLGFKYWQYSKSDFANNIIFGLFRPAFNLHDDGTSAPSEGIGGD
FT                   KGRFMSLLTAILVVCYAYSGTEIVCIAACEAKNPRKALPSATRRVFWRIIIFYVLSAFL
FT                   VSLNVYAGDPRLLRYFSGKTGIDPSEYATNPAVIQAGGEHCSIDYKVVAGYGSGAQSPW
FT                   IVALQSSSLCQFSSITNAFLVFFAVSCGNAQLYVSSRTAYSLALQGKAPKLLTYCNRFG
FT                   IPYNAVLFAGSFGLLAFACVNESATVVFQNLTSLIASSGIFVWFTMCLTFVRFYYGLKR
FT                   RPDILDRNDKSYPYKSPFQPYSAIVGCIGTLFILFSMGFVVFLKGEWNTMFFFSSYGSI
FT                   MIFTVLYVGYRFIRGTSVPSLDKLDFDSGRTEMDRYIWDGGRSYNKRNVKEVAHKLVSF
FT                   LA"
FT   ncRNA           complement(867844..868031)
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U2"
FT                   /db_xref="Rfam:RF00004"
FT   mobile_element  complement(868214..868469)
FT                   /mobile_element_type="retrotransposon:solo LTR, iota V"
FT   CDS_pept        868916..870844
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534059"
FT                   /orf_name="CD36_18720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43652.1"
FT                   /db_xref="HOGENOM:HBG396225"
FT                   /db_xref="UniParc:UPI000192D519"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB82"
FT                   /transl_table=12
FT                   /translation="MRFRPSYRRRYDTKGFRSNRTHRSEPRKASGRDRRGYRRYYHQQP
FT                   SKYVYVEEPDSEIDPTEDEDEILHNEEYEQEPVVYYDDDEEDDEDEDEDIYYDSDEQPV
FT                   EYYEEDSSDDDDAKEELPIYFYNEDGADADDVEIAYVDSDGNEFIIDNDVLEEAILDEL
FT                   EANGRVHDLNNEIVEYYDENDGLSSSDSDSSSESDLEVDSLSESDSSDESGVESEESDV
FT                   EQELKEDLLLELIRREFEEELVSSDELTSDDEGSELGSEPEYFEVDTEDEENSEDEGIT
FT                   IYKSLVLPENIEDEDVVFYDDLGEESENETTGDTKLLADDSEDEFQVIDLTEDLKNSSD
FT                   YKLEEIDANTYKLNVRFPSLVKDELKIDFLKNENELVIKGKLNLNDAEIDEEVEEVSEE
FT                   DDNDVSEDDSDADSFVEELKEKDKNKRAKLAAILAELEKEQPEEDSEEDDDFASANEED
FT                   EDEEDSEELSGDEDTFLEQIKQDAKSAKASRKERIAEILADLKAQEENYNEESDDDFDA
FT                   DKWEGVESEGDNQSSDDSEESSSDDDEEIQEDEEELAKQYKNQEVHFEKHFQFDKVIKF
FT                   NKIKARFIGEDELELIIPNENKTVDDGNCMSIGIEPLQDDDSSITEESDNTVSIPSLKE
FT                   VEDAIME"
FT   CDS_pept        871086..872570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093661" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381219"
FT                   /orf_name="CD36_18730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43653.1"
FT                   /db_xref="HOGENOM:HBG396226"
FT                   /db_xref="UniParc:UPI000192D51A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB83"
FT                   /transl_table=12
FT                   /translation="MFAKKYTRHYPYSKFSPGNEFKGLPATSLGITSETRFMSGLDSAK
FT                   DEYTTWDLFVVHVLRVTLNFTIFTYMRLLDIHTFIINSWELMSIVLFDLNYKISSHKRD
FT                   PVKHYYQTIIDESIFYWETLLYIPWLFWKVFNPRTGTPIGLSRCREYIPKLNTPKSVAL
FT                   VLQVNQPMFQSPPEIPQPYLDADRKIRIPEKKEVQYVIAIRNEYFTQCKSHMAAERVRV
FT                   LREIGRFITWCCLVPTITEISIYEKLGACWDGDSSFIDSIKNSILVELVALANTCDPSE
FT                   LKQFRKVLPQIVLLDKYTKATYVVNDEDSNIPNINTDVTVDDILSAYEDHKKLVVTLCD
FT                   HRVKTANYRVLSAKIIENNLGPDDPVFTEEIPTSPELIFAPSNEGHQVTRLCGYTCIDP
FT                   NTETKVKSVLYFSHIKFGYPFFSRAMYHYALEFPFKLLEEVREQEEEEHPNMIPPSQDI
FT                   AKIFKKISTSTLKQNAITNRISRVPSPQSLIAKSLA"
FT   CDS_pept        872876..873877
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381220"
FT                   /orf_name="CD36_18740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43654.1"
FT                   /db_xref="HOGENOM:HBG398397"
FT                   /db_xref="UniParc:UPI000192D51B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB84"
FT                   /transl_table=12
FT                   /translation="MIRSCLIRTGNIPSVTPSLHVTPFYTKRMFQSLFTHSSFIRKFSS
FT                   CPPKFQAVPSLNNDKTFKDTSSQQTNGNNNKDTNGKEEEKADGDSDILGSEKVLPEGVS
FT                   KDEFLTEIFGNLDPYIDTYSMYKQLREAGFTPEQSDQIISLLVHQLNSKLTKLSTVYAQ
FT                   NFELENEQYLFESAQQEIRVDITRSRDQHINELIALINILERDFNVINDELNNDYLKLK
FT                   NDSQVAINESKSENTLNSKKLFLRIQEANHKITTELNSDIKSEIESLRWYLSRWGLITL
FT                   LVSLFSGLIIFYNTKRRNVTKEAKKDFAPLVIREPSEYEDDDYHTELDRGSV"
FT   CDS_pept        874410..878021
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568268"
FT                   /orf_name="CD36_18750"
FT                   /product="ATP-dependent DNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX43655.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG396227"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D5CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB85"
FT                   /transl_table=12
FT                   /translation="MTGTHLESSKKITSHVIPEDSDIFNYSPDANSKTKSSITTNTNFQ
FT                   QSNKSQNNSSELTRCQPENPSSLLLATDVLPYSQRSVFPFKQFNKMQSKAFSSIYNTSN
FT                   NCVISSPTGSGKTVLFELAILREIGQEFEPNFKVLYLAPTKALCSERLNDWTKKFSLLN
FT                   ITVGILTGDTTFKEAENVRKSNIIVSTPEKWDMITRKWKDYSRLFGLIKLLLVDEIHIL
FT                   KESRGSTLEVVMTRMKRICIGLRILAISATVANAIDISKWIRLHDESTLPAETMCFGEE
FT                   FRPVKLSKIVYGYKSTSENDFQFDIFLNTKLLEVINRHSNDKSVLIFCSTRNSCQATAK
FT                   FLFNNLPEASRTDIKLKDRDAMNYTTRGIAFHHAGLTFGDRKQIETAFLNSRLKILCCT
FT                   STLAVGINLPAYLVVIKGTKCWVESSFQEYSETDILQMVGRAGRPQFESDGVAVIMTSS
FT                   KWKHRYERIIEGTEKIESSLHMNFREHLAAEISVGVIKNIDDSLAWLKSTYLYVRFLAN
FT                   PGYYALQIPKTRDPEDTLTSFCFQQCKALAQENLVTMDEQNNCKITAYGYSMVMHYITF
FT                   NTMKNLIHSQGQLSVYETLCLICESSEFADLNLKHQEKRLYKEINGSPILRYPSKSKDL
FT                   GKKDKIKLIIQFELGGLDFPAYNGALKLHSSFLGDKFYVFKHIYRIMMALLDVFIEKQD
FT                   AKSLHSSSYLLRCVNGKCWEDSPNELRQLDGIGPASVKKFCTHNILSLNDAKALTSSQI
FT                   EYFLGLKTGAGNKIKRNIASLPNLQLNIEFENEELAEDRTSVEITLNISIDVVNASTTS
FT                   VWKNKLVYIHLITDTSNGHLLDFRRIPVSKFKTSGLKTFELSYPTKDLNEVIRCQASAD
FT                   TIASVKTNTSMSIYTHLSESTIKDFANNTDDFEFSESDEDDLFNLKTKNQDESKVIELR
FT                   NETRGENPKSEVSKPTANEIKTRKVLANGNYECNHVCKDKQKCRHLCCREGLPPKASGG
FT                   NKNPENEITTPLNSNVQENPIGIGDKAANQKTTQASAKKQLKIRKNKVTLKRTLFDDSD
FT                   PEEIVSPIETTQSTMKPKKKTKSTVFSIDDGGNYENGEIVHGMKTGQDGGTLSAIPKES
FT                   IQLETKNKVIPKNQGNSPESFLIETSANQNESLSSLDVEDIRSKEDDSSQNVSVQICNS
FT                   TSESKDAITDLNKNEQRKIYNKEELQNLLGLDIDIDL"
FT   CDS_pept        complement(878114..879469)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568269"
FT                   /orf_name="CD36_18760"
FT                   /product="Nucleolar protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX43656.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG512123"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D5CB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB86"
FT                   /transl_table=12
FT                   /translation="MSSFANLFGKSTKVDENIDQLFKNTRDGPISKDELVKKQRTVIKI
FT                   PKVTAPTDQTTGNESTSSQSADESDEQEGNESNEDKDDDNKQGEPTSKNDDENEDLEAQ
FT                   YFDKLLNEQNGEEDNSNESSERKSSKAEKEHTKAKVATTVDLKEKELEKADRTVFVGNV
FT                   PADVITSKIIAKNFKNLFKHYGKIDSIRYRSISFDENLPRKVAFAKKNLHKSRDSVNAY
FT                   IVYKEKPASIAAKELNAAVFEDHHLRVDHVSHPAPKDNKRTIFVGNLDFEEKEETLWKY
FT                   FNSKFDEDVESVRIIRDSKTNLGKGFALVQFKDTLSVNKALLLNDKPLESGASKKGRKL
FT                   RISRAKSNAKPSLMSPNHFDNQKKKFAAGKSQQKLTDNQKTKIGRAQSTLGKADRSTVG
FT                   KSKRIILEGQRATKGEAIKGIKGSKKGKKVKKPRIRERSTKFKEERKSMNKV"
FT   CDS_pept        880569..882389
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568270"
FT                   /orf_name="CD36_18770"
FT                   /product="Transcriptional regulatory protein, putative "
FT                   /protein_id="CAX43657.1"
FT                   /db_xref="HOGENOM:HBG396228"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI000192D5CC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB87"
FT                   /transl_table=12
FT                   /translation="MSQSQTEVNNTELVENPSFPTPLKNDSISNGDGDLDSTTNQAANI
FT                   TLGKESPLSDITASPVPFDLSLRDVDGEVQSTIDNIEKFLEEREPTNENRNNTKSEERN
FT                   EAAENAVQEVLREIEAETLKKLDHEEKVNKDSNISIGDDMKNRDSYESSELSDLDENQS
FT                   EAETDKMDFLDEIGTVQDDDVSNGQSNGLSDLQNLSQLTELTRLKDVDSDFGDDEEEDE
FT                   SNNSNSHSNGTKLAINGESLKRTSENEHEQPTKKLKSAPQVPDPEDKNQEEEQKDTLEI
FT                   ETNANNKSKNKLDSREDKIELISLKSDQENSAEDNGAEAEPEDEGEDNDNGHNTDAPEV
FT                   EQVPNSEVEQNIKEDAVAVENEERDDVDLNKQRNLAIQELIAIEAKFAEVRDKLFKDKL
FT                   SLLQKELQLCLDGSHPELSKIYGRINEFYQDGLRLANANLMYKLKCVDKETIATRTSIH
FT                   QNFLRNLMDTKNGMITDTTSLWYKINKERNQLDQLVPDFTFAAIPSIPNGAISAEDSIA
FT                   NGNIDGSAESPVSKKLSKQSTLIELVKQRNNINEQLGILNGLVEFHGFPSAISSSLSEE
FT                   ISEEQSNELLLKKATDEEINNDLRAMGISI"
FT   CDS_pept        882944..884611
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568271"
FT                   /orf_name="CD36_18780"
FT                   /product="Chitin biosynthesis protein, putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43658.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG447892"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="UniParc:UPI000192D5CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB88"
FT                   /transl_table=12
FT                   /translation="MVEVSLTVGKLDASLALLLTKDHHLIEFPTILLPNGVRAGSIIKI
FT                   RCDQDFDSEKEEAEKFTKIQDEILQTFATNLPEPPNLKIKNVTQTSCVLEWDKLNLGTA
FT                   TLKNLILFKDGKKLGSIPQPLNNRTSKLSGLPIDKSFKVQLRLDTTAGTFLSNEIEVTT
FT                   HKMTDLSGITVCLGDLTPNDQFNKEDIEETLKNIGAKYPVQSQVKVDTTHFLCTRENKQ
FT                   NPEYVKANDMNIPIIRPEWLKACERERRIVGVRDFYVKDCVLPDIFAKNYWQKKASEPA
FT                   GNSSGQSLPNESPAVPDKEESQKTDLKKELVKDEPTEVYQAKDEPVTQEVVIGETPAVV
FT                   TENATTPDTNIEEADIGEDDSAKIESVPAEEIDTKVEPTPVGVETEDVVAEPLADQNVT
FT                   VPLESTSVDEQELPKSDETSKQVNDDQQEIEVEQQEKVIDISKEQVNNPDSNNEAQKTT
FT                   TDDAFDTVPLENNEHTESVSREIEPIPTEPTETVDVANVNSPASEGTGEDDEDEEDEGD
FT                   ADNEGKSDETSEPAPAGSASSSPTKKKNKKKKKNNKKK"
FT   CDS_pept        complement(884849..885217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000056545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568272"
FT                   /orf_name="CD36_18790"
FT                   /product="Vacuolar ATP synthase subunit F, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="CAX43659.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG402579"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniParc:UPI000042ED3B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB89"
FT                   /transl_table=12
FT                   /translation="MSEAMEKRKLVAAIADEDTVTGLLLAGIGQISNEPGKESNFLTVI
FT                   PGKTTVEQIEEAFTTFTSTRDDIAILLINQHLADLIRFKVDSFSNAFPAILEIPSKDHP
FT                   YDPEKDSILKKVRKLFGE"
FT   CDS_pept        885499..886356
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568273"
FT                   /orf_name="CD36_18800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43660.1"
FT                   /db_xref="HOGENOM:HBG715231"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="UniParc:UPI000192D5CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB90"
FT                   /transl_table=12
FT                   /translation="MIRSLISRNSTRIRGINTNLTSVRFAGHSKWQNIRHDKAKNDARK
FT                   SKEATLISGRIESCVRVGGKESNARLDQLLEKAKTLNVSKTVVEKAIKRGCGELTDTAQ
FT                   LQNVQYEFMGPGGVAIIVNALTDNKARTVSMVKNAMTYFQATLSPCSYMFDKMGEVIFL
FT                   PKDNSENFDDVFEVALEIGAEDVEEFEFEDEFVPGKVHKFYRLLCDPTSINQVSNDLSS
FT                   KGYKLHESAVRYLANSDSQVPFPEESSKGYSRAIDNLDQINDVTDYYTNIEEEHKERIV
FT                   SSIN"
FT   CDS_pept        complement(887066..888046)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228411"
FT                   /orf_name="CD36_18810"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX43661.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D5CF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB91"
FT                   /transl_table=12
FT                   /translation="MEEYKLQSIPKESNHLLSDIKNFIKIDSNASFIAGGIAGAVSRTV
FT                   VSPFERAKILLQLQGPGSQQAYQGMFPTILKMYREEGWKGLFRGNLLNCVRIFPYSAVQ
FT                   FATFEKCKDLMLHYNPRDTQQLNGYERLIAGSVGGIVSVAVTYPLDLVRARITVQTASL
FT                   SKLNKGKMVRAPKVMETLKDVYKNEGGFLGLYRGIIPTTLGVAPYVAINFALYEKLREM
FT                   MDNSPRDFSNPIWKLSAGAVSSFIGGVLIYPLDLLRKRYQVASMAGGELGFQYRSVAHA
FT                   LHSIFTTEGFFGAYKGLTANLYKIVPSMAVSWLCYDTLKDWINRW"
FT   CDS_pept        complement(888518..889933)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534060"
FT                   /orf_name="CD36_18820"
FT                   /product="4-aminobutyrate aminotransferase, putative "
FT                   /EC_number="2.6.1.19"
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="gamma-aminobutyric acid metabolic
FT                   process"
FT                   /protein_id="CAX43662.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0009448"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG483813"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D5D0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB92"
FT                   /transl_table=12
FT                   /translation="MSSKSVSSLYFPEEPKEPVVVDSHAKSNEIADRLGKVFDNRGVYF
FT                   VADYQKSVGNYIADVDGNVYLDVYAQIASIPLGYNNPALIETAKSDKMIRAIVDRPAIG
FT                   NFPGKDTDEIVAEILKVAPKGQDKVWSGLSGADANELAFKAAFFYYQAKKRGYTTQFSE
FT                   EEMKSVMQNEAPGSPELAILSFERGFHGRLFASGSTTCSKPIHKLDMPSFKWPKAQFPS
FT                   YKYPLDKYAEENKKEDERCLKIVDDIIQNNKIPVAAVLVEPIQSEGGDNHASAEFFQGL
FT                   RDITLKHGSLLIMDEVQTGVGATGVMWAHERFNLQPPPDLVTFSKKFQSAGYFFHDPEI
FT                   IPNFAYRQFNTWCGDPARMILAGAIGQEILKHDLVKRAAEVGDYLFKKLEQLQEKYPKY
FT                   IKDLRGKDRATFIAWSLESGEARNKFLSDMKTVGVNIGGCAEDSVRLRPTLVFEEKHAD
FT                   ILVNAIDKLLASY"
FT   CDS_pept        890687..893140
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568274"
FT                   /orf_name="CD36_18830"
FT                   /product="Protein TBF1, putative"
FT                   /function="telomeric DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="telomere maintenance via telomerase "
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43663.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007004"
FT                   /db_xref="GO:0042162"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396230"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR013867"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000192D5D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB93"
FT                   /transl_table=12
FT                   /translation="MSDQIEKDIEESIPSINDQQNQEHQETQEAQEEEHKKQQHVEKPS
FT                   SLEEAKAIEHLTDSNKDDSGVTKLQESEDLIENFSVDPQLKEQQESTTKMSSSEKDLVD
FT                   EIDELYSSSTTPFTENNQPSDSNKRTYEYSDKDQEPTTNDKRQKLDASTEILVASESES
FT                   APKHSEQLQAIESSQQGQPSTAETANFVAAPASTLNEQEGASSSINEEEDLEMIAKQYQ
FT                   QATNLEIEQAMEGHGNGKQEVSIQEKDQASESMLISSIVPSDSELLNTNQAYAAYTSLS
FT                   SQLEQHSQANTMLSSATLSALPLSIIAPVYLPPRIQLLINTLPTLDNLATQLLRTVATS
FT                   PYQKIIDLASNPDTSAGATYRDLTSLFEFTKRLYSEDDPFLTVEHIAPGMWKEGDETPS
FT                   IFKPKQQSIESTLRKVNLATFLAATLGTMEIGFFYLNESFLDVFCPSNNLDPMNALSNL
FT                   GSYQNGFQTTDSPIGAKVGKLLKPQATLYLDLKTQAYISAIEAGERSKEEILDDILPDD
FT                   LHMYLMSRRDAKLLTPTETDFVWRCKQRKESLLNYNEEIPLSEQYDWFTFLRDLFDYVS
FT                   KNIAFLIWGKVGKTMKNRREGTPHTQELLDNTTTSAQVSNEMPPSSAPSSSTSSVIDPN
FT                   KMLVSELREANIAVPKPSQRRAWSREEEKALRHALELKGPHWATILELFGQGGKISEAL
FT                   KNRTQVQLKDKARNWKKFFLRSGLEIPSYLRGVTGGVDDGRRKKNRVTKKTAAAPVPNM
FT                   SEQLQQQQSRQQQQQQQLDKQQEEEEEQQQEKEPQQEPQEQQQVQQQSEQQHQEEIQPP
FT                   ESSDK"
FT   CDS_pept        894155..895525
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568275"
FT                   /orf_name="CD36_18840"
FT                   /product="Guanine nucleotide-binding protein subunit beta,
FT                   putative"
FT                   /protein_id="CAX43664.1"
FT                   /db_xref="HOGENOM:HBG396231"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D5D2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB94"
FT                   /transl_table=12
FT                   /translation="MSDYIAQSLIQSSSLQEQEQQTLLSSITGQINTARSEAKVLYTEI
FT                   LSVKRRTQDATIQVISQNVSQIPKNSCNLTLYNTLRGHQNKIAKLCWSSDSSKILSASQ
FT                   DGFMIIWDAVTGFKKHAIQLNNPWVLTCSYSPNEKLVASAGLDNNCTIYKIKPDTSNFP
FT                   VTEERSGTYQMQGNFYQSIQSIFKGHTAYISECEFIGNNSIVTASGDMTCSLWDLTKGS
FT                   KSRDFVEHSGDVLCLSVFPQNILSANLFVSGSSDGSAKIWDLRSPTPTQSFGISNSDAN
FT                   SVKVFPDGNAFATGSDDGSIRLFDLRSDCELGHYSLSQELRNKQNLSHLTIPSPVDERY
FT                   IKKFGNAAVQAYDEQSTSLLHSNGSSSGNLDQYSVNSLQSVIENQGVFSLDFGKSGRFL
FT                   YSCYSEYGCVVWDTLKSETVGIVGSEHMNKINQVSVSPDGVALATGSWDATIKVWSV"
FT   CDS_pept        complement(895799..896509)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077018"
FT                   /orf_name="CD36_18850"
FT                   /product="Transcription initiation factor TFIID subunit,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43665.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG329099"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="UniParc:UPI000192D5D3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB95"
FT                   /transl_table=12
FT                   /translation="MRKWSIQISMLDSQGKEHPAKILDRVTYTLHPTFANPIRTLKQQP
FT                   FKVEEQGWGEFDIPIAVHILGIPGKAGERKFQHDLNFLQEKYVNDHVISIPVSPTKNPA
FT                   LNKVLAETGSLPFEDSGASASSASSGSVGIKRKLESNNGAAAAAATSVDNKSKKSKGAM
FT                   KGNIDLEKLSQGLTKLSEDDLIVVVQMVTDNRTNEMNIKNDVDNGEFTMDLYTLPDSLL
FT                   KSLWDYVKKHTGEA"
FT   mobile_element  896920..900079
FT                   /mobile_element_type="LINE:2C, Zorro3"
FT                   /note="5' truncated in ORF1 and with middle of ORF2
FT                   replaced by 5' end and start of ORF1 in opposite
FT                   orientation (and with eta LTR inserted in 3' UTR)."
FT   mobile_element  896974..897444
FT                   /mobile_element_type="retrotransposon:solo LTR, eta F"
FT   CDS_pept        complement(897653..898813)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568276"
FT                   /orf_name="CD36_18860"
FT                   /product="Polyprotein of l1-like non-ltr retrotransposon
FT                   zorro 3, putative"
FT                   /protein_id="CAX43666.1"
FT                   /db_xref="UniParc:UPI000192D5D4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB96"
FT                   /transl_table=12
FT                   /translation="MTPISDLSYQLIMKLMNIFIFSKLYYRDLHSPISTTAVSSVVTTV
FT                   QQRLPLYFKLQRLQTPNHLGGFGLMNPNHQVKGRRGKQIYLLYTQEDDLIIKFMRTKIQ
FT                   DILDNIAKDYKLMPTEPDKLMVYPWYYFGMGVSCHPSLQFRYLKERVYENLTKSEISWF
FT                   EAWFQLVHYTGPPVETPIRIMSIEDYANLIIQPKTEIINLMSPNFEKQPLSEQTFHHTS
FT                   RKLCPQAPIIPEGWGKHFDTIKSLTISDWTEFWKNMNKVQKQSVGSLQDYHLFILGYYL
FT                   HYPFYPNYKKSEIHFCQLCNTGTDSIVHHIFECGETMELWSKHFNSQRTPQFIIGNKHL
FT                   HKKDLHALNEYIKEVVQKVKRRRGSPILNHGEKENVDAGTNVLVQT"
FT   CDS_pept        898884..899330
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568277"
FT                   /orf_name="CD36_18870"
FT                   /product="Non-ltr retrotransposon zorro 3 orf1-related
FT                   protein, putative"
FT                   /protein_id="CAX43667.1"
FT                   /db_xref="UniParc:UPI000192D5D5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB97"
FT                   /transl_table=12
FT                   /translation="MTTNGTNGFEIAEKGDHPPRQSQENPPGNFQESPLDGGQIRKSSS
FT                   TDGVSKNVEFNTQTNAHESWADFPESDQMDTDSSEYPSEEENEEGKISKGPYHAFKNFS
FT                   TEEYFTPETATNKVVDNTTPSQTTQSINQNSTTYASVAANYKSN"
FT   mobile_element  900380..900769
FT                   /mobile_element_type="retrotransposon:solo LTR, alpha A"
FT   mobile_element  complement(902245..903164)
FT                   /mobile_element_type="retrotransposon:solo LTR, kereru B"
FT   mobile_element  complement(902611..902897)
FT                   /mobile_element_type="retrotransposon:solo LTR, toroa A"
FT   CDS_pept        903767..904948
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568278"
FT                   /orf_name="CD36_18880"
FT                   /product="Branched-chain-amino-acid aminotransferase,
FT                   cytosolic, putative"
FT                   /EC_number="2.6.1.42"
FT                   /function="L-isoleucine transaminase activity"
FT                   /function="L-leucine transaminase activity"
FT                   /function="L-valine transaminase activity"
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="CAX43668.1"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="GO:0052654"
FT                   /db_xref="GO:0052655"
FT                   /db_xref="GO:0052656"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI000192D67E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB98"
FT                   /transl_table=12
FT                   /translation="MILKPSSLLRSVVQPRQWLRYTSSVAPLQASRLIIEKTNNPKPKL
FT                   PKDKLVFGKTFTDHMLEIEWTKEKGWHTPKISPYHNLSLDPSTIVFHYAFELFEGMKAY
FT                   KDTNGNIRTFRGDKNMIRMNKSAERIALPTFDGEELQKLIDKLLLLDKDFVPEGKGYSL
FT                   YLRPTLIGTTASLGVGTPDRALLFVIASPVGPYYSSGFKPVSLEATDYAVRAWPGGVGD
FT                   KKLGANYAPCVKPQLEAAERGFHQNLWLFGDEGYVTEVGTMNCFVAFENDDGTKELVTA
FT                   PLDGTILEGVTRDSILELARERLPSDEWTVSERKYTIYEIEEKANKGQLIEAFGAGTAA
FT                   VVSPINNIGFRGKSIKVPVALGNSGELTATVAEWIRKIQYGEEEFKNWSRVAK"
FT   CDS_pept        complement(905083..906096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568279"
FT                   /orf_name="CD36_18890"
FT                   /product="Hym1p orthologue, putative "
FT                   /function="binding"
FT                   /protein_id="CAX43669.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG331109"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D67F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WB99"
FT                   /transl_table=12
FT                   /translation="MAFLFKRNPKTPPELVRALNDQVSKLDCALPDNAKKYQDECARYL
FT                   KNMKVILHGDDEVEPQPDQITQLAQEIYSTDCLYFLVVNLRKLDFDSRKDVVILFSTLL
FT                   RRTMANKSPTVDYLVHSKPEIITMLIKGPENPEIGLICGQILRDCIKFEVINRFVLYSP
FT                   SFYNFFKYVQIPTFEIATDAMMTLHELLTTHRKLVSEFLGNNYDVFITAINKLITSKNY
FT                   VTKRQSVKLLNELVSQRSNQQFLSKFFDDANNLKLTMLLLSDKSKNLQLEGFHTLKFFV
FT                   ANPKRSQKVTDILIKNKANFIEFFKTFDIASFHDSNIIEERDYTLGEIKNLPDRIH"
FT   CDS_pept        906679..908715
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568280"
FT                   /orf_name="CD36_18900"
FT                   /product="Vacuolar protein sorting protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43670.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396232"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="UniParc:UPI000192D680"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA0"
FT                   /transl_table=12
FT                   /translation="MPKTSIIMTTSWLHIWNPILINRSNRPILQDNEYNIYIRDNVGLY
FT                   QGRQKIVNRQNGRIYLTNKRLIYFDNSDSSKSIAVELKLFKNAELVAGYFRRSPKVTLY
FT                   IKTENGGTTNIGGNENGTNSKNITIDWVCKICSFNNHLASDYKINENELPKCTSCGIRP
FT                   SKSYLSQILESAQNNVSVKEDSPASMTPEPESVSPNNNNQCPKCTFINHPALRYCEICG
FT                   TELKPSNDSNTKLLKATQSLSNVSINSNPLNLKLETGEELYTNNQPYIKLSFRKGGESK
FT                   FYQEVCKVLDDMKWQILEQKGGINKDAVKLVDNSTSVNKNSTTAAAGGGGGGGIHALER
FT                   LGELQRKQNEIILTTSLDDLEQLMFKYQDLIKLSTSFNKLIKQPLSSTTTTTTTKSGVV
FT                   IPALSIKKSSPLYHQELSRHISEFLINFKLTQKTSMISSQDLFAEYNRFLIRNQGFGSA
FT                   LVNCDDFKCAIELFDELNLPVVVKQYMKSDIYVIRPKVDANIYGQHIVQYLKDQEYEYK
FT                   LMTLRREITSGDYENINNELYNAVNYGKTVSEISNKFNWSYNITIEELEKCVETGSVVI
FT                   DHHISGTFYYVNKFPFSDGEWDDSKEIQEMRELLIKEQQEITLTLRNEYVEQNMDNLVN
FT                   IDPDYNFFGVGNEEDKDELESTVTTSVPESQTQSFNDLVGLQF"
FT   CDS_pept        909012..910880
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568281"
FT                   /orf_name="CD36_18910"
FT                   /product="Meiotic mRNA stability protein kinase, putative "
FT                   /EC_number="2.7.11.23"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II carboxy-terminal domain kinase
FT                   activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43671.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008353"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D681"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA1"
FT                   /transl_table=12
FT                   /translation="MSYSSASFRKLNNVGISQPSQTVSANQPQHHQQSHQQQQQQQQQQ
FT                   PLQQSQQSLHMKSNPHIPHHQLPGTVGTRTSIPQPALMASNSILTLGPFKHRKDLTRES
FT                   VLSTYQIMGYIAAGTYGKVYKAKLKSNKLNKPDDESGGDGFNNNKDILSESMNELHHDN
FT                   NSNIGVNTTNTTTATTTIINNTLPLPQFFAIKKFKSDNHHHINNNNNGANHLSKGNNSI
FT                   HQDEVLHYTGISQSAIREMSLCRELNNKNITKLVDIILENKSIYMVFEFCEHDLLQIIH
FT                   YQSHPEFKPIPCPTIKSLIWQILNGVTFLHKNWILHRDLKPANIMVSSQGVVKIGDLGL
FT                   ARKFKSPLQSLYTGDKVVVTIWYRAPELLLGTRHYTPAVDLWAVGCILAELLSLRPIFK
FT                   GEEAKIDLNNKKSVPFQKNQLQKIIEILGIPTTDIWTNLNKYPEYLSFTQHFNQSYPNN
FT                   LSNWFKLINGGNNQNSEKCLELLSGLLKYDPELRLTADQALLHPYFLELPKVNENAFEG
FT                   LNYKYPNRKIYTDDNDIMTTAANINNNSTNNSGHQHQHHHHSQQLPQQQQQQQQQQQQQ
FT                   QNVQIQQVHQMQQQIHSQQLQSHGANNTYKRSGIDDLPGGARKKRG"
FT   CDS_pept        911042..912076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381221"
FT                   /orf_name="CD36_18920"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.22"
FT                   /function="ATP binding"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43672.1"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D682"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA2"
FT                   /transl_table=12
FT                   /translation="MKLSDYYTDKELIYNSAISDIYKAIDKSNKSPVCLKIVDEDFSLP
FT                   PHSIHREILILKNLKSHSHPNIIEYINDLKVYDDIILVTKLYRYNLTQLMESSKYCKRT
FT                   TRFIYETDTDTNGVVNKYILSNRIEETDIKLWLKSMSSGLEFIHSQQIIHRDIKPSNIF
FT                   FISDDITQPIIGDFGICYDLKSPPKDEPIMEKYIDVSTGIYKAPELILGITNYEYEIDI
FT                   WSLSIILTILYSKDFQSILIKNDKEIMINDSHISDLYLLNQIFQNFGTPNLIDCNNELF
FT                   CDEYNHENLHFKKFNLQNYSRKQWDIILPRCNDELMKEIFTKMIKYDRSQRITSKEIFQ
FT                   LILD"
FT   CDS_pept        join(913669..914500,914572..914594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077019"
FT                   /orf_name="CD36_18930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43673.1"
FT                   /db_xref="HOGENOM:HBG396233"
FT                   /db_xref="UniParc:UPI000192D683"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA3"
FT                   /transl_table=12
FT                   /translation="MSANTDQKFIRTADYDFIQKLGINVYYPSYIENPQISGGELKDLI
FT                   IDKPIYKEANKHAKKRSDLKKLKREQRRESSQMKHDQKSQLKEAKRQSHLERKELKKEL
FT                   HQQKAEMKKEQHQQRADIRAEHRLQKSDSLKQSYCGHYMKQGLSMNSQIDPKNDSYPQP
FT                   TNNNNNNNNNYPQPNSYSSYNNYKNLFDISNSDMTDDEKTEVESDMESTIKSLQSTTLA
FT                   TTVNHSVAYNHKEEHQSKMARANSYDQTKSTFTSFRSNIKNKLKFRTLRSSSEQLVEVF
FT                   ATN"
FT   CDS_pept        915281..916510
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534061"
FT                   /orf_name="CD36_18940"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43674.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D684"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA4"
FT                   /transl_table=12
FT                   /translation="MSAKIELVTENVTNGHSGASETIQYTKSQMVGHGSFGVVFQIQLQ
FT                   PSNEIGAVKRVLQDKRFKNRELQIMKLVHHRNIADLKYYFYTNNEKNELYLNLILEFVP
FT                   ETLYKASHYYVSKRLNMPPLEVKLYTYQMFRALNYIHSQGICHRDIKPQNLLINPDTGE
FT                   LKLCDFGSAKILNPSEPNVSYICSRYYRAPELIFGATNYTTKIDVWSAGCVMAELILGQ
FT                   PLFPGESGIDQLVEIIKILGTPSREQIKNMNPNYMEHRFPQIKPIPLQKIFKKMSPDCI
FT                   QFLIKVLQYSPIDRISCIEGLIDPYFDELRNENTKLPNYRKIFSQQFHSNNSSGFGNAA
FT                   NYQLYNAQPDLRDLPELFDFDDRELSVAPRLNKQLVPNWAYSHLRLNQHINSLDEFSPM
FT                   SADELKVTLE"
FT   CDS_pept        complement(916799..917536)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568282"
FT                   /orf_name="CD36_18950"
FT                   /product="Membrane protein, putative "
FT                   /protein_id="CAX43675.1"
FT                   /db_xref="HOGENOM:HBG448404"
FT                   /db_xref="InterPro:IPR018811"
FT                   /db_xref="UniParc:UPI000192D685"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA5"
FT                   /transl_table=12
FT                   /translation="MFRRVIVTSPRIFKASQPYLSNIKTCSPILLNRSFCQSSSTLKLF
FT                   SKTTSSTTIKTKPDTVATTTTSPTIDPTEKDFQNHPILKRVPKFLRSYTKQFINAPFSH
FT                   LISFLVLHEITAIIPLFSLWYFFHNHPNYIPMEIPSWAIDQGAKIIDYGLSKITNWEIN
FT                   SKDKMSIIIEGAYAFSIVKFLLPLRIIISLSLMPWFARWFIVPIVNIFPNFTKLLNYKK
FT                   IKQQQEKTRFDNAKIKHIDKPRL"
FT   CDS_pept        918301..919509
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568283"
FT                   /orf_name="CD36_18960"
FT                   /product="Acetyl-coa acetyltransferase, putative "
FT                   /EC_number="2.3.1.9"
FT                   /function="acetyl-CoA C-acetyltransferase activity "
FT                   /protein_id="CAX43676.1"
FT                   /db_xref="GO:0003985"
FT                   /db_xref="HOGENOM:HBG370930"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000192D686"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA6"
FT                   /transl_table=12
FT                   /translation="MVPPVYIVSTARTPIGSFQGSLSSLSYSDLGAHAVKAALNKVPQI
FT                   KPEDVDEIVFGGVLQANVGQAPARQVALKAGLTDKIVASTINKVCASGLKAIIIGAQNI
FT                   ICGTSDIVVVGGAESMTNTPYYLPTARGGARYGDSTLVDGIQKDGLLDVYEQKLMGVAA
FT                   EKCASDHGFTREQQDEFAIKSYQKAGDALKQGKFKQEIAPVTIKGFRGKPDVVVEKDEE
FT                   IEKFNEAKLKSARAVFQKENGTVTGPNASKINDGAAALILVSEAKLKELGLKPLAKING
FT                   WGEAARNPIDFTIAPALAVPKAIKHAGLTLDKVDFFELNEAFSVVGLANAEICQIPLEK
FT                   LNAYGGAVALGHPLGCSGARIVVTLLSVLIQEGGKIGCAGVCNGGGGASSIVIEKVDSD
FT                   FKL"
FT   CDS_pept        919802..921664
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568284"
FT                   /orf_name="CD36_18970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43677.1"
FT                   /db_xref="HOGENOM:HBG396234"
FT                   /db_xref="InterPro:IPR010770"
FT                   /db_xref="UniParc:UPI000192D687"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA7"
FT                   /transl_table=12
FT                   /translation="MSSVDYLWTEDYLNDFEIENRFIDTTITFIIVSKDPSSCYDNLIG
FT                   FFQPWLKSYPWTIDRPNITQQSTRIKNILINYIYGELNYHEYTFESLLLISILFQFSKY
FT                   HQDCYIHLFDSSIIEPILFYCHDFLPNDLQDIITSINRTWIHDFNIIVLNLHDDRFINL
FT                   FIAINQLNNLDYIINQQLSQFWQKKIEFNEYLTNIHDLEIINIPIDIGKLIINDPTMIG
FT                   KALLELEQISELKKLSNIEQLKCCNVIVPINDINLLTLLSLCHNNNNNNNNNNNNNNNN
FT                   NDIQIRDILAQGLSKYYRSSNSNSNSNSKLPLPPLPLIPSSISQISRLDLQQELINRGL
FT                   LSHIVEENKDVYQVIENLNNNNETSIENEEELANQLYQILLDKRIQNIIEEEEEEEDDD
FT                   NDNDDNDPDYSDFSDDDDELIEFRNKYYEITNIWLDKIQLKSKYNQFKQSIITSVNNFK
FT                   QEFINTEFDDFPEFMETNVILDLNKDYNDDSDYKSDDNNEGIYQGDMAFEEYLRFKKKL
FT                   RKQGEIIGDDHEHDDDENDEDWEDIDNDDDDDDDDDESDEGDSDGYIEEIYQESPKISE
FT                   IHDPDPEIIERLSNNFQNLQTNEIQKSSNLEDIIKKKKKKHTYI"
FT   CDS_pept        complement(921843..922853)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18534062"
FT                   /orf_name="CD36_18980"
FT                   /product="Dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43678.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192D688"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA8"
FT                   /transl_table=12
FT                   /translation="MSSFELDSLPYLNPNVDRRIAFITGGSSGLGFYTVLQLYLHGYTV
FT                   YIAGRSKSRCLKSIKELKNKAIDIRSTYTSLQLNERFLGDLRFLEIDLSNLTSVITAVE
FT                   NFKKLEDHLHILINNAGAMALPYTLTIDKFEIQLQTNFISPLVLTTKLLPILQKTTDKF
FT                   PKLPTPRIIYLSSFGHQFALQYFNLNNGLNYYPNFIFTWIRYGMAKVAGIHFMKMLALR
FT                   NPKVLFLTVHPGLVMNTNLFSYWTRLPIVGIIFWFVFYLFGYFFGVTSEQGANVVIKCA
FT                   LNENLTVEIDNGKYFGPNGKESQPSNIATNMDYAARTWIWTIKELNQRGIEIPNP"
FT   CDS_pept        complement(923802..924368)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000032567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381222"
FT                   /orf_name="CD36_18990"
FT                   /product="Gluconokinase, putative "
FT                   /EC_number="2.7.1.12"
FT                   /function="ATP binding"
FT                   /function="gluconokinase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX43679.1"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0046316"
FT                   /db_xref="HOGENOM:HBG335815"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="UniParc:UPI000192D689"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBA9"
FT                   /transl_table=12
FT                   /translation="MTTTTTVIVVGGPAGTGKTTQGELISKYYQCPFIEGDALHPQENI
FT                   DKMSQGIPLTDEDRWGWLKQLSQVSSIKAKDSKNITNISVVSCSILKKKYRDFIKKNSV
FT                   DSLINFRFVFLYTTFEELMNRVENRKGHYMKSDMVKSQYDIMEIPKDEELLQNGGDAIT
FT                   VDTSGKSPEEIFKEIIGTDNILLKN"
FT   CDS_pept        complement(924806..926974)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228412"
FT                   /orf_name="CD36_19000"
FT                   /product="ATP-dependent RNA helicase, mitochondrial,
FT                   putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX43680.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG396235"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="UniParc:UPI000192D68A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB0"
FT                   /transl_table=12
FT                   /translation="MLLLLSCQKPTYRLLRYSIKKYSTSLYSLRGSTRVNLLHRTYATS
FT                   IAEENINHGDSSPILNNNNKVQLENIKYINTLIHPILLDLNNKLIQGKFDSPYSILNNQ
FT                   PLDVKTAIFKSFEQQLTKALFSKSIPENKITLVDYLNPTLDNIPSLLQLISTNTYPNNF
FT                   LEFNNLSSNNELIMQLFTQLLHKIFLQYRIENASFEKAKVDFSNPAEWFPEARKMKRKI
FT                   IMHVGPTNSGKTYNSLIKLSKSKTGYYAGPLRLLAREIYEKFNSQGIGCNLITGEEVVP
FT                   SIDKYGKVSGIASGTIEMIPLHKKMDLCVIDEIQMISDPLRGSVWTNAVLGVLAHEIHL
FT                   CGEESAVPFIQKMVKITGDELEIKKFDRLGKLTVEKSSINLLQLKKGDCLVVFSKKKIL
FT                   KYKCDIERNTRLKVGVIYGALPPEIRSQEASKFNNGEYDVLVASDAIGMGLNLKINRIV
FT                   FSGVNKFNGSTLQKLSVSQVKQIAGRAGRFSAQHGSKEGFVTALHRSSLVYINQCLKTP
FT                   VSEILKASIWPTNGIWRQYMANNPKKNSLSSVYENFLTNVLKFQNDNFFISELDQKVQL
FT                   LNLVSKDRFLSTMIIDDQLTISETPISFRTSNNPKLLQNTVIQFYKTIVKRDCKSILDF
FT                   GFLDLELLSQTSFVDTNVMVPLQKVEKLEDMHKLVLLFLWLSQRFPTLFIDKDSAMEVK
FT                   ALVEKRINQELVNVERANSFYSDRLKGY"
FT   CDS_pept        927630..930530
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248219" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534063"
FT                   /orf_name="CD36_19010"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43681.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396236"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020658"
FT                   /db_xref="UniParc:UPI000192D732"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB1"
FT                   /transl_table=12
FT                   /translation="MNGIGSSKVINHTAQLAAQFNEFYLEITSPKISQIGNYKIIKEIG
FT                   EGAFGKAYLATHVLLNINVVLKCGLIDDPNIVREIYYHKQLKHKNIVSLYEVIKTENHL
FT                   WIALEYCQGGELYYYIYEKKRLELDECRNIFFQIVLGVKYVHSLNLSHRDLKLENILLA
FT                   DQKRTIVKLTDFGFIREFNPQSRKFLSTICGTTVYMAPELLTGQKYSGFAIDIWSMGVI
FT                   LYTMLNGMLPFDDDDEMKIQHKVINTDPMFYDHVPVDANQLISKMLSKDPNQRPSLNEI
FT                   LNSSFLIDLYNKYLEKGNKRNSSGSGDAESIISINQHYNTVDRPFEAKIEKDLLRKLQR
FT                   IDFDTEELKATMYNNEINSLTAFYELLLTQEYSKKKQKYIREKKRKLYEAKKSIKKSRK
FT                   RVKSALSLSDQASNSQPLERIMSSLSITSNKNSSSRHTSFIARKSLDKADTSQIPPSPK
FT                   SSQGSRLNIEIPSPRATNTSIALPPRSRRSSREISTTTAASSITADLTTPLRRTVSFVP
FT                   DGRRLSQVISEPKEANKKTNKSGKILHKLQFWKKNKGDEYQDDTISHYSTKSNHSKSTN
FT                   DVMMESDGENPLEIIVKGGGNKNNNSPIKLDNTMHTVAPEVLDQQRLASRFQKNDGTQK
FT                   QRENQNLEGQSGKLERPQQVQSQHHRQQQLQSSNTGLSINAIDSPHTPPSAETSRFART
FT                   RPSSMISQISQFSKLSQMSTMLSESELDILDETDTMDDDDDDDDYDDEVYESSINTSQD
FT                   NKISGSNAPPSSSNQGGMKTSNKKRPTYRRGVASDTSITSTPSASGGGGSGIISTIPKK
FT                   KNSLSKLRSNSSEDISEDSYRFNDENIPLGRSGSPDLGKKRSFRALQQPVPLINGTIAT
FT                   SISEKLNDATKMPYVRAPSPPVGFKYNAKANKKMMTTAVNGNNNNNNNNYHQPPGYQDT
FT                   KQVEDWIHNGTTGNTNTFTKSTIYQPVINEEEEENV"
FT   CDS_pept        930914..932137
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568285"
FT                   /orf_name="CD36_19020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43682.1"
FT                   /db_xref="HOGENOM:HBG396238"
FT                   /db_xref="UniParc:UPI000192D733"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB2"
FT                   /transl_table=12
FT                   /translation="MASVIVVDSELKDSIQEYSQIIDNIKKSQEFSTSIKSFLPEKEGE
FT                   EVTNKSELYNQILNVSTSEILKQLTEKEFEPTFYLLIYILIQLSNQTEVLDNEKSPIFQ
FT                   TLLEINPQQPPSLRDRKSIKSTSILSILSTIFNLLPVTSNTRVFILKTILNVIKTSGID
FT                   FNLIQDNIGSNLINWLKETNTNEQEIKSIFWEFIKLDGTFNENSLKLIKNFTHTNTLST
FT                   QELRELIYIALSSKTVDVSFLVNNNVAQALSNNKHDDKLVTIFNKYIHGEIIPIEEIPN
FT                   GLPGQFIHSKSKILSLAKFFADASTSSSSHDGVIFKYNEIPNIKSSLEFEQTLVEAIKA
FT                   GVIEGKVNQVEETFYLSRVNRFILAGEDNTKNWENVKLVLKQWQNSLNDINNIVKTARE
FT                   NIVNNNTD"
FT   CDS_pept        complement(932218..933759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568286"
FT                   /orf_name="CD36_19030"
FT                   /product="Folylpolyglutamate synthase, putative "
FT                   /EC_number="6.3.2.17"
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAX43683.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI000192D734"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB3"
FT                   /transl_table=12
FT                   /translation="MNQTIEPDSMRINLQRTYRDAINALNSLQSNFASIEATKKLGPSV
FT                   NRNELSINEVHEFTRRLGYTPTDFNKLNIIHITGTKGKGSTCAFTESILKQYPISKIGL
FT                   YTSPHLKSVRERIRINGQPINQEKFAKYFFEVWDRFSTTKSDPQQWPTLQPCDEIKPMY
FT                   FKYLTILSFHVFLQEGVDTAIYEVGVGGTYDSTNIIDKPTVTGISALGIDHTFMLGDNI
FT                   ASITENKTGIFKKGVPAFVSKQLEYPETHKLIEKRANELGVSSLEFVDTKDLPNVKLGL
FT                   SGDFQKQNAALAIRIANSHLQTIGITQDLPEFDNDGEIKKLSDKFINGLENVDWPGRCQ
FT                   IINNNPIGITWYIDGAHTIESINASSTWFKQEQLKFDKPKRRVLLFNQQGRENYAELLE
FT                   KLFNVTYGTGSDDQIKFDDVIFTTNTTWSSGQFNSELISKNTSEDAVKKLEVQNNLSQV
FT                   WKRLDGGVSKRHVFADIETAVNYLKNLGDEDLQVFVCGSLHLVGGFLVVLDNERD"
FT   CDS_pept        934656..935396
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568287"
FT                   /orf_name="CD36_19040"
FT                   /product="Covalently-linked cell wall protein, putative "
FT                   /protein_id="CAX43684.1"
FT                   /db_xref="HOGENOM:HBG396239"
FT                   /db_xref="UniParc:UPI000192D735"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB4"
FT                   /transl_table=12
FT                   /translation="MKFSTVALSLPLIAMVQAGISSPTYYNSEHNEEHGLETVDYEFAL
FT                   GVREKCDEDTIYLVYEVDDGQLERNEKKVDCNCKSERVFRPTPSPSAIAVVGGNEECDE
FT                   NCDDEHKKKIYKRGEVEEPCETTNCDYCTIEKSFCQDHFTLCDGVLKDQRSAIGSIVSN
FT                   HQFQFDKPAQKDALYTCGWSIIEKDCVKLLALDGCTDFWECPVDDCGTYKLYNSAIDSK
FT                   CKEIEIIVILFEEEEEENKKHTSW"
FT   CDS_pept        936721..937896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381223"
FT                   /orf_name="CD36_19050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43685.1"
FT                   /db_xref="HOGENOM:HBG626593"
FT                   /db_xref="UniParc:UPI000192D736"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB5"
FT                   /transl_table=12
FT                   /translation="MINDNIYKNIHSMASATGSTATTIPHNANPADDVNNTDPNLKRIS
FT                   QFILLGATEARGNRNHNLHDGKSELSYESSLDIMSVQNNEELKDEFDEFIEIPTLVSDN
FT                   ESEEIESIATKTSAPHWKPQISLQPTPTTSQSGSNREGIEGSRFSTQSSNIHQHQPVVH
FT                   QHTSTQRENIKREILATRKNNQQATITVDDVKQSINSATTTKTKASKKSSLGCSQEQFN
FT                   LERTKVMTIVIKYVTAKIHNSFPPDSSRNVKQNELPLDKFLLILTSRLRLTLPVFLKSI
FT                   IYLFRYMDIIYLLRYLNQTNNFVNYNDMGFELKKLIVGCFKLAIIKENRINKNKYVLNW
FT                   EQITGLKNQEINSIVKTLVGRMNGKLNIKDIEVANMKNEMFRFVKMISTQV"
FT   CDS_pept        938547..938807
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534064"
FT                   /orf_name="CD36_19060"
FT                   /product="Hypothetical leucine-rich repeat family protein,
FT                   conserved"
FT                   /protein_id="CAX43686.1"
FT                   /db_xref="UniParc:UPI000192D737"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB6"
FT                   /transl_table=12
FT                   /translation="MCHLPTSLLRLHLIAHESGKIYPITRMVKWPLLLSDFGFQNLNID
FT                   YWTLEWLNMNESRFEKITINKGNIQTLNANLFPISVNYLFF"
FT   CDS_pept        940339..941595
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568288"
FT                   /orf_name="CD36_19070"
FT                   /product="Homocitrate synthase, mitochondrial, putative "
FT                   /EC_number="2.3.3.14"
FT                   /function="acyltransferase activity"
FT                   /function="homocitrate synthase activity"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAX43687.1"
FT                   /db_xref="GO:0004410"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="HOGENOM:HBG701974"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D738"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB7"
FT                   /transl_table=12
FT                   /translation="MSVASNPYGPNPSDFLSNVNKFEVIESTLREGEQFANAFFTTEKK
FT                   IEIAKALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDARVAVET
FT                   GVDGVDVVIGTSQFLRQYSHGKDMNYIAQSAIEVIEFVKSKGIEIRFSSEDSFRSDIVD
FT                   LLNIYRTVDKIGVNRVGIADTVGCANPRQVYELVKTLKSVVSCDIECHFHNDTGCAIAN
FT                   AYTALEAGAKLIDVSVLGIGERNGITPLGALMARMITADRDYVLSKYKLHKLRDLENLV
FT                   ADAVQINIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPNDFGLTRYIHFANRLT
FT                   GWNAIKSRVDQLNLHLTDDQVKEVTNKIKKLGDVRQLNIDDVDSIIKDFHAEQSTTNTP
FT                   LLKPVEADDETPEIKKQKV"
FT   CDS_pept        942424..943473
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568289"
FT                   /orf_name="CD36_19080"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43688.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D739"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB8"
FT                   /transl_table=12
FT                   /translation="MPTQSGYGYVEGYSDIQKFTNIPIPIPKGNEVLLKVEAAGLCLSD
FT                   PHVLIAGPIQSKPPIPLATKFIMGHEIAGSISSVGEQLINDPNYKQGARFALQIAKACG
FT                   MCNSCRQGYDGVCESSHQAYGLNEDGGFQQYLLIKNLRTLLPIPDGVSFEQAAVTTDSV
FT                   LTPFHAIQKVRNLLKPTSKILVQGCGGLGLNAIQILKNYGCYIVASDVKNEVEKLALQY
FT                   GANEFHIDINKSNHESMSFDIIFDFVGIQPTFNNSDKFIKRRGKIVMIGLGRSKLFIPN
FT                   YKLAIREVEIIFNFGGHSAEQIECMQWVAKGLIKPNVHVADFNSLPQYLEDLANGKLTG
FT                   RIVFRPNKL"
FT   CDS_pept        943690..944367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568290"
FT                   /orf_name="CD36_19090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43689.1"
FT                   /db_xref="HOGENOM:HBG329670"
FT                   /db_xref="InterPro:IPR010422"
FT                   /db_xref="UniParc:UPI000192D73A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBB9"
FT                   /transl_table=12
FT                   /translation="MAKKNAGENSKKAAGNARKAEQAAKKKQEVMDKLEQEEEAAWSQG
FT                   AKKGNKKKEDEQFKKEEAARKKAERDALLAAEEASMPSKPTKAKNRGAEKVAQRRTGKI
FT                   DDFLDYNKDIPELSASGLDSALEALSLTGTGGGISNKDIDRHPERRVKAAYNAYEEKRL
FT                   PEVRKENPGLRLNQIKNLIFKEFQKSPENPMNQDTNVQYNASGEDIANKKKEARAAREQ
FT                   KFT"
FT   CDS_pept        945642..951398
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568291"
FT                   /orf_name="CD36_19100"
FT                   /product="TATA-binding protein-associated factor, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAX43690.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG356018"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="UniParc:UPI000192D73B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC0"
FT                   /transl_table=12
FT                   /translation="MSRLDRLVVLLETGSTPFIRNTAADQLSDLAKAHPEDTINLLGRV
FT                   YPYLKSKKWETRIAAARAFGGIVNNAPLWDPNSEKQIKLEKDTEQVFVKEELQTDPIVK
FT                   KEFPQDEIIIKKEQDEELQKLTKNLSNLINFDSFSLQELIKCGTKLLASKSDDTDSDDY
FT                   ANDVTLLGRIKRHRSSIIPKEKTNPELSKENSPDPHVKEEPIVKQEHTGHQQQDIQTSA
FT                   SASPPPPPSGSNKPVSSARLKAMQRRRAKASAKNGANKIRSVDISQSSLSRQMMENGEG
FT                   MDIDSKDSTPQFDVTSQQGGNKLVVETKTSELSPLLSQQNKVAGLIWQFQGVYELLLAD
FT                   LFDDQWEIRHGAALGLRELVKKHGKGAGRVMNKTQQENDTNNAATLEDLAVRICVIFVL
FT                   DRFGDYVSDTVVAPVRESVAQTLAALLIHLNEDTVVKIFHCLNSMVLQKDMVPKCWEAK
FT                   HGGILGVRYLVSVRTDILLANPAMFDDVVTMVLSGLKESDDDVQSVAALTLTPIASQFV
FT                   TTRKNVIGTLLTVIWDCLVNLRDDLSASIGSVMDLLAKLCSHKEVIEIMQQDASENKDN
FT                   SFENLVPRLFPFLRHSITNVRKAVLRTILEFLSIEDSSTKAWINAKALRLVYQNLLVEQ
FT                   NIDVLNLSAQVYEKLLLEMTNNNINIDVIFTKQSKSLLTLTMTPIGISRHTYSMNTTLI
FT                   MRPSGEMLGPLQDDDCRGKKRKPDENTTDIPVEDLKVNIDSPIYKGDVMLVGYDKLIGM
FT                   RCAASAAFGKTLSYMQSEETLLKIFEAILGYLKSSHATSVLLSAFIVEEYATALKQRGL
FT                   KPNEKIVALLSETFNQVLSEPESLPHFRELVPTLKSVRTSCLQLFDVFVTAGKISPSRI
FT                   PQIPVVVQGEAEAGPGAFGLDTAEKICNENFVKLKKHLSASHRLSANQALEDAKHRISV
FT                   AMEESQLAFTSRANSIFAGFAAASLALAGVPKKLNPIIKSLMESVKSEETLVLQKRSVF
FT                   SVARLVQQLVDVGKKGASDKIVKNLCAFLCVDTSEVPEFHHNVGFKDNILSLRKEEAQI
FT                   DPTDVAAHERAVREAKVKRNGALMTLDQLLHIYGSKLFDQVAKLKEMMIEPLRYLSQTE
FT                   EVSQDELKGQSVIDALGILRALFPKMDKALYPEITDNLDLFLPGLQSEYSVFRYSTAKC
FT                   LATICSVIPAKAFIFIVNSVLPMLKNAGDVKQRQGAIETVYHISAAMGAGILPYVMFLI
FT                   VPVMGRMSDSDHDVRVLAATTFASIIKLVPLEAGIPDPEDMPQELLEGRDRERDFIQQM
FT                   MDPTKIKPFDLPVTIKATLRKYQQEGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIVS
FT                   SDHHIREEKFKETKSAEYRKLPSLVICPPSLIGHWEQEINQYASFMKVLVYAGNPSIRI
FT                   PLRSQIPDVDVVVTSYDVCRNDVDSLTKHDYNYCVLDEGHIIKNASSKLSKSVKRVKAE
FT                   HRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFHEKFAKPIAASRNSKTSSKEQEAG
FT                   ALAMESLHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKKLYKDFAKTQKESIK
FT                   TEVQGSEKEGKTHVFQALQYMRKLCNHPALVMSEQHPKFAEINKFLIARNSDLRNIEHS
FT                   PKLLSLKNLLLECGIGSQDSEYNNSSKKKSLQHQQQQQLISADGVISEHRALIFCQLKD
FT                   MLDIVENELLRKYLPSVTFMRLDGSTDPRDRQSIVRKFNEDPSIDVLLLTTKVGGLGLN
FT                   LTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRLITKDTLEEKIMGLQKFKMN
FT                   IASTIVNQQNAGLQSMDTNQLLDLFDVDDTGNGNGNGGKIEEPIKEETDTNGGGGPANG
FT                   DIPDDITGGLTGKAAGAVGELADLWDESQYEEEYNLDNFIKTLK"
FT   CDS_pept        951971..953191
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568292"
FT                   /orf_name="CD36_19110"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX43691.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D73C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC1"
FT                   /transl_table=12
FT                   /translation="MTEEEKKRLQVLERDAETAYPFLASDEKSSTFKTAEDLESGINPP
FT                   VSVAIKDKSPKLNIVSNGGGGDGGDFTEKQKPKPKPWVHFVAGGIGGTVGAVVTCPLDV
FT                   VKTRLQSDVYHSMYNKIPKSGNPIIQVWQHLSETGSVLRGMYINEGGSSLFKGLGPNLV
FT                   GVIPARSINFFTYGATKEFLLGNFSQINNNNSSGSNSKQEETWIHLVSGINAGFVTSTA
FT                   TNPIWLIKTRLQLDKSKGKNYKNSWDCFKHIIKHEGFTSLYRGLSASYLGGIESTIQWV
FT                   LYEQMRMFINKRSLQIHGNDPSNKSTKDHILEWSARSGAAGLAKFMASLITYPHEVVRT
FT                   RLRQAPLESTGKPKYTGLIQCFKLVIKEEGFGSMYGGLTPHLLRTVPNSIIMFGTWELV
FT                   VRLLSEW"
FT   CDS_pept        complement(953448..954149)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381224"
FT                   /orf_name="CD36_19120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43692.1"
FT                   /db_xref="HOGENOM:HBG396241"
FT                   /db_xref="UniParc:UPI000192D73D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC2"
FT                   /transl_table=12
FT                   /translation="MIRGNWSLADEFKKNEKKQISKIQQRQRDNHKLEKLKTIDPIHLY
FT                   YKIERLKQTSNKSEKDISYLNKLNEDWDFIINHNLHSSKLKPFLENQQRKQQQKLKQQR
FT                   KLWGQKSIYFNPELNPLGKVPQVGNLPYNLKHPIENLTIPLKGKRINYSPDPIIKESQI
FT                   KCPPGNPPRFYKLIQNTSKKNNPNSESNNNEIPLESNNIDIGNSSEENDSPHEDDDEEE
FT                   DGPNLKRHKYS"
FT   CDS_pept        954404..955135
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568293"
FT                   /orf_name="CD36_19130"
FT                   /product="RNA polymerase II mediator complex subunit,
FT                   putative"
FT                   /protein_id="CAX43693.1"
FT                   /db_xref="HOGENOM:HBG396242"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniParc:UPI000192D7FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC3"
FT                   /transl_table=12
FT                   /translation="MSQTPFNPNSPSVPTSLPPSTDFSQIPYDVLESIRNRLNQIRQSL
FT                   TKLADQINNHNRHPQKIKLPSYSYFQNQFQVLITQLMSITNQLYNNEDLLRNTNVYPTP
FT                   IFPTSAHENMLTTLLRKKVAPEVDEWINGAKLIMENESKNKSKNKNKNKFDQQVDLLKM
FT                   DQWVQLCLAKIQELRDEFQFYGFHTVEELDHMETPQGKQEIKEKKDKEFEREQIELKIT
FT                   AGGQKGLHPNQVLKFMCQGQI"
FT   CDS_pept        complement(955393..956460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568294"
FT                   /orf_name="CD36_19140"
FT                   /product="Vacuolar protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43694.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG489944"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI000192D800"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC4"
FT                   /transl_table=12
FT                   /translation="MKVSKFLFTLTLLSTSCLAIIENIDGSIEDTHDSLSPTVDKSTHK
FT                   LGVQPLEDEDNHPTPKHSKQPLDPYKNGGKLGHEASSSSSSSSSSSSSNENQELPDTSY
FT                   NAFIMSISMIIVSEIGDKTFLIAALMAMRNSRIVVFSAAFSSLVVMTVLSGVVGHALPT
FT                   LISQRLTQFLASILFIIFGVKLLREGLAMSKDVGVDEEMAEVEEEIAMSKLNTQMNDIE
FT                   GGVTTGGAITSSNNNNNNNNNNTPVYVEIGNQIQNLATFVFTPVWIQVFVMTFLGEWGD
FT                   RSQIATIAMAAGSEYWFVILGAIIGHGLCTAAACIGGKYLAKKISMRNVTIGGAIAFFI
FT                   FAMLYFYDAYYGIES"
FT   CDS_pept        complement(957478..958953)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251534" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534065"
FT                   /gene_name="NDH51"
FT                   /orf_name="CD36_19150"
FT                   /product="NADH dehydrogenase complex I subunit, putative "
FT                   /EC_number="1.6.99.3"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="FMN binding"
FT                   /function="NAD or NADH binding"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43695.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG669338"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="UniParc:UPI000192D801"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC5"
FT                   /transl_table=12
FT                   /translation="MLSNFKIKPPRTLLRGLATAAADPAANPNRVHGGLKDQDRIFQNV
FT                   YGTYGHDLKSAQKMGDWYKTKEIILKGDKWIIDEMKKSGLRGRGGAGFPSGLKWSFMNP
FT                   PGWEKNVGPRYLVVNADEGEPGTCKDREIIRKDPHKLVEGCLLAGRAMNATAAYIYIRG
FT                   EFYNETVVLQNAINEAYKAGLIGKNACGSGYDFDVYIHRGMGAYICGEETALIESIEGK
FT                   AGKPRLKPPFPAGVGLFGRPTTVANVESVSVAPTILRRGGDWFASFGRERNSGTKLFCI
FT                   SGHVNEPCTVEEEMSIPLKELLEKHCGGIVGGWDNLLGVIPGGSSVPIMPKETCDNVLM
FT                   DYDALRDVGSGLGTAAVIVMNKQTDIIRAIQRFSHFYKHESCGQCTPCREGTTWLQRMM
FT                   DRFYTGQATEKEIDMIFELTKEIEGHTICALGDAAAWPVQGLIKSFRPVMVDRIKEFQQ
FT                   KHNGEQLEYGGWVDGGKVKNGVVIDNPLPSGHH"
FT   CDS_pept        960450..961682
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568295"
FT                   /orf_name="CD36_19160"
FT                   /product="Mannosyltransferase, putative "
FT                   /EC_number="2.4.1.131"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43696.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI000192D802"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC6"
FT                   /transl_table=12
FT                   /translation="MTNYFIAFISGVILSIYYYFVLNYFSQFKSIESFPPPYYPLAKDQ
FT                   PKLASNQYLDKIYPSENRKQLGKENATMVMLVRNIELEGALQSIRSLEDRFNRDYKYPW
FT                   IFFNDEPFTEEFIEKTTLMASGETFYELIPTEDWQPPLFINETKLQENLNNSKTNVIYG
FT                   GIRSYRNMCHFNSGFFYKQKRLLNYDWYFRVEPNVEYMCDFQYDPFEFLRINNKIYGFI
FT                   IAITEYENTIPNLWSTVESFMEKYPELIHPNNAIEFLISKEISLNHYIDLIPSATDYNL
FT                   CHFWSNFEIGNLNFFRNQSYETFFQYLDYTGGFYYERWGDAPVHTIGLSLLVDKDSIHH
FT                   FEDIGYYHAPYLACPSADDILASKRCVCVSRQSEDKINRTIDTNVYSCLPRWWKYGSGK
FT                   RFLNQIDYKRD"
FT   CDS_pept        962059..963348
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568296"
FT                   /orf_name="CD36_19170"
FT                   /product="rRNA-processing protein, putative "
FT                   /protein_id="CAX43697.1"
FT                   /db_xref="HOGENOM:HBG714721"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniParc:UPI000192D803"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC7"
FT                   /transl_table=12
FT                   /translation="MARSILKQQLKSHQLLDAIDKAKSKPTKKISVVEQQQQQQPQEEE
FT                   KEETIETPVITKVKSNKKSKKSNTNKNDDYQSEVLSKKEQRRLKKLQSKQQEEEKEEEE
FT                   EEEAEDSEEEEEEEEEEELDLEKLAASESESDINDDEEEEEEEEEEEEEELNDEPKDDI
FT                   PLSDVEVDSDADIVPHTKLTINNMAALRESLARIELPWSKHSFIEHQSIISDNKIESEI
FT                   KDIYNDTERELLFYKQGLDAVKQSRKTLLKLKIPFSRPMDYFAEMVKSDEHMDKLKNKL
FT                   LTEAANKKASEEAKRQRQLKKFGKQVQHATLQERAKQKKEILEKIKSLKKKRGANEISN
FT                   DNDYDNDDDDFQIALEEATENNRTGGDNKRRKPNSKRLAKDAKYGFGGKKRGKRENDAA
FT                   SSADISGFSTRKMKGKSSSRPGKSKRNKKH"
FT   CDS_pept        963836..964891
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228413"
FT                   /orf_name="CD36_19180"
FT                   /product="Farnesyl pyrophosphate synthetase, putative "
FT                   /EC_number="2.5.1.1"
FT                   /function="dimethylallyltranstransferase activity "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAX43698.1"
FT                   /db_xref="GO:0004161"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG328346"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI000192D804"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC8"
FT                   /transl_table=12
FT                   /translation="MSDKLVAKERFLNVFEDLIKELKQILLSYNMPQEAIDWFIKSLNY
FT                   NTPGGKLNRGLSVVDTYAILNNTTSDKLNDTEYKKVAILGWAIELLQAYFLVADDMMDQ
FT                   SKTRRGQPCWYLVEGVNNIAINDSFMLEGAIYILLKNHFRQDPYYVDLLDLFHEVTFQT
FT                   ELGQLLDLITADEEIVDLNKFSLDKHSFIVIFKTAYYSFYLPVVLAMYMSGINNEKDLK
FT                   QVKDILIPLGEYFQIQDDFLDCFGTPEQIGKIGTDIKDNKCSWVINQALLIVTPEQRQL
FT                   LDNNYGKKNDECEQKCKDLFKQLGLEKIYHDYEESIVSKLRKQIDQIDESRGLKKDVLT
FT                   AFLSKVYKRSK"
FT   CDS_pept        complement(965153..965440)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381225"
FT                   /orf_name="CD36_19190"
FT                   /product="Ubiquinol-cytochrome c reductase complex
FT                   ubiquinone-binding protein QP-C, putative "
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /protein_id="CAX43699.1"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG333553"
FT                   /db_xref="InterPro:IPR004205"
FT                   /db_xref="UniParc:UPI000192D805"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBC9"
FT                   /transl_table=12
FT                   /translation="MAGAPHPHTYMGWWGSLGSPKQKYITQYTISPYAAKPLKGAAYNA
FT                   IFNTFRRTKNQFLYVAIPFVVIWSIWTRARDYNEYLYTKEGREELERVNV"
FT   mobile_element  complement(965633..966118)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon O"
FT   CDS_pept        complement(967186..967743)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381226"
FT                   /orf_name="CD36_19200"
FT                   /product="Large ribosomal subunit protein, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAX43700.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG568696"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniParc:UPI000192D806"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD0"
FT                   /transl_table=12
FT                   /translation="MVRYAATPANPAKSASARGSYLRVSFKNTRETAQAINGWKLERAQ
FT                   KYLDQVLDHQRAIPFRRYNSSIGRTGQGKEFGVTKARWPAKSVNFVKDLLRNAQANAEA
FT                   KGLDSNKLIISHIQVNHAPKQRRRTYRAHGRINAYQSTPSHIELTLTEEDEIVEKSIEQ
FT                   KQVRLNSRQRGRLASQKRLTAA"
FT   mobile_element  complement(969934..970225)
FT                   /mobile_element_type="retrotransposon:solo LTR, toroa D"
FT   mobile_element  971114..971290
FT                   /mobile_element_type="retrotransposon:solo LTR, phi C"
FT   CDS_pept        972595..975636
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568297"
FT                   /orf_name="CD36_19210"
FT                   /product="Transcription regulatory protein SWI3, putative "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX43701.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396243"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000192D807"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD1"
FT                   /transl_table=12
FT                   /translation="MSVSPPPDTTPSIHEETSSSCIDQQQEQSPQSSKEYQDNEQEEEE
FT                   DIKTKQTSDSIQDNNDAANEDVADDNLSEASTEESGEESSEETKTNPADDNDDEQQNDV
FT                   ELENKDDANEHQDNSNDNDNDNDNEDSKQDNNSDSDMKLDIPDAPDAPTSESEKQEQEQ
FT                   EQEPTNAEDTNDDQDKMDIDIPQETSIAITTNTENSNIEEYEKEESKQELGEDEELKHI
FT                   QEDDPSFDENYNTNDPDKSNDDFDTSVLINGEDFNMEIDELDYSKDQESESKNQQIEIQ
FT                   EGNKKKNNNSESTDDQKESEVKEESTEVKKPNESKQSTEIPSTLTSSSVPNADADADAD
FT                   ALATESTFSNQDTNTADLEIKTNTTDKDVDMDQKQKQKQKSESESESKDKNEEVQEQEE
FT                   EEDDDEEDDDDEDEQEEEEEEEPPKEKPQFKQTHLIIIPSYSSWFNMKKIHKIEKESLP
FT                   EFFDSIHPSKSPKLYVNYRNFMINSYRLNPNEFLTLTSCRRNLVGDVGTLMRVHRFLNK
FT                   WGLINYQVRPQFKPGYALEKMPNGQSMDLPYTGDYHVKFDTPRGLFPFDTSRIPVERID
FT                   VKKLQQLLNEKNGNNSSEVKQEQQEKVEQQNGNNKNKKHGLEEEESEEEVPPLKKKHQD
FT                   GWTKTEEDTLINAIKTFKNDWYKIAQVVGNNKTPEQCIFKFLKLPLEDKFNPIKDEDES
FT                   NIKLLKYASNYNYPINSIDNPVLANLAFMTKLVDNNVAKAASEAAKKAMDENIVKKINE
FT                   VYNNHKENSTTTTPTTTTTTTTTTNNNGHGNVDINAETERESNTKDVAIATTFGIIGGR
FT                   SHLFSNYEEREMYKISSNIINYEISKIETKLNKIEQLEKIYERERQNILKQQEELFIDR
FT                   ISLTKSTIGIIKNLEEAIKLIESESKSKLESKSESNNSNSNSNNINNISGLLNEAKSLL
FT                   YKPTRRVLEQIKNGNNNNNSTNNNTNNNNNNSNNDNTIDNDSNKINSSGSGSGSAVPND
FT                   VELQNDNFKPLSLKSPQTFKIWAP"
FT   CDS_pept        complement(977062..979992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568298"
FT                   /orf_name="CD36_19220"
FT                   /product="U5 small nuclear ribonucleoprotein component,
FT                   putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX43702.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192D808"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD2"
FT                   /transl_table=12
FT                   /translation="MDDEDLYDEFGNYIGDSLDSSDNDDDDLSSFHPPSINDNEYSEEE
FT                   EHEEEEDEEDNNNTALIKSNIATNQGETIYIQSQTQSLSNQPIIQPIYEKKMKLEYTTQ
FT                   SSTNSNGDEFPELTYSRDYLISLLNQCPERIRNISIIGDFQCGKTTLLDQLIMFTHPTI
FT                   SNNTSNTRYLDNHKLEIERELTIKSSPITLLLSDSKSRSQIFNLIDTPGHIDFEDEILS
FT                   ALNITDGVILIIDAILGLTPQNQDLIDEILQQELSMIIIINKFDKLILELKLPIKDCYY
FT                   KLVGIIDDINDYIKSNKNKNKNNKTKEYKFSPDLNNVLFASSKFGIIFNLKSFAKLYIN
FT                   KQNSLMNINEFSRRLWGENYYDPENHKFIHHNNNNNNNNNNNGSLNHSFISFILEPIYK
FT                   IITYTITNEPNDKRLSKLLWENFQISLSNKFDYKKNVEDLLKSVFQTIFNNYESFVDSV
FT                   IEWIPSAVEVATKQQQPEQPEQPEQQPEIDNSSIDKLARVTKLIESSDGKSFSSLVRIY
FT                   KGNLTIGDKIKIYGENYYQDKDDYKLEIIKKIYLPGGRYNFPINQANFGNIVLIDGIDS
FT                   IIKKGTAIITTNKTINDTTIIKNFSLFNSSKYINKSIFKVAIEPEIPSELPILLEGLKK
FT                   INKSYLSSIINVEENGEHIILTKGELSMDCILHDLRFFYCDDLQIKVSDPMIKFSETCI
FT                   ENGYTKTKATTKTVSENDLLSITIIVEPINDIKLSHDIEIGKLNLDMDFKQLNKFLKLE
FT                   YGWDSLKSKSLWSIGSINDLKNPTILLNDILEKNNINIESIKSSIISGFKWSINEGPLV
FT                   GDPIRNVQFKIIDISTTTTTNNNNNNNSSISSAQIIPLMRRACHDAISNALPKLMEPIY
FT                   QLNVICSYKAINVIKHLLNNNNNTNNNNNNKRRGIIDKVIPIPGTLLFFVQGYIPVIDS
FT                   IGILIDIKLNTQGQAIGSLKFNHHWEIVPDELSEEFIIKTRKRKGI"
FT   CDS_pept        complement(980437..981246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228414"
FT                   /orf_name="CD36_19230"
FT                   /product="DNA-directed RNA polymerase II subunit, putative "
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX43703.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG592325"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000192D809"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD3"
FT                   /transl_table=12
FT                   /translation="MNVSTSALGVRRRKVATQNIDDEENAAVLKLGPEFQLNQITNDGE
FT                   QQQLIALNLSEARLLIRAALKERKHNKNKNKKKKSNNNNNINNKSRLNGNGSNDINNNG
FT                   SGNGNGDITNDGNNISNNDTNTNTNTNEDNINGDKGNNEKEEDEDDDDDDDDDDDDDEN
FT                   SKEDEISNMELAGPNSNEIVHKTLNFLTNFARFKNRSSCETVEKLLNDFSDHCNESLHP
FT                   FELAQLGTLECEDPEEAKSLIPSLQNKVSDVQLQTLLTELRKYQTLS"
FT   CDS_pept        complement(982056..984446)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170931" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077020"
FT                   /orf_name="CD36_19240"
FT                   /product="Dual specificity protein kinase, putative "
FT                   /EC_number="2.7.12.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43704.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396244"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D80A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD4"
FT                   /transl_table=12
FT                   /translation="MAYNNNNNSANYNYNFNRHNSIGGSWHLPPPPPPQPQPPSTGAYQ
FT                   QHLSPNNPNGQDILSSDSQFSPQLKSNQIPGFRNPWFSQQQNATPNMLSSSSSSTSTSL
FT                   SQSPTKSHQIPLLQQHQPPLLNKRLSFTNNLPITYEHESTSNNNNNNNNNNNNNNNNDN
FT                   GNNGNNNVPPYIHPPTRADNPFNHYFANQEVTLSNNDRRMSAAVDGTHYNPYGFNQQQL
FT                   NAYPSGPAGVAGAQYLNNPNLGPSINANRRSSVGVLPNYYRQQQQQQQQVQIQDPSAAA
FT                   TAAAAYYLPPARLGRSASIVQYQQYQQALQNQRITKHKNPAPKARKIYNKLDLTPKFHQ
FT                   QPKYRRCSINSIHISPVNALSIYLTESYSLCQPRKFQYSKSTNPKRVLTKPSEPKYNNG
FT                   YDNEDSDYILYVNDVLGSEEGKKYMVLDLLGSGTFGQVVKCQNLINQTVCAVKVIKSKP
FT                   AYMNQSLTEVRLLEFLNTNSDGKNFIRLLDTFMHKEHLCLVFEILASNLYELIKQNQFQ
FT                   GLNMKLVKLLTKQLLDSMAQLKNFQMIHCDLKPENILLCQPDKPNIKVIDFGSACFTRN
FT                   TIYTYIQSRFYRSPEVILGLPYTESIDMWSLGCIVGELFLGLPMFPGTSEYNQIYKIVD
FT                   MLGLPPRHMIEVGKNSLNFFKKKIITTTTNTTNPDTKPIYELKSFDEYCQFLEYKRQKQ
FT                   EGNTTTNTTTTTNGSSQHHNHNYKKEQPNKNYFKHKLLKDIIINYKLPSKKMTNSMIEK
FT                   EYHDRLLLIDFLTKVLNLNPLERLTPQEALKHPFIIDVNTNDL"
FT   CDS_pept        986084..986548
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568299"
FT                   /orf_name="CD36_19250"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit, putative"
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX43705.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG325936"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000192D80B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD5"
FT                   /transl_table=12
FT                   /translation="MSADHTRDPCPIVILNDFGGAFAMGVIGGCVWHGIKGFRNSPYGE
FT                   RSYGALSAIKARAPVVGGNFGVWGGLFSTFDCTVKAIRKREDAWNAVIAGFFTGGALAI
FT                   RGGWKHTRNSAITCACLLGVFEGVGMMMQRLQAQPTMAPVYPEEPTALAA"
FT   CDS_pept        complement(987191..989194)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381227"
FT                   /orf_name="CD36_19260"
FT                   /product="Amino-acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43706.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D8C6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD6"
FT                   /transl_table=12
FT                   /translation="MTTISPSYEPVLQQPHNNDDSSPPPSYASHILHDIGSSAPIRYIG
FT                   SLIEEANREGGSANDDHDGILDMVEQVEHFKYKQDLERKLTVTSVIGLGFSLMGVPFGL
FT                   SSTLWISLMDGANVTILYGWLVVGGFSLCVILSLSEIISKYPTAGGVYHFSSVLSDEKY
FT                   SNISSWFTGWFLLIGNWTYAISIMFSGSQFILSIFGMKNVYIYKEDRFLVLSVYFILLG
FT                   VCGFINFKFSKHLEKINKACILWTIYTVLAIDFLLIFSSTRTNSLKDILTKFDNSRSGW
FT                   PDPLAFIIGLQSSSFTLTGYGMLFSITDEVKTPEKNMPRGAISAVFMAIITGIIFIIPI
FT                   LTILPELEILLDENPNIMPIDLIFKLSTESYLISFLMACLMIGTVIFQSIGSLTTASRS
FT                   TYALARDGGLPYADLWTQVNSIEDYKLPKNALFLSMVICAILSSLSLISQSAFNAFMGA
FT                   AVISLALANGVPILCLMINKRKKVRGATFKLGKIGWIINGLSIFWILLSVFILCMPPVI
FT                   KHLTWSNMNYAILVIILFAIIATFGYKTWGKKSFTGPVIDNDYFELNNLETNVSSSSSR
FT                   QAAADANVDVDENDFVIIGNDEEEDPDTSSSSSHTKNKNWDQEEEEISIENKLPPIKNK
FT                   KRINDYQPLEENGSNESRTSNEGEVIFDIDKN"
FT   CDS_pept        complement(989713..990738)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248442" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381228"
FT                   /orf_name="CD36_19270"
FT                   /product="U3 snoRNP protein, putative "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43707.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG396247"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000192D8C7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD7"
FT                   /transl_table=12
FT                   /translation="MKPSEFLLGDTAYKNAKKSLQSLINQYSTQINTSTNDDSTHISST
FT                   NNQGMAIHLVISIKIPLSRKKDYIPRIIPISYKLDDITNKSILLITKDPSIPYRSKLMI
FT                   KDSPTEDLFSDIYSFKKLKSMINSSKGKKQNLIKIFKNYDIIVCDHRIMKFLPNTLGEL
FT                   FYYKNKKIPFLIQMAKPIITEIERKKFKAQLKANNSSSSSNDIDGLTISKENKIKDNRC
FT                   DPKYINLQIKSIVGNTNYLPSNVINKGDCISLKIGYTNWSIDKLLININDIIDYLLNKE
FT                   YFTSIGGEGLIKDLNNLGNIHVKTNQSISLPIIDTTNGMINGKDGHDDDDDDGNDSDFD
FT                   F"
FT   CDS_pept        complement(991057..992082)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381229"
FT                   /orf_name="CD36_19280"
FT                   /product="Protein ure2 homologue, putative "
FT                   /biological_process="regulation of nitrogen utilization "
FT                   /protein_id="CAX43708.1"
FT                   /db_xref="GO:0006808"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192D8C8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD8"
FT                   /transl_table=12
FT                   /translation="MMSIDQRVQQTMNDNNNNPSNNNNSNNNNTNNQNVNNNSNNNNTH
FT                   TISNLSAGLKSVSLTDQQQNEVNLNLLQQQLHQEASTQQQQSRITQFFQNQPTEGFTLF
FT                   SHRSAPNGFKVAIILSELNLPFNTFFLDFNNGEQRTPEFVTINPNARVPALIDHYNDNT
FT                   SIWESGAITLYLVTKYLKENGECSLWSNNLIEQSQISSWLFFQTSGHAPMIGQALHFRY
FT                   FHSCPVPSAVERYTDEVRRVYGVIEMALAERREALIMDLDVENAAAYSAGTTPLSQSRF
FT                   FDHPVWLVGDRTTVADLSFVPWNNVVDRIGINLKVEFPEVYKWTKHMMQRPAVKRALRG
FT                   D"
FT   CDS_pept        complement(992898..994937)
FT                   /pseudo
FT                   /gene_family="HOG000093309" [ FAMILY / ALN / TREE ]
FT   CDS_pept        995981..997552
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228415"
FT                   /orf_name="CD36_19300"
FT                   /product="Nuclear pore complex component, putative "
FT                   /protein_id="CAX43710.1"
FT                   /db_xref="HOGENOM:HBG396248"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniParc:UPI000192D8C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBD9"
FT                   /transl_table=12
FT                   /translation="MPETVLEDSIYEDAVSFTTKPYDSVYPQIDSSIVNLPVTLQRLPR
FT                   NNSMSGNGLVSTINFNSKSLSSEREHFNNMSLSNVNPSSTSSSTVLKDVNFKILQTKLS
FT                   LEKDKQWKQQELEVVKRLDRPMYYKPPSHDFKDGFYGIKDCLPPNVKLNDQSPQQQEEN
FT                   DNSFNKATKFPIFINAATAKRAKDNKTHAQVLQSIRNELNEDDINDNDDDPNSTDNPRG
FT                   SWENPVVKEAISRQINLEYQMKSLIRNIIYLSIFILFKSSISKLFLLLLTARTISPTES
FT                   DSQLYNYSHNNHMINSQSSPLSNTTSNLTFYFVLITKLIMGYFIINIIISGFKLLKGQD
FT                   QCYDLPLTIHQRKLLGLKVNDVPEDYVIDEKAEMILKQRRYDLLKNKGKSVNNQQQQQQ
FT                   QQPQSIPKYKKLNDYYCSSYYDGVNEAEEDSMFNINPQFNDKNKDSSLIKNQSLYQPRH
FT                   DEGGSKSNNPIELNNQVSTSGLKFLGNQTVLGVQNKNMNSKYSLQTIQKAQSKFEKNFD
FT                   IQFNCN"
FT   CDS_pept        complement(997594..998421)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381230"
FT                   /orf_name="CD36_19310"
FT                   /product="Cell division control protein, putative "
FT                   /biological_process="cell division"
FT                   /protein_id="CAX43711.1"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG396249"
FT                   /db_xref="InterPro:IPR012535"
FT                   /db_xref="UniParc:UPI000192D8CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE0"
FT                   /transl_table=12
FT                   /translation="MEQELIQIINLLTSNELPTVITGLEQTHQLLMSLLPSIKQYQNLL
FT                   MNTNNNSASLMYNQRHIKQNRDLQQLIQFQISQDNFQYNLIQYLLPIYDKYKLSLNDYL
FT                   LSNQIIQGILLIHPNSKRIFNINQHNMKIILDLLDGCNNKDTTNDNIKLSISLISTLIH
FT                   VLLKNYDNYRIFENLNGCSILIKHFKLSSFENINDQTNTNTNTNSSNNEDEELNNNLNF
FT                   KIIEFLMLYLSEEIDNTNPNGGGKSIQEKSQFFINDFPEIDSLIENLNQLNNL"
FT   CDS_pept        999491..1001143
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534066"
FT                   /orf_name="CD36_19320"
FT                   /product="Hypothetical integral membrane protein, conserved"
FT                   /protein_id="CAX43712.1"
FT                   /db_xref="HOGENOM:HBG396250"
FT                   /db_xref="UniParc:UPI000192D8CB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE1"
FT                   /transl_table=12
FT                   /translation="MSESSTSSIILGCSVAVISSGLQSLGITLQRKSHLLHIQYLPIDS
FT                   TIPTNTNTSNIEDQQQEHEQEQHLRRQIHLNHQQQKYKRNMWLFGFLLFIIANVLGSII
FT                   QISTLPLIILSPLQSIGLIFNSILSCLLLPGDHFTNKLWVGTGIISLGAIIIAYNGNVN
FT                   SMPPNSPSKPLPPIDERFHLILQKLINPSFVVWFIGTFIMMLGLLLVNYIYLNKKIRQL
FT                   QSRQPFSIITMSNDNNNNNKAKHIPVNSCNNKYQFFKGVNYGIISGTLTAHTFLFAKSI
FT                   IDVIIETILHENFKNLFTITNALPYLLLLTMLSIVGLQLTAFNLGLAQITTAILYPLCF
FT                   LIYNFINLINDLIFNSLITSHKMTWLQLVWIIIGLVGVLCGVVILSWDSAFNANQNQRN
FT                   FKNGHDHGIGIEDGTDLISMKFPYNNNSGNGIDNDNNVDPHQSYLFGRVDEQTELLEGS
FT                   RSGSTPLSSSSSYNSADSGPLDVYKPYSDEPTKDSATITIQQQQQKPNIEALIELNDEA
FT                   AIDAEISMLSKNSTNQRLSFEQNQLLNSLDLSK"
FT   CDS_pept        1001811..1004459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248092" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228416"
FT                   /orf_name="CD36_19330"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43713.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396251"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D8CC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE2"
FT                   /transl_table=12
FT                   /translation="MQMNATSLYKRTEVIGRGKFGVVYKAQHKQTKQIVAIKVLNLDTE
FT                   EDEVIDVQQEIQFLSELKNVPNITHYYGCILNDTKLWIIMDYCAGGSLRTLLKAGVLEE
FT                   RYVAVIVRELLITLSAVHKLGVIHRDLKAANVLISKEGNVQLCDFGVAAKITANSSKRT
FT                   TMAGTPYWMAPEVIRTGDTYNSKADIWSLGITIYEIATGNPPYCDKDASWAMQLISKST
FT                   PPRLEGREFSSALKECIALCLDENPEERPSADDLMKCKLVKIYKNHPTSILKEVISRYL
FT                   LWRDKNSSRDSVFINLENEQEDSVDDIVNKNLDGGYHNHNPQQQQQQQQQQHNHQSHDQ
FT                   DHDGHSNQIQVKWDFDSLSSREYIMENDIDLDKVNQQYNNNFDTQQENTYSTLPTLKAP
FT                   TTKNNTLAATNKNSMTASKNNSKSTTEVPKSLQMLFEDNSEEQEDLAPPKSNVSVMERM
FT                   ESPTIEIPDMDSLSQLPSASTTNHPHLNKPPALYHSQSASGNLESRFSSLSTSPKDNGN
FT                   GINNNNSGISRPRKKTISNTSGGTVNAQFQQASSAVPHTPPYTTPASVRTPSPKPPSSV
FT                   NLLNATSMSKTGSPSKMKALQSSSNPLLQPINMKSENMNAAVTGGTGSHPPMQAPPQLV
FT                   TQQSMPVLPTTTATTSSSSSTTTGATTGNMKSRRNKPGFIQMPTPSNTLINNMSSLTND
FT                   HQDSGNGNNGGDNNNNVNQFGINPAQAASMPVSMTPVTEKDHSQLFPNTNNDESSEKTN
FT                   SSRSHQNSLSSQKKSLTSLSSHNLSSLGFSNGNNNPTTAPPPPPPTMFANRGSSNSISQ
FT                   SQVNFSLNGGGGTTSNGNNNGIQTSGGFPVIPNINGDVFSDTVAKQKLVNELDVMITLF
FT                   NQGLEVLEEIL"
FT   mobile_element  1004671..1004748
FT                   /mobile_element_type="LINE:2D, Zorro4-like"
FT                   /note="partial ORF2"
FT   CDS_pept        1005312..1008776
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228417"
FT                   /orf_name="CD36_19340"
FT                   /product="SWR1-complex protein, putative "
FT                   /protein_id="CAX43714.1"
FT                   /db_xref="HOGENOM:HBG396252"
FT                   /db_xref="UniParc:UPI000192D8CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE3"
FT                   /transl_table=12
FT                   /translation="MPPRIRRRITSSKREEIEKEQEELSKTIVRPYDVLQSLPVSYSQP
FT                   PTSSSSIFTHPLTIKDTGVLYYSLIKSRNNYLTMCPMFKLFWVKQSSYVRKLLELDKPL
FT                   PKSMENDIYLNREMVLNNDSSARDIMVKLCDGGISFSSGIHFFEIRIFIAKDKRSDINE
FT                   IKLIKQREKELKKINKLKEKELKDKLREENRLIKEQERLERLKEKELEKQLKQKQKEEK
FT                   QKQKEQREKEKEIERERKEKEKKEKEKEKERKEKEKKEKEKEKEKEKEKDKEKLTENKG
FT                   TGNNGKDTLIVGVIQKSNIGTGDTSISKTSQTKKKQTTKQSNVNVQTKYASKQKPNNFK
FT                   VKSESATSQTDNVNQELKVSKGIQTEKVAKTINNNPQNTNTTTNSNTTQNTHKYNINSE
FT                   ENQLMIKNLNLIAARDSSLNSLMHTVAVGRASMEQIAVFKEYIKRARAMGPPPHDDSVW
FT                   AEVFRTPIWEVAVKNELGSSQEPKPSSSQNDKKEREDNKVESNVKQEVDKATQSSDKEK
FT                   SPKETSSKNGEEVEMAEGQSKDLEPTEKKELNLKDNENENEKSENNESELKNKVENQEK
FT                   ESKPDDKEEQMKEKPQDPKKDKKDIDKNEEDTIDKEKVEKNEELNKDKSEEPKKSEEPK
FT                   KSEEETEKQELQSIEKIEVLKEDEGTSKKGDYKIEKREVETKDKEVESEIKEEDANEKE
FT                   MPPKGKSDTGSKELSPKEKKKSSEKPSKVKKEKPPKQPKLSKQSKAEIPDDQKLTAFQE
FT                   RYLEDATLLFEFVENPNVRFLFPKDAICEVLPASTMINAENGNNSDNRDILMSFIWIHN
FT                   QKEVDEYEKKLEEYNKKKAEEEEKKKQKEEEERKQKEQAEAEEQEKIKVEEDSKETQNQ
FT                   NLDEVQEDQSKDVEMEDNTSNTVKSEVEVIEISDNPQPTEEPEEIKQEIEETVPAKRRA
FT                   PPRRGKKKRRVPPPKKPAAPKPLEPPIEPEYRFTTLSFTIHGIPSKLVPIFMNSVNPVK
FT                   EVQEKMKHILEVGTRTSSFYLWYQVDGKLDEELAENIRVSLNQEEKKMTGIPTTQHETP
FT                   PEPKKYPKKRKIKEEPKKAGNEQGDESQDNCKKIKVETLEENTEQNEGGESKVSGESNE
FT                   SASKDHDKDEPLPQNEDTTAASDIVDSSVTNQTEETLEPIKEDSSTK"
FT   CDS_pept        complement(1008860..1009927)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568300"
FT                   /orf_name="CD36_19350"
FT                   /product="Mitochondrial 40s ribosomal protein, putative "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX43715.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG396254"
FT                   /db_xref="InterPro:IPR016712"
FT                   /db_xref="UniParc:UPI000192D8CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE4"
FT                   /transl_table=12
FT                   /translation="MSGSSSELFNLVKNSRLAQVAKPLSNNIRGNSKTPTHQIIFTPKS
FT                   SALRSDYGLKSTLPSKIGSSHISFNDIDNRQSMPDVEKNSGFHYKQLMFQELGLCVKTH
FT                   FTNKNPLFYHENNKSNRSMRDGSLSNTLNLPTKVQISEINKILKKNPQIYKEFRQYLVD
FT                   TYPNILLSSSSSPTSQSEIIEALKNFLSTSSQISKKKINLFTTHKIDPKFQQQQIQGTG
FT                   GFSYNQKGRLRNTPNGIKYGTVVPGRIIANKEAAITGFVASVTDRSITLQSNYAKNAPG
FT                   KHHRQFTVPFKINEAELAEDGSVRLFAEGIKTGKWMEANDRYVPTKTNFASSSERNKAD
FT                   GKSLESLLNLILPTK"
FT   CDS_pept        complement(1010173..1011564)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177242" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228418"
FT                   /gene_name="MDM10"
FT                   /orf_name="CD36_19360"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   10"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAX43716.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396255"
FT                   /db_xref="InterPro:IPR022197"
FT                   /db_xref="UniParc:UPI000192D8CF"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WBE5"
FT                   /transl_table=12
FT                   /translation="MYTYMEYLQKCFYKSTNWNEDNIYSNITATSQALLDFPIPNGFKI
FT                   DSSSKTTDYSASSFTLSNHHQINGSLAYLYSSIPLTNTMGTKDVSLQDAIAGFRIIEPS
FT                   VGLSSKLTNNIIQNRSSLLYGRMYFPGSALEAMIIKRITKNSQLLIKCVNNPHLEKNGT
FT                   MIVYLQNNTAKYSRELIYSTNEALIGLRCLYNLGNDATSHNFPHVNPAVIPKFDNSVIS
FT                   IGTELWYAARTMSPGLSAALRYSTRSTSTGKPLTMTLAINPIVGHISSTYTVKTSVAST
FT                   FCSKYDFNVFSYASNLSLGFELYSYANKKKNTFPSFEHHEIYSSSEENKYLKKHPELQR
FT                   HHRVPIKSHKYQGNRTIINPIQNLDNVYHINPTLLSSTTNSPTNNDNSNTSETVTAAFQ
FT                   NLVNESDFSSVFKFSTSLNDKVVKILWEGRLKDFLVSTGVKLSLNPITNTPEFNKLGIS
FT                   FSYAL"
FT   CDS_pept        1011893..1012555
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228419"
FT                   /orf_name="CD36_19370"
FT                   /product="Imidazoleglycerol-phosphate dehydratase, putative"
FT                   /EC_number="4.2.1.19"
FT                   /function="imidazoleglycerol-phosphate dehydratase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX43717.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004424"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG289010"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192D8D0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE6"
FT                   /transl_table=12
FT                   /translation="MSREALINRITNETKIQIAINLDGGKLELKESIFPNQSVDEHHAK
FT                   QVSGSQYINVQTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTAEDVGISLGMAF
FT                   KQALGQIKGVKRFGHGFAPLDEALSRAVVDLSNRPFAVIELGLKREKIGDLSTEMIPHV
FT                   LESFAGAAGITIHVDCLRGFNDHHRAESAFKALAIAIKEAISKTGKNDIPSTKGVLS"
FT   CDS_pept        1012802..1014124
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568301"
FT                   /orf_name="CD36_19380"
FT                   /product="Ribose methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX43718.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG396256"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniParc:UPI000192D8D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE7"
FT                   /transl_table=12
FT                   /translation="MISQKRTFSILSILLKSKSIASGDLKPVFKPRHSNSNKGQPQHFE
FT                   KNLPQTTVELKPWEKQNISKDAFFKRKYGNISPEDRKALNAKVERQRRFRAMKIAHEKS
FT                   LQEKANEERERARALAREAKGFKTSNSNYDTVVDRNDTIFDYVFGTHPVKAVLAAGKRR
FT                   MLDLYTFNNDDPDIVELAVEKYGITPKRLKDKNALNILCKNGVHNGVVLKTNKLEIPYI
FT                   KEVGHAENGEYKLAIESLEDDSVNIETKTVIRDGNEEVEELYPLSLYLDEITDPQNMGS
FT                   ILRSAYFFGVDFIVVPNHSTAKLGPVANKASAGALDLIDIYQTGSSLKFIDSVRQSGWH
FT                   VISTSGRPTGAKPREEVNDDLEIPEPHLKNKFIELQDLRTILRKTPVMLIIGSEGSGVR
FT                   TNMKMRSDYLVGIPKLRRNDNIVDSLNAGVATGVILQNCLD"
FT   CDS_pept        1014756..1016027
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568302"
FT                   /orf_name="CD36_19390"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX43719.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396257"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000192D987"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE8"
FT                   /transl_table=12
FT                   /translation="MSNYHLVILVHGVWGNSSHLAYVEKQIHENIHSYDGTIIHTHKTG
FT                   SHSGYLTYDGIDVNGKRISDEVWEQTKLIEEKGGKVIKFSVVGYSLGGLISRYCIGYLS
FT                   SQGYFDDVEPINFTTFCTPHVGVSVPQSHNFSARLYNRIAPLFLADTGAQFFLRDKVGE
FT                   FGKPLLVWMADPRSKFYKALAKFKYKSLYANVVNDKRCSWYTASISPDDKVNSSYNKNP
FT                   ENINCKYIKGYQPNVIDVTKPCYYDKANNLKGTTNYRFKWFWKTLNWIKLIGTIAVYSP
FT                   IFIITSIVQRIYNRKRVSEFFKNESNDLLHMYEHEGGEEEHPSVFADISNKVDDEQETL
FT                   VEDIYDAMNWRVSHSSAFPPIKLDRDQSYIVEKLNTISWKKYPIIIRHTKGTHGAAIIK
FT                   HYDPNFDEGEVIVRHFVKEVFKLE"
FT   CDS_pept        1016151..1017008
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381231"
FT                   /orf_name="CD36_19400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43720.1"
FT                   /db_xref="UniParc:UPI000192D988"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBE9"
FT                   /transl_table=12
FT                   /translation="MEDKAMFHNDKEHVGIKSSTLRSLFGFKDKVSLSSTIVAKPNEES
FT                   NNNDTSAEEHCSQFTSTITKTVHIRVPLLDVFQEPKFHDYHWKLKLLPQWQTYLLIYVC
FT                   LTNGDSLITQLYQDIKEFIDYYQKLDEVAILIHSSNQSFHYSMLKYCSPIFVINMVISN
FT                   SKWLYLINNYMMTSVFKEMNLQMVKYYNFGFPRVVLSVFGIPASVNKQELISFFEKLGK
FT                   LISIKFAPIGKLTKFHVISLQFSRFSNFTVIKSQILKFKSAYLSSKQALTLTKKQKKTS
FT                   DLVL"
FT   CDS_pept        join(complement(1018408..1018454),
FT                   complement(1017069..1018329))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534067"
FT                   /orf_name="CD36_19410"
FT                   /product="LAS seventeen-binding protein 3, putative "
FT                   /protein_id="CAX43721.1"
FT                   /db_xref="HOGENOM:HBG656384"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI000192D989"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF0"
FT                   /transl_table=12
FT                   /translation="MGINNPIPRSLKSESKKAAKILSSFIKPNQIAGPDQVIPPRILKN
FT                   AKGLAIITVLKAGFLFSGRAGSGVIVARLPDGSWSAPSAIVTAGAGVGGQIGAELTDFV
FT                   FVLNTKAAVDTFAQLGSVTLGTNVSIAAGPLGRSAEAAGTATVGSVSAVFAYSKTKGLF
FT                   AGVSLEGSAIVERREANRKFYGSNCKARNILAGQVDIPPACEALMRVLDSRVFSNKLPY
FT                   DEDDLYNDDYYDDIPDDFSDTTSDYSSASRNRRGTVSSSRSRRRGNSNGYYSSDEDQYS
FT                   SEDDYGYSRNRRTSTRGTSSGGSAGGRKTANWEDDIYDTNYNNKSRSRGNSDVDRLGSR
FT                   LGSTRLSPRKSDQGSSGAPSRPSVASKPNFGGAQKSNATQAIALYTFKGEQSGDLPFKK
FT                   GDVIDILKKTDTIDDWWTGRNNGLTGIFPANYVELI"
FT   CDS_pept        1019729..1020958
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568303"
FT                   /orf_name="CD36_19420"
FT                   /product="Transcription factor IIIA, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43722.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396258"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D98A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF1"
FT                   /transl_table=12
FT                   /translation="MSESDETKSVSSIISASSSSRPKKYICTYEGCEKAYNRPSLLEQH
FT                   SRTHSNDRPYKCTVEDCDKAFFRKSHLETHIVSHSENKPFHCSVCGKGVNSRQHLKRHE
FT                   ITHTKSFKCTFENCEEAFYKHQSLRHHILSVHEKTLTCKECNKVFTRPSKLAQHKLKHH
FT                   GGSPAYQCDHPGCFKNFQTWSVLQFHIKQMHPKIKCPLCGKGCVGKKGLSSHMLSHDDS
FT                   TMIKIWTCDYCDVGKFAKKNELIEHYNIFHDGNIPDDLLKETDVKKLEDLLDQGSKLNN
FT                   LNELQKVKSVNNDDEEYDCLDERRSDARSDSVSARRSIKSFTASLEDSKNISQLISNSG
FT                   KINCPKNNCDRLFSREYDLRRHLKWHDDNLQRIELFLNSIEKEETPEGEPLAKKARIDL
FT                   LSNETSVISR"
FT   CDS_pept        complement(1021054..1025859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381232"
FT                   /orf_name="CD36_19430"
FT                   /product="Protein RLR1 homologue, putative "
FT                   /protein_id="CAX43723.1"
FT                   /db_xref="HOGENOM:HBG396259"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="UniParc:UPI000192D98B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF2"
FT                   /transl_table=12
FT                   /translation="MSLSYITEEVIENFSGSGMDSLFEVLESYQENDAESEEILAQIFT
FT                   ELLITFEEDKLDVNDIKKFFTHAIKSDDHARIFFQVLNSFAVSKNIHDLLHLLFRDNKI
FT                   KIETLALHLSSDFLKSVEIVPKDYFQRTLSHKIRDEYFTQKKFNLLHEEVEGYSKFVSE
FT                   MYYILDSSDAEFQLDYAIQIMEKLIGHYDLDPNRCLSLLFQVFTATIVPHYHFILNLLR
FT                   KSRWWPNIESDNSSLSSLGIGGSETAAKVIGLELVGETGTRDLPETYKCLVAIFIKEGF
FT                   VSFGSLYKFMGSDELEMDELEAEYKKKLDRDVLVAGATALALAAPLADEEDEEGEKGEN
FT                   KTKGKTRQAATEKDLASLLKVNMKYQFLKVFLGVGLYWPAIFILTKYPYLAQIDEEITF
FT                   LINRLFATMINPLYCKLRIFSDEEIGNLQKPKGTTISRPHNTVLIEHSPVTNLLSFYPL
FT                   VHGYGNKKFTYFYREFSKDLPKIEDIDSLIAVSNELLKFNGPNLAKDTDIFIETCEVTR
FT                   YLLCKEEDKSKVFFYFKNFIFPAMPLIEENSIAINKAFEILLFFPIEDRFSLYGELYNI
FT                   LAKNNPLIKIAYSKAEKSTKDVLKRLSKENVRPMMRRLAKICFSNPLPCLLTILQQIES
FT                   YDNLNTLVVETARYFNAYGWDNLTAAILIRLASSRSSTYNGMSERQWVQSLASFIGKIC
FT                   QRYPHAIDIKTILAFILKSFYSGDTIGLLVLKEMFISMGGIQHITNLTINQIDMINCGS
FT                   SLQKIVYNTIDDLRFERRATGKYLIKCMNEIDAVNELLVLLCRISNDVTFTGNESYLKV
FT                   LVSKSDDVNAVIRLFVTLINLYDESLNLMPIKQLSDFGVPWSWAYEVWRFRDETDKDSL
FT                   SLESTTSIFDNFWKLSLHDINYTNELYDNETVKLESNIKSLKDSIVINLKNKELPRTVI
FT                   DKQRKELETCEEYQKTLADERAKHKHENEKIEQQLKSISSNWFIDLGFEEFIQKCIFPR
FT                   AITSSFDAVYSARFLFKLNSMRIDNYSLVNVLGLLFKSESLFGTLCSSTPTEAENIGLF
FT                   FADILRTLQGWRDESKYGEVGLQDQDGDKIAFDNFKQLLYDYHSLLLEEIRIGLQAPEY
FT                   ISRNNTIIFLKNLLAVYPSVDDHGKQIVDLIERISTTEKRNDLKLASNALLVHVKSKSK
FT                   NWVPIWDFISMSEEEKEKIIKAKEEERQRIIKEEAEAKRKKELELEREKQMKLAKEEEE
FT                   KKKLLAAASLNYDSSAAGTRTQTRSTPIGRSYEKYAVETRSEAHSRQTTPIPTQTQTRT
FT                   LTSVPTSPNSLSKENKLQERVNKMKQAYKESRISSDTGNETLNSEPLGGETIDDEKDAK
FT                   QEDSKDQEKIDSEAMEKIKSVQNNGETQSTTKTEDSTGDNSTKTSDSSVPKDSGPKRTP
FT                   LPPQNETKKSISQEDFKGPSEPKRTPLPPQKMVARNKDDSSGRSEARRAPLPPQHTIKK
FT                   QSLGAESSNGAGSSRPPSGQSNANTFRNDVRSSKGVSSSSQQNSRQPQSASIPPPPPLP
FT                   PVQHPRGRNDYGNSRGYQSNRDNYGRHSNSRNDSRPATNRNPTYDNRARNQGSRDSRNT
FT                   GRNDKRSADGFGGRGYDKRPRH"
FT   CDS_pept        complement(1026219..1027667)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000249250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568304"
FT                   /orf_name="CD36_19440"
FT                   /product="NADPH:adrenodoxin oxidoreductase homolog,
FT                   mitochondrial, putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX43724.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG522200"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="UniParc:UPI000192D98C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF3"
FT                   /transl_table=12
FT                   /translation="MKPRFLSHTTRLLAKPFKVAIVGTGPGGFYTAHHLLNKSSPDVKL
FT                   SIDFFEKLPTPYGLSRYGVAPDHPEVKNCEDHMINIMKDFGNSESRHKVRFLGNIEVGK
FT                   DISLKELENNYNSIVLAYGCTSADNKLSIPGADLPGVVPARQFVNWYNGHPDYYGKNKY
FT                   IPPPLDKIDTVSIIGNGNVALDVARILLADPRKHWAKTDISVDAQQLLEKSTVKHVRII
FT                   ARRGILESAFSNKEIRELLELPVKFVPLAKDLLDFDTKKLGRVDKRRVSLLEKYSKQQK
FT                   GDTNRSWELEYYKSPIEFIPGENNLLKSTKFVINKPANDPLAPHKVEPTNETVTENNEL
FT                   VILSIGYQGSPIQGLEELGIWYEKNRLQNKSGRILSTKSKDKDEHNAVFKPGWYAAGWI
FT                   KNGPKGAIASTMMDSFDTADKILEDLANDAYIKTNSDKELEFSNAMYWDKWEKLNTYEL
FT                   EKGEALGKSRLKVCNKDEMLDVMK"
FT   tRNA            complement(1027797..1027868)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   mobile_element  complement(1028401..1028652)
FT                   /mobile_element_type="other:novel LTR element 6"
FT                   /note="fragment of copia-like Pol ORF"
FT   tRNA            1029167..1029237
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        complement(1029375..1031621)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093675" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568305"
FT                   /gene_name="CRK1"
FT                   /orf_name="CD36_19450"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.22"
FT                   /function="ATP binding"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43725.1"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396261"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D98D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF4"
FT                   /transl_table=12
FT                   /translation="MSVIASHHVARSNDQRQYDTPSVPINIAPDSEGHIHEMSRLKDYE
FT                   VIEKLGQGTFGVVQKARSKKDGSLVAIKQLINHSAKEGFPITAMREITILKQLNHQNIL
FT                   SIQDMIFEEPKMNNRADIITTRGSFYTVTPYMSSDLVGLLENPKIKLEIGQVKCIMQQL
FT                   LTGIQYVHNQKFLHRDIKAANILIGQDGVLKIADFGLARVYHGNVPRLGMGPGGGEKAY
FT                   TGLVVTRWYRPPEILLGERKYTTAVDLWGIGCVFAELFTGKPILVGKSDSHQAQIVFEL
FT                   VGSPLTWTDAAKLPNKNEYSCGLACKRSLEAKFASIMPTEAIDLLSGLLTLDPYKRLNA
FT                   LDALNHRFFSTDPLPLLPTEMPKFEESHEIDKERFKKLKDKEQAVSELKPPTEIRYDNH
FT                   SESRYNADHSIFGSGAGGAGGKETSFSTGKTDYNDHYESRARKDYYESRIRNDNKDSYD
FT                   AWGEFEPTTRQEQRRRDAHNRIDTGGMDTYISKTTTAKLREHIGTESLSKKYENYQPIN
FT                   VSKESKPSSPSKSQFISQSKADFTSKTAVQKFASRENSLERKPGLNGVRSTADVEPPRA
FT                   RARGPTDIFGRPMGPSSTQVQQTRNKSLERQKDPMKPANGSNDDRSKKPPLEEKKEVVK
FT                   PSLAIPKIKKSSSLVSLSSKSVTAPAASNPLKVTKRLVSSSTPPAPLKKPKISKTSSES
FT                   DVSDVEDDSNFTGENAVVFERFMAFEQLQRLPVYKRIVNEKMKFKKLSESHKSM"
FT   CDS_pept        complement(1032029..1033693)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568306"
FT                   /orf_name="CD36_19460"
FT                   /product="Myo-inositol transporter "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43726.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D98E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF5"
FT                   /transl_table=12
FT                   /translation="MGSSSNNVQQKATTSVLENEVNSSKSSVVSSTSSAKGLLRETTNH
FT                   GTIETSSVQISESEARPSKMVLALTLASSISGFMFGYDTGYISSALVQIGTDLSNKILT
FT                   SGEKEFITSATSLGALLGAIIGGISANLIGRRRVLLGSNIIFVVGTIIQLAAHTVWTMI
FT                   AGRFVLGWGVGIASLIAPLMISELAPAQYRGRLIVTNVIFITGGQLVAYFINWGLTRVD
FT                   HGWRVSVGLCMVPPVLQFILFWFLPDTPRFYVMNGNFEKARQVLRKVHVDPSEAFVSAT
FT                   IDEMIASDSTVPGNGPLQKAWKSIKIIHTTPGNFRALILACGLQGIQQFTGFNSLMYFS
FT                   ATIFETIGFHNATAVSIIIAATNFVFTGIAICIIDKVGRRRILLVGMPCMCISLIVCAV
FT                   AFHYLNVDFSTGTVVSRGINGWGIVVIIGMILYVASYAIGIGNAAWVGVELFSDVNVRS
FT                   IGAMYAACTNWAGSLVIASTFLTMLENITPTGTFSFFAGLCFIAFFFVYFLLPDTAGLE
FT                   LEETTDFLSNGFNVKQAAKLSKERKKRSKFAKSKPTV"
FT   CDS_pept        complement(1034775..1035641)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000003867" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568307"
FT                   /orf_name="CD36_19470"
FT                   /product="Cytochrome c1, heme protein, mitochondrial,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /protein_id="CAX43727.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG314262"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="UniParc:UPI000192D98F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF6"
FT                   /transl_table=12
FT                   /translation="MFRTAYKTMNQSMVQKFIAGGVGITGLTASYLLYQDSMTADAMTA
FT                   AEHGLHPPAYNWPHNGMFETFDHASIRRGFQVYREVCAACHSLDRIAWRNLVGVSHTTS
FT                   EAKAMAEELEYDDEPDDEGKPRKRPGKLADYIPGPYENEQAARAANQGAYPPDLSLIVK
FT                   ARHGGSDYIFSLLTGYPDEPPAGVVLPAGSNYNPYFPGGAIAMGRVLFDDLVEYEDGTP
FT                   ATTSQMAKDVSTFLNWASEPEHDDRKKWGLKALVVLSSLYLLSIWVKRFKWTPIKNRKF
FT                   RFDPPKK"
FT   CDS_pept        complement(1036672..1037100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534068"
FT                   /orf_name="CD36_19480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43728.1"
FT                   /db_xref="HOGENOM:HBG396262"
FT                   /db_xref="InterPro:IPR018794"
FT                   /db_xref="UniParc:UPI000192D990"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF7"
FT                   /transl_table=12
FT                   /translation="MSSDPLTSNARPATDSLITVRIIKSFPYRNVKNHIIKDIDLKSTT
FT                   PKELLEKLHEIINTTGALRPYRNVEYNSIKIYTKAHGSKSMNLVINFENDEDWVLVNPN
FT                   KSGDKESLWDLDIRNETELSLFNWDDYLAYKENPVEKW"
FT   CDS_pept        1038417..1040255
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568308"
FT                   /orf_name="CD36_19490"
FT                   /product="Alpha-actinin-like protein, putative "
FT                   /protein_id="CAX43729.1"
FT                   /db_xref="HOGENOM:HBG396263"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="UniParc:UPI000192D991"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF8"
FT                   /transl_table=12
FT                   /translation="MFQKQASPWEYLQEATLVRWVNTKLIEDTLSPQTPTSTCQNISQT
FT                   INNLTSDLHDSLVLTKLVNRLIYEVTLNPDHPMNKKGNLYYLTPIYNKPTFKLQKLENL
FT                   QDLLKFLNMILSINVTSISPENIFDGNLKLTLGLVWSLFIFNTSSVFPGTPTYSGIKTT
FT                   LLKWINGILTDTSIRNFSKDWANEPEIILCEIISNYDPNIPRGISLSKLLDYLEESIAF
FT                   PKLIEPDDFQYNDEKCMIVFLVELYKIFEIEKSYNNVTVDNRFRFDEIIKATVEMFKLK
FT                   SQYESDALKLSNQLNTLINQLSLDISDLKDDFTMDILSCLQLLEDSLLDSTKLSHFQKN
FT                   FDCLNIKLTSLVNILQRFQNFRFEIKSDLVYQSYPQIIQTLGSIKSMLGLFGDIDYIPA
FT                   SKTLNIDPISTKLEQLITLDSLILAEITEVILNTNSEELFAKLNKLKQVKTKHKLVKVE
FT                   CETTIEYFLGFFHKLEMFESSLQTTLPMKYFEACDLPDFNNITPELFDQFKTVILRHNN
FT                   CHHDKLFRVLQEQLVPSDFSNTTLEFFTRLIPIKVSPISSNNDSSFDLTSSTSTDEGDD
FT                   IFDELQQKLDFHLSLTNNKVYDIQEFIRRFENGFKL"
FT   CDS_pept        complement(1040459..1041448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233021" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568309"
FT                   /orf_name="CD36_19500"
FT                   /product="Casein kinase II subunit alpha', putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX43730.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192DA46"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBF9"
FT                   /transl_table=12
FT                   /translation="MISSKSRPYSIARVYADVNENKPTEYWDYENHKIQWGLIKNYEIV
FT                   SKIGRGKYSEVFQGVNVLNDEPCVIKVLKPVKLKKIYREVKILQNLTGGPNIIGLLDVV
FT                   RDEQSKIPAFIFERVNNVDFRVLYPKFTIKDIQYYFTQLLIALDYSHSMGIIHRDVKPQ
FT                   NIMIDPMNKKLRLIDWGLAEFYHAGMDYNVRVASRYHKGPELLINLQQYDYSLDLWSVG
FT                   CMLGAIIFKKEPLFRGDSNNDQLVQIAKVLGTENLMKYVNKYGIKLSSEYDDILGNYPR
FT                   KPWRAFINNDNRHLISDEVLDLIDRLLTYDHQLRPTAKEAMEHPFFKI"
FT   CDS_pept        1041874..1042686
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228420"
FT                   /orf_name="CD36_19510"
FT                   /product="Mitochondrial morphogenesis protein, putative "
FT                   /protein_id="CAX43731.1"
FT                   /db_xref="HOGENOM:HBG396264"
FT                   /db_xref="UniParc:UPI000192DA47"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG0"
FT                   /transl_table=12
FT                   /translation="MNYLTTIQLHESKRNVINDIQLWSMNKTLKLPSITSCNPISYIKH
FT                   VSLPLYLVYCCPITVYTDDPDTSDYFKTRLVETPLSNGKSGVGLLCQVDSNTFLVFYYE
FT                   DNVKVLVLSFSKFLETLPQLDIQSIPKNTLLDLRPPKRIRTNTTIIDKIIEKKKQRSNS
FT                   FIANPNTTKGNTSSSSSVLTNQEQINTAINKIIFSGLRIRGLSSNVASSLNDKLTIKEI
FT                   HQMTFKATQFALRKHNYSFNKRETKKPLRLNDLQDIIENLLQLFVDVE"
FT   CDS_pept        complement(1042730..1043581)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534069"
FT                   /orf_name="CD36_19520"
FT                   /product="Large subunit ribosomal protein, mitochondrial,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAX43732.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG396265"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniParc:UPI000192DA48"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG1"
FT                   /transl_table=12
FT                   /translation="MFSLPSLTQKLGISKASFLTPIRQLGALGYLKPHEGSTFNYKRLG
FT                   RGQSSGKGKTAGRGQKGQKARSKVPWWFEGGQTPYYKRFPITGFRKPYQTVLEEVNLSK
FT                   IQDFWDNGRIPLQKGETLNIKVMKECGLVTGSLKDGVKILGKGVKNYNVPLNIEASRAS
FT                   DIAIEAIEKSGNSFTARYFTRLGLRAHVNPEQFLLKRGYVPLQARPTHKRDIEFYSNPD
FT                   KRGYLQKDRSILLDPLEKAREELTNKKPTKKLSKFKSLEEQLEEASTFSYKPSKTVSVM
FT                   DV"
FT   tRNA            1044183..1044255
FT                   /gene_name="tRNA-Thr (AGT)"
FT   tRNA            1044281..1044353
FT                   /gene_name="tRNA-Thr (AGT)"
FT   CDS_pept        1044780..1045229
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228421"
FT                   /orf_name="CD36_19530"
FT                   /product="Early meiotic induction protein, putative "
FT                   /protein_id="CAX43733.1"
FT                   /db_xref="HOGENOM:HBG396266"
FT                   /db_xref="InterPro:IPR021475"
FT                   /db_xref="UniParc:UPI000192DA49"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG2"
FT                   /transl_table=12
FT                   /translation="MGKDDKELEEIWKLFQDSNEDVQKRRKEITKAIQKDTNLNEYPGS
FT                   VSLMTALDELIACFALGGQVKNYYRYGTYDSCTRQREKFWFAIKHGSFREQEERPLEEL
FT                   SERELTNRIKVQEFYKKRFLEDKAKGSSEDIWDKREELLSNPFKK"
FT   CDS_pept        join(complement(1046009..1046039),
FT                   complement(1045317..1045918))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228422"
FT                   /orf_name="CD36_19540"
FT                   /product="Protein rho3, putative"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43734.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00006797CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG3"
FT                   /transl_table=12
FT                   /translation="MPLCGGGQKTIQRKIVILGDGACGKTSLLNVFTRGYFPQVYEPTV
FT                   FENYVHDIFIDGQSVQLSLWDTAGQEEFDRLRSLSYSDTHCIMLCFSVDSPDSLENVQS
FT                   KWVGEIADHCEGVKLVLVALKCDLRNNEDIEDQQQSNPYSSQKRLITYEEGLAVAKKVG
FT                   ALRYLECSAKKNKGVNEAFSEAARCALNAKPKGANDNEPQKKGCVVM"
FT   CDS_pept        complement(1046542..1047411)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568310"
FT                   /orf_name="CD36_19550"
FT                   /product="Hypothetical membrane protein, conserved "
FT                   /protein_id="CAX43735.1"
FT                   /db_xref="HOGENOM:HBG396268"
FT                   /db_xref="UniParc:UPI000192DA4A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG4"
FT                   /transl_table=12
FT                   /translation="MPMNDNVVILTLEAANRITRLKRADSTTSAEAMPTLSDPNAYTTP
FT                   SISVPPNNNNPFIIRQSNPSGTVFIAVGAIVGAILLGFILYHLIISLTASKLAKKSNAD
FT                   DRKLYEKYQSNNTNAYGYSGVTPQTSLNNFTSDYGGSVSKLPLLNKSFANVNGSQAGDN
FT                   STIYQSEVGAAVTSKHDLTKMFVSPTAEVMQHKRIRSSHYNPSLSNLSFGGSTSNLVNP
FT                   APATNRHSQAVPNLYINQEVNNSDYSLSQHGSVTASQQQQQQQQQLNTPANRKTLPSMY
FT                   LEDLIDKE"
FT   CDS_pept        complement(1047712..1049139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077021"
FT                   /orf_name="CD36_19560"
FT                   /product="Glucose n-acetyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX43736.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG396269"
FT                   /db_xref="UniParc:UPI000192DA4B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG5"
FT                   /transl_table=12
FT                   /translation="MLYKNNTRSLTIQMTLKGSSWKALLKNWEFKVAAFIGIYFLVSHV
FT                   LLETTDVVKEKGLKSHLKVLPEEVIDYYGKQPFSNVDNYAYMQYATNYDYLNLAIINFI
FT                   HLRKANTEIPNLVIIYDEVLHYYASDKWSELYQVANKYKITLKSAPLIKANYQDESNWA
FT                   ASFTKFHIFNQVEYDRIVFFDSDSMLVDIPDVIDFENMESKFNHIDELFKIPRELSFAS
FT                   PQAYWLNNVVEGKSPKPRKNVEIPNKKRYSLRMKKLVNDLSIYQDFNLLPSLIYENHYF
FT                   DNANHFFANHIMVLTPSKKIFQELMRYVHNPWWWSITNRGNLKKPNDYDMEILNKFLSN
FT                   ELRRKRINVGILPHRVYGVLTGEFGEEWHERFVVEPQYLPFINKKSNKGWSPLEFFKKI
FT                   KVVHFSDSPIPKPWEEESNEEHYNTKKIYCAKGDMEKYHRDYPVYKPRLTDDCDSVSIW
FT                   NWFREQFYRERSGYWFA"
FT   CDS_pept        complement(1049780..1050178)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381233"
FT                   /orf_name="CD36_19570"
FT                   /product="Sulfiredoxin, putative"
FT                   /EC_number="1.8.98.2"
FT                   /function="DNA binding"
FT                   /function="sulfiredoxin activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43737.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0032542"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG599373"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="UniParc:UPI000192DA4C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG6"
FT                   /transl_table=12
FT                   /translation="MSMYTSRLATEYVPLSEIKRPIPPVLDYQKIDAMLSTLKGVPMES
FT                   ATCKVEDITAGELPPIDVFKIRENGKNFYFAFGGCHRFQAYDRISKETEKEVMVKSRIL
FT                   PATRKSLRIYLGASVDALFDSVDSGASN"
FT   CDS_pept        1051133..1053382
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568311"
FT                   /orf_name="CD36_19580"
FT                   /product="Ferric reductase transmembrane component,
FT                   putative"
FT                   /EC_number="1.16.1.7"
FT                   /function="electron carrier activity"
FT                   /function="ferric-chelate reductase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX43738.1"
FT                   /db_xref="GO:0000293"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396930"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI000192DA4D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG7"
FT                   /transl_table=12
FT                   /translation="MYYSAICISVAIAIVLLPFLIPIRLKNPVCRKIKASLIVGLIISI
FT                   LAAVAPETAQIGAPFHKYGRSKIAFFGCNYQIMLTTARFCPSNATFEWCYCNNFPAFAT
FT                   LAHCYQVGHPKEIESLISMCKPFNKTITMSTVNHAEEYYKNHAKPVDEFHKLPNYSQID
FT                   FPVQLNESEVFIFKQSYEQFLGNYDESVDYGWYLVLYWVVVLAVVSVGNWSKIIFPNFT
FT                   KSLTDPVSNWYRKHISTPATGSRNKTKELHIARGFDMLAPSRFETIILTGMTVLCLKFF
FT                   IGDFQYAENNPLFHSKTNALLRFYGVRSGLLASALMPLLILFAGRNNFLQWMTRWDYST
FT                   FVMFHRWISRIIVALSLVHTVCYTLYLKQHSKKPEAYIYWGFTAMVAGLIILVQGLLVL
FT                   RRRWYELFLILHIILAVVFIGGAWMHVEALYCVWFYYTSAAIWAFDRIIRICRLISFGF
FT                   PKAQVYLLPDETLKVIVPKPDNWEAVPGGHAFIHFLKFDCFWQSHPFTYTTSEKDIALF
FT                   IKVKKGVTLSLFRYLKSKENCFASIRVAIEGSYGESTPAKNADMAVFIAGGNGIPGIFA
FT                   EALDINRHQESKHKVKLIWVVREYNSLLWFYEELMSLKNTEIKTTIYITRPGILVDEDD
FT                   FKKRMQGISQGMENELQPLLQKSVPASYNSEPVNSTDGILNKIKEELFHIKMIEGRPNI
FT                   EKVIETCIEESSGSACFVTCGHPAMVDDIRVAVANNIDNKEGKRVDYYEQLQVWA"
FT   CDS_pept        complement(1053698..1054684)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568312"
FT                   /orf_name="CD36_19590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43739.1"
FT                   /db_xref="HOGENOM:HBG396270"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI000192DA4E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG8"
FT                   /transl_table=12
FT                   /translation="MAKKKSRSGLLKAPKTITGKHGIPKSLKPQRAREIIRRFHVLQKS
FT                   KDSVLAKLQKIISQISKTDYHQVEEMSTYQEAFKGFVLPLKYSENPIYKIDNTLNKNDL
FT                   IKILACIDAEIKQRGGIEAYQSASTQGQAGKRGGDSSKKLVEWLKSDLYKQKLQHVNAL
FT                   EIGCLSPYNAISTSSIFEDVVRIDLNSQNSLILEQNFMDRPIPQKESEKFNLISCSLVL
FT                   NFVPSPKERGEMLLRITKFLKNPKKSMSALFLVLPLPCVSNSRYFDSKKLIELMTVLGF
FT                   TQTFSYEGNKVVYWLFDWNGKVNLKKKFCKKELHSGSNRNNFCITLA"
FT   CDS_pept        1054888..1057164
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000290702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568313"
FT                   /orf_name="CD36_19600"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX43740.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192DA4F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WBG9"
FT                   /transl_table=12
FT                   /translation="MVKQGKKKVSKPRKPPTLKQKLKKESKVVKAKDLQWKPVDIPDNL
FT                   GDYEGFYGLEEIDGVDVQIVNGKTEFIVRDKGRVVDDSKKDEDHMDVEENETPEIEDEK
FT                   PTEQDEEEFFGFDDDENDQENDNSTEGVSNNNKEYELAETNNVLNAVSFANLDLPLPDD
FT                   NEINLPNWQEGDLGSSISAYTLYGLSQLNFKKPTPIQKETIPIALSGKDVIGKATTGSG
FT                   KTLAYGIPILEKYIQSLNLIKQNNKDNKINHPTGIIFAPTRELAHQVVDHLNSLAKYSP
FT                   LSTRGIVSITGGLSIQKQQRLLRHGPGIIVATPGRMLELIQGDSELAKRLASTDIIVLD
FT                   EADRLLQDGHFDEFEKILELFGKNRPENKSIEWKWQTLVFSATFSRDLFRKLDRHQKGK
FT                   SSSLMGNDEIVQLLNEKLKFKDKKPTLIDANPKEIVSGQITEALVECGPTERDLYLYYF
FT                   LLMYKGSTLVFANSIDSVKRLVPLLNNLNIPAFSIHSSMIQKQRLRALEKFKEASQKNE
FT                   VSVLVASDVAARGLDIPNIDHVVHYHLPRSADVYIHRSGRTARAGKEGVSVMFCSPQEA
FT                   SGPLRKLRRLVASNSNKESRLNMHNDVKLLPIEMDLVSQIKPRVEISSKLADASISSTA
FT                   TRKEDSWVKQAAEDLGVEDLSGLEDFEDDIIKKQRKRKEGKMLSKEETKALRYELKSLL
FT                   ANPIKKNARKSYITSGLQNLAHQMVTGAHHDDVLGHEKVNALSDLKGSKNKIKKIEKKR
FT                   ISKKK"
FT   CDS_pept        complement(1057298..1058608)
FT