(data stored in ACNUC8465 zone)

HOGENOMDNA: CANDC_3

ID   CANDC_3; SV 1; linear; genomic DNA; GRV; FUN; 1863824 BP.
XX
AC   FM992690_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
DE   chromosome 3, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; mitosporic Saccharomycetales; Candida.
XX
RN   [1]
RX   PUBMED; 19745113.
RA   Jackson A.P., Gamble J.A., Yeomans T., Moran G.P., Saunders D., Harris
RA   D., Aslett M., Barrell J.F., Butler G., Citiulo F., Coleman D.C., de
RA   Groot P.W.J., Goodwin T.J., Quail M.A., McQuillan J., Munro C.A., Pain
RA   A., Poulter R.T., Rajandream M.A., Renauld H., Spiering M.J., Tivey A.,
RA   Gow N.A.R., Barrell B., Sullivan D.J., Berriman M.
RT   "Comparative genomics of the fungal pathogens Candida dubliniensis and
RT   Candida albicans.";
RL   Genome Res. 19:2231-2244(2009).
XX
CC   This Genome Reviews entry was created from entry FM992690.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1863824
FT                   /organism="Candida dubliniensis"
FT                   /strain="CD36 = CBS 7987 = NCPF 3949 = NRRL Y-17841"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 3"
FT                   /db_xref="taxon:573826"
FT   CDS_pept        join(complement(4930..7974),complement(3834..4952))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   mobile_element  10697..10943
FT                   /mobile_element_type="retrotransposon:solo LTR, iota J"
FT                   /note="(subtelomeric)"
FT   mobile_element  11446..14040
FT                   /mobile_element_type="retrotransposon:Tcd21-like, LTR"
FT                   /note="Gag & PR ORFs + duplicated fragment, (subtelomeric)"
FT   CDS_pept        12869..13516
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229712"
FT                   /orf_name="CD36_80040"
FT                   /product="Retrotransposon tca3 polyprotein, putative "
FT                   /protein_id="CAX42537.1"
FT                   /db_xref="HOGENOM:HBG398458"
FT                   /db_xref="UniParc:UPI000192D82C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCY8"
FT                   /transl_table=12
FT                   /translation="MNPTRSTLMLIFLSFLLQSKTTMTSMRLSSSTSMILISLRSIAYV
FT                   FILDMGRSNLKIILDTGAANNFAPVSIGTYYKDAKIFQLKNIIRVKTADGTIHEITQGC
FT                   KIMLPPPFRTTYLVNEFGWKEGQLSQSSLLQDLHDDVQVRLAELDGVNTNVEKHNDLRV
FT                   RRMAYINSMRQPFQKSASFMKGDWILLFSITVHLPGRPLSIIPQSGYSCQQN"
FT   CDS_pept        13552..14049
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573459"
FT                   /orf_name="CD36_80050"
FT                   /product="Retrotransposon-related protein, putative "
FT                   /protein_id="CAX42538.1"
FT                   /db_xref="HOGENOM:HBG398465"
FT                   /db_xref="UniParc:UPI000192D82D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCY9"
FT                   /transl_table=12
FT                   /translation="MKTLNQFASRYEQQTAQGINQTREQEARDFQKFNSAGMKLESHVQ
FT                   DVEHETHELEKEVGAFEEAYNKRVRFEDERFQQASNVMAQAQNKELDLQTQITALKEQM
FT                   ETFSTTQPAAASTGPKSSFVTTENIATQIKRIFPQADLTNNDWNQPTNEFPPFMDFKIL
FT                   LC"
FT   CDS_pept        complement(13975..14571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078278"
FT                   /orf_name="CD36_80060"
FT                   /product="Retrotransposon-related protein, putative "
FT                   /protein_id="CAX42539.1"
FT                   /db_xref="UniParc:UPI000192D82E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ0"
FT                   /transl_table=12
FT                   /translation="MAIESHLEKYPDVQVDKNKYKVVVKNNHHDNIGIYRFLHPAEEWK
FT                   VETLIHAFFDNKSDEWMPALKQAANITTTEENIEFSILKSEVNNADEFTKQPLKAGKYA
FT                   TSYFMIGWSGNNVPKKSRYFWKHHKLDLVSIAKYCTTSPTLFHTRWSCKHGNHCFRCNQ
FT                   NGHATGNHFNNLAKQDFEIHKRWEFVCRLIPIVVG"
FT   mobile_element  complement(14059..14944)
FT                   /mobile_element_type="LINE:3A, Zorro1-like"
FT                   /note="partial ORF1 (subtelomeric)"
FT   CDS_pept        complement(14561..15004)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573460"
FT                   /orf_name="CD36_80070"
FT                   /product="Retrotransposon-related protein, putative "
FT                   /protein_id="CAX42540.1"
FT                   /db_xref="HOGENOM:HBG398325"
FT                   /db_xref="UniParc:UPI000192D82F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ1"
FT                   /transl_table=12
FT                   /translation="MEPHANTDRELEELENMVNYVKSIGASQWPVMLNRLDCASKAFIR
FT                   ECVSDMVTDQYTGDHTNVVDERDSDGGYFEQQEVIKVHLKKTIPDKIREQGVNSDMEKA
FT                   LLYAAEKDLFRVRFMTDGTYRIIYSQTGGKFSDMFPNLDTNGY"
FT   CDS_pept        17643..18050
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573461"
FT                   /orf_name="CD36_80110"
FT                   /product="Ribosomal protein, small (40S)subunit, putative "
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42541.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316677"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniParc:UPI000042C316"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ2"
FT                   /transl_table=12
FT                   /translation="MSDAVTIRTRKVISNPLLARRQFVIDVLHPNRANVSKDELREKLA
FT                   EIYKAEKDAVSVFGFRTQFGGGKSTGFGLIYQSVADAKRFEPAYRLVRYGLAEKVEKAS
FT                   RQQRKQKKNRDKKIFGTQRRAQKRAARRNAD"
FT   CDS_pept        18078..18851
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573462"
FT                   /orf_name="CD36_80120"
FT                   /product="Component of spliceosome involved in mRNA
FT                   splicing, putative"
FT                   /protein_id="CAX42542.1"
FT                   /db_xref="HOGENOM:HBG398498"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniParc:UPI000192D830"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ3"
FT                   /transl_table=12
FT                   /translation="MYSRYQKKKKEKFVDKKKKKKVFSSSSMSERKAINKWYPPDYDPS
FT                   KVPKRKKNASSTIKIRMMAPYSMRCLKCDEYIGARRSFNARKEITNEKYLNIKIIRFYI
FT                   SCPGCNNTITFKTDPKNAGYTPEEGAVRNYEKTTKKESEDDLLARLEKEEQEDKKYQLL
FT                   KSKRKNNPFWNEQTVGMENLEKRLQEQHKQQLLNEQLEAIQTKASIDKDKLEEKAREKL
FT                   QVKINRPTTKHRLPIPTTIKLPKKPKLVNYSSDSD"
FT   CDS_pept        complement(18848..21307)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093791" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573463"
FT                   /orf_name="CD36_80130"
FT                   /product="Exocyst complex component, putative "
FT                   /protein_id="CAX42543.1"
FT                   /db_xref="HOGENOM:HBG398499"
FT                   /db_xref="InterPro:IPR010326"
FT                   /db_xref="UniParc:UPI000192D831"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ4"
FT                   /transl_table=12
FT                   /translation="MSDSTLSKISELIKLEDDLAKIGSIRQQFLKEKSSVDVKLSSTTQ
FT                   VQIDSIMKNLANLNNTMERLDSIKGGIGEVQQVHDRTIGEVREYDTIKKMTMVNQFLHQ
FT                   VGSLYEDISGFKSFLNKLNEMIQGELEELQNDLTYPLPNFVRIHHAYTQARNFVDYLEV
FT                   YSTSLSDDLQSIVYKVVSPIKKTIKLFDELLNEGVQSLTEVTKEGNFECFFKIIAAVTW
FT                   EENEDLKVSLMKSLDMVESDPKTVNYKTFRGRCRNYKKFFFDKLRAHLHEIFDSCVEYY
FT                   GNDKILVYDGLYWLEDEMRFVYTTLDKLFPGNWGVSGFIQDVYYNRLHDFTMDLISADP
FT                   PAEDLLKILSYDSRYGSFVSEFGVKQKSIIGEELKGNVLDDYLKNITTKMREWNDNLIR
FT                   QETKTFTERPNAPDIYPIESTIEDLDANKNEVQLTIELNVYVMPDFKIALTMLKEQADV
FT                   AAESKYSRILVEVIESWSECYVKRIANFREVVEDEMDRYMSVFNNEKYLIKESKAKRLF
FT                   RKKPPVVDLDNLSPEEQSKLSREGLIEYLAALANSLDISDDIMNDKFAPGYKEKVHTNY
FT                   HARIGKAFDVASESSNALISEVLSAITDIIMNDLTPALCKLFTKKWYEDGHSQTGEPTI
FT                   AELVVETISEYMGEMRQYCVYPVYQLLFVIFLDNFIPTYIRIGYENVLHGDGKKIDPKA
FT                   TKKYKSFSEGITRDIEVFFSGLDPLFTRKDGEYFFASLNAIELLSVLGECEVENVKDVW
FT                   QHEVLPKFYDCSVEYIRGVCLCRKDMDKSQVKQLVPQLQEIKDQYHQEVQPPDVPIFTL
FT                   NDFEFQD"
FT   CDS_pept        complement(21382..23145)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573464"
FT                   /orf_name="CD36_80140"
FT                   /product="mRNA polyadenylation regulating protein, putative"
FT                   /protein_id="CAX42544.1"
FT                   /db_xref="HOGENOM:HBG396596"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniParc:UPI000192D832"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ5"
FT                   /transl_table=12
FT                   /translation="MKGQSNRASNVKNGHRRSNSRFANDDKRLVYLMSKAMGKKCIATI
FT                   TDGSRYQGLLVGSDLSQGSPLSVVLLKPQLVGASLLNEKNNLDKLPENLIIQAKDLIDL
FT                   EVDVDVGEEIKAPPEFKTDADISGKTQIKERELERWVPEDEIEMTLEDDGSEWDQFKVN
FT                   QEKFGVESTYDEHLYTTRIDTSAPDYQDRVAKAERIAKEIEQQATTDRHILEERGVIVD
FT                   DSGVDEEDKYSGVDRRGDELMAALRNASISKPAQQGATTHQHHDPAIVSSLKQKKPDSI
FT                   PPKPPVPNESFRLNAQSEINSLREFSANFKIPHKMPQDLLPILAKDKMKQDEILKKQQQ
FT                   QQQQQQIKKEPKTYKLNPKAAVFTPSSKHATITSPPSFKKSPRPYSNGNVKKHYQISAA
FT                   DFFGGIGRVPTKEGQIKKVGEFKFGFNMFVTTRRKHKDGPVVYEKSFQTPPTWTSTVDV
FT                   SHDKLFSARAVAPSQFVPSPMVAPGPIPYVNKFAMSPQQQQAAAAAAMVVQMQQQQQQQ
FT                   QQQQQQQQQQYAMMYQQQFVPQMPVFYGDPTFYPPQGFVPPPAQFGNPNMMMGNPYQYQ
FT                   GRRYSKKGGQH"
FT   CDS_pept        complement(23259..24716)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573465"
FT                   /orf_name="CD36_80150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42545.1"
FT                   /db_xref="HOGENOM:HBG396706"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="UniParc:UPI000192D833"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ6"
FT                   /transl_table=12
FT                   /translation="MCTNIIAVFLAEFDIRSGYKLVWSKAEVPGFEFDGLEYKVLPSGI
FT                   HEYGESTVLLSHWHEGRVYYGMSRYYQYVIGNDSTDRSNVKMFALGILCDPGSSVWKPN
FT                   EFIRNGWEYVEEVHQKLVKFVHSREYTDFAKLQDIPKVTPNINNHLLTNLPEMFRTLGP
FT                   LVFVLYKQSLLRKRILLFNQRSRSHDDQDILPNGVDNLYNISSFCYLISLLSVVPQEID
FT                   FISQTSVPTYSQPVYQIGLTDMAGELIKLKGYIGSTNDDILKESPVYDIGVVIDEWARV
FT                   FDYEQRPIKATNKDYDKFVLIYSELPRSDGVTNDTDISADDLSSIRTDTWKTFDGECVA
FT                   QDMPEWWKTEATEPVSWTESIWSAFSWFATAGQQLEGSPQPPPHVQDKVDLVDLVNIVG
FT                   YFHKLTKKWFYIINEVVLEVLDDQACTDEQPLTERISLELTYQDVVEMELDPYSSADLE
FT                   FIKEFILLYWEVVDSVDIGMGLNNICC"
FT   CDS_pept        complement(24771..25118)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208407" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382580"
FT                   /orf_name="CD36_80160"
FT                   /product="Vacuolar transporter chaperone (VTC), putative "
FT                   /protein_id="CAX42546.1"
FT                   /db_xref="HOGENOM:HBG333094"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI000042CEE3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ7"
FT                   /transl_table=12
FT                   /translation="MSSTNKRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLN
FT                   FGDYVGRISAGLFTFIAMLTMVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCIFLLVA
FT                   VVVNFILRIRA"
FT   CDS_pept        complement(25275..27071)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000219146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573466"
FT                   /orf_name="CD36_80170"
FT                   /product="Allantoinase, putative"
FT                   /EC_number="3.5.2.5"
FT                   /function="allantoinase activity"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /function="zinc ion binding"
FT                   /biological_process="allantoin catabolic process "
FT                   /protein_id="CAX42547.1"
FT                   /db_xref="GO:0000256"
FT                   /db_xref="GO:0004038"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG724623"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI000192D8EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ8"
FT                   /transl_table=12
FT                   /translation="MSRALSSTRVLINDTLLPATIIFSVESGTILEVVDRVLPPSDPIL
FT                   TSYNVFPIDYRNVTPSVIMPGLVDAHVHLNEPGRTEWEGFETGTKAAASGGVTTVIDMP
FT                   LNAIPPTTTVANFNLKINAAKGQTWVDVGFWGGLIPDNLYDLKPLIRMGVRGFKAFLIE
FT                   SGVDEFPAITPAHIVAAMKEVKDEKTLLMFHAEMQPQDKRKAQFSIAEEDEEGDFSNSA
FT                   DTLTADIEDFNLGMSASFIHRAPTPVVKLLSTDHGDHHHEHENCRLPHNHAGSINPSVL
FT                   SDEQAKALAHTPILAGAEPTFGKYARKVNTRHSRSYSYTEEDSNTPLLLAQQENAKLAN
FT                   IDPTAYATFLASRPDNFETTAIAEIINCSTLMPTVPLHIVHLATHEAVPLLRAAKAKGL
FT                   PVSAETCFHYLSLCAERIGNCSTHFKCCPPIRTDDNRRLLWKALRNGVITTVVSDHSPC
FT                   TPDLKGMEKGDFFEAWGGISSVGFGLPILYTEGLKLDPPISLAEINKWCSLNTAKQVGL
FT                   SHCKGTIRVGYHADLLIFDTDTKYTVENKETFFKNKLTAYDGMEFQGRVLETLVRGNTV
FT                   YAMGRGFSVAPMGNLILEPRLE"
FT   CDS_pept        complement(27198..28346)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229713"
FT                   /orf_name="CD36_80180"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42548.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D8EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WCZ9"
FT                   /transl_table=12
FT                   /translation="MYSLLKRPSLLATHQFRTMITAQAVLYSQHGEPKDVLFTQKFEID
FT                   DDHLTPNQVVVKTLASPVNPSDINQIQGVYPSKPEKTTAFGTSQPAAPCGNEGLFEVLK
FT                   VGDNVKGLEVGDWVIPANVNFGTWRTHALGEEQDFIQLPNPTQSRTSGKPYGLSLNQGA
FT                   TISVNPMTAYLMLTHYVKLTPGKDWFIQNGGNSAVGKYASQVGKLLNFNSISVIRDRPN
FT                   LEEVVGELKGLGATQVITEEQNNSKEFGPTIKGWIKESGGEAKLALNCVGGKSSTGIAR
FT                   KLNNNGLMLTYGGMSFQPVTIPTSLHIFKNFTSAGFWVTELLKHNRELKLKTLNQIIEW
FT                   YESGQLKDAKSNETKFDGSKELHELYKDGVANSKAGKQLITY"
FT   CDS_pept        complement(28421..29149)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573467"
FT                   /orf_name="CD36_80190"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42549.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396904"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000192D8ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD00"
FT                   /transl_table=12
FT                   /translation="MRSNPLIYINRANTPKKKNFFFSTTFPPAMSALQSLNAQYLAYII
FT                   KYPLLTKSITSGVFSGLNETVASVITNEFKETKIAGIKIKHVFTEKLLTMIIYGSCIAT
FT                   PISHYMYFIINSKIFKGPLTKSGKILQILTSLSTVTPTLAACFVSWIALINNYKLPKGT
FT                   IDPVTELNKVVAIVRAGLKKGYFGVLKSSLVTSSIALVIAQKFVPPELWVVFFNVVYFF
FT                   LGTYQNTKLKRLQKQQRLSK"
FT   CDS_pept        29853..31742
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573468"
FT                   /orf_name="CD36_80200"
FT                   /product="Myo-inositol transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42550.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D8EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD01"
FT                   /transl_table=12
FT                   /translation="MATTTKPTANDDLFENSSSSSSVPHNKEVSELESVNSAAEREGGE
FT                   HGNILAQYTEEQVMQMGRNYAHKYDLDPDLFGRAAVLARAPSAFNSMSFLTDEEKQGLY
FT                   LEATKKWHIPRKLIEVIAVGAIAAATQGMDESTISGATLFYPKAFGVTEMKNADLIEGL
FT                   VNSAPYLCCSVIACWTSDYWNRHLGRKWTIFWTCLISAVTCIWQGFVNNWWHLFIARFF
FT                   LGFGIGVKSATVPAYAAECTPKHVRGALVMLWQFFTAVGIMFGFVSALAFYYVPHKSFG
FT                   TGLNWRLMLGSACIPPIIVLFQIPFVPESPRWLMGKDRHKEAFESLKALRFEEIAAARD
FT                   CFYQYVLLKEEGTYDIPTWKRLIQMFAIRRNRNGAIGSWIVMFMQQFCGINVIAYYASS
FT                   IFIKARYSEVSALLASWGFGMINFVFAIPAFLTIDKFGRRNLLLFSFPLMGVFLLIAGF
FT                   GFLIHDRKGQLAMVTTGIYIFSAIYSSSEGPVPFTYSAEAFPLYIRDLGMSWATATCWF
FT                   FNFILAFTWPRLQNAFTPTGAFGWYAAWNVIGFFLVLWFLPETKGLTLEELDDVFAVPM
FT                   YEHAVYRTKELLNGFQRYILRRNIPPMPPLYHHQRMAVTNPEWNDKTEVDHIE"
FT   CDS_pept        complement(31795..33168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573469"
FT                   /orf_name="CD36_80210"
FT                   /product="ADP-ribosylation factor GTPase-activating protein
FT                   (ARF GAP), putative"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="CAX42551.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG736886"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI000192D8EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD02"
FT                   /transl_table=12
FT                   /translation="MSDTIATKEEASKIFDRLKKDPANQVCFDCSNKNPTWTSIPFGIF
FT                   LCLQCSAVHRNLGVHISFVKSSNLDSWQRIQLRNFKFGGNQQAKDFFLKNGGSQFVNNK
FT                   NGVDATAKYTSPCANKYKEKLKQKAAQDAAKHPDVVTLEDVTDVLSLSDSPSESTDDFF
FT                   SNWNKPVNNSNTASPLSSRAATPNASTDDLTKKKTVVRTTTTSARLKSTNSAAKKSILS
FT                   SKGNGPRNSRLAAKRINKTDEDIDFDEIEKKAKQEAEEAKKLGYKPTEPVAAVEPKKQP
FT                   TTSSLSLKKENDEVKLTPAPIQETTQQFQKLGFGMTQGDNIVGSGGTAKKYKEVKYTGE
FT                   VSNKYGSQKGISSDEFFGRGPRFDEQAKAEAKTKLQAFNGAQSISSSSYFGEEEGGSGG
FT                   VRGGRSNSGVGGLSDLEASAREFASKFSGNANQDLEVLKDALEDGATKLGSYLRDFLR"
FT   CDS_pept        complement(33335..34615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573470"
FT                   /orf_name="CD36_80220"
FT                   /product="Import inner membrane translocase subunit,
FT                   mitochondrial, putative"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial inner membrane
FT                   presequence translocase complex"
FT                   /protein_id="CAX42552.1"
FT                   /db_xref="GO:0005744"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG396560"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="UniParc:UPI000192D8F0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD03"
FT                   /transl_table=12
FT                   /translation="MLRSGIIKKQPATAIIRPLISARCFHYTNVNLNDKPPSSDSPLKV
FT                   FFDTFKTEVKKSNELKENIKALQDESGRMAESEAFKRAKEAYAKAQLGSTAAGKVLKKG
FT                   AETVGDAAYKAWESPVGKGVRTSVRVTADVADKAFEPVRKTQVYKDMSEVIDDGSSTAY
FT                   GGFLTKEQREALRKKELERKKKQGFQGPVKENEEAGGALVATEHKATGPTVGEKWENFK
FT                   LKSPIGRGVVYLQEKWEESENGLIALIRTIVEKVTGFFSETEQAKVVKQLKLMDPSFRL
FT                   TDFQRTLTNYIVPEVVDAYIKNDAKVLKEWLSEAPYNVWEANNKQFIQQGLFSDSRVLD
FT                   IRGVDIVTCKSLQPNDVPVIVVSCRAQEIHLYRKAKTGEIAAGTEDHIQLSTYAMVLTR
FT                   IPEEFDNKVTDGWKIVEFARGGSRPFH"
FT   CDS_pept        complement(34742..36112)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251788" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573471"
FT                   /orf_name="CD36_80230"
FT                   /product="Kynurenine 3-monooxygenase, putative "
FT                   /EC_number="1.14.13.9"
FT                   /function="kynurenine 3-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42553.1"
FT                   /db_xref="GO:0004502"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG430104"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000192D8F1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD04"
FT                   /transl_table=12
FT                   /translation="MSEEDSEKTIGIVGAGLVGCLAALAFAKKGYDVTLFEYRPDPRTV
FT                   DSSQRNLRSINLAVSSRGIRALQYVDPAMADRILEHVIPMKGRMIHDITGTKQESQVYG
FT                   LNGESINSIDRSFLNNCLLDELDKSNVKVLFGHKLVKLDTSNTSRMTFIDAHNDAKTST
FT                   FDFIVGCDGAHSQFRYHLQKTMRMDYSQKYIDMQYLELYIPPSEDPDNKFSIDANHLHI
FT                   WPRHNFMLIALANKDGSFTSTFFSPWSVIEDISSSEEFVEFFRRNFPDAVGLIGEDALS
FT                   SAFKSNPRGSLMQVSCYPYSNGKGIILGDAAHSMVPFYGQGMNCGFEDVRILMELIDTN
FT                   NGDIEEAFTQYSASRKKDLDAICKLALDNYYEMSSKVVDIGYLIKKKLDYSLGKIFKNK
FT                   WLPLYTMISFRDDIPYAKAIEIEKRQNCILNNVGLGVLGTAAVYGLVKLGQFLNRRQ"
FT   CDS_pept        complement(36247..37773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093795" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535361"
FT                   /orf_name="CD36_80240"
FT                   /product="GTPase activating protein (GAP), putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42554.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG396571"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000192D8F2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD05"
FT                   /transl_table=12
FT                   /translation="MSQESSPPPPLPARKSVDSAAEKISIETEASKKLPDLPPAANANQ
FT                   RISFDLNDSVSQISAVRQWELYTSLQLNETSDLFVNNSIGQNTIRSKLNELEVEDGDTN
FT                   TKFWIDIVNDYTNSILLNKKINKLEEKVLAGVPSNIRYLVYLKTLLVRQKLNSRETFSS
FT                   LLTKSRQLRDEYIESLNVDSRVKEVLIVFNYYINEMTNSKFEIESEESSEVMQFPISRF
FT                   IINVCILLGTFPDASQEDVLYLLLKFNKLYTCLNKDEFFYKVSRSLEEDLPDIFKHISV
FT                   QGINLNSLFRGILVQLFSSELLDEEICLRVLDFVVFEGFDFVLRLILYMFRRNLEKIKE
FT                   LDGDALLEFLSCPEFVSEVQFDFKEVLAEEPSVIQYENEFYLINANSMNNNSNELTNLK
FT                   EVNDELVVKINDLRRKIDSLQATHYEISDQSEQYTKDLSEAEIENQKLLKRQAELQEKY
FT                   QNLTMAENLSNTIKANQEFSQRNFELEQQIKNLQKSIEEKNAKLAKIQPS"
FT   CDS_pept        complement(37933..40479)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229714"
FT                   /orf_name="CD36_80250"
FT                   /product="Ubiquitin-like-specific protease, putative "
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42555.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG396576"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI000192D8F3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD06"
FT                   /transl_table=12
FT                   /translation="MSSLKDKDYPSLKRKGTSIGSGSYKPVNTLGTATDRPNSNNGPEE
FT                   TFLSNITMKESYAAVNDPSLSLERAKERRHRLNGLAEILKTNSSPTVSSDVTEFQIRDC
FT                   FGNAVTIPAKDLRDEPAVSINLKSFHKVGGAYYRSTMHRSHSLQISRSGEYICIFERDS
FT                   PKSDFLINIDTQLKSLSFAPEAFVMELDEGHETIIASHYGRDKEVREYFQNNPTNKVDP
FT                   SKTLSGNALQRLEKTVQLENDNDFDFTGRKVSRNRPSRVRTRLESKAFWSSVAEENKED
FT                   PLDIVKATDDPAIESIFVEDDYVPYEKPAPFDPDLQYTFPDNKIFRITAKDFATLYNND
FT                   WINDAVMDFCIRFDIEEAITQGFVKREDVYAFNSFFYTKLMSGKTGDYYDRVKRWVQKI
FT                   DLMSFSHIIMPINEKHHWYCCIIRGLPTLLEMIKSEGEKPDTERQDSEEKFKKWGVDIF
FT                   VFDSLGLRRDNVKKPLKAFLIDYCKDKYNYDVNTDQIRVTAARVPRQNNYNDCGLHVIY
FT                   NVKKWLLNIEACESFWRKGQRAAMRTIFLADERNKMRRYWIDTLLKLHSEQIPANGNTS
FT                   GANIEEEDDDDIVEIVDTKTIVQPSLPSSDSVTKKQSNIVFKNIVLNQEFCNESIPRFV
FT                   IDTLNKIFPRSLHIPDDVKKLVATFIKDAQNEVSTEQELKETFIRNYEVIKKETENQNR
FT                   PKNKTLRIDDAISNLRIDPGVFFAPNGNGSHRSLNEETSGIRQDHLLEEIDIRPIIKAM
FT                   RTPPKSDRAKQDEQEGDSTESDDSSLSKNNENNNSEPDTASKHSTSGKHLQVDVIDLEE
FT                   DRNSRHRATRSRQRAKQNIMNLTIFDNIGRKRRKHE"
FT   CDS_pept        41124..42449
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573472"
FT                   /orf_name="CD36_80260"
FT                   /product="26s protease regulatory subunit, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="peptidase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAX42556.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000192D8F4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD07"
FT                   /transl_table=12
FT                   /translation="MGQGPSGMPGGDNLNKRKDDKKKEKPKYEPPVESKFGKKKRRGPD
FT                   MAVKLPSVYPNTRCKLKLLKLERIKDHLLLEEEFVTNQEAFQPTEARQAEEREKVDELR
FT                   GYPMAIGTLEEIIDDDHAIVSSTASSEYYVSIMSFVDKGLLEPGCSVLLHHKTVAVVGV
FT                   LQDDADPMVSVMKLDKSPTESYADIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKG
FT                   VILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFQIAADHAPS
FT                   IVFIDEIDAIGTKRYESTSGGEREIQRTMLELLNQLDGFDDRGDIKVIMATNKIESLDP
FT                   ALIRPGRIDRKILFENPDANTKKKILTIHTSKMSLADDVNLDEIVTGKDDLSGADIKAI
FT                   CTEAGLLALRERRMQVKAEDFKSAKERVLKNKVEENLEGLYL"
FT   CDS_pept        42574..44934
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229715"
FT                   /orf_name="CD36_80270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42557.1"
FT                   /db_xref="HOGENOM:HBG396583"
FT                   /db_xref="UniParc:UPI000192D8F5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD08"
FT                   /transl_table=12
FT                   /translation="MILWFQRRGGLRQLWRHVCTSVTPESSPAVYLSKLENARAETKTI
FT                   LPLNSFASLGKVTKFQNATKRRIDVSRHLELEIQSVFHQVIKLHHWFSNKKVLESTVDL
FT                   INRDRGQILIMRIQLDHVFTSHHVPSAAEKKEIDSLIHSVVKKIFDSNLDFGMKLDKMY
FT                   PPVIKYYQTSDASNYVQATLQVETSQLTDLNCNIKKMATKFQNLHKLASSMKRTDQKSP
FT                   PLAFYGSLKKTSSGVIQEIILSEALQARICNRIKQTIAHRGEVSILGEEPKASAIISQV
FT                   GKEFRLSIKTNVYVEQYPKKFASFHYKRDLSEMNYEIVQLVFKGLKGTGIELDEIYTLD
FT                   SLVKENSVVSTSSKLRIVFAEDYLKPSDSTLIFPEVNEEVLPKRRKLDRNSKQRDNKGF
FT                   RFVNFDKLQGIGLASYKKAGPEKPCYTVTLTDWNTGRGGGGYRPVLGLSPLTVTSVAGK
FT                   NFKNPTNREVIELIGFSILRELSCKWAITNLTIKPIHIINGFLASVRSAKLMEQSPKGY
FT                   IKLDLINAVQAYMGLKYLEENKIDGIAKWYKTRLETINLSFYFDKDTWITKQQPKLESL
FT                   CQSHVAGPLDLTLFSQVNRPTLLKYLPHKLPPIPRLNNNFLYSFIRLSFSHPFHNKKHN
FT                   KLIYFKKSLDGLGDAILKRLSCEYFMNVSQTDPTFKWNIDDIHFINTNILFGRLAIAYR
FT                   LHEGIQNENYSTFIKNRLLGPLDSANVFLGNHFEILVSVLYLDNPETCKEWMFKVYDAI
FT                   RGNLTTSNETETFLDKEKYIRLYEHQLKTHTLY"
FT   CDS_pept        complement(44965..45354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573473"
FT                   /orf_name="CD36_80280"
FT                   /product="RING finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42558.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396590"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D8F6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD09"
FT                   /transl_table=12
FT                   /translation="MSTPNVTNISSDDEDDEIEVLEFRKLTQDLLDHPSQSEERRITKK
FT                   LSDVQCPICFDDVNMATTTSCGHIFCLECIEHSISSSHARGQVRSSQRGRGLCPLCRKQ
FT                   VVFKETIPLKMKKANNIGKPNLPPK"
FT   CDS_pept        47011..47775
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078279"
FT                   /orf_name="CD36_80290"
FT                   /product="(Dl)-glycerol-3-phosphatase, putative "
FT                   /EC_number="3.1.3.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42559.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D9AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD10"
FT                   /transl_table=12
FT                   /translation="MTKTQQPAVFYVNAALFDCDGTLVNSTGAISEFWRDFGKTRPHVD
FT                   PEEIIRTSHGCRTFDVIAKWSPEDAIEEQVTAWEGAIPDTFGHHAKPIPGAVELVKSFD
FT                   KFSKEATENGKQRWAVVTSGTLPLATKWLKLLTIEKPDCFITAEKVTKGKPHPQGYQSA
FT                   RDALGYHDAHYKVVVFEDAPAGITAGKGAGAMVVGICSTYDPEKVRKAGANIVVKDLSS
FT                   FRIDSYNKETDEFKVVVDDYFFADEQFLQESA"
FT   CDS_pept        48147..50252
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573474"
FT                   /orf_name="CD36_80300"
FT                   /product="U3 small nucleolar RNA-associated protein,
FT                   putative"
FT                   /protein_id="CAX42560.1"
FT                   /db_xref="HOGENOM:HBG396602"
FT                   /db_xref="InterPro:IPR018843"
FT                   /db_xref="UniParc:UPI000192D9AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD11"
FT                   /transl_table=12
FT                   /translation="MSKPELYDQYMITSLPRTPDLDLSEKVVVSTIKYIDTSIIDIGVS
FT                   KSTISSYITKPTPKLLWSYSLNPTTMVDCMDVLVKDDKKYYVCGLSDRKKFRLLLLETT
FT                   RSITEDGNANYATTNEFELKLDRKAAAISFMSPEIITVVYVNGSAEEVEFSESTLKFSG
FT                   VKYTGTKNKDTVVYSEFVNDLEDNLLLTVSRNSKNTIYKLISINSKNSIFEVNSHSVSG
FT                   VSDDAKFCYSSGSLYQYTNKAIESRSITNFKITNTICVDSIINDEEITSVAAPAPDRIL
FT                   IGNANMIYLINVRFASLLSSFKSSSSSSHPIPDKVFLNQVVPVKGNSTNSYISMAVYLN
FT                   LKNKDNNVYLNVIDVNVGMNKLSECLGKSLNKSKSTFHEIPELFNIQDTLPSNGEIQEV
FT                   YSYLKDAREAQDLNKWESILIPYLKNKKTWAQIKSLLSTKPLKTDKVYEFKEFEDDKDR
FT                   VIDIGFIESVLELIFTEDPLAFANEEFVPEYTLMYLLTNPLFPIKFTSGLIELFSITGN
FT                   TTLLRQAVNTCPNIPCRDLLDQLVIEQNKETLLDLINRLIGEFSRKEITNNFKQLIQLQ
FT                   GNAVDVVELISKLIGLPGNNNWYLIEILIDVNGLFNWDMEDIKALEEIISHKVEALTIN
FT                   SYNLTLSHQVMLHNKRLSKKAKEKGSSSQLDNLLTLTNHTTSAKFDDASEEANVKVPVY
FT                   SVERVAF"
FT   CDS_pept        50440..50793
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573475"
FT                   /orf_name="CD36_80310"
FT                   /product="Protein FMP36 (Found in mitochondrial proteome
FT                   protein 36) homologue, mitochondrial, putative "
FT                   /protein_id="CAX42561.1"
FT                   /db_xref="HOGENOM:HBG396608"
FT                   /db_xref="UniParc:UPI000192D9AE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD12"
FT                   /transl_table=12
FT                   /translation="MSSTLSAYRNALRATRIAFRQDLPILQAARMQLKQGIRDNSNLQT
FT                   QPEIEEAVQKLNDVAKFLIQNIVQGEKQQDGKYFLNFHEKTELGDNETIKQGRKEMGSL
FT                   AGKKGNSIKSCKD"
FT   CDS_pept        50935..51558
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078280"
FT                   /orf_name="CD36_80320"
FT                   /product="tRNA 2'-phosphotransferase, putative "
FT                   /EC_number="2.7.1.160"
FT                   /function="tRNA 2'-phosphotransferase activity "
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="CAX42562.1"
FT                   /db_xref="GO:0000215"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="HOGENOM:HBG332834"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniParc:UPI000192D9AF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD13"
FT                   /transl_table=12
FT                   /translation="MPPPDKARRDVLISKALSYLLRHGAEKEKLSIDEQGYVKISDVLS
FT                   HQRLKSLKTTIEDIERIVRENDKKRFTIRDEMICANQGHSLKAVKNDNLVPMTIDELNQ
FT                   LRIYHGTYKTKLPIIKSSGGLSRMNRNHIHLTCDQYATCSGIRYNANVLVYIDASKCIE
FT                   HGIVFYKSLNNVILTSGDKDGKISWEFIDRIVDLEGKEIYKEEI"
FT   CDS_pept        53956..54678
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229716"
FT                   /orf_name="CD36_80330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42563.1"
FT                   /db_xref="HOGENOM:HBG448116"
FT                   /db_xref="UniParc:UPI000192D9B0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD14"
FT                   /transl_table=12
FT                   /translation="MFMDNQQQTVVTPRAHTYYPKMHTTPKQHARSASSNQTTNLAPQA
FT                   PNRSFSQNHLLPNEPTTEKSSHNSLSTSDNKICQWYCCSCGQSYGSVLYRDDYREVRPN
FT                   GQPPQKRARSLDSSNYILDSLKYYSQVVYRDHKHVISNASFSSSSSVNNNADTNYFDCK
FT                   TTTTDSSTQSTEGSHSPIIAPNTPMLSPLHLNLNHNSFIDYGEKVILNIPTRFTCHRCD
FT                   HMMCPYCLKLRLKDLDIS"
FT   CDS_pept        complement(55006..55644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229717"
FT                   /orf_name="CD36_80340"
FT                   /product="Bud site selection protein, putative "
FT                   /protein_id="CAX42564.1"
FT                   /db_xref="HOGENOM:HBG626356"
FT                   /db_xref="InterPro:IPR013268"
FT                   /db_xref="UniParc:UPI000192D9B1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD15"
FT                   /transl_table=12
FT                   /translation="MVLTRSQAHQPIKKKFTDDDFSDEENINPSSPVQPEDIHSSEEAD
FT                   DSDSDSDDAPEEESTSKARSEILLEQKKLQQAEAELKKQEREKRKALDLRNTQQQQLKK
FT                   SRQSPFELPEFLPDDVASIINQPAKASESNLKPRHIRLDDIEPSPKLDKKTLLEEKLRL
FT                   LKAKKNVALKKGPVHVKIQSFNSKVVPRSESKIVKNRDKWLHRKSVNRK"
FT   CDS_pept        complement(55791..57815)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573476"
FT                   /orf_name="CD36_80350"
FT                   /product="DNA replication origin binding protein, putative
FT                   (Protein dia2"
FT                   /function="binding"
FT                   /protein_id="CAX42565.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396621"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000192D9B2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD16"
FT                   /transl_table=12
FT                   /translation="MTDTSLIEDKIKLAILYFKSQDFEKALGAYNVLINQLKNLPRSTI
FT                   KQIRKSYNLLETPIIGPTIHPKLGSLLDQRAATFEKLNQPASALKDGRELIKLEPIGCK
FT                   GYLRTGKILYSLDKKVEAYKCYQEGIYIIEKSIKDYNITVPGKLFTSLKTQYKALNVEL
FT                   KRKRTLAETKNTTLVKKTKIQTTDPFVYFPIDILELIFQDVPMKQILKCHTVSKLWYYT
FT                   LTSIPRLYEFKCRTNIALNEFVSGIRLFRKICAYSSSKSIEHVRINHVCNKQHLTKVLD
FT                   ALIREQGILPRNLSIMDKNFNLQVLFYLLAKSGWKLLNFQNLESLKIGINCSIKYGHAL
FT                   LNMFRKLRTLEIVVLVSEKSLLDLIPIQDKLFRKFKDQELEEYSLERLLLVNHPKLLSD
FT                   NPNPISPQTYSPYPVLLNRVFPELTELTLVSFDFSTTLPQFGEFLMQTPKLQKLYLENN
FT                   QAINMLIFFQMLVNYKPAFKLQEFTFRESSVVSAISLTEFRLTDLPQLKNLHKLDLYKN
FT                   CLSVTGFLKILKISGKSIRHLNIGHSIYISFVLHSTKMMYLYDILNKCPHLSHFCLSDM
FT                   DIDQQAMVQINKDLERISSHLQVLDLSFNKIDGVSLIRMFERCLIVNPIEQMVLHGMDI
FT                   STDTIQYLIRKKYVKNVLMDTSRLKWQVFGVNSWVQERM"
FT   CDS_pept        58028..58840
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078281"
FT                   /orf_name="CD36_80360"
FT                   /product="Metal homeostasis factor, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42566.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG396629"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000192D9B3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD17"
FT                   /transl_table=12
FT                   /translation="MILVLVVLPLVMFIATFAAGIVPLRLAVAQHHLKYLSFLSMGILI
FT                   GTAMMIILPEGIETLSQETTEVSSYVGLPLLLGFLTMYIIDCSFSTNVKAQESSVVESI
FT                   IGSPITLGLIFHGIVDGIALGSSFASGEVMTLIIFAAIIIHKIPTSFSLSTILLQEGTS
FT                   DSKLYWHVLLFALSSPLACWLTFVVIKLINTKSNLVLGVLFLYSAGTFLFVVNHVMHEF
FT                   SSNDFYALPTSVESEMTAVESHSKIPRNELIISLVGISIPTLLSFAKE"
FT   CDS_pept        complement(58892..61798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078282"
FT                   /orf_name="CD36_80370"
FT                   /product="Triacylglycerol lipase, putative "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX42567.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG398461"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI000192D9B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD18"
FT                   /transl_table=12
FT                   /translation="MSSEVTLVPTVSTTSSDAIIKELFQQYISLHPNNKTNPTQNKQTD
FT                   YIGFSLRSLPIIGNFFPEMDDKKKTINELLEIQKVTTSYREWYDTSLKLDELLGNNAWK
FT                   SDPKSDIYDYDLIYRNLNEMRRARLNHDYKLLLYYIRTKWIRNIGNMGDANLYRHAYVG
FT                   TKKLIEEYVRECQLSLEYLVTNDEVNLNDRYLLGMLIQTRKNIGRTALVLSGGSTFGIF
FT                   HIGVLTTLFEANLLPRIISGSSAGSIVASILCCHNNEETFELLSTITTKKFNIFDVVDC
FT                   DTSQIQGSFKKVLYYLGHWIKYGTIFDIEGLQDTMIGFLGDLTFREAYNRTGKILNITV
FT                   SPASVHEQTRLLNYLTAPNCLIWSAVCASCSVPGIFPSCSVYEKNPKTNEIHEWNNDES
FT                   MKYVDGSVDNDLPITRLSEMFNVDHIIAVQVNPHVVPILRVSVSNIGGQVENDLIYKMK
FT                   HLLNNVYDFVSCEAIHYLQLLNELDVYKNLSNKMISILSQNYSGDITIIPEYKMSDFVN
FT                   LFENPDTEFMLDFICRGAKVSWPKVSIIHNHCSVEFALDKAITILRGRIITSANYRITS
FT                   NSSGVRRSQSYYKPKQQIMNLVTSPVMNDNAQFNTAPATPLKQKQRPLGVQRHHSTSNA
FT                   TSNKHQPRSKRNSMSATDGSQVDVAASYAAVNSGAGGATTPYKKLSKGISTTALMQLTQ
FT                   GYASGDSTLVNDDSENSNGPATTFRRGIRKARSSGNIRNNMDYSNTDRPVSRSTIDRIP
FT                   YKNNPYLQQRSKESLESFNKAEEGSSQREKPNLPSVSSSNSHRNSYIGLNRLKDNNLSR
FT                   QNNNSFFNLKQLGKGPNNQELIKKLEQERKGILKNGNRESLANLELFANSDDDDLCKLE
FT                   LSHEGSLGDDEHSNEKEYTPGDDDDSDEEGDDSQFHSDEEEEEEEDDDDDEEEEEGIAY
FT                   NDDNEKANGSSSKVAFESVEMTNRSESVVDDINPYFGS"
FT   CDS_pept        62357..64930
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382581"
FT                   /orf_name="CD36_80380"
FT                   /product="Ribonuclease Z, putative "
FT                   /EC_number="3.1.26.11"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42568.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396642"
FT                   /db_xref="UniParc:UPI000192D9B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD19"
FT                   /transl_table=12
FT                   /translation="MFRVTTITHLTDDTTRPLICLTTRKGFKYLFGKVPEGTQRVANTF
FT                   GSEVKFSKLQGIFLTGSILSWSDIGGLPGFFLTVSDATKNGLTVMGCERILSYILATWR
FT                   QFVFRMGIKLHILDAQANPTLEDEEVVISPITINPAHQISPPENSSKLLRQIKKLASLM
FT                   FPLDTSQVNSRDPESYKSDPTQNDIHTHVHLPSASEVVTTQKSISYCISFVPVLGKFDP
FT                   KRAVELGLTPGPQFRDLTNGLSVVNKNGDIIAPDQVIAPNRIFRKILVIDVPSNDYYEN
FT                   TINSNRWFEHDQTKNAGEVGLVYHMLGQDLQLDLLDYKKRFLSKFSSDTYHVISHPSMT
FT                   NNVIMNDRFISNTMKIKSILNENFNLVNSETFKPLSDSHVDRLHALQSYHINDNGVVPD
FT                   SSAAIKTTNKSLFDEEVGSLDIPNAADFESMEKTKIELDCNRHNNLKDRVQVFMLGTGS
FT                   ALPAICRNVLGNLIRVPYQDGSGTISYRSIILDGGENTIGSLLRLFGHENGKEFFQIFQ
FT                   ELSLIHLSHLHADHHLGIVSLINEWFNINQDESRILYLVVPWQFITFLKDWYSLESQYN
FT                   KVFDMNRLVCISCEDFMMDNRTPEFIKIDMDKFEEFYDKGNLHKPIPRDRLLSVDRKKV
FT                   KNMYETVGLNSVTTVRALHCAWAYSTTFDFKLNENGDTFKLSFSGDTRPNPKFAECGYG
FT                   SDLLIHEASMDGNWIEEAIAKKHSTMIEAVAVSKLMNCPKLILTHFSSRYGISNNCVPK
FT                   SELQSCADNLDTYLNKSHCELNIFSSESPSNLNLEEIDLWFAYDLMGVCYGDLHKQEQA
FT                   WPLLTELFPPSAEIDHEKINEKKEAKRLERLAIMKVKKKRKMSPK"
FT   CDS_pept        65129..65701
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078283"
FT                   /orf_name="CD36_80390"
FT                   /product="Telomerase subunit, putative "
FT                   /function="telomeric DNA binding"
FT                   /biological_process="DNA duplex unwinding"
FT                   /biological_process="telomere maintenance via telomerase "
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="telomerase holoenzyme complex "
FT                   /protein_id="CAX42569.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005697"
FT                   /db_xref="GO:0007004"
FT                   /db_xref="GO:0032508"
FT                   /db_xref="GO:0042162"
FT                   /db_xref="HOGENOM:HBG396648"
FT                   /db_xref="InterPro:IPR019437"
FT                   /db_xref="UniParc:UPI000192D9B6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD20"
FT                   /transl_table=12
FT                   /translation="MQKSENDVPMIMQSSWLVNEVIKSINSNGQYINSLIKKDFQPTVL
FT                   PVSFVLRILKFTATTDSKDITAVLADSTHKIFAIFLFSPAIVDFENKYHHRMTYNTRSS
FT                   VIRIHKANLRFMDQSTVNKCYNMKTNGNLAIAVLEILEFDIFLKDQYSFITSIENRLKY
FT                   VYEDTRYDQLCREKMHRPEYDDLMCDM"
FT   CDS_pept        65830..66459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382582"
FT                   /orf_name="CD36_80400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42570.1"
FT                   /db_xref="HOGENOM:HBG396655"
FT                   /db_xref="UniParc:UPI000192D9B7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD21"
FT                   /transl_table=12
FT                   /translation="MAEAEQKDSSPKSLPLRRHSDVLVTTGTTYSATTPNSLNEGNSIT
FT                   SHRELIIPSSSGGEQQSPILDLVHPISSGNLATTSQETRTRNCISWCTGLFNFRNSPQE
FT                   TAENSSLLPVYHVRSNTSPIDSAGIASNLSEFIRRLLPGLARDQYPNTFSWLLATLLTI
FT                   VLIAATLGLYFSGNLSGLLVLFKALVCSVFRQFQPSDVALPLFCRS"
FT   CDS_pept        complement(66554..67660)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000232982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573477"
FT                   /orf_name="CD36_80410"
FT                   /product="Ribosomal protein of the large subunit,
FT                   mitochondrial, putative"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /function="transferase activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAX42571.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG748739"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniParc:UPI000192D9B8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD22"
FT                   /transl_table=12
FT                   /translation="MLPITRRWLGNAANPAVSLLKCSRGFIRFNSTSEFTELELQDIKY
FT                   RKQRELSLKLTKMKNYGDAFPVHSHPGSTHYKKPVHDHLHKGRPVKELTVARSHRSSGR
FT                   NNEGKITVRGRGGGHKKRARLIDFHRWNAGRQEVVRIEYDPNRSGHIALLKHLETGDLS
FT                   YILAPQGLRSGDIVESFRQGIPKDFMEEMERTNNGEIDDALLSARILQRGNCLPLRMLP
FT                   VGSIIHNIGLRPGDRAQLVRSAGTFGKILSKHPEKNRAVIKLSSGEQRYVILDCHATLG
FT                   VVSNKEHQLISWGKAGRSRYRGFRPKVRGVAMNACDHPHGGGRGKSKSNKVSQSMWGLK
FT                   KFQKTRLRPNPDQIRNRKGHLINHDKFK"
FT   CDS_pept        67954..68571
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000075825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382583"
FT                   /orf_name="CD36_80420"
FT                   /product="ATP synthase subunit, mitochondrial, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrolase activity"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAX42572.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG668108"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniParc:UPI000192D9B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD23"
FT                   /transl_table=12
FT                   /translation="MISRVFSRSLASAVKSTKPPIQLFGIDGTYANALYSATIQQSDMA
FT                   QTYKSLEKIENVIKGDPQLKNALTNPSLTKDDRVAIAKSVASDLGLDKTTANFLTVLAE
FT                   NNRLGNFSSVFQKFGLLNDAYNGVVEAKVTSAKPLESKILRRLQTSIGKSSFVGEGKTL
FT                   KLTNQVNPEILGGLVVEVGDRTVDVSIANKVARLNQTLRDNL"
FT   CDS_pept        68997..70442
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093805" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573478"
FT                   /orf_name="CD36_80430"
FT                   /product="Uncharacterized protein yil039w homologue,
FT                   putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42573.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396668"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000192D9BA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD24"
FT                   /transl_table=12
FT                   /translation="MAISPKIKALVDLATVIAILLNFFVYFYPDIVNPTEKCNWHNAPE
FT                   LKSKYTFLNNNLPTDWVNILLLNFPNLKEDKDIQRELESNDIHMLLFGDPQINGNWPST
FT                   KYIKRLDNYGNDYYLGHIYNTMKRRLNPSHVTVMGDLFSSQWILDSEFYNRTYRYVERL
FT                   FPQPLEYKQNALEVHARHENYNWQQWLEDEKAMDPVHRFQSRVYNDVYDWVYRNRSTPN
FT                   YDQPLFINLTGNHDIGYSGDATWQHMARFHLLFGQNNYVINYKKGSPDEWRIVVLDSLT
FT                   LEGPALQEEFVNYTWSFLENLRDRENPNFKGSTILLTHVPMYKKAGLCKDGPEHQYYIN
FT                   NEKEPYKNGKLRSHNHLAYETTQNVMDIVFPNKDKSGIILTGHDHEGCDDWYNYINSEW
FT                   TASKEKYSVERESVREVVVRAMMGEFDGQTGILTGHFDDARDTWDFHFSYCSFVIQHWW
FT                   WASKVALLVVILLQSFVKLFGGI"
FT   CDS_pept        complement(70599..71393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382584"
FT                   /orf_name="CD36_80440"
FT                   /product="Peroxiredoxin, putative "
FT                   /EC_number="1.11.1.15"
FT                   /function="peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42574.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000192DA70"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD25"
FT                   /transl_table=12
FT                   /translation="MPELRRSARVAARPTKEPEAAVEQPPTKKAKTTSTNTAKPNAGLE
FT                   IGEKIPEITLLNQDGKEINLAEVAKGSKYVVIFAFPRASTSGCARQVSGFRKLDKDYKD
FT                   VAIFGVSSDSIKAQKTFQTKQSAEYDLLSDPEKKLIGALGAKKHPSGIIRSHWIFVDGV
FT                   LKVKQIQVSPEVSFTSAEEEIKKFINENENSKEATENDTIKEELKEEPQQDNSKEVNDD
FT                   NTKQTDEKATESAQDEVKNVSEESKGLVEKSTEEPKTEAPAI"
FT   CDS_pept        72690..74315
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229718"
FT                   /orf_name="CD36_80450"
FT                   /product="Histone acetyltransferase subunit, putative "
FT                   /EC_number="2.3.1.48"
FT                   /function="chromatin binding"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42575.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG631736"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000192DA71"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD26"
FT                   /transl_table=12
FT                   /translation="MAVAEIKKEKGSSMSPAPSSPIQILSTEPDANPDSKQEKFTPKDI
FT                   LPGCKVHVSKDGELRLAEILQEHIKKGRKVFYVHYQDFNKRLDEWIELDRIDFTRSLIL
FT                   PEIKTDTKENKSKKKSKSKGSTKSSKNNTTANSTTGTPQPNDGQPIMGDDEMDLENLNV
FT                   QGLKRPGEEFSREDEIKKLRTSGSMTQNHSEVARVRNLSTIILGEHIIEPWYFSPYPIE
FT                   LTEEDEIYICDFTLSYFGSKKQFERFRSKCSMKHPPGNEIYRDSKVSFWEIDGRKQRTW
FT                   CRNLCLLSKLFLDHKTLYYDVDPFLFYIMTIKSDQGHHVVGYFSKEKESADGYNVACIL
FT                   TLPCYQKRGFGKLLIQFSYMLTKVERKVGSPEKPLSDLGLLSYRAYWTDTLVKLLVERN
FT                   SPALFRKNNPQLEYDEAENGKDGSATPTPGPGSYASQFSTSASALASRSGLNSSPVFSN
FT                   EITIEDISSITCMTTTDILHTLTTLQMLRYYKGQHIIVLTDQIMELYEKLVKKVKEKKK
FT                   HELNPKLLNWTPPSFTANQLRFGW"
FT   CDS_pept        complement(74332..75543)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078284"
FT                   /orf_name="CD36_80460"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /protein_id="CAX42576.1"
FT                   /db_xref="HOGENOM:HBG630928"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192DA72"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD27"
FT                   /transl_table=12
FT                   /translation="MSVPIKLNLKNYRIMSLTAFSRDILMSTDDSILPPEDTLSEAMYN
FT                   NVKLDYYFNNLSKSHEQSSVDDQTNQLIVSSAPKSEESPVLEWKLLRTLAGAHQGWIRA
FT                   IALDEITNKWYVTGSADSTIKIWDFENNSLKAVLTGHVLGVRSLCISKRHPYLFSGGED
FT                   KSLRCWDLERSNSDAGCQIRSYHGHLGGVYTIGLHPELDVLFSGGKDCVVRVWDIRSRV
FT                   EAMTLLGHTNDITSIQTDYSDPQVITSSMDGTIRLWDLRKSKTELLITNHSKSIRSMKS
FT                   HPKEATFISGDSNGEIKQWLLPKGELLNEFGTSQLSPNQRDNSRIINSLAINPVTNTLF
FT                   SGYDDGKLEFYNYASGSLQQSGQSPSLAGPEQSAIYASTFDMSGLRLLTCHGDKSIRIW
FT                   GTSY"
FT   CDS_pept        75641..76738
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382585"
FT                   /orf_name="CD36_80470"
FT                   /product="Cell wall biogenesis protein, putative "
FT                   /protein_id="CAX42577.1"
FT                   /db_xref="HOGENOM:HBG396690"
FT                   /db_xref="UniParc:UPI000192DA73"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD28"
FT                   /transl_table=12
FT                   /translation="MEVQTISKDNDELPIIRELYKVITSSLRSQKIIQIAQIPQNGNSQ
FT                   SNIVTYDDEDNDTLEIGISKPTYLAMFKQSHDYWYKYMEINKCTLEKLEIATLSELYLM
FT                   TLGYLITANDHNSIMNLHEQIVKILGNFETDIEIVSCFLTSRLKRINKSSLLWHWMKKM
FT                   TILVVFNKLEGKQGGQGLLLGNQLYNKIISRAFKSCELHFMNYYANNFIHWIMQCTMVV
FT                   LGVDDGGYLFHQLQKHCHEAPSDSSLWTNMKNYIKCMQGSIQADNQIIKEYNQINMNYD
FT                   ATLQNHSPSPLILTKESDEDIMVNEFQWLVKVQCKNVIPFSVLIEAAQTKRVLKKLKEL
FT                   IHLHEFNKNLAKIESLIELRSRTIE"
FT   CDS_pept        76903..77487
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233456" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229719"
FT                   /orf_name="CD36_80480"
FT                   /product="NEDD8-conjugating enzyme, putative "
FT                   /EC_number="6.3.2.-"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAX42578.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015580"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000192DA74"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD29"
FT                   /transl_table=12
FT                   /translation="MLKIRQLQKKKQEEAERLAKSQSPTPTPGDSTTPSNERVSPAQIR
FT                   VQKDISELDLPSSIKVTFPNPNDPFNFNLQLIPQGGYYKNGKFEFKIEINSNFPIDPPK
FT                   IKCLQKIYHPNIDLQGNICLNILREDWSPVLNLNGVFMGLNILFLEPNPNDPLNKDAAN
FT                   VLVKNKKQFERNVYNSMRGGYLDSVYYDRVI"
FT   CDS_pept        complement(77585..79054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229720"
FT                   /gene_name="PAC1"
FT                   /gene_synonym="LIS1"
FT                   /orf_name="CD36_80490"
FT                   /product="Nuclear distribution protein PAC1 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /biological_process="transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="spindle pole"
FT                   /protein_id="CAX42579.1"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG396701"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017252"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192DA75"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WD30"
FT                   /transl_table=12
FT                   /translation="MEKLSILTERQQTELNYAIIQYLQPLCQQDNHALLDQLSKILNID
FT                   QWTQESNNVEKVDNYLEKRWSTVLRLQKKIIDLENEISNLNNIINSSNSDNNGIVLSKD
FT                   KINWIPKGTAKQSYQCENIVTTVKLHPNLPLVLNGCNDGNLYIWNISNDDNTIPEKMIK
FT                   AHTRAINKICFTYKKPYYLATCSSDLTIKIWDEKFNHIRTLNGHEHTVSSIQFSPIDNS
FT                   ILYSVSRDKNIRVWDIFQGISLKSFVGHSEWCRDLDIVSSDNNGDFVLTCSNDQSARLS
FT                   HASSGAGLAMIVGHGHVVETVKFLPALQANKILDEYITKNIEQFPTIPLELLKDKTYNQ
FT                   LGFKYCITASRDNTIKLWLIPPPKIAPHRPPLPSKYNNSQSWMIAELRGHSSWVKCLCV
FT                   HPNGRFIISGSDDKTIKFWDLSSLLETGSVNVVKTIIGHDGFINDIDFARLKEASDSTP
FT                   TSQEDLLKEVEKRMRCLFISGSADNSIKLWN"
FT   CDS_pept        complement(79746..80648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573479"
FT                   /orf_name="CD36_80500"
FT                   /product="Increased sodium tolerance protein 1 homologue,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX42580.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG739022"
FT                   /db_xref="InterPro:IPR005061"
FT                   /db_xref="UniParc:UPI000192DA76"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD31"
FT                   /transl_table=12
FT                   /translation="MQTEEAKKKKKSHNDYYLQQKERPPSPIEIQYNSHITHFWIMARP
FT                   LAVPPHLNPLRLKTTLKMAISKLKFIQEKKTAITKQQRRQLSELLSQGKESSSKIRVEN
FT                   IIRDDIYIELLEILELYCELLLARLPILLERTTVEKNLQEAVNSIIYSANHTELKELIT
FT                   IKDILIYKFGGPEFAQPILDNKNGEEVPEKVVKRCDIEPPSETLVDLYLCEIARAYNVP
FT                   YSGLKEEEATNATGDKNNNDDNDDDDDDDGGQKEFGLAEPLGGVAVKPVFKNHDPKIQE
FT                   ESDFDALKARFAALKGTSP"
FT   CDS_pept        complement(80813..82915)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573480"
FT                   /orf_name="CD36_80510"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42581.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396713"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192DA77"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD32"
FT                   /transl_table=12
FT                   /translation="MPDKHKLKLFGKHKHDKDDELSLSTSNHSHGSARKFLGFHIGKHE
FT                   SGESLTSPVMSNSSEGHHHNHHPHQANSSANHRNPSPIHSNTGTATTVPSIQSPQPHAS
FT                   GLHREDSDKKSSGSVVDLKKFFKTKKTSNPRKEGHSILGHYSNQLHSPPPMAQVHSPGA
FT                   GSGNGSALQSREQSSTSLATLINQTSSQLLYNASHSVNSNRDPFTDDNSPLVKKYGKIG
FT                   KELGSGAGGSVKLITRPSDSKTFAVKEFRAKRSTESLKDYTRKCTAEYCIGSTLRHPNI
FT                   IKTIDIIHENNRYFEIMEYAPIDFFAVVMSGEMSRAEINCCLKQIIEGVAYLHKLGLAH
FT                   RDLKLDNCVITNEGILKIIDFGSAVIFKYPYEQFGSNNSIQPCHGIVGSDPYLAPEVLK
FT                   SPNSYNPQPVDLWSIAIIYCCMTLKRFPWKIPNPEKDNSFRLYCMYDDNFHDYYLSNEC
FT                   HKLLLQQRKLKNTIVRSNKRKKQLEEEQGDKNDADAYKEDEEMKDAESVPQHHHSHETE
FT                   SGTNATSTTGKEKSNEAVTVLTDEQAEEIMAQLNDIDKKLQEFEDKKNELKEKYEALRD
FT                   ADPKYQKQLAQIHEEEEKQRLKDAEHGSDDKKKSHHKQIHGPYRLMRLLPHAARPVISR
FT                   LLEVDPKKRATMEEILEDEWIKEIQCCTVKSVSKSTDATLDIIEDDDEVLVKGVPPHEH
FT                   TIVKEG"
FT   CDS_pept        complement(84398..85699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535362"
FT                   /orf_name="CD36_80520"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /protein_id="CAX42582.1"
FT                   /db_xref="HOGENOM:HBG436413"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192DA78"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD33"
FT                   /transl_table=12
FT                   /translation="MKVKTISRSSDTYIPVKNTQESALPRNLNPALHPFERAREYTRAL
FT                   QATKLERMFAQPFIGQLGDGHRDGVYFIAKNYQATNQIASGSGDGIIKYWNLTDRLETA
FT                   SFKAHYGMVSGICIYANKMYSCGDDKTIKIWSVNSDDFDVKVNDDVDEIYHNNSNLLEG
FT                   KTSGGLLKTFIGEHSFKGIDHHRDDDLFVTGGATIQLWDVNRSKHISDLSWGADNVGTV
FT                   KFNQTETNIIASSGSDNSIVLYDIRTNTPVHKVVTSLRNNCITWNPMEAFNFATGNEDH
FT                   NGYLYDMRNLQKTLKVYKGHVGAIMDVDFAPTGQELVTGSYDKTIRLWKTLDGRSKDVY
FT                   HTKRMQKVFSVKYSTDSKYIISGSDDTNLRVWRSDASSRSNIKSSRQRAKLEYQDKLKE
FT                   RYKYMPEINRIARHRHLPKPVKKAEDMKRLYSKK"
FT   CDS_pept        complement(86366..87751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573481"
FT                   /orf_name="CD36_80530"
FT                   /product="Plasma membrane-associated protein phosphatase,
FT                   putative"
FT                   /EC_number="3.1.3.-"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAX42583.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG396725"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192DA79"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD34"
FT                   /transl_table=12
FT                   /translation="MGLLSSLLCCSIESKDDNDDKIHHPSTSNGVATTTSKKSNAAVTS
FT                   ASLKGNSSRNNQQDKAKKINTTETTKATTTTTTTTTTTKTRTPTTNTSKSPSKTTSGRH
FT                   GKNASINDHNSDLIKDNDIDVIGDEDEDEDEEDEVDALKPSKKDLLDDDQSINEIETIA
FT                   NTNDESNNNTPKSSNDTTKTDTNNTKINTSDIITQVPENGGTHTNTNSSSTYQNENRNV
FT                   KKNEASNGEDDDNNDNDDDEEEEDEEEDEEEDIDDDDSLEDLTKLQDGQAFNAETGFLL
FT                   GKKDKNFGNKKCLILDLDETLVHSSFKYLRSADFVIPVEIDNQIHHVYVVKRPGVDEFL
FT                   QKMGKLYEVVVFTASVSKYGDPLLDKLDLYNSVHHRLFRDSCYNYQGNFIKNLSQIGRP
FT                   LEDTIIIDNSPASYIFHPDHSIPISSWFSDSHDNELLDLIPFLEDLAKPIVDDVGLVLD
FT                   ISL"
FT   CDS_pept        91763..95569
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573482"
FT                   /orf_name="CD36_80540"
FT                   /product="Hyphally regulated cell wall protein, putative "
FT                   /protein_id="CAX42584.1"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniParc:UPI000192DA7A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD35"
FT                   /transl_table=12
FT                   /translation="MLLKNFVFLFIATATTVFASYDVSSSLIHYHDFDFNVGDISIRNG
FT                   ASFSLVNTFDCLFKGDLTIEEKSKLYITSTGRALLLNVAGLFNKVKNDGLLVINTIESY
FT                   AAAICNIFGASFVNTGDAIFAFQGKWLPPIIAFTAQQWQNYGRVHIFQKFPSKALAILG
FT                   RFGGSIENYGTLCFTNSIFKQVTTIDGSGCIALEKSSSFFIENSLFPIDKEQVIYMGEG
FT                   NPSIQVVATTFPQTFKVANFGGNGAHKIGLNLPLLNLPLLNKRGWSYNERTGILTLKVT
FT                   DLLTQNFDIGLGYDPSKFELCSDESVGFLFVFHGAIKYNGPAPNPGRPSICQVCPGLHP
FT                   APGAEPTTSTNSITTTKTDGSICTEIDAVVVSSDQSGSWYTSTSGISTVCGATSEAPIP
FT                   NPRVTITTTWTQVTTATVTESGTKTDTVIVQVPYTPNPQVTVTTTWTGTYVTASTITGD
FT                   KTDTVIVDVPETTTSCLTTTNTWTGEYITTITTSGWVIIEIPTESVATYVYTDSQVTPT
FT                   KATATSEVTAVTSATTGNDNTASATGATGNNNNNDSTTGATGNEKNKSTPSTAGNVNTA
FT                   ATTTTGNGNNDSTTGATGNNNNNDSTTGATGNEKNKSTPSTAGNVNTAATTTTGNGNND
FT                   STTGATGNNNIDSTTGATGNEKNKSPPSTAGNVNTAATTTTGNGNNDSATTTGNVNTDS
FT                   TTNTGNNNNIDSTTGATGNNNSASTTATTDNVNTASTTGATGKDNNDSATTTGNVNTAS
FT                   TTNTGNNNNNDSTTGATGNNNNDSTTGATGNNNNNDSTTGATGNTLSTVTTGNDNTAST
FT                   TGATGNDNSASTASTTDNVNTASATGATGKGNNDSATTTGNVNTASTTNTGNNNNIDST
FT                   TGATGNNNSASTTATTDNVNIASATGATGKDNNDSATTTGNVNTASTTNTGNNNIDSTT
FT                   GAPTTSDFSGSTESQSRETKHTKSKNTETHKTKLTETSTSLAAISSSSEFPFENTSNSI
FT                   CQCTPVTVTKYIPQSNIPENTESTTQSTSALTPATSQEIASQPSFHSKVESTTVVSSAT
FT                   SQEIASQPSFHRKVESTNVVSSATNQESTTNFSSETDVQSSSQFVTPTNAVHSSLSTEY
FT                   YTTGVTSYYTSYVTVTAETTKVVTLTSCANDVCHKTTATTGVTVVTLSTSDIQTVLTTY
FT                   APLTQTVTLGITGSATFDLGCPTGHFGYKGYIGKGVEISPNGIKANANAGFNVGFDAIK
FT                   RDQKVVNSTNVTVQSSKNAGAINSIYSSIELLCAVTAIMALIF"
FT   CDS_pept        98671..100275
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573483"
FT                   /orf_name="CD36_80550"
FT                   /product="Hyphally regulated cell wall protein, putative "
FT                   /protein_id="CAX42585.1"
FT                   /db_xref="HOGENOM:HBG396742"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniParc:UPI000192DA7B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD36"
FT                   /transl_table=12
FT                   /translation="MLLSNLVIPLLATSATVSANFDVTSSLTKYASFDFGLGDISIQEG
FT                   ASFSLVNTFDCAFQGDISIEKDCEFVIASTAKALKLTFNNIFHKIENKGKWIVHTLEAA
FT                   AASTCNIIVQSFVNTGEIILAFKGHVLAPIINIAANHWVNHGCLHIFQEIKSISVAILG
FT                   VVGGEIENHGTICLTNQLCKQVTKISGGGCIALEKSSSFYISNSFLSIDAQHTFYLGAG
FT                   NPTIQAQAVSSPQTFKVANFGANGAHKIGLNLPLLSISIAGKKGWSYDTKTGILTLTAN
FT                   GFISQKFDIGLGYDVSKFEVCTDDSVGIVSVINGSIKYNGPCPHAGRPSVCQVCPGVPT
FT                   PPVITSSATAITSTQSKTASSSTSKVATTSTASSSTSKVATTSTASKPKPTTLSTSSIA
FT                   STKTTASSKTNSVASTTTPEGSYSTSFVTATAETTKVVTITSCSNNACHPTTAPTGITV
FT                   VTLTTSDIKTVVTTYCPLTQTVTLGVTGSKTVDLGCPTGYFGYNGYIGKGISFGHDGVA
FT                   ASASAGFQIGFDIFNDH"
FT   CDS_pept        100792..101520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229721"
FT                   /orf_name="CD36_80560"
FT                   /product="Conserved oligomeric Golgi complex subunit,
FT                   putative"
FT                   /protein_id="CAX42586.1"
FT                   /db_xref="HOGENOM:HBG396751"
FT                   /db_xref="UniParc:UPI000192DA7C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD37"
FT                   /transl_table=12
FT                   /translation="MTNTDESLSMYFDDDFNPSAYIDKLVHTITNSNPASSTTPVTAYS
FT                   KSSLTKLSNDISHLITHLDYYTNMITNDSLQKKLDALDKSNEIINNNEENGTTRLQYHV
FT                   HVFNNAVLSLQTELNEINKQLDESTINNEAIQKLIQLKQVKSNLTKVLSIFELVYNSIS
FT                   QDDELSFTVDKFQNALDDLLASIKNQLESSDKNDKLLAQIDKLLEMNGLFTHLSRFNTA
FT                   FKKFLTKLSNEKEVYLNKKR"
FT   CDS_pept        join(complement(102024..102034),complement(101619..101961))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573484"
FT                   /orf_name="CD36_80570"
FT                   /product="Protein required for assembly of cytochrome c
FT                   oxidase, putative"
FT                   /protein_id="CAX42587.1"
FT                   /db_xref="HOGENOM:HBG737843"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniParc:UPI000192DB24"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD38"
FT                   /transl_table=12
FT                   /translation="MGASCKDQRKALAICLQRSPCVLLDRHTPKECLTDPELKKDLPEL
FT                   CKAQFRAFMECKNGMFDMRKRMRGNAPLSTGKYDETFDNLSTGNFDPREEIRKLDVLNR
FT                   NLSRQQQAQEKKD"
FT   CDS_pept        102505..106209
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535363"
FT                   /orf_name="CD36_80580"
FT                   /product="Regulator of V-ATPase in vacuolar membrane,
FT                   putative (Regulator of"
FT                   /protein_id="CAX42588.1"
FT                   /db_xref="HOGENOM:HBG396764"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="UniParc:UPI000192DB25"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD39"
FT                   /transl_table=12
FT                   /translation="MTITFIPGEVNKSNYSVAHSNWKNHHIVAYGSGNNLIITGGTVQP
FT                   TNKNPNPFNIDKSLQTIYLDRDPSAIDINPVNGYIIVSIDTKILVYKPMNEYMKIPKWQ
FT                   SSIEIDVNGSTINCIKWASEENEIVVGTDSGLYLFYLYEEYGELKYRKRWETIQVSPVT
FT                   DIIVTPNSKMIMTKSGSFDRLIKVWTRISYGDENTLFEVTYLPHPRGTFVMDYHLKKQI
FT                   TEDKKKELDASMANIKNIRDYINNTIDEAEVIYSFCSDYKFRVWASCEQSGHNQINNWA
FT                   TLDLNGVFSKITTVIVIENYHLRETLIPALKNSDCTLFNGLDVNDLDLLFVVSDTTEVK
FT                   IYAITNVSQCPPTKICFTPISGSYRFGKNEYPLIHIQAKTEEISTSYIESEEFITTVLK
FT                   PLLVKGVCILNERVPYLTFLLHDRVKNTLRFNIMNIARLARDAKFESVLINKYQGHTKS
FT                   IRKLVKSNSSFSQNNVLLSISNFPQHNYIWEPMLLQTNTMSVTKRFQINVESGILNAVI
FT                   INDVEPPVDWKRRHIVITAGRNSEVSVWDCNGSTNDDQPADLITEIKTGVEKEPLVFVL
FT                   TEYPDNTQIQRRYCIVALYAHDQIKSWKLSLQYEQNKITDILFDEENIASLPQEEEIYQ
FT                   ATAVDAFVSEANKSLIAVISKNGLLRSYSLDFGKSIKWEKVSELETNVSAASKIHGSTV
FT                   INKFAVVDSTGYKLSIWDVVQGVLEYEETFPESNGPVTDLDWTFLSASKMKSTSNALLS
FT                   VGFSRFVLLYTQLRYDYTNKIPAYAILKKIDISDYTSHEIGDSIWLDGGYLIIGAGNQF
FT                   FIDDRWVKLGSSAIDSTIRQLMSGYTNDDEEMVFDISYLVRVLNGPLPIFHPQFVIQAL
FT                   FIMQFTAVKKILVQLFQVIRRGDIITWDLNTDVENMFRNDEIYQPKRRMSLTLDTFTEF
FT                   NNEVADLLIERLMKISLPLLTRHQQSTLISTISIVKDFTKDMLVELDPNGIRYLISLKL
FT                   SSTATATSTTSATTKKRLAQIQWAMMCKTPDILLEHVIKHYGGKIKWKEMKDSGMPFWV
FT                   ERSSFIKLFEKMAALEFKDAPLGRICLYYLSLKKKDILIRLIKHKDDKEKNKIIGFMQK
FT                   DFTQASNRSSALKNAYVLLGLHRYLDAAYFFLLADAAKDCCRILADKVDPDLAVAVAKV
FT                   YGVEDIADNQLSISNMEYLHDPILLLNSESFYKSGLSETLIRICMIYTRMGCDYIALEL
FT                   LKNWKFSDK"
FT   CDS_pept        106948..108432
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000005382" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078285"
FT                   /orf_name="CD36_80590"
FT                   /product="G1utamic acid decarboxylase (EC 4.1.1.15),
FT                   putative (Cysteine sulfinic acid decarboxylase "
FT                   /EC_number="4.1.1.15"
FT                   /EC_number="4.1.1.29"
FT                   /function="glutamate decarboxylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="sulfinoalanine decarboxylase activity "
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAX42589.1"
FT                   /db_xref="GO:0004351"
FT                   /db_xref="GO:0004782"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG738168"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192DB26"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD40"
FT                   /transl_table=12
FT                   /translation="MTIESNLETNRSEELDNLLTKLKPRLLAYIDEADPKSSNYKPESL
FT                   GTFHEPKFLKQQFIDPDNDLDTPCTEEELFETIDKVLKFSVNTWNPGFLDKLYASNNPI
FT                   GVISDILLSILNTNSHVYTVSPVLSVLENYIGKKYAQLFFHNETCGGLTFSGGSWSNIT
FT                   SLQIARSLKYPDTKVKGNGDYKFALYTSKHCHYSVEKGAILLGLGSENVFKVDVDENGV
FT                   MDVNSLKQVIERTKKEGYTPLYINATAGTTVFGSYDPFLEISKVAKEHNIHFHIDGSWG
FT                   GNVIFSPKYRNRLAGSEYADSITVNPHKMLGIPNTCSFLLLPQVANFQTAMSLKAPYLF
FT                   HGRESGSDENYDLADGTMGCGRRSDAFKFYLGWLYYGEQGFAKRVEHAYSIMEYFVQSI
FT                   ESNPNFEIVGPQSPQCLQVCFYYHPTTVNKSNTEITRYVSRELHKLGKYLVDFSPNPVD
FT                   DTQGEFFRVVFNSPILSDKIVDELIASIISVGRELE"
FT   CDS_pept        110534..112063
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573485"
FT                   /orf_name="CD36_80600"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42590.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG323845"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192DB27"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD41"
FT                   /transl_table=12
FT                   /translation="MEKDQTKMDINSNSSLSNKDLEVQPEHLELKHHTSAEIEASGNWC
FT                   DKQINILGAKFRFSSAMCQIVLLAFVVFLTPGMFNALSGIGAAISDKKTADLANTALYV
FT                   TFSTVGFFAGTICNVIGVKMSLVFGGFGYAIYAGSLLSFNHNENKGFVIFAGAFLGFCA
FT                   SLLWAAQGTIIMSYPTEQTKGRAIMVFWVIFNLGAVIGSIIPLAENMHNQGSSASDGTF
FT                   IAFIILMICGSVLANFMLPISKVWKSDGTRVMTKTHPYWKDELIGLGRTLIKEPKILLM
FT                   FPMFFASNWFYTYQFNNVNYGRFNLRTRSLNSLLYWLAQMVGAIVLGYILDFKKFRRST
FT                   RAKIGWAILFVTSLAIWGGGLKFQMSFTREEVESKPPKISQLDFKDGAYIGPMFLYIFY
FT                   GVFDAIFQTYTIWVLGAMSNNPKKTALYAGFYKGIQSAGAAIAWRLDSLEVPYINLFAS
FT                   SWGLVQGSLVLAIPLIFFMIKDHTALEDDNMGDVVDDAELDVVKSTTVHIE"
FT   CDS_pept        112326..115889
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216677" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573486"
FT                   /orf_name="CD36_80610"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42591.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG396780"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000192DB28"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD42"
FT                   /transl_table=12
FT                   /translation="MLINDESIYLYNLTLKPPSHYISSIVGHFYKQGNSTKNAQQLVLA
FT                   SYTTLQLFEVNEETGKLELQSSQNLLGTINSIEKICISEVDGVVITSDSGNLSILEYDN
FT                   TSKKFISKIQEPMTKNGWGRNYVGENLAIDPENRCILVAAMEKNKLLYKIESTSSGSKE
FT                   LSSPLEAHSKQVSCLKIVALNTDHNNPLFGALELTPEKNFIINYYELDQGLNHVVKKKP
FT                   ASLNSDPLPDDVNYMIPLPGHIGGMLVCGSNWCFYDKLDGPRIYLPLPRRDGQTQESII
FT                   VNHVTHVLKKKNFFILLQNTLGDLFKLTVDYDFDKETIKNISITYFDTIPPALSLNIFK
FT                   NGFLFVNVLNNDKLLYQFEKLGDDLAENELVINSSDYDSLDNVRGTDTTTFKLKGLDNL
FT                   ALIDVLETLSPIIDSRINDSKLVTLSSHSYVKSITHGVPTTTLVESPLPITPTDIFTTK
FT                   LSLESANDEYLVISSSLSSKTLVLSIGEVVEDVEDSEFVLDQSTISVQQVGIASVVQVY
FT                   SNGIKHIRTVNGKKKTTDWFPPAGITITHASTNNQQVLIALSNLNVVYFEIDSTDDQLI
FT                   EYQDHLEISTTITAMAIQEHNSEKSSFAIIGCSDETIQVVSLQEDNCLEIKSLQALSAN
FT                   SSSLKMLKSSGKETHVHIGMENGVYARIKIDTINGNLSNSRVKYLGSKPVNLSVIKFSN
FT                   EIEGVLAISSAPWISYLYRDSFKITPLLEIDITNGSSFISEDIGGEGIVGIKDNNLVIF
FT                   SVGKEDSVFDPSQDLTITNTKLRYTPRKMITHGDRLFISESEYNVQGPFKCNINGNVKE
FT                   NVDEDYYEAFGYDRKQDSWASCIQVVDDKTNQVIQSLQFEENESIVSMSDVAFNKSLSS
FT                   VHASHLVVGVCTNQTILPNSYEKSYLYTFKIGKKHLQLVHKTELDYIPQVLENFQDKLL
FT                   VASNNHIQLYDIGQKQLLKKSTTIIDFSQNINKIIPQSNRIIICDSHKSSIIFAKFDDS
FT                   QNQFVPFADDIMKRQITSIMNLDIDTLIGGDKFGNIFVTRIDEDISKQADDDWTILKSQ
FT                   EGILNSCPYKLQNLIEFHIGDIITSLNLGCLNLAGTESVIYTGLQGTIGLLVPLVSKSE
FT                   VELLFNLQLLMQQFQNNLVGKDHLKFRSYYNPIKNVIDGDLLERFLEFDTSLRIEISRK
FT                   LNKSVNDIEKKLIDLRNRSAF"
FT   CDS_pept        join(complement(116872..118438),complement(116321..116808))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573487"
FT                   /orf_name="CD36_80620"
FT                   /product="Fork head protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42592.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG396792"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI000192DB29"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD43"
FT                   /transl_table=12
FT                   /translation="MSGQFITPKKRPLSELDSNGLLRTFEDPQDMINAVISTLSAPEEK
FT                   TNVSIAYANDKNQATEIQAYAKIAGKDWTFYVKSLAVSIGRNTELSAPSNTNITTPLID
FT                   IDLGPAKVVSRSHAAITYNLDLRCWELKVLGRNGARIDGQKVSVDSPNVNALHSGAILD
FT                   IGGTQMMFILPDAPAVVAPKMLEKCLLKYKEQQQNQNKRISSGPGVGGSTSFQMFDKAH
FT                   LTHSPSSISANSLQSNLDQDLSKEEAKDIKPPYSYATMITQAILSNPQGVMSLSEIYNW
FT                   IADHYAYYKYSKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWQISESYKEEFLNKI
FT                   SDGTISKTRRGSSVSRQLSLHLATHNHLPESHKYTMDQQIHNGPAAPIPQQQQQQQQQQ
FT                   KRPPPQQQNSQPHYPIPPNPMQNNTMGYITQSNIYNMPNNDRRYTPFQQQPNPLMYQQQ
FT                   QQQQQQQHIGQTYNQLGRPLGQLGQPMMQPQPQGYTSSNIKPEQNSLKRNPSISNNSPK
FT                   LAKGTDFELVSTESHSRSASYTTTQLHETSNFSSSANDSTSTAPTASTTTNGDIGLNFA
FT                   SPKKITALEAYTPERGSKGNSASTNNNNNNTNNNGKNITGGPNTNQSSPAFWNFVQFST
FT                   PNGQSPVRKSSEEVGNTSPTLNRKMKHDRTNDETTSPFKKDQRTEMIDS"
FT   CDS_pept        complement(120106..121443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078286"
FT                   /orf_name="CD36_80630"
FT                   /product="Subunit of the COMPASS (Set1C) complex, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX42593.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG595571"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DB2A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD44"
FT                   /transl_table=12
FT                   /translation="MNLSLQDPFSVAKEFPETLTNTLNYGHSVAIQFNHKGDYLASGLS
FT                   DGSIVIYEMVSSGVIAHLNQYCHIRPITSITWSKCGRYLLTSSQDWWVKLWDLSKVNTD
FT                   IDDSPVIRQVKFDGPIWSACMHPTNPFIFTASLFEDSPVYVDFTIKDQPPQITTLTTTP
FT                   LEMNEPTEGDDEEEVARKKRKKMEKHMTLVSIFTHEGNYIFTGTSKGWLNIFDTTTSTR
FT                   ELKLVRSIKLANSNIKNLMISQNGRKLAVNSSDRIIRQIDLPDLINVEDSNEWDFEIDH
FT                   KYQDVVNRLQWNSVSFNHNAEFLVASTHGQSSHDLYLWETSMASLVKILEGSNEELVDV
FT                   KWNYSRCTIGSIGLDSGIIYLWSVQFPQKWSALAPDFVEIEENIEYLEKEDEFDIIDED
FT                   ELHKKRLEEEDYVADVLKMDTTDARGFDITQDSFIIPINYEKNFYD"
FT   CDS_pept        121678..125727
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074502" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573488"
FT                   /orf_name="CD36_80640"
FT                   /product="Vacuolar sorting protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42594.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396805"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DB2B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD45"
FT                   /transl_table=12
FT                   /translation="MVLTDSVFNELSAKTLLSSSSPSIISNSTSSISESSLRKTRFDDR
FT                   ATTKTSLALKSYRNNSNPKLPISTLKETRINGGGGDDDGDDDEVLLKDIFQWNELKTIS
FT                   ETINSPEFINLHGSCLFVKSNAVYIAIITNRGNIVIFNYRREIDYILVPTQSNDETCAI
FT                   SCIAFSSDCSYLAAGLQDGSIRLWNLKRATKGNSIPNLPFYTIYPISLKSRFTQNIQGH
FT                   IINTRITYISFVGESNYQLITADDCGLVFYHNGIKKFMNLIYVTTKLLGKNDANLDDSK
FT                   FKIRCMEMLPLGSAHQITDKMGISAIMTDDLLVIVSTISLNDDTVSYVKQHFKIGKPKL
FT                   VLQEEGLPSHCLSWMPSMHTKAGFTNTRLAYCWNNVLTILELDNKSLSGRMLDFINNAK
FT                   DRNKVISKLPFKKIARLIDERIIRDIKWLQSDVLCLFFDDEMITIYSNGSALVPVASQT
FT                   IGNISDINLSKHRVLYNRESKLFIGKSLGWADILLKKLSQGLYAEALAIADSYYNSNSV
FT                   GKLTVIGLPQNRKQRAELIEPYLVKIMREAMPHLIQSDRESYITLCLNIIAYIAVPNDL
FT                   LETLYEIVQDDSVFFQALEPFILSGLILSLPPVVLKALIQYYVKGENHPSTNMGDNGDL
FT                   LTEIICTLDIKSLDIDLAIQLCKQHDLRECLVYIWNFVLNDYQTPLIEFFVDINNNPSS
FT                   ADNFKIYTYLSYILTGRQYPIDKFINNDMAAKKSICDILFTSSTISSVPTRNGNTIFPY
FT                   LYTLLKFDSLEMLSCINEFFEDSFLNEDAKLNRQYLLDALIDIFEANDEHFTDFDKCQL
FT                   SIFIARNYPKYSQFLRLSDSILSDVFNRLCENKSEAIFQDCELALQSLLPYFEPEDDYY
FT                   VEKLEMAKYYNVLINMYKSEGMFSQALRMWLKREQGNISDQSLDNQTPEMDIGGRNSND
FT                   DHDHVDQLYQLLESSFASSKNPGDRLNLVKIVKENFGRFLKLNDVSDYNTARLANLIEQ
FT                   FSPNLHLEVLKLTGSGDEGDASNEIVLSYLREVFLVSKSIDLTQFINRYIELLLLYKKD
FT                   KEVVSFVKQWKDKVDYDVAMQLFENHNIIEPQVILLVDQEKFSTALELILKYIEDNVND
FT                   TTLQEQFSNLLDLAIEICENPKSLVISKVEADELKSNEKLWLELITRLVVLANSTNTVV
FT                   GSPLHKFFNQFIHDCFKRISDHKLNNDSKSLFLNVFNKFLHQFPENDPTKFATLANIKD
FT                   VLQQVFISYSYESEILKITMRMFNRDMYKSMMLLQDIKLAKWDITTKNCANCGKPMWGK
FT                   HIDSEDLNQHWLAWEHCQRQKLWGNVKDDTFHDLKLIFFSCGHGYHFNCLERLGVNDYC
FT                   VICGKK"
FT   CDS_pept        126615..129941
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078287"
FT                   /orf_name="CD36_80650"
FT                   /product="Chitin synthase, putative "
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="CAX42595.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI000192DBCE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD46"
FT                   /transl_table=12
FT                   /translation="MANPDFNNKNNHNPFDNVSDDDDDLFDDIEPVQQGSPSQPQHHHI
FT                   ATNANNSYQFDNTPYRRSSSYDVYNNNPFVSNTSYTNTTTTPPPMLQQQQSQGLSPLQP
FT                   PLFNSNGNNNTHYQQPQQYNKYRTPTSSNSNSSYSTMVDNDDFQLSRKKTVAFTEPEYP
FT                   PLTYSPGKKRDTATSTNVYDYDLENMDDASFVANGGGGVHADFAGDDYIINPLQDADDD
FT                   DSLDPFGDDESLFSDTGEEIMRRGTTIKKRHSTRRGGRNGTLKRGKSTNTGYDGENEKL
FT                   VNNGENGNNGDEEEDDDDDDDFKPKLTYTKTIKKAKLINGNYVIDAPVPKTLLETYGKK
FT                   MNYHQDNIAREMSFVRYTAATCGPSNYVKFNYNLRQELYAPSRQTEIMICITMYNEDEV
FT                   LLARTLKGVFENIRDLTNRSDPNWGDDSWKKIVVCIVNDGRLELNKRTETLLAALGIFQ
FT                   DGYAKSKINDKSVKAHIYEYTSTVGIDAVNDKVHLACNSTPVQFLFCLKEKNSRKINSH
FT                   RWCFQAFAPILNPKVIMLLDCGTKPSRDAFFYLWKSFKDPNVAGACGEMRVALGPNKNL
FT                   LMNPLVAAQNFEYKISNVLDKPMESVFGFISVLPGAFSAYRYEALLNVNGEGPLEKYFK
FT                   GEYLHQMTTEGDSNDPDFDDERDVKEKNFQQAGIFTSNMYLAEDRILCFELVAKKNHNY
FT                   ILRYVNEAKAETDVPEKIDEFVLQRRRWLNGSMFAAGYAVFHWTKIWRSNHSLFRKLFL
FT                   QLEFYYQLVTILVSWFSLASFFLVFRILTANLGSSDMNFNVGKYLAIIFLWFYVGSVVC
FT                   TFVLAFGNTPRGTRKFYLVIAVFFAVLMAYMMFAAIFLAVHTVNSIVHNHKTDFTIALV
FT                   FTNTKFRDLVVSMVSTYLLYFIGAFMYGEPSFMFTSFAQYVLLSPTYINVLNIYAFCNI
FT                   HDVSWGTKGVEQAKDLGSAKSFGKNSDELVMIAPENLTQELNDKYVATLDNLRNMIPVK
FT                   DIPQESNKKKDDLAYYAFIRTITVLVWMLTNAILIAIVLEAGGVDILSGNKSGQTNADG
FT                   SISGNSQVFLTIILWIVAGLALFRFIGAFLFLVFKTFRPLKWKLRANRENKRNRNQNRN
FT                   V"
FT   CDS_pept        136262..138949
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573489"
FT                   /orf_name="CD36_80660"
FT                   /product="Plasma membrane H+-ATPase, putative "
FT                   /EC_number="3.6.3.6"
FT                   /function="ATP binding"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42596.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG706356"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192DBCF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD47"
FT                   /transl_table=12
FT                   /translation="MSATEPTNEKVDKIVSDDEDEDIDQLVADLQSNPGAGDDDEEEED
FT                   ESSFKAVPEELLQTDPRVGLTDDEVHKRRKRYGLNQMAEEQENLVLKFVMFFVGPIQFV
FT                   MEAAAVLAAGLEDWVDFGVICALLLLNAFVGFIQEYQAGSIVDELKKTLANTALVVRNG
FT                   QLVEIPANEVVPGDILQLEDGTVIPTDGRIVSEDCLLQVDQSAITGESLAVDKRSGDSC
FT                   YSSSTVKTGEAFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGTTLLVFVIVT
FT                   LLVVWVACFYRTVRIVPILRYTLAITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKL
FT                   SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLDAI
FT                   DKAFLKSLINYPRAKAALPKYKVIEFQPFDPVSKKVTAIVESPEGERIICVKGAPLFVL
FT                   KTVEDDHPIPEDVHENYQNTVAEFASRGFRSLGVARKRGEGHWEILGIMPCMDPPRDDT
FT                   AATVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYDADRLGLSGGGDMAGSEIAD
FT                   FVENADGFAEVFPQHKYNAVEILQSRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAA
FT                   RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLELFLGLWIAILNRSL
FT                   DINLIVFIAIFADVATLAIAYDNAPYDPKPVKWNLPRLWGMSIVLGVILAVGTWITLTT
FT                   MLLPKGGIIQNFGGLDGILFLQISLTENWLIFVTRAQGPFWSSIPSWQLSGAVLIVDII
FT                   ATCFTLFGWWSQNWTDIVTVVRTWIWSFGVFCVMGGAYYLMSTSEAFDNFCNGKKPQPH
FT                   TDKRSLEDFLVSMQRVSTQHEKST"
FT   CDS_pept        140850..143219
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573490"
FT                   /orf_name="CD36_80670"
FT                   /product="mRNA-binding protein, putative "
FT                   /function="RNA binding"
FT                   /protein_id="CAX42597.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG396817"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DBD0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD48"
FT                   /transl_table=12
FT                   /translation="MPSGSRSVSLSSGKDLKYHQPQSSTASLRSTSIGSSFFTPNNNAP
FT                   AHAHAHVPTSNSSSSNEPSFLNGENTSANCTNSTESEDNELIEPSKDIDIVGAISTLHL
FT                   DDDDDDDATATDTNSISGVKTGNKHNPQYGSITPQSLAKTRSGNSKNTWNITQSAPPQP
FT                   IRSSVSENGSHPNDQSVFVKPFELPESQEDASKKQTTNGLNLPLLGKILDSEGVKGNDQ
FT                   NTPSNNTQFYDGAIPFVPINHNVSGNGNSQIPPPPLGNIPLPMSSMPPPLPPHSMGVPS
FT                   FSPFPHPSFYQGYVPSPPAHTPNPGDYQSFEKIPSVSSPAPPVIQESQASASASQPQPQ
FT                   QQQQLPAMWNPLHSPLVRLPFGQQQLQTVYSPTQPTQSPLTPQQGQPQQQQPPFPVMPQ
FT                   HNYHQHNQYHPRPHYRNNNGMMNVHRKNLRRKEDGAKYSDAKLQDFTGSILTLCKDQHG
FT                   CRFLQRELFNETNATLIFNEIYFKVVELMIDPFGNYLIQKLFTMINLEQRLVLINQSSN
FT                   ELFRIALDPHGTRSLQKLIDVIENNEEIEIITRNLYSNIVVLSRDLNGNHVVQKILTKF
FT                   NTISHNANSSHSSKDETNHENQNQNQFIFDIIQANLLYIACHRHGCCVLQRCLDYGNKQ
FT                   QCQQLSQEIAKHTIKLSLDPYGNYVVQYVLNKYSVSQTKIIDDEEDKQVMDNIIQEIKS
FT                   NFIQLSLHKFGSNVIEKCLKITSISNDLIDNLIELDHGQAFNQLLNDPFGNYVLQTSLD
FT                   VANLEQFEQLSKILLPLLPNIKSTPHGRRILNKIQQ"
FT   CDS_pept        143682..146249
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573491"
FT                   /orf_name="CD36_80680"
FT                   /product="Transcription factor with zinc cluster DNA-
FT                   binding motif, putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42598.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396831"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DBD1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD49"
FT                   /transl_table=12
FT                   /translation="MGSSSPNSTQSSLTETSPQNATTTTTTTKPIKKVIKKSKYSRGGC
FT                   AECRRRKIKCDELKPYCHNCTRLNKICVYPTKPKFKFETPKTTFNNANNNNMNADQASH
FT                   NGNSVSYQFLDDKYNSRNLPIYFNDNETNRRLLNGSNGNNTSSLQQQNGMSFMETNNLG
FT                   PLPAPPPPPPLHPQPTKKFKISDMLSPDNDNHSNTNSNNRNAYDFINMDYYNWDTLPIT
FT                   DLQNLFDDASLLVQDSLGLFTAFENELAIGPIGQDENDNGDNHNNDFQLPVLDSSSDKI
FT                   SSSNSPSATLSPSSFGIPRKLLSNKKLIEKTLLVHDIQGPHKIYLDQLTKTKLSYHVYP
FT                   FAESIETNQVLRILLQYSLDSPYLLTAILATSATFQFIETRQLIHKEHQFKYTNISLKY
FT                   LSEAFPQESNKDNHNSGDTNNDNGNFKMMTKDIEKLLLTILVLTLNFTALAYFQRNNPD
FT                   GSTGISSVNKNNWKIHLRGVKDLLLKYSKLAHAHSNNQQYITDGLALAKTWFFAIESVA
FT                   ELNDPLGGTIKYSTKNISSHVDIIKTNQNVLDCSDSSRLWVETGYFNRGKNQDYHDALY
FT                   RIGMVTNPNLPISTQFNMFLGFSIDVVKLIDEMTKSLDLLRENKPGQLSGTCIANIFTL
FT                   ISRARNNDIVPKVNKETFVIPKESIGHPEYKEFDKLVLPKSCYTHEIINDNTTGTKETI
FT                   YYSWYDWSEQLHIDSVYMKLFHIKGLMKLPRDHPLVQELKGKVLTSMFFLKDKQQNIVE
FT                   TTKFNNVSKIFLESDHYYLHCDLFDTRAIMAQSSFRECIKIANSLLDFEKLELYFQGLI
FT                   KLGNGSSLLALDNVKKFKQNFINGKSGEDDVDLAFDSEIIPFS"
FT   CDS_pept        146825..148234
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573492"
FT                   /orf_name="CD36_80690"
FT                   /product="C-24(28) sterol reductase, putative "
FT                   /EC_number="1.3.1.71"
FT                   /function="delta24(24-1) sterol reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42599.1"
FT                   /db_xref="GO:0000246"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG592488"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniParc:UPI000192DBD2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD50"
FT                   /transl_table=12
FT                   /translation="MAASDTQSASDETTPLVRFDESRYIPKDQIEYEFGGPIGALGMMI
FT                   GFPLLMWYMWISAKFYNGQFALPSEGQSWKDFIIDDLFSKWVENGIPSFGNWAYFTGFI
FT                   LIQALFYVTLPGVWTKGQPLTHLNNKQLPYFCNAIWSFYTSIVLSLVLHFTGVLPVYYM
FT                   LDNVGGIMTTAIFYGISLSIILYLVCLFVTGDYHRMTGNHIYDMFMGAPLNPRIGKYLD
FT                   LKMFFEVRIPWFILFFLSFGLCFKQYETYGYVTPQACFMLYAHWLYANACAKGEELIVP
FT                   TWDMAYEKFGFMLLFWNIAGVPFSYCQCILYIAYQEPEVYQWSIGYNVFLFALITIAYY
FT                   FFDTGNRQKNSFRRSVAGNSQLRKTFPYLPYSDLVNPKYIKCANGSLLLTDGWYVYARK
FT                   MHYTADYIQTLTWALMCGFGSPFPWFFPIFFFIVLVHRGYRDQRKCAKKYGKDWDRYLE
FT                   ACPYMFIPYVW"
FT   CDS_pept        complement(148448..149191)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535364"
FT                   /orf_name="CD36_80700"
FT                   /product="Proteasome component, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAX42600.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000192DBD3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD51"
FT                   /transl_table=12
FT                   /translation="MSNSAGFDRHITIFSPEGRLYQVEYAFKAINSANITSLGITGQDS
FT                   AVIISQKKIPDKLLDPKTVSYIFKITPSIGMVATGSIADARAQAMRARSEATEFRYKYG
FT                   YEMPVESLSRRMANISQLYTQRAYMRPLGVALTFIQVDFADEGRGPQIFKCDPAGYFTG
FT                   VKAVATGPKQQEATTYLEKKFKKIDAVKGDWQKTVEFAIIALSSVIGTEFRKNDIEIGV
FT                   ATEGEFRILTPEEIDERLISIAEQD"
FT   CDS_pept        149524..150888
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573493"
FT                   /orf_name="CD36_80710"
FT                   /product="Histone deacetylase, putative "
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="CAX42601.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI000192DBD4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD52"
FT                   /transl_table=12
FT                   /translation="MTISISETDTFTTDSKTRENTPIYDPNHPGTNNKYNVSYHYNPEV
FT                   SRFHYGALHPMKPFRLMLTDHLVISYKLYEKMDLYTPRRATKEELLEFHSEDYINFLQS
FT                   ITPEKCKTIGNDTLAQFNIGDDCPIFDGMYDYSAIYAGASLDATRKLISGMSDIAINWS
FT                   GGLHHAKKFEPSGFCYVNDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYNTDRVMT
FT                   VSFHKYNGEFFPGTGSVDEVGIGSGKNYAINVPLRDGIDDESYIRLFKSIMEPLITKFQ
FT                   PTCIVQQCGADSLGYDRLGCFNLNIRAHGECVKFIKSFGIPMLVVGGGGYTPRNVSRLW
FT                   CYETSVLNDVSLDHKIPNYLPTYDWFGPDYSLHPQLDGRIDNKNSKKYLQSVQTTIMEQ
FT                   IRYLNHAPSVQMYEIPPDLTGLTEDEDKAIQELNEDMERDEKIMKDEAKPGELMT"
FT   CDS_pept        151441..153870
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573494"
FT                   /orf_name="CD36_80720"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42602.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG447546"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI000192DBD5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD53"
FT                   /transl_table=12
FT                   /translation="METNKLAIVLDPKSNRKIINHRYRIIKKIGQGQYGKVLLGEDITT
FT                   TVNSSTGKNNSTTISTYVAIKTINRIDKSRLLLVKNASNNISIKIKREITIMKQCNHPN
FT                   IVKLYQVIDDLRFDKILLILEYCQYGEIDWKRYNHYHEKYRKVDVESIQGKANSIPQTR
FT                   LTLNKILRDIINGLEYLHDYKHIIHRDLKPSNLLINQDNTVKISDFGVSLILENNANDA
FT                   KELAKIMGTPAFYAPELCQFVNNRFSMVTNEDHAGNKIKISYNIDIWSLGVTLYCLSFN
FT                   NLPFNGNNEFEMCKNIVKSELQFPLIKHSSKVTENDIKELKYLKDLIKKILVKDPDERI
FT                   SLKEIKVHPFTTFDLNELEKKKFFKFNQNIFRAEDCKKELDVDGSISTLSPQSSSLSKR
FT                   IKNLFSSKYPAATTTTTTTTSSPPPASSLPSTPGNSSSKHIPSNLKYNNLSLKELEHVD
FT                   DLLDSYLDDSSSLGSVEGDDEVVVDTSNILGDLDRDTNYDDSPQQLQGKVNEIITDVPE
FT                   EEKKHKPQPLDLKQAATSFPSLPPPRGNSSTSLDVTSNNDNITSPATPINENITTIIGE
FT                   SSPGNYYNSTNDGIGDFPSRPSRRSFEKQNKSASLASMTYQPTIISLSSPVKTKSESWG
FT                   GKMNNMSIHNSIGGINDNHKHLNMFEPPSIFRESKPLEGNKTASASNTENNFGSTSRRN
FT                   SNSSQHFGYGLSRITSSSSSLNLNAYLTDDDDDDGDVLNSASMPELNHSSSISTRYSLK
FT                   GMQQQHQSERKSQDNEQTEEQEDHEESEEGDSTIIANNYQIMRNYNDMSSYLDGLD"
FT   CDS_pept        158221..160842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573495"
FT                   /orf_name="CD36_80730"
FT                   /product="Protein tyrosine phosphatase, putative "
FT                   /EC_number="3.1.3.48"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="M phase of mitotic cell cycle "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42603.1"
FT                   /db_xref="GO:0000087"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG447545"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000192DBD6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD54"
FT                   /transl_table=12
FT                   /translation="MIDNEDFIPNFLQDSSSASITHTLRVKRNRPKSSYFEDFSPDASQ
FT                   EDANVENANCASPTLMRKSALRKSSSKTLNCNTNVNSKSPSPAFASTNATSGTPLRNLT
FT                   NFVIPSSVKSKTRQLTNSLTRSMTEVVSKSSHSFFNSLHLATSTTSSSVSTTTPKIEFN
FT                   SIAANDDIPTNYDSDEEFEDGDTFDTIHLDSPVQRKPSNNNNTNNSNNNTNIPTKIRRF
FT                   HSMYQTDKEIASYQLHEDNSFLKFTNIEYSHSESDLLPRIDAHQLAKILRGDHNDQFDE
FT                   FIIIDCRFEYEFNGGHITKAINISTQETLQEKLIQYQQKDVKNTESKKRLIIFHCEFSL
FT                   FRGPMMAKHLRKCDRMCNYDNYPLLTYPDIAILEGGYKTFYENYPQWCDPQGYVEMKNL
FT                   RHKKICESNLDKVRKDNKLTRAKSYQFGNQHHRGGSTGGLFSSYNYNVMNSSDQQFWGS
FT                   CTSSTAHHRSCSSSFIINNKHSSGSSYHHRSHSFVTINNEKIIKRQRSTPQVNDSPTRS
FT                   NSSTASPGKPIPLANIHRLTRANTISSDQALFSNKPMSSPMMSPLASSFEQSSIGMNSS
FT                   EISVTTQDFQPPTTSFRNSTHNLSNGSNRRRKSLSSNFSSCSINSISSSAAESDYAGSV
FT                   DSALTEPYTSSSPLLDSSDYFDNGAKRQNLIAMPISKGQPSFQRKHSSRSGSNIQASLA
FT                   NPPSLPPPTTACSSSTTPSQLSPTIQQQPYLQFQFPRSRSNNKLLATPSKSTHSFTSPI
FT                   TNNEIGTNNNLPMVSPFFTPGTDASASITANTYDGYNISTINTNCHGNRSSIIDPINDT
FT                   PVDFSVPTSISTSSSKSIRFKLHKRSGSLINSSISESQELYNVTSDEHGSQYHDQKNEG
FT                   HY"
FT   CDS_pept        complement(161097..163820)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573496"
FT                   /orf_name="CD36_80740"
FT                   /product="Peroxisomal hydratase-dehydrogenase-epimerase,
FT                   putative"
FT                   /EC_number="1.1.1.-"
FT                   /EC_number="4.2.1.-"
FT                   /function="binding"
FT                   /function="lyase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42604.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327812"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192DC81"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD55"
FT                   /transl_table=12
FT                   /translation="MSPIDFKDKVVIITGAGGGLGKYYSLEFAKLGAKVVVNDLGGALN
FT                   GQGGNSKAADVVVDEITKNGGVAVADYNNVLDGAKIVETAVKNFGTVHIIINNAGILRD
FT                   SSIKKMTEKDFKLVIDVHLNGAYAVTKAAWPYFQKQKFGRIVNTSSPAGLYGNFGQTNY
FT                   SAAKSALLGFAETLAKEGDRYNIKANAIAPLARSRMTESILPPPILEKLGPEKVAPLVL
FT                   YLSSAENEVTGQFFEVAAGFYAQIRWERSGGVLFKPDQSFTAEVVAKRFSEVLNFDDSS
FT                   KPEYLKNQHPFMLNDYTTLTTEARKLPSNDASGAPKVTLKDKVVLITGAGAGLGKEYAK
FT                   WFARYGAKVVVNDFKDATKTVDEIKAAGGEAWADQHDVATQAEEIIKNVIDKYGTIDVL
FT                   VNNAGILRDKSFAKMSDQEWDQVQKVHLLGTFNLSRLAWPYFSEKKYGRIVNISSTSGI
FT                   YGNFGQANYASAKAGILGLSKTLAVEGARSNIKVNVVAPHAETAMTLTIFREQDKNLYH
FT                   ADQVAPLLVYLGSEEVEVTGETFEAGGGWIGNTRWQRAKGAVSHDEHTTVEFIRDNLKD
FT                   ITNFDSDTENPKSTTESSMAILSAVGGDDDDDDDDEEEEDEGDEEEDEEEEEEDDPVWR
FT                   YNDRDVILYNIALGATTKQLQYVYENDSDFQVIPTFGHLITFNSGKSQNSFAKLLRNFN
FT                   PMLLLHGEHYLKVHKWPPPTEGAIKTTFEPISTTPKGSNVVIVHGSKSVDNDSGELIYS
FT                   NEATYFIRNCQADNKVYAERRSFATNPFPAPKRAPDYQIDVPISEDLAALYRLSGDRNP
FT                   LHIDPNFAKGAKFPKPILHGMCTYGLSAKVLIDKFGMFDEIKARFTGIVFPGETLRVLA
FT                   WKESDDTVVFQTHVVDRGTIAINNAAIKLVGDKAKI"
FT   CDS_pept        165942..168260
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573497"
FT                   /orf_name="CD36_80750"
FT                   /product="Glycerol 3-phosphate sn-1 acyltransferase (Ec
FT                   2.3.1.15), putative (Dihydroxyacetone phosphate sn-1
FT                   acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /EC_number="2.3.1.42"
FT                   /function="glycerol-3-phosphate O-acyltransferase activity "
FT                   /function="glycerone-phosphate O-acyltransferase activity "
FT                   /protein_id="CAX42605.1"
FT                   /db_xref="GO:0004366"
FT                   /db_xref="GO:0016287"
FT                   /db_xref="HOGENOM:HBG324690"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI000192DC82"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD56"
FT                   /transl_table=12
FT                   /translation="MPHPPPSSISSFDLHYERPKWYRLAIYDSLLWLLSVIFDCFFREI
FT                   RPRGAFKIPREGPVIFVAAPHHNQFVDPVLLMNQIKKEANRRISFLIAAKSYKLKAVGT
FT                   MAKCQLSIPVVRPQDCLVKGTGKIFVDFDKDPLRVIGKDTKFTKECMVKGLVALPQSLG
FT                   ASEIVEVISDTELIIRKEFKSSDKVKLLLTNGTTYKRADKIDQKQVYQMVFDHLLDDGC
FT                   IGIFPEGGSHDRPDLLPLKAGVAVMALGAMDKNPGCNIKIVPCGMNYFNAHKFRSRAVV
FT                   EFGDPIEIPKELVKKYANPETNREAVKELLDTITTGLKAVTVTCEDYETLMLIQAVRRL
FT                   YAGNFAQQLPLPLIVEMNRRLVIGYQHFKNVPKVQEIKEKVLHYNDFLKTLYLPDHDVE
FT                   SCNDEAHKITLIPIFFFRVFKLFILFILALPGATLFSPVFLSTKIISKKKAKEALANSV
FT                   VKIQANDVIATWKILVSMGIAPIVYSFYASVGTYYCSTHDYFSHWKLFWVWIFLYSCGV
FT                   LVTYSALLTGEQGMDLFKSIRPLYLSITSGSSIKELKKMRHELSEEITELVNHYGPQLF
FT                   PNDFNLLDLQKSLNINGDVVYADSDEEEDLKTEELRNRRIAKRKAEKKKKKTQENEDTQ
FT                   ELQSSDMKHSSSMSDGISLLNSDNSLTNLPMFSDYILHKNAKNPDLQLDPQSHFGSRVN
FT                   SNLNSGANSSVSIYDDYRFASQSEHGTASPVRYSRRPHLPETPSSDHMELNFSSKPQGQ
FT                   KTRLRDKIKTKLRENRKDN"
FT   CDS_pept        complement(168434..170980)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000036006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573498"
FT                   /orf_name="CD36_80760"
FT                   /product="DNA ligase I, mitochondrial, putative "
FT                   /EC_number="6.5.1.1"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA ligase (ATP) activity"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAX42606.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003910"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG570821"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniParc:UPI000192DC83"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD57"
FT                   /transl_table=12
FT                   /translation="MYQYCLRFLICDKRESHLEGSCTLLNCFTRKNRVSFFFSNIYILT
FT                   KHRNCLLPFFFLYSNRRKVDFLFIINYLHLNSLSYIFMFSRLVSHRYPTGVQLKQANRV
FT                   MANKKQQSLARFFGGIAPATGSDSPSPKKQQTLTRFFGNSSNNSSPKKATSETKQKRQA
FT                   TPPKSPPPSKKAKIESKSDELSSSNGDIEMETKPELKINGFGNDIRNEAEQLIKLSESE
FT                   QAKHGNEKLGVKIPYAKLASVFEAIENESSRLAIIAIISQFFLEVLQQSTIDKLIRIVY
FT                   LCINRLGPDYEPGLELGLGETILIKAISECYGRETSKIKADYKSTGDLGLIAQKSRSLQ
FT                   PTMFKTAPLDVDTVFDNSLKIAKSTGKESQSKKISIIKQMLTACQMKSCEAKFLIRSLQ
FT                   GKLRIGSAEKSIIIGLAQAFVNYENKSNKKIDASKLTEAEEIMKEAFSRVPNYEVVLKT
FT                   AYQYGIFNLLEHCFVTPGIPLKPMLANPTKSIGEVLDRFQNEEFTCEYKYDGVRAQVHI
FT                   LSDGSVKVFSRNLEDMTQTYPDLISIGKQFAVDGNTISMILDCEAVAWDREAHKILPFQ
FT                   KLTTRKRKDVNEEDIKVQICLFAFDLLYYNNESLLPKSLADRRKIMQENLSPIEDRFQF
FT                   ATATNSSSNLEVLQQFLDQSIKDSCEGLMVKMLNGSDSFYEPSKRSRNWLKLKKDYLEG
FT                   VGDSLDLVVIGAYNGKGKRTGTYGGFLLASYNEDSGDLETCCKIGTGFSDEDLLNLYNK
FT                   LHPTEIASPKNYFVYDTNNSNAVPDVWFEPSMLFEVLTADLSLSPIYKTGHQEFGKGVS
FT                   LRFPRFIRVRDDKGVEDATSSSRVCEFYQRQAHLNN"
FT   CDS_pept        complement(171028..171528)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066101" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382586"
FT                   /orf_name="CD36_80770"
FT                   /product="Uncharacterized protein YER093C-A homologue,
FT                   putative"
FT                   /protein_id="CAX42607.1"
FT                   /db_xref="HOGENOM:HBG396893"
FT                   /db_xref="UniParc:UPI000192DC84"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD58"
FT                   /transl_table=12
FT                   /translation="MTDLLHKLNFKIADASPEYKQRRKIQMIRFFTASAVTIFASRFAY
FT                   RATVSRQYIPTLFQGNHSPPLSYNFTTDAAVAVGTGTLLCGSVTGMTVFGLCWILDVSN
FT                   IQEFGWRMKSMLGGWESEKKLSEAPMDEESSYIQDSLNDILDGKYDFEEDTEEVHTAEM
FT                   KTK"
FT   CDS_pept        complement(171929..174370)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573499"
FT                   /orf_name="CD36_80780"
FT                   /product="Uncharacterized protein ymr031c homologue,
FT                   putative"
FT                   /protein_id="CAX42608.1"
FT                   /db_xref="HOGENOM:HBG396894"
FT                   /db_xref="UniParc:UPI000192DC85"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD59"
FT                   /transl_table=12
FT                   /translation="MSHSAYKASGKPLSAEALYHQRVKQGVFQSPSGTIVGVNSNASDT
FT                   AALLAASSDLSVQPSYVRSVAPEAHTAALAAKQQEIKAWERGQEDPDAGAAAVNAKRTS
FT                   TFSSTTPSTTVKVGIPSMNSNTIYKAANANSTSTMTSRINPEKDIRRSGIQSKQGATSL
FT                   NIDKINKLATKNSTKSLSSRFNPELDYRSGLKKQAPAEYLNQDEEDLAASGAAASLKHG
FT                   AGLTDQVSSQKRSQTFTAASVVNASLLKAANEKAELRLNSLKSNNPATLKAQAQLYANA
FT                   LAVAQKRADERVQNRAAGLISLGGGLTISQSELDKLASTYVQPILDDIEGKAEAKRQID
FT                   IEKKQKELELQQLHEKAKKEEQEAKEKEKRDIEIAKLERNAQNDKRKKAEDDKYAEYQA
FT                   GRNEEVDTKLQEYKDVEAKHAEEKKALLDEKKENQDRIDAEEAEKIATRKQELDELQAE
FT                   KDEILKPTLDELKEESAKLEEVTNARDELANEVKASEDLNKEYEEKLAELESKLQEAKN
FT                   DIEKYTTDLEEATAKHESTDKEVAELQELHDKEKADAEKEHEDLDGKLNELEQQKESHL
FT                   EDKATKKKEILAAIDEKVKDEHKINSELPEHLREEVDERKIRDTSSLFSEEEPEIKHVP
FT                   LIKESETADPEKKASTVAEDSTVTKAADTTAPIATKSAATAAAATDSASKRPVTPSAAQ
FT                   SPTKKKSSFSRRLSSIFKYTNTEEKSKSSTGSSSAVKKDTKPIKKTAETPAEPKKTSET
FT                   AKAAETTTAPATKQNQPAAKDAEKEAKSVKDGDVSEFADFEDDISLNRKENKGGVFTEE
FT                   I"
FT   CDS_pept        176094..176732
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573500"
FT                   /orf_name="CD36_80790"
FT                   /product="Histone H3-like centromere protein, putative "
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42609.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192DC86"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD60"
FT                   /transl_table=12
FT                   /translation="MARLSGQSSGRQTGQGTSAEAIRQQREELRRQRELRLQQQQQAER
FT                   QRQRPQYRTEQSPIVPAATSSSRYSQFGIYRNQPGDVVDTLASSLPRRTTTTARSDINR
FT                   TVPRVKKRYRPGTKALREIRQYQKSTDLLIRKLPFARLVREISLDFVGPSYGLRWQSNA
FT                   ILALQEASESFLIHLLEDTNLCAIHAKRVTIMQKDIQLARRIRGQSWIL"
FT   CDS_pept        178397..181387
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573501"
FT                   /orf_name="CD36_80800"
FT                   /product="2-oxoglutarate dehydrogenase E1 component,
FT                   mitochondrial, putative"
FT                   /EC_number="1.2.4.2"
FT                   /function="oxoglutarate dehydrogenase (succinyl-
FT                   transferring) activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42610.1"
FT                   /db_xref="GO:0004591"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289950"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="UniParc:UPI000192DC87"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD61"
FT                   /transl_table=12
FT                   /translation="MLRAFRSAVPRTQLLKSRLTILKTSVVGRRYLATDSFLQGSNSNY
FT                   VDEMYEAWRQDPSSVHASWNAYFKNIENDNIPPSKAFQAPPTIVPTVSGGAAGFYPGQS
FT                   PISEDVVTHLKVQLLVRAYQVRGHQKAKIDPLGISFGDNTTVPKELTLDYYGFTEQDLA
FT                   KEITLGPGILPRFAQGGKKSMTLKEIINFCEKTYCSSYGVEYVHIPSKEQCDWLRDRIE
FT                   VPQPFKYSPDQKRQILDRLIWATSFESFLSSKFPNDKRFGLEGAEAVVPGMKALIDTSV
FT                   EYGVEDVVIGMPHRGRLNMLSNFVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARP
FT                   TTSGKHVNLSIVANPSHLEAEDGVVLGKTRAIQQYKQDIGSFKKAMAVLLHGDAAFAGQ
FT                   GVVYETMGFANLPAYSTGGTIHVIVNNQIGFTTDPRFARSTLYPSDIAKAIEAPIFHVN
FT                   ADDVEACTFVFNLAAEWRATYHTDCIIDVVGYRKHGHNETDQPSFTQPLMYQEIAKKKS
FT                   VIDIYEKQLIEEGTFTAEDINEHKQWVWNILEDNFKKAKDYKPTSREWLTTPWEDFKSP
FT                   KELATEVLPHLPTAVDEATLKKIGNAISETPEGFEVHRNLKRILNARKKSVETGEGIDY
FT                   ATGEALAYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQNSESVWTPLSNLSEDQGAF
FT                   NISNSSLSEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVVIDQFVAGAESKWKQR
FT                   SGVVLSLPHGYDGQGPEHSSSRLERYLQLCNEDQRFFPSPEKLERQHQDCNMQVAYPTT
FT                   PANVFHLLRRQMHRQFRKPLILVFSKSLLRHPLARSNLSEFTGDSHFQWIIEDVLGDKS
FT                   EVKRVVLLTGQVYAAFHKKRASLDDKSTAFIKIEQLHPFPYAQLRDALNEYPNLEDLVW
FT                   TQEEPLNMGAYNFVAPRVEAVLGETQKYKDLKLRYAGRDPSASVAAGSKAMHVAEEEEF
FT                   LAETFRQ"
FT   CDS_pept        complement(181679..183829)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573502"
FT                   /orf_name="CD36_80810"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42611.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396896"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI000192DC88"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD62"
FT                   /transl_table=12
FT                   /translation="MATHPSLWYRDKDSLRIGGVARYTIEYTRLDPTIKRIYFRLKNIE
FT                   KSSIRAIHLLSGPFILYCHVVPCNYNPRKPFHPENVEKNTEIVFENQIKPNQAFNVSLL
FT                   LNSNSLKGQDEKGYDIFEWEIEVVSQIVITKKTEVVYDFMIGDDLHLMKKLGQNIIQQT
FT                   LTSLGTKSDMNEGIKPAIVDKVIDGINSDSHQIYNTQLKVSKLTTDDIWSNEPKDPKKP
FT                   VHLVIVTHGIFSNLTADMLYIKDQLELRVKENILVRGYRYNAGRTERGVKKLGTNVANY
FT                   ITDLIENSLYQYDKISFIGHSLGGVVQLYAIKYILMTKGPDYFEKMKIKPINFIGMATP
FT                   FLGILNEMNFLISWVLDMGTLGKTGRDLTLSKRLPAWSDINIGESKKRDSFKPVLETLP
FT                   EDPLQKFLTQFEQLVVYANAMNDGIVPLRTSALLYLDYEALGDVSELKKSKHMHVHPEL
FT                   EEADHEIQVNRSRDTVSEVPEEANQMVQDIQDAAKATDVSKQTDSSDTVDRNHVVSKYK
FT                   EFLNLNFSEHNSSNHKNKLTKRQRKYKNFSVRGTDYNVFNDVLPEDHSFQSDETNSTQD
FT                   SQTIVVPPRASAIESAINTLICPIPSNEFLINPESRSHVIFHDKYYQFNKSPQEGDNLN
FT                   KHSKVEWFASVLLRYHSKWKLEKQKQIADKYHNACGWRKVLVNLPPDAHNNIVVRRRFA
FT                   NGYGWGVVDHLCDLFRISENKL"
FT   CDS_pept        complement(184195..185076)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17573503"
FT                   /orf_name="CD36_80820"
FT                   /product="NADPH-dependent 1-acyl dihydroxyacetone phosphate
FT                   reductase, putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42612.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192DC89"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD63"
FT                   /transl_table=12
FT                   /translation="MSERQKVALVTGASSGIGYATAIEFAKRGYKVFAGARRLEPMQKL
FT                   KEDYGVIIFKLDVSDLDSVKNAKKFIESETGADYLDFLYNNAGQSCTFPATDVTDAQMK
FT                   QCFEVNVFGAIRTVRELIPLIINAQGVIGFTGSVSGIIPFPFSCIYSASKAAIHQYAAT
FT                   LRVEMKPFGVKVINIVTGGVKTDIEDKRDLPESSLYNVPGIKDAFNERRQMAARNKPMP
FT                   AEVYAKKVVTDFESAKLNGALNIYRGTMSTFLSFVLTFIPRFIVEAALVSKFKLNSVFQ
FT                   YLHEKYSKEKVN"
FT   CDS_pept        186156..188978
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093816" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382587"
FT                   /orf_name="CD36_80830"
FT                   /product="Spindle pole body component, putative "
FT                   /protein_id="CAX42613.1"
FT                   /db_xref="HOGENOM:HBG396897"
FT                   /db_xref="UniParc:UPI000192DD3B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD64"
FT                   /transl_table=12
FT                   /translation="MSSNFFKDTQNSKGVSLFGSNQCPDGTGVSSFKIQPSPAIDIDSS
FT                   LGSEFEIGLNFGKDDLQQKFLDSACEVKNDVEKSEISLATTFTESSKSNETRPSLNSCT
FT                   DASITEHEIGFESRKCLNTGARKTKTLCLFNQPKSNKTGKTEKSSSTTKKEIKKLSTPR
FT                   VFDTIQLEERSKAKTRSASNGGVSETPLRSQISGNFSAVSFSELIGQVEATKYNLEKEL
FT                   ELTRRKLSKIEAEKLEKEQYIKNLSDVNSRTKSQVEALFKHVTQLDSDFNDLRHDKDKA
FT                   EKKYQKIKDDTNRYKTKVGEFFSTLDELKQSMNSIRMQMQVHFKVKELELQQKDVQLDE
FT                   MSGLLSEEKIRLAEMQKISFDSSKLESKILELCRALVIDISGRFSNEIKQAIGSENLNS
FT                   SLEDKFAFVEKEFKNFISTSIASKIAELEAAIVNKDQNLSSLVCSEFQKAAALESANHL
FT                   TTREQLSIQIENNIGLMQKKILDDQELRSDYDQKLALLESEITQLERAKVQLESELSSH
FT                   KTSSHDRILHLTGKSNELEQELATARQKVIECDSTAEKSLHDLLNVQEELKLKNALLNE
FT                   KDAELCELQKNFKVEVAAFQSKTSKEKKEHLLIVESRNCLLKEAEVLKMVIRSISRDYE
FT                   ICQKVKADNDLERDKWKIKYDDMKSQNNLLMETLKDCFAQNQETNDTVSQLIQQHKEQL
FT                   NIIKKDLEAEHKNSIRLEQANLKLQSEIQSKELAMKPEESITYCKRMFDVFGEALKNEE
FT                   ALTKGLGVQIKDISEFMKSDSASYKCDLNNLNETLSSLKIQLKHPMEVSSFRFDNSCTL
FT                   GEPKQSNNQQLLLPLNNQNLRVNNPTAVMESSAKLTQRIKGRKKTLKSQETEISQESHK
FT                   MHRIHTSVDSNSGANYCKDTISSASIVDHKKLNLTNRNSKKTLNKQIADDVFSLSHITS
FT                   SPPSKKSKKK"
FT   CDS_pept        190622..191419
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573504"
FT                   /orf_name="CD36_80840"
FT                   /product="Acetate transporter, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42614.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI000192DD3C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD65"
FT                   /transl_table=12
FT                   /translation="MPSTSSQKSVGSSVVDENDPQVGKVEVSGDGGEFVVINRHKYYRH
FT                   ELMAAFGGTLNPGAVPWPKININPAPLGLCAFALSTFVLSLYNAQAMGIKIPNIAVSLA
FT                   LFYGGLAQFLAGCWEFVTGNTFGMTALTSYGAFWLSFGAIFIDSFGIVAAYEKSEETVP
FT                   QLKNALGFYLLAWAIFTFILWLNTLKSTVAFCALFFCLFVTFILLAAGEFSGKTALARA
FT                   GGVLGVITAIIAWYVALAGTATTTNSYFRPISIPMPGNVAFKK"
FT   CDS_pept        192478..193275
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535365"
FT                   /orf_name="CD36_80850"
FT                   /product="Ammonia export protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42615.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI000192DD3D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD66"
FT                   /transl_table=12
FT                   /translation="MTSSSSQKSVGSSNIDADQAPIKKVQIAGDGGEFVIINRHKYYRH
FT                   DLMAAFGGTLNPGASPWPKININPAPLGLCGFAMSTFVLSLYNAQAMGIKIPNVVVSLA
FT                   CFYGGAAQFLAGCFEFITGNTFGMTALTSYGAFWLSYAAILIDNFGIVAAYEASEETAP
FT                   QLANAIGFFLLAWAIFTFMLWLNTLKSTVTFSSLFFLLFVTFLLLAGGEFSGKVGVTRA
FT                   GGVFGVITAIVAWWNALAGTATPTNSYFQPVSIPLPGNVVFKK"
FT   CDS_pept        194281..195921
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078288"
FT                   /orf_name="CD36_80860"
FT                   /product="Ubiquitin-protein ligase, putative "
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42616.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG396898"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192DD3E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD67"
FT                   /transl_table=12
FT                   /translation="MPDDSGTSNDRNNSNNLSNGSDEDSNNRRRNEDNQHSHSNRNDRT
FT                   SASQNSSSNRSNSNRSHRLDFGIFDRFMDTFLRGSRGRNHNVRGPSPVRNDISEQLTNE
FT                   NNARDQQGQSEQSSQRLSSEPPSSTSSASNRDEESDRAIIITVNYVFSDENRPAVPNRS
FT                   GSLIMSLPNNASNREPSVIQEFIRLATQMAYSSIVTGLNRERGTTIEKFKSFDNVKLHD
FT                   LGENQICSICYEKFEAEEEDETVSHKKRRLVDETSQTTSSSSNARNTREGESEEEQPSP
FT                   SNPSQPVYLSEYVGEFNHSAVKMPCSHIFGKGCLCEWLKLHTTCPLCRFSVSEETTPET
FT                   DTNDRTNNVSFFTIPADGNTNPLGNVTVQNNFSNAPSNDQPPPRVHYFGFSPIPSPGST
FT                   TPSSNSRSNPIETPLRRIFRSTRARREREARQNQESNDFPHIDPFAFDYLRNRLATSDR
FT                   QPEPLFPFGMSSRRTANGVETTSTDQVGSESEDNLNMRSLFDASPMPEARRNEDDTRVG
FT                   NGRSSNETTSNNESSTNISHGDGDDVDNL"
FT   CDS_pept        complement(196142..197371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382588"
FT                   /orf_name="CD36_80870"
FT                   /product="Peptidyl-prolyl cis-trans isomerase, putative "
FT                   /EC_number="5.2.1.8"
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX42617.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI000192DD3F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD68"
FT                   /transl_table=12
FT                   /translation="MYFFFFFFFFFSIQLLSLLVATTDFLVVPIDKLSSMQIEKVRSKT
FT                   YFDITNGSKKLGRVVFELYDDLAPKATENFLNLCKGITLNDKTYSYQNTSIDKVVKNFM
FT                   IQGGSLNGNVSTIFGDQGINKPIPGENLSDDLSHAFKLCMANNGDVNCNGSQFFITTSK
FT                   QSHMAGKYSVFGHVIHGKSIIREIERVKTNKDDVPESNVVIDHCGVWTDDMPVPIFNAS
FT                   YDTIGGDIYEEYPEDDDSNFNQESTEEAFNVASQIKESGTLLFKKGDQENARFKYIKAL
FT                   RYIMEFIPDPDQDQEWYKKFIDLKKKTYLNLSLCCLQLKDYHRCIDYCSYLLDMDESVL
FT                   TKQDKTKTLFRKGSANVGLKKYKLGLDDLKLANKLTPDDVGIQKSLESAEKLFQQQKQN
FT                   EKATYSKFFS"
FT   CDS_pept        197421..198563
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248823" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382589"
FT                   /orf_name="CD36_80880"
FT                   /product="Conserved hypthetical protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX42618.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG396899"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI000192DD40"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD69"
FT                   /transl_table=12
FT                   /translation="MITRSRYISKRLYSTNYSAILFNAQENVNQLLESQDRSSYILAQY
FT                   IPEPVRNTYLAIRAFNLEINKINEGGSNVQSRAARASSQMSNTLGVSTADLKFKFWSDL
FT                   ILRVFTEDSRNETDLGEPIAILLRDGLKHDFNLDISYFQQFLQTRRHFIKNNSSFQTVN
FT                   DICSYGEGTFSQLNYLTQGLLLSPSISPSVIRLLEYSTELQSQMSDIAAHIGQATAVSS
FT                   MILGVPFYAQSRNQITLPVDLMTSSGLSQESLLRLFQGHIKDSTEENQIKEALKNVVYE
FT                   TAITANDHMLTAKSKLEKAKQEIIKIVQEHPQDQLLNKYSKKWRKGIPDSLYVPTMASI
FT                   PTSLFLNKLEKCNFDIFHGRLQKEWRLPMKSFYYYHMRLM"
FT   mobile_element  complement(199007..199125)
FT                   /mobile_element_type="retrotransposon:solo LTR, kahu C"
FT                   /note="truncated"
FT   tRNA            199188..199258
FT                   /gene_name="tRNA-Gly (TCC)"
FT   CDS_pept        199509..200174
FT                   /pseudo
FT                   /gene_family="HOG000185113" [ FAMILY / ALN / TREE ]
FT   CDS_pept        202285..204654
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573505"
FT                   /orf_name="CD36_80900"
FT                   /product="Flavin carrier protein, putative "
FT                   /protein_id="CAX42620.1"
FT                   /db_xref="HOGENOM:HBG396900"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI000192DD41"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD70"
FT                   /transl_table=12
FT                   /translation="MLSSVVFSILTLILSCFVSTTEARRKLSATSLVTCMDNSQISPSY
FT                   FNVTFNPDDRSLRYALDLTTSISGYITAHVQVYAYGFLIIEKDINVCSLGWKQFCPIYP
FT                   GALQVDSVQYISSEYTKQIPGIAYQVPDIDAVVKLVVKERDSQETLSCLQANFSNGKTI
FT                   SQTGVKWATACIAGLGLIVAAMLSTFGNSNAASHISANSLSLFLYFQSVVVVSMQAVER
FT                   VPPIASAWSENLAWSMGLIRIQFMQNIFRWYIQSTGGSPTTYFISTTKQVLVQKHKRSL
FT                   DYVAGVAKRSLEYALRSHSNLYVLRGIKRIGYNSKIEPTSIVATGYTWFVLIGYLLVVL
FT                   MVLVKSVIVLLTRAKKINPRTFNSFRGSFPNLIKGSLLRYIAIGSTQLIIFSLWEFTQN
FT                   DSPAMVVLAVLFVLLLLGVLGWSYFNVMRIGKQSIRSYNNPAALLYGDNKVLQKWGFCY
FT                   TMFHANKYWFGVVLMGYNVFKALFIAFCQDAGKVSVLPVFVADLAYTIYLIWTGPYLNK
FT                   PTNVINYMMSIVTTINSFLFLFFSDLFGQPAPVASIMGWVFFILNAAFSLILLILVIVF
FT                   VLLSVVSKNPDARFAPAKDDRFSFQRKSSIKHRSFTEKNASGNKDGGDEELTALGVAAQ
FT                   DHSADWESQMYKLNDLSLDEEDDSRTNQDFVRPDNANELTSDYDEGEEDEDNTRIATDD
FT                   DKNKKLAAKWKSKISRKLSKKKSVKNKNDTTTVRRLSDTLINDERDSNERREENDELTP
FT                   ITNPYNQSTAFNNHKRAQSTTSTLSNNNPTNTKGFI"
FT   CDS_pept        complement(204895..206139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229722"
FT                   /orf_name="CD36_80910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42621.1"
FT                   /db_xref="HOGENOM:HBG396901"
FT                   /db_xref="UniParc:UPI000192DD42"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD71"
FT                   /transl_table=12
FT                   /translation="MDKLFPVYFLLYIISFIHCKLFYNQQHKICNPKQSASFFPFTGFK
FT                   ITRQYKISGYTLPVSMHFITISHCNHGQVDYQKVIRTDSSGKIDWGKPFCMLKPKLGEM
FT                   LTLSNHDTIGDPEIQDNIEETDEFMIGIFGFIMYKGNKLTRLLRKKFDLQLEKLTNGKW
FT                   LEYTGKNKNLHQQDLMTTDPQASLTWESRNLVCYKMARRKKYAKRKFDFYMPHTFVGGL
FT                   FECILPMDLKQQIFHQFTSSDLIFQQIQIQCDPNLSRPISPLIAEDSTTQWFENKLYNI
FT                   VNPGIIQTIPYLTTSTPLNLRFSTSETPDMFKDSWATKIEVNENYVYREADVHLISRAI
FT                   ALSADLLNKLISPIDFNQLVKSYNKANERENPDMEEFLQDITWTQKVHLWLSTIDRKIS
FT                   NQILTQIEGFWDDME"
FT   CDS_pept        206423..210028
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535366"
FT                   /orf_name="CD36_80930"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /function="ATP binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42622.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG330916"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI000192DD43"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD72"
FT                   /transl_table=12
FT                   /translation="MDQQQTNKAHRGGTKKPGAKKKLHQDGQNKKAFAVSAPRKLERMA
FT                   RRSHDVNEKKLHVPMIDRTPDDDPPPVIIAVVGPPGTGKSTLIKSLIRRLTKTTLTEIN
FT                   GPITVVSGKRRRLTFIEVNNDLNSMIDIAKVADLVLLLIDGNYGLEMETMEFLNIAQHH
FT                   GMPRVLGVATHLDLFKSQSTLRTSKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDREIL
FT                   NLSRFISVMKFRPLKWRNEHPYLLADRITDLTHPQKITENPKCDRKVAIYGYLHGTPLP
FT                   IEHAHIHIAGVGDHYVHSVEKLPDPCPTPYFEQKLEELERERMKNAAASGEPLAKTTRR
FT                   RKRLEDKQKIIYAPMSDVGGVLVDKDAVYIDVGKEIFKTGTGTSELKGEGEKLVNDLQE
FT                   ISQTMTERLEDGPGLQLFSSSKALNQVDDELQEEDEEESGLLSDEETIVDTGRSSLRKA
FT                   RVYGKSVSEDDEFDELESDEEDGDQLSDDDSDDQGNLKSRGMVEVDFGSNNKYKENDLE
FT                   YVEDSSLSSDEDYYKKSAAKLTGSVRRKWDINKLIYVKNIDAKEVIKKWRNNDIDEEDD
FT                   EEEEEDIRQDDQDFFVKKKIEDNKEDLDTSMPSFPTLESLKEKFNPNTIDENNSDEEYE
FT                   NGYKILKSRLLVAPKMTDDTEEGEEEKEIKENDDDELYGDFEDLEATENQEQEQEQEKS
FT                   SAEEDDFADFDAEEEKEKEEEEEDDDEIDEESMTIEEKRQLNAAKKAKLKMQFEEEEDR
FT                   EFGASDPEDEAETWYEYQKNKMAKQLEINKAQYEEMTPEMRIKIEGYRAGSYVKIVFDN
FT                   IPCEFIDNFDPRYPLVLGGLLATESRFGIMNARIRRHRWHKKILKSQDPLILSLGWRRF
FT                   QTLPIYTTSDSRTRNRMLKYTPEHAYCFASFYGPLVAPNTTFVGFNIVDSKSTTGAFRV
FT                   AASGIIEDINSSVEIVKKLKLVGYPYKIFRNTAFIKDMFSNSLEVAKFEGAQIRTVSGI
FT                   RGEIKRALSKPDGYFRATFEDKILMSDTVFLKTWYPVKVKKFYNPVTSLLLGQHSEWKG
FT                   MRLTGQVRADENIATPLNDDSQYKKVERVERRFNPLKVPKSIQAELPFKSKIHTMKPQK
FT                   KKTYMSKRAVVLGGEEKKARDLMQKINSIRKEKDTKRKIKKDEKFKEKLKKIAKTEELR
FT                   KEKERERKKEYFSKEGKKRKLGSSDGQAFGKKQRV"
FT   CDS_pept        213249..214997
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229723"
FT                   /orf_name="CD36_80940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42623.1"
FT                   /db_xref="HOGENOM:HBG396903"
FT                   /db_xref="UniParc:UPI000192DD44"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD73"
FT                   /transl_table=12
FT                   /translation="MATTTKTKKKKLVYRQDPDGVFRLKKIDDNNSIKSVDLANKKKEV
FT                   DNYLNELIDCSYSIVDDIPDKEIAQEEEKIINNNNPPQSYPEPEPQPQPQPTMKKVKPT
FT                   TVNTSSKNLTIKPASTPPQPVVVVTEKIGEAKPEKKTSPPTPPTTPPQPPQEETKKKEQ
FT                   DTLITDIPSPTDFVTHEEIGEKKVEEVIIPAKPSIMSTFRELIRFHIPSFAFGIIATVI
FT                   GTRYKDEIIYGAIGLTVLATGLAIVGILGLCLCLYLGLVKQSDLKVFSRYIDILKFRAT
FT                   EERPEEKVVVHEEIVAESESEPEHEHEHEQSEEVNMEEPQPEPQPEQYVAHDTEVIREI
FT                   PIEPQPKLYQPKQKRASHPKVTPILIKDPHTQETGYQPLEEPQPPKPRRKSSTIRVTPY
FT                   VYEPREPRKYSVIPTNNTIPLPGDSPTKTTTKHKLVHPKPLLQRIQTEPIKDLSRRNSK
FT                   KSTGSESPTSTRSDPYYLLQNVPHHTKEKPHEIPPQVFKTKELPNLPHQAEELPFINEV
FT                   RLVDAVSDDESDMIIPMEAPTSHYTAAIHDDNIYRNQSTKSRQSVLGTRANYRRFVSNV
FT                   DNDYEY"
FT   CDS_pept        215431..216918
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229724"
FT                   /orf_name="CD36_80950"
FT                   /product="Actin-like protein, Arp9 homologue, putative "
FT                   /protein_id="CAX42624.1"
FT                   /db_xref="HOGENOM:HBG396905"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI000192DD45"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD74"
FT                   /transl_table=12
FT                   /translation="MPLYKEDNFLIIYPGSKHTLFAFGLSDTLSPPQFKIPSVVYQDSI
FT                   TKQYQASSTNSTSETTIEEIYPIIESKIVNLDAFNYLLKIILQSVIANHPTITINQIPM
FT                   LLITPSLTWSRQSIEYITKYVIENLEITAFNIIDLSLAATFGIGQSTNSIVVYVDEENI
FT                   QIVPIIGYQTIKFAGKLIKNEGGITITRELKQNLPNLTFQQIEDLKNSNIFEVVIDQQG
FT                   LVLDYIKDINIINKDEDNEFDVAKIVTDNENGLPGTITGISNENKNENENENEKEQQQD
FT                   SNKPNKELEKNYFIDSKTQEKIWIGKERFSGTNNLVKLISSSIYSSLLLIPDIDKRQDC
FT                   YDNIILTGSIFQTPGLKEAILIKLNQDYLIKEPNFIDQSINDPSVNTAILKYQQSTTIN
FT                   DYNENDNNNNNTTTTNNSNSNQVPNSIKLVKYPDYFPEWKKPKEKGGSWHDVYFLGGQI
FT                   YSKQIYSGSSHHHGKELFVGSDMYEERGPQSIWDASI"
FT   CDS_pept        complement(217112..218044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093820" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573506"
FT                   /orf_name="CD36_80960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42625.1"
FT                   /db_xref="HOGENOM:HBG396906"
FT                   /db_xref="UniParc:UPI000192D27E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD75"
FT                   /transl_table=12
FT                   /translation="MEPIINQYIEFLENDVKKDTSGLAPILRSVSLFGKKVNDSNLELS
FT                   KNSKTPVNSATKITIIKGYMCMLRCQYVEAENHFTQALNEIPNEYHSQLSLLKSYNQMT
FT                   GTSIFKKKELELMLHNVQKLELDGSLKQQILAKIYHDLHNIEESSSSSKSRKTGKKKNG
FT                   ILKLNQRTDYLKSSIETYIQAIIMAPVDDLFIPSLYDHILSLLITNQINIRIIAFFYQI
FT                   RYHFAIRADYEYLYIPGVLDDFNVVPSSVNGDVIYDIKQYLEKGIINGSTILKEDHADY
FT                   VKYWMKEYRKEHKVTQTIKYYYDKVFMET"
FT   CDS_pept        complement(218347..218937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093821" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573507"
FT                   /orf_name="CD36_80970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42626.1"
FT                   /db_xref="HOGENOM:HBG396907"
FT                   /db_xref="UniParc:UPI000192D27F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD76"
FT                   /transl_table=12
FT                   /translation="MCKKIIQTLHVYSINKTSITMNLFSKLENHQSNEDHPSLILFPDF
FT                   LPEMLSFTTAENERIQDLYLQLCSLFNHHNYNEILFLLPQVSSFSMLPPIINLIIGATM
FT                   IRMGRLDSGFRELAVAIIMSSRGEQRIGFLIVAATLHAELNDKERVQGYLGEILDLSRQ
FT                   VVQSSEEFDIVKENLEELENTLLVKLENIKDKE"
FT   CDS_pept        complement(220490..223510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093823" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573508"
FT                   /orf_name="CD36_80980"
FT                   /product="Protein Cin1 (Chromosome instability protein 1)
FT                   homologue, putative"
FT                   /protein_id="CAX42627.1"
FT                   /db_xref="HOGENOM:HBG396908"
FT                   /db_xref="UniParc:UPI000192D280"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD77"
FT                   /transl_table=12
FT                   /translation="MDDFENEQILTKKSVQLHNDIDSLLSKLESLVKAVEITYEDRQRL
FT                   IQITTTKINLIINEFETNPKLLDSYLKDYINRLCDLFLNQLSIRSQCGEIIYNLAKIRQ
FT                   MKNIILYFPSDLYLINKIISIADKSTNEFTTFYGLLWICNLSLLPFSLNSIDINLSTTI
FT                   YKLGIENLHKYYNGSKNQIVSSILLSKLLTRNDCTQLLVEFFQIMDINNWVVLDAKSKL
FT                   SYYLTVNKLLKSQNIIDENELLKINQCINNDLLQVKHVNPSNLNVLYSVKILSKLALNY
FT                   ISRKDFLQVQSIINNLINDILLETGNFDYNLRYCMAKALSNIVNKLSNYAINYEEQLIE
FT                   FIFSNLDITDNMSISKNHTILLTLGYLCLNKTMPNKYIRKLLDIVHTTMFIKIKTTHSQ
FT                   RADLGNCIRDSSCFITWAIIKNQKYQNELITMDQLSIIFVDLIKLLIFDQELLLKKCGI
FT                   AVLQELIGRYGQKIFQNYYEDQELLGEFIINFMESFSDVRLRQKCITFEMIDLLYDKID
FT                   LKFLLSSLLDEIYNNDDLNDDLNDDLNDDLNDVDILGLYLHKLLVQQDSLLSVVEYTYN
FT                   LDEIKLNLIDKNRWKYLYNLPVVPIQELSKKFSNFEYYDNSQLLSGYLTFLLNKIELTN
FT                   LDWENLFQIIKLNDGKFDNYIGRIIQLQNDVPKDSLLHLLIKNNVTLSTTIFNFHNWTI
FT                   QDVEYIVNMIKNPNMDIEIRRNLIYNINDNYTTYPIIDQMYSLFDDYTLTVQGDIGGKL
FT                   RLAMIELVQTHNLMNETIKLKLIRLSGEIIDKIRFSAFQLLVGEETINGNKYWQDWFDY
FT                   YKSLNNDLEKIEFWKGSLHTIGSFKGDPKIINNALTYLLIYEPQREDFNIWLKLLDKSP
FT                   DNKETSRELKLKLMILQTFLKLFQANYNFNNYIDFNELYEKCYKLYSNGGNINRISIIL
FT                   RLFYYIAKKSFNNPNLLMKIHQQFTRFLKAKYLCKLRFDEIFLQIILDKNGDLQRYEQI
FT                   EWGDLSTNDIIFIREFL"
FT   CDS_pept        223665..224147
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229725"
FT                   /orf_name="CD36_80990"
FT                   /product="Mitochondrial ribosomal protein, large subunit "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAX42628.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG690556"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniParc:UPI000192D281"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD78"
FT                   /transl_table=12
FT                   /translation="MFCCLFFFFFLSLCLSLFDKSSNFHHERRERFYNLTINTILILSL
FT                   QTTTHTNTHIFIYIYIPLTMSTVPKQLYYRITQIRSSIGMPPKTRNTLTSLGLKRRFQV
FT                   TYVKVDQSSAHQLALVKELVKVELSEEKKTRQEINQERKYKPGFELIKDGMKKTYT"
FT   CDS_pept        226518..227210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573509"
FT                   /orf_name="CD36_81000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42629.1"
FT                   /db_xref="HOGENOM:HBG398500"
FT                   /db_xref="UniParc:UPI000192D282"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD79"
FT                   /transl_table=12
FT                   /translation="MNSIDYSFPQKFVPTTVNLDLHIDIPNHTTTTTSTTITIQQPIFK
FT                   QFTTKTFQDPLNDILKLSRQKIQNYQLSLPSYEEEEEEEEGETHKDDDDDDDEVKSELE
FT                   NNKENDIVGDSKTIDINQSTPIKKLPQLPPQLPQQLPSVPLRNKKSDNLACHADNILRM
FT                   AIDSTIISSNSFTINSFEEEEEDDDDDFLQENSLIQLLKYKNSKRDLRFKPPIIKFDIN
FT                   ADDINSVL"
FT   CDS_pept        complement(227281..229491)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382590"
FT                   /orf_name="CD36_81010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42630.1"
FT                   /db_xref="HOGENOM:HBG396909"
FT                   /db_xref="UniParc:UPI000192D283"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD80"
FT                   /transl_table=12
FT                   /translation="MFKNAIITMKNIRSKLNQSYKYNAQFLRLQHNSAILNQHQHQHQH
FT                   QRQRQHQSITNSTASSPLNSPKFNSNHVKSSLPNNHNHLASKQLTNINVDQILSDISKC
FT                   NDYNNLTKYISTINHQQHLNSQNSIFQLLTKWIKFNNKFNNKLPSFNALNGIFESLIRQ
FT                   HELITTTTTTTTTKNSSYVSNLLILYLYLYRFNHSALNILPLNLVWLQYGNPLIYNVYF
FT                   LTYLKNLFNTNQNQLCIITLINELKITFQIDQDMEEIKILENLPRSMILYMIEMKNFDS
FT                   LNFLISRFLIHKVIIDNELWNLLLQLGLENNNYQLVTLVYDNYIMKDFHQGKITLDDII
FT                   LNTKLLSSHNSTVVDLKSFGDSLIFQILHTISMNGDIKRTEELITSHFIYKSLSNMDHG
FT                   LTKELCIKIIESYCYNKPDNIKSLSSSSVSDNSVKEILSLIDVILDNQKNLSSIDFFEC
FT                   MNYKFKNWTITSSNENMSDSQQQRPPPPPPPLPPLHEEEEELPLLQGNKNLHNSKYGII
FT                   LANLSNLHEFINIHMNYMDENNHKLETKTIFINCLLNHIMIFLNHSGVVSLLKNLHYLK
FT                   GSSIITNNYLDSISWRLIIKSLSNSTSKKCGRIYYNYLKSRQKDIEITPLMYSQLIMTC
FT                   INDDSNGYYHDVLFYIMEYFKDYSKLSDEIKEVLEYGGQFDINVQNLLDNIINWQNSNK
FT                   NIETLLSNLKDIQLQPIENLIKRQYLEKYDLRDSEILMKIFQ"
FT   CDS_pept        229735..230799
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000265011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573510"
FT                   /orf_name="CD36_81020"
FT                   /product="Methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX42631.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG678410"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000192D284"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD81"
FT                   /transl_table=12
FT                   /translation="MNKYISITRSLATAAKKSTNSTTTKTTTTKNSQPPQFKVFDKSTK
FT                   LLQRSKHAKLTPELSRKKDYLRDEIAIKTIERLAFITRPMDNLLDFGSNAGNFLNQLIK
FT                   DSKIPPPPQGKNGDDEDDELEVKLIEQLNKDKQIVRNKIKNLIMFDTSKDLLYRDVNET
FT                   TTTLSNTSMKITRCVGDDEETFNHEIFKNDNQYDAIISNLSLHWINDLPKVLTNIHRIL
FT                   KKDGFFMATLFGGDTLYELRTSLQLAELERKGGISPRVSPLIHLNDIGSLLTKAGFSML
FT                   TIDSEDIIVNGYPNIINVCEDLQIMGENNGLISRNYLDRDVLIAADQIYKSLHGDEHGL
FT                   PATFSVIFFIGWKN"
FT   CDS_pept        complement(231161..233899)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248820" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078289"
FT                   /orf_name="CD36_81030"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42632.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG448495"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="UniParc:UPI000192D285"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD82"
FT                   /transl_table=12
FT                   /translation="MPSQNHNREVIIKLSITRTHNTPPDSTTTTTTPTTTTNRIEKTIC
FT                   VRRELFTKIKSKPALTEFLNKQLPGYLSNDDNYLVYTRKSKRNKDFVSLLTDDDFKSLA
FT                   RSLKVKNHVKLNVIDTSTPPKVNNTNQENNNNNNNNNKNNNQQYGYTYTGTTYKSGKSP
FT                   SIDFGNLRDALIDAAYDHFKEIFNEFSNGLKKEMASTTTTTATTSTSNTKESPPAPIST
FT                   PAEPVVEEPKVETKTETESKAEPEVETDSSPIHPNICCDVCHPYDFVPLKGIRYNCLVC
FT                   SNFDLCSKCEAKQHIEKLEFGSHSYLHPMAKISYPTMSSTSTRAGFGHGNHFSRVGNNC
FT                   GFASTGGIGGIGGGRGHGHHHQQQWTANDIVYDIPLENCNADTKRKLEELLKSKGFERF
FT                   IKDVEHYISNSERYEKLCAMMDFEEEEDEEVKYLILMSALEYANNEFNEEELIASFNQS
FT                   TTTTDKESEELTSSEPPQEQQQQQQQQQQQPESESESESGVLNAEGDVIARPKNFGGNV
FT                   SQIISLQLINNTNETIQGGELLFEFFNQDQTIPVTVKNASDIKPGRVKYYHLGKIPEDF
FT                   KKTDDNNNNNNNNNNNNNNVQLRITSPNAVLLGDYKFNNDSMLKLQVIKTGSNSTTTTS
FT                   VISGSTLQQQEEEEDLLVLQPNDEVQVTLVPKSSTLAQAIITNKSHKAIDCNNLKLEII
FT                   NCFDKPVSSITIHKKHSIMPGKTAKFNFTLINTHTKYPFKFILQNDYNIASCDMTKDDM
FT                   SGNLVFEENCCPMEIDERETNSPSSCSSSSGTESIIDDDDDDDDDDDDDDDNKNNEEEE
FT                   EEMGGTSGEFSSGSIHSIVLPSLPKESFIATSRYFDANSDVTNEQGVKDKDIPINADVD
FT                   ADVDVEAEASTDEDYDIISGAEEEDPVSDFEVLSAVSTNNQ"
FT   CDS_pept        235349..236575
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176389" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573511"
FT                   /orf_name="CD36_81040"
FT                   /product="Protein disulfide-isomerase, putative "
FT                   /EC_number="5.3.4.1"
FT                   /function="protein disulfide isomerase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAX42633.1"
FT                   /db_xref="GO:0003756"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG523089"
FT                   /db_xref="InterPro:IPR011679"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000192D286"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD83"
FT                   /transl_table=12
FT                   /translation="MKLLSTTLLLYFFSTSLVLSYTTSNIIQANDNNLQSLIKTPGKFS
FT                   FVDFYADWCRHCKKISPIIDELSELFIDYPEIQIIKINGDKDGKKMSKKYVDIGYPTLL
FT                   FFYDDGEKKIEFDGIRDLNSLSNFIQQLSGIRLKNESEKGAVNNIEEKESSSNVNGVVE
FT                   QTNNKLIELTPDNFDEKISQSPISIVSFGASWCKYCQELDPALDKLANEVYIRDIDDNK
FT                   IMIGHLIIDQYKDNSIDERYNIQDLPTVLFFRRNGNGDDDLQTPLVYKGKKNFYNLLND
FT                   INKFTGLNRDSQGNLNNDAGIIKEISQLIKNFNSDDHDHNDDGDELEIYDQLEKFKTTT
FT                   TSGGGSGSGSGSSGGDDVEYYEKLINAKEYIPIELSRINNILQNDIDKLNGITIDSLTK
FT                   RANILKSLL"
FT   CDS_pept        complement(236680..237618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382591"
FT                   /orf_name="CD36_81050"
FT                   /product="Actin Patches Distal protein 1 homologue,
FT                   putative"
FT                   /protein_id="CAX42634.1"
FT                   /db_xref="HOGENOM:HBG396546"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192D287"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD84"
FT                   /transl_table=12
FT                   /translation="MNIVKNLFKGNQTTTDKEIQDKGFEISQCSETCESCSSKFPKSLK
FT                   FEGEGTPLWNTTKPYGMHIIIATGKKDWSHDAINEDGKNKHTLKYKIGKWAEENTNSSS
FT                   SSSSSSSSSSLGTIKVNVSSMGSDDLYINENYKLEKQGDLLILPYFLNIKGITIDEVEP
FT                   ILNELKSLLLINKHDTTIEEITSKIPKISPNLNQSFVFFCSHTTRDKRCGITAPIMKRE
FT                   MDNYLEELDLKRNFGDNRPNGIQTEFINHIGGHKYAANVIIYLKKSGKNIWLGLCKPNN
FT                   IKPIVDECILGDGRIWPDKVRLIQKFDPIEW"
FT   CDS_pept        240213..242480
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573512"
FT                   /orf_name="CD36_81060"
FT                   /product="Phosphatidylinositol-4-phosphate 5-kinase,
FT                   putative"
FT                   /EC_number="2.7.1.68"
FT                   /function="1-phosphatidylinositol-4-phosphate 5-kinase
FT                   activity"
FT                   /protein_id="CAX42635.1"
FT                   /db_xref="GO:0016308"
FT                   /db_xref="HOGENOM:HBG588608"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniParc:UPI000192D288"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD85"
FT                   /transl_table=12
FT                   /translation="MLQISSISQTFKFKSKNSTSSQSLNQSKDTSDTLNILSEEQQQQQ
FT                   SLSSNMLSTIGPSPRPPSDHFHNNSSKSDKNSSSSTPFQTQPSDDELTIKLPLLTSENL
FT                   LQRQEEEEEKQVQAQEGNPIEQSSNTNNNINNNNNNNNDNDNHCSPSTPTSFKGTRSET
FT                   NSNYTHETTPSSLDHNDSKSTLPPSDTGYQFNLKINNHRSSFDIDPLHKPSSNNHESQL
FT                   SETNNKTKPQPQPQPITDPILIPQKTITNSTTTETPKSIRRHTSPMPLIPRRSFDVQVG
FT                   SSKLQKLTSRTDSAIALTRHSINIDRPTNRSTFGGTGSPRALPISSTHEIQRMRDSILL
FT                   KRHMKKRPTEEDKVLVGNKISEGHENFVMAYNMLTGIRVAVSRCSGVMRKLTDEDFTAT
FT                   KKLSFNFDGSELTPSSKYDFKFKDYCPEVFRELRQIFGIDPADYLVSITGKYILSELGS
FT                   PGKSGSFFYYSRDFRFIIKTIHHSEHKQLLRMLKDYHHHVKDNPNTLISQFYGLHRVKM
FT                   PLFGGGSRKVHFVVMNNLFPPHRDIHIKYDLKGSTWGRKTSVFSEWDEKEISKHTLKDL
FT                   NWLERNQKIQFGPEKRHIFFKQLESDVKLLQKVNVMDYSLLLGIHDVKKGNSADIEKQL
FT                   SVFEPKSFDKRALINTNPRDLDRQQDLPNDVFPGRSKYVFYGHDGGIRATNEENIPTSE
FT                   IYYLGIIDCLTNYSLKKRLETCWRSLSHPRQTISAVPAKEYGDRFLEFIKKGTTQLKKK
FT                   RN"
FT   CDS_pept        243000..244463
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573513"
FT                   /gene_name="AIM24"
FT                   /orf_name="CD36_81070"
FT                   /product="Altered inheritance of mitochondria protein 24,
FT                   mitochondrial"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX42636.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG396547"
FT                   /db_xref="UniParc:UPI000192D289"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WD86"
FT                   /transl_table=12
FT                   /translation="MSSLNQYIRPVKSRLSYISFIRNISITQSSINSTIKDNESISKTT
FT                   TIPENIQQAKELAGYRALEVPEFKVLGSTSNGGNSTSSSCSSSILSINVPPSVPIYIRR
FT                   GSLLSIYGIQEISSIDSVRSQLQFPNFWQRLIYGGYISGYQKLISTTPFSLLISSKSRT
FT                   IMNGGNSSTEKSFVNLILDGTTDWAILDKSALQVYTGNSLSITMHKLPKFISKKLSRSL
FT                   KNNNNSSNKKLETGLFSWKKMGYTLLSGRGKIGLVGNGNNSGCSIYNINLNQDEEILIN
FT                   KNNLLAITVNGPYDLQNCIIKYQFPIINNSNNNNNNNNSNNMTKNIKESGNIVKPKLIE
FT                   PTTWNLIILKIKNINNRIKKFFQFINKYTLNLKTTSYNYLSGNQEFIKIIGPRNLLLQS
FT                   NINHNGFNFTTRRKQQQKSIWPTTTDTTNTTTTKVDNTSSTPKDYLNYVTIEPDKGAIF
FT                   KSTSDFSETIETIEKKKKNKGKDINTTPI"
FT   transit_peptide 243000..243185
FT                   /gene_name="AIM24"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WD86 "
FT   mat_peptide     243186..244460
FT                   /gene_name="AIM24"
FT                   /product="Altered inheritance of mitochondria protein 24,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WD86 "
FT   CDS_pept        complement(244665..248018)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573514"
FT                   /orf_name="CD36_81080"
FT                   /product="Uncharacterized sialophosphoprotein, putative "
FT                   /protein_id="CAX42637.1"
FT                   /db_xref="HOGENOM:HBG398438"
FT                   /db_xref="UniParc:UPI000192D32D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD87"
FT                   /transl_table=12
FT                   /translation="MVDRNDNKKLSQNLEQNYYPQQPTSYNNNRANVPPPLSGANVASV
FT                   LPPINQLPGHQLPSHFSPHHQQPPISQHQPIINPFPYQPQPPLQQQQQQHQYQQQQQQQ
FT                   QQQQQQQQQQQQQQYPPPELSSYNNNTNSNNIQYVRSFRNHLNPYYSVNLKFLKDLNTM
FT                   TKFWTNTEIQNSRRLVKFDFRNEGSTQMINFEPISQDQYDNISPIISCIYWKEKSRYIS
FT                   TSVDIITLLEFMVKQTFDVEEKNRIRRNLQSLKPTTISRINKNDRRFFDLIMSMENPRP
FT                   RNIEKDLKVFDWSDLGKAVQKVMSKYYIEPTSISSSSSSSSYPNANPNGNPTSQQMPII
FT                   PGIVGNSQQPPNQQQQQQQQQQQYQQQLSVPTSGMSTVPAYGVYTGRSSSFPINQTPIH
FT                   YLTSPIGNNGSFPKSQIVSPSVYHTFNQRPGTTILPTHDRYQFFDQPKSQPHIQPLSSG
FT                   NINGFTSTQFPTTQIFEGSNRQTLSNDSNNNNNKYQENQAIGISGNNNNDNSNKTKPNS
FT                   KETNIIKNNDISETNDNNGDTKDNNNNNNNNNNNNNNNNNNNNNNNNNNNSKLYSNEYH
FT                   SSNSSFPQSIISSESTSTSTSTSRSELKNPPSSSYSGASLSSSSGNNSISPPASFNPRN
FT                   ETSTASASSSASSSSSSGNIITPPVVVAPESAITDEKDDQNSLNSSNGDNDGNTSSSSG
FT                   SGSSTSSSSGGGGGSGGSGGSSNGNSRRGSGGNSKKRRKRKNKKKKNKKKNLKFKDKSN
FT                   SYFSNVSNDVSSSYSSSSGKELQDGSSSGFISGSGSGSGSASVSTPGSGSASVSAVGSG
FT                   SGSGSGSGSGSGSENSNGDDNNSSSSGGSDRHRRRRRRRGGPKDIQREVSNSNSNSNSN
FT                   SNINSGSDSIYSKDSSLSLNKESNNSSTNSSVIWDKESSSTNGGTKSSSSTTTTTTNGN
FT                   KNNKKKSNNNNNNNNTITTTTKKKKNTKNTKNTKNTKNNKNSSITTHRHRHDNGPDQHG
FT                   INNGSEEGGDEDEDISMEEGGYDEEDDDEDNDEDNDTLMEEKNDKNDKLKLNNKPNVNV
FT                   PQQQLQQHGKNKDNVIIINKDSPPPKLPSISQLLGQDFQSNTKSFTNGINESENKLPPI
FT                   KKKIEKWKDH"
FT   CDS_pept        complement(251803..253239)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573515"
FT                   /orf_name="CD36_81090"
FT                   /product="Cytoplasmic protein required for sporulation,
FT                   putative"
FT                   /protein_id="CAX42638.1"
FT                   /db_xref="HOGENOM:HBG586490"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="UniParc:UPI000192D32E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD88"
FT                   /transl_table=12
FT                   /translation="MTNNDTDKTPLLSSEIPENPIVLPPQQPSSSQSSGKSSSITPTPS
FT                   LVSLKQPTISPSSLSNTTKTNSKLVKSNKIGLQRTSRTSQKLKLLPEDPDLDTINTTLG
FT                   GKVGDNDDDDDDDDDDDNENAPPTRVYSQVKKITDTSARKDAETLNKSHRDLLPRVTAY
FT                   CTCGSYRMKELLRWLKDKKKIHNTSPKLFDECLYTPFTYKDWRGTTNNNSDNNNNSTII
FT                   DDANANAAAAAARKLIRLADEGGEIDIGKKNDIFIFEYGVVIMWGYTRKEESAFLEDLA
FT                   RFESEKLSEEDIQIEEFNYYITKSYQPRIYNDFITLRDDDNYMLKLSISHGLAQSVKIS
FT                   LFEELVDNTIEDTQEIPQQIAHTGKVEMTRDEIMKSIGELFILRININLHGSVLDSPEL
FT                   MWAEPHLEPIYQAMRGYLEINQRVELLNQRLEVISDLLSMLKEQLGHSHEENLEFIVVV
FT                   LVGVEVLVSVINIIIDIMAF"
FT   CDS_pept        253604..261040
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078559"
FT                   /orf_name="CD36_81100"
FT                   /product="U3 small nucleolar RNA-associated protein,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="CAX42639.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG396548"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D32F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD89"
FT                   /transl_table=12
FT                   /translation="MSKLRTKTTESSRRHAFSSFRERVDSIKIEPSKKLTKRVYDYIDT
FT                   EDQTDSYFLTTLEHWKETNLSGNFTEFLNKIEQNCQSLPQLIYHQSTIYQALYDAIAKN
FT                   DVHSIQPLLELMSQFIHDLGSDFLPFYTKTLKLLMDLVLSVNPNDFQNNRNSSNVLEWA
FT                   FNTLAFAFKYLSRNLAIDLKPTFIELLPLLQLTKKTYISRFCAEALSFLIRKSNQESLN
FT                   EIIQFSLYDQIDIILDNDAYCESLTILYSEAMKNTKGTFHSKANLIFSKIMENTLYKVD
FT                   TKAQPKLISIISDIILDILNHGTVESCDKFYAMVTDYLNNLLEKHNADPSEIELLTTCQ
FT                   ILSTLAFAESGKKISNWDIVLETVDLLVAKINCNNNATRQELLESYIYLLVIVFRNADI
FT                   QSLTIRHKKYFDSIYNTSEFLTFTEASLSIAKSKVINFGIIKLLQNYINNCQDYDKEVE
FT                   KLTYFLNNNDISSKLQIPQSLVSQISNQINKDIKSKSFKSIHWKLLLLNFANNFQDINL
FT                   QSLKELLFNLESGNKNLAAITLDIISHKLKEFPDSQTHIDEITSYLETNFHKFDTSTKF
FT                   LNAINNYIKVTKSGGDFLSNAITCLHYPTHELRTNAIELISTLVVNESSTYLSQIRLIE
FT                   QIPLNISTGRDITLRIRNLAMEFSKEINPSDLDKKLIVNYFFGLLSNKFQPSWTAVYES
FT                   LPLISSTCKSEIWQVAYKLLTLDYTNDEDEDEENTEERSVVDFPIESTLIDWQPRNSRL
FT                   LNNFESFENSYLAPYRNISQAINNNLERNAHFDSMVRSHVLNALKTIPSIVEKNAGKLI
FT                   PIITHQPTIDEDELQNWSRKDRNELLELFAKFKNLRKIPESEELYDYLLDYLLTSKYVK
FT                   VQQLALDVLFTWNNPSINKYKDNLKNLLDDAIFSDEISNFIINGTNISTSNIIEPQDKP
FT                   LIMKFVIRILFGRVQGSPKSNSKQGKKFAVISVLPSLTNSEIISFIELGANKIGYEGFF
FT                   NGQIPKASLGLDQSELKKISGFINLLSEIYHILGANYNAALQTTIKPLIFSLVSAQNRI
FT                   ESTSLIDSIISEKMAKNIRSNGMRCLTELFTIIGDDFDWNDYLSLIYDNLINPRMETFA
FT                   DENLQQPSAMLKLISFWIGQSNTLPFLYIDEFATTRAILSLLSKSSEAKESVITLVLDF
FT                   TINALERKDNEIDEKYFTLLAFVVDSLLQYLPQTIEMIYNKEVGSRAIKVLLLLISGKY
FT                   IEDQDTKASLIKSLTIALEKNNNQIDLDDKANILVSLSSLIDEYDCEFHEIQPLYEIIC
FT                   KLFKMFATRNVRETLVVVINTMGNKFKQIEPIAPIITGLNAYSDRMSEYDFEKRLEAYR
FT                   LVNEEMYKDLTPIQWLPLLYCALFFINDRDELAIRVNAGYMLRRFVDCYSSIIIEPKEY
FT                   VHLLKDIVLPNLKIGIRKENEDVQTEYILVLEHIVKHSVNYTELNDMKVLIGQDDEEGE
FT                   DNFFQSINHIQLHRRQRAIRRLRDYKDDLKDNSISHYILPIIEGYVTTKEDKHRNIGLE
FT                   ALETIGVLLKSVTWNQYKAIVKRYISNLNKSQDTLKQRVNLMVAVSFALAQSVKENNKN
FT                   LPEQQQELDQFILYEISPPLLKLLQIRDDETIVARAPLAEALTNFMLCITKDKIDGELP
FT                   KILTSTCQVMRSRSEELRDAVRKTLGKIAISLGPNYLSFIFKELKTALSRGSQIHVLSF
FT                   TVHYLLTCVTSILQHSDLDDCIEIVIGIVMEDIFGAAGQEKDAEGYTSKMKEVKFKKSF
FT                   DTAEIVASNVSLNQFGTIIEPIKLLLQEMISHKTQVKLDELLRRLSFGLNHNQEASNIE
FT                   ILHLCYEIYMMSKENDEVNETKVSAKEQHFLTTLDRKVKKRVDKSLYKQTMQRLSFELL
FT                   RTAISRHDNLMSVTNLQGFIPLLEEGVKSENETVIIASLKILNIIIRLPFPDQGIFKAC
FT                   ARRTLILIKDSPSTNSDICQAALKFLATTIRHNPEVTMKESAISYVLTRIQPDLEEPNK
FT                   QGLAFNFLKAVVSQHIMIPEIYDLMDNVAKLMIVNHSKEIRDMSRSVYFQFLMEYDQGK
FT                   GRLEKQFKYLVSNLTYPTEEGRQSIMELIHLIVVKAGKDLLNKLSSSFFVALANVLISD
FT                   VSSRCREMASSLITTILKKLDDTSSMEKYCSVWIKQSTNSLLKRCGLNIYKLIITVRGF
FT                   GKNKELDKIALDNILNIIEAARNTKDEQDSAGTTTTSDDVEWELVYSCLSTFSSMASII
FT                   KDRIFEYRKIWNGIINILLFPHSWIRLITCRLMTILLSNGSGDIEKYDLQNIATKLIHQ
FT                   LRAPSITSDLGTQITKNLVLIAMKWEKETYEWDGNLANDYLLSKICGIIKSEHVHSIES
FT                   KKSCIKLTAMFIQFTNQQRIIKISEMIISALYNYTDPTYATPDDELTNLSLEALELVQE
FT                   KIGTSEYTKLYSNIKVNVNVKRQERKAKRAQMAISAPDIAAKRKLKKHERVREKRKHEK
FT                   DINGYYKPKKKRTL"
FT   CDS_pept        complement(261094..262032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574516"
FT                   /orf_name="CD36_81110"
FT                   /product="Non-histone DNA-binding protein, putative "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42640.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG396549"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000192D330"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD90"
FT                   /transl_table=12
FT                   /translation="MKTPSKDSIPESEEVRFKQKCKELRKRVLEIEESNEIATIALSRT
FT                   QATIRRLRLEYAILLERLEDRATQLPEGIVAFEEMACPPTPTILDDSLVKSNKSSNKKS
FT                   KTSSSSSSSSKTTLGSGSSKLSNGPSDVASTTMGKQKARDPDLPKRPTNAYLIFCEMEK
FT                   ERIKQDDPNASDLSKSMTEAWKSLSEERRRPYYKLYEDDRIRYQREMAEYNQKKGNGGE
FT                   PDLKKQKLPSQPEQPQEEEEEEEEEQVKQDSSIGKETTEITTNDETKQATEIIKSEENS
FT                   TITATAAATATATEENKPLENINSTNETTES"
FT   mobile_element  complement(262141..269851)
FT                   /mobile_element_type="LINE:3B, Zorro3"
FT                   /note="nearly complete apart from small deletion where LINE
FT                   3C is inserted."
FT   mobile_element  262283..264351
FT                   /mobile_element_type="LINE:3C, Zorro3"
FT                   /note="5' truncated ORF1 + 3' truncated ORF2"
FT   CDS_pept        join(262472..262972,262923..263348,263096..263824)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        264001..264396
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535601"
FT                   /orf_name="CD36_81130"
FT                   /product="Polyprotein of L1-like non-LTR retrotransposon
FT                   zorro 3"
FT                   /protein_id="CAX42642.1"
FT                   /db_xref="UniParc:UPI000192D331"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD91"
FT                   /transl_table=12
FT                   /translation="MKRNDSYINNLTIGSKIIGSHQSTDFKKLLDIFLKLIGEHPVIDI
FT                   WFIQEIRFVSQEQFTYINTILKQHNAQLRMHHFKDLTGFLIHSPHAKLKFKINENENHQ
FT                   TTHFEGRISILEITSTFVPASTFSFSP"
FT   CDS_pept        complement(264309..266360)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078560"
FT                   /orf_name="CD36_81140"
FT                   /product="Polyprotein of L1-like non-LTR retrotransposon
FT                   zorro 3"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAX42643.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR015706"
FT                   /db_xref="UniParc:UPI000192D332"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD92"
FT                   /transl_table=12
FT                   /translation="MSEVIITLIPKKSKTPIIENFRPISVLSCAVRLLSSVIEKQLNPV
FT                   LAKVIENTQTGFLKERSISNSIYLLDMVLTRYQTSKTADAESAGFINLDFRKAFDSVHH
FT                   DFILKVLQQVGFGPKATNFLREITTQQKAKVSINNIEGPCFPLKRGVRQGNPISPLIFI
FT                   LILETFLARLSKEIEGIGVVNEFSPVAYTAYADDVIIFFKNKNDQERIQQLLEDFGRES
FT                   GLYLNNNKTEVCYFNDIPEIYFLAYVSKKLQLEKLTYLAVPMKKADEEFDPWTSFVLNL
FT                   NPQIRMTPISDLPYQLIMKLMNIFIFSKLYYRDLHSPISTTAVSSIIKTVQQRLPLYFK
FT                   LQKLQTPNHLGGFGLMNPNHQVKGRRGKQIYLLYTQEDDLIIKFMRTKIQDILDNIAKD
FT                   YYTMPTEPDKLIVYPWYLFGMGVSCHSSLQFRYLKERVYENLTKSEISWFEAWFQLVHY
FT                   TGPPVETPIRIMSIEDYANLIIQPKTEIINLMSPNFEKQPLSEQTFHHTSRKLCPQAPI
FT                   IPEGWGKHFDTIKSLTISDWTEFWKNMNKVQKQSVGSLQDYHLFILGYYSHYPFYPNYK
FT                   KPEIHFCQLCNTGTDSIVHHIFECGETMELWSKHFNSQRTPQFIIGNKHLHKKDLHALN
FT                   EYIKEVVQKVKRRRGSPILNHGEKENVDAGTNVLVISKMLIRPSKCVV"
FT   CDS_pept        complement(266592..266972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229957"
FT                   /orf_name="CD36_81150"
FT                   /product="Possible non-LTR retrotransposon Zorro family
FT                   polyprotein"
FT                   /protein_id="CAX42644.1"
FT                   /db_xref="UniParc:UPI000192D333"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD93"
FT                   /transl_table=12
FT                   /translation="MSQDENIIKDLNNNEQSSLTPFSNWNGIINRIKEKVIFYEKYQRY
FT                   IRAYIPHAGNFPDEKMLKFRFRPSFNFSIITEMQTESGNTVQDTEIMINLATKFYQDLF
FT                   SVEERHLDSFTFVDQFDKKKDR"
FT   CDS_pept        complement(267018..267839)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229958"
FT                   /orf_name="CD36_81160"
FT                   /product="Polyprotein of L1-like non-LTR retrotransposon
FT                   zorro 3"
FT                   /protein_id="CAX42645.1"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000192D334"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD94"
FT                   /transl_table=12
FT                   /translation="MKRNDSYINNLTIGSKIIGSHQSTDFKKLLDIFLKLIGEHPVIDI
FT                   WFIQEIRFVSQEQFTYINTILKQHNAQLRMHHFKDLTGFLIHSPHAKLKFNINEQEIYH
FT                   TPHFEGRISILAITLITNENILLINNYLHSGDMDAQMTHLNAFTKYIANLKKNPNNHNI
FT                   IYGGDFNHIMSLDDVQLPSNQNSYTFTKKESEIIQLMSRFYNKWKLQDSFQIFNNMRPT
FT                   NFHSNESVKKRLDRIYIDSRIRRKLKKYRLLQEFKQISTHKIIATSFQIQK"
FT   CDS_pept        complement(268016..269836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078561"
FT                   /orf_name="CD36_81170"
FT                   /product="Non-LTR retrotransposon Zorro 3 ORF1-related
FT                   protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42646.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000192D335"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD95"
FT                   /transl_table=12
FT                   /translation="MAEKGVNDFNFTARGDHSPQQTQENPPGNFQESPLDGGQDRKSSS
FT                   TDGVSNNVEFNTQTNAHESWADFPESDQMDTDSSEYPSEEENEEGKISKGPYHAFKNFS
FT                   TEEYFTPETATNKVVDNTTPSQTTQSINQNSTTYASVAANYKSNLVKSQEKKEEERMGH
FT                   FNVPKEAFEDLKRHNDTVFPRGLVTADIAHLINKYGGVVVYHTIARTIENSIKETKGFL
FT                   NNYSEDAMKTAFKYFNLKLSVSDKKTKDTCEEILGMREEVMFLQRTMDFHFVQKVMCFA
FT                   PFSDEHMEKDLTEPIKTITNIIESLDFDFNGIVEKIKIDSTKRNRQLVAFRTPMSIKTQ
FT                   AKQKFQKLFLNKEDVIVQQYTPEVSVLQMTGEDPQKVDPNVVCYFIVDIYSGQVPKRRI
FT                   KKVNDKGEEIMDSCTSRVLSNCKYCEYCRSINHTKYNCPLIKPCANCGIKGHKTTSFEK
FT                   TTPAPKRVLKKPETKQYFPALPTKVGKGKPTEELQRRSSSESNKEKDSSSTKEDNIEHE
FT                   VITPERPQKTTQPVSTSVPITDPKGDSVKTSYNTETKKKNKTAGIIEMDTNKDTISSND
FT                   EASPRKKNNSTGQPRSPTKDPGLHSSPNLQ"
FT   CDS_pept        join(270304..270345,270451..271968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574517"
FT                   /orf_name="CD36_81180"
FT                   /product="Zinc finger transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42647.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG447618"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D3D9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD96"
FT                   /transl_table=12
FT                   /translation="MNQFIITTQPTKRRKAVLACLNCRKSHRKCILQTNNNQNSCQSCI
FT                   DKSIECKWTSQQSQKYSTTTSISKKKFERFKQEEQIYSTVVASENHHHQQLGDGGRGGG
FT                   GGCGKFQFICSTHPIASFLSTDKFLCFDGDKFGLFNPWRSSPNIETNTITTGSTGSAIE
FT                   DENPNLTEYLNREGAFILPPINEQRQLMEIFINKIYPFFPVIDICDKDSLNKFSPLLLN
FT                   SIFLVASRCLSNENNINININIRQRCQELFERCKLLELNENNKIALIQSFLLMSIHEEG
FT                   INGSSLSKEYITRACNLCGDLGITTLSGSNGTVQDTQHRVYKKLYYGESILTRLFWISY
FT                   CCDILSAATHAREVYYNMNDVFIGDVPKEFPELTIFVELSTLLYRTLGSHYRPHKGRII
FT                   DEKLSTDIINWQSSSINHHPWLKLLHSYICMINLRCELDPITLDPIVVKSLHEQFINVA
FT                   KCDPFWFKFHIVGVHSLLHVTSLLNVLGNDNDDLNNNIRKSLEDLKEIWWLAASGLKLF
FT                   DK"
FT   CDS_pept        complement(272038..272724)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574518"
FT                   /orf_name="CD36_81190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42648.1"
FT                   /db_xref="HOGENOM:HBG447548"
FT                   /db_xref="UniParc:UPI000192D3DA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD97"
FT                   /transl_table=12
FT                   /translation="MPLISRSTISFNQDNLKFLVFFIIPILLSIYLIPKFINPEIINNL
FT                   LINFKIGLLSKKYCQIQPIYCSILLNDNDKYGGGGGGGGDPNQLKRIQFKYFELIYVVH
FT                   KWIYNIDQFIIHKLILSWPIKKIIGSIMIIIMMRNNNNNNNNNNSGGGGGFGGEQYMEE
FT                   IWEKWIEIIQIILAVINSMIYHSIWGLIVSRMYVFFIFGTLITVFEPWERLIDPLMSVL
FT                   STNNVY"
FT   CDS_pept        276050..279751
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574519"
FT                   /orf_name="CD36_81200"
FT                   /product="Calcium-transporting ATPase, putative "
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42649.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D3DB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD98"
FT                   /transl_table=12
FT                   /translation="MAPRTPADKLGHASTLQLPTYDNDDQSSTNSTTPLHKDEPTSHSE
FT                   ETTDSTATPTTHGVEPFHPPKLINKSTTSPSLKLTSMLSKTSTKQNPNFPISLQSLNDL
FT                   HDPKSLKQLYNLGGIENLLTMLHTSTDGLNEHNESDLNQRKQYFGVNKLPQKVQKSFLK
FT                   LCWEALKDKVLVILCIAAIISLALGCYESFGSGTHYDDEGLPLPKVDYVEGLAILVAVA
FT                   IVVLVGAANDYQKERQFAKLNAKKEDREVIVVRNGGEQKLISIYDLMVGDVINLQTGDV
FT                   VPADCILIQGEVECDESALTGESHTIHKVPVNKAMKVYQNHLPTDEDIGSTKIKFRDPY
FT                   LISGAKVLSGLGNAVITAVGTNSIHGRTMMSLNHEPESTPMQVRLNDLAEGISKYGFLA
FT                   AIVLFVVLFIRFCVEIAPPNGNMNDAEPADKGKRFIDIIITAVTIVVVAIPEGLPLAVT
FT                   LALAFATTRMAQNGNLVRVLKSCETMGGATAVCSDKTGTLTENKMRIVRGFFGLSKQGS
FT                   PLEFNDTVSNQHDHPTSIDIINQISSEQKIYLTTNIILNSTAFENSEYDEEKAKLARQK
FT                   PLQQNFFSSIFQKNKKSQYQQMGLVDEPYLGNKTESALLTLAKDKFHLFDNKSLETYRQ
FT                   ENHDDVVQIIPFESSRKWAGIVMKIPNGYRLYVKGAAEIIFKNCGFENNINDELIKLDR
FT                   NKRDDVLTKIDEYANDALRAIALGHRDFVGISSWPPSELINEKTSKEADPTKLINTNFT
FT                   ITNSAAAAGASAGGGGSGGNEIHKMFILDALVGIQDPLKQGVAEAVLQCKRAGVTVRMV
FT                   TGDNINTAKSISKECNILTSDDLSNDYSCMEGPQFRKLSIQKRREIIPQLKVLARSSPE
FT                   DKRILVDTLRKSGEVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDF
FT                   TDIVQAIKWGRTVSTSIKKFIQFQLTVNITACVLTFVSAVASSENKSVLTAVQLLWVNL
FT                   IMDTLAALALATDKPDDSFLNRKPAGRTAPLISTSMWKMIIGQSMTQLIITFILHFAGK
FT                   QLFFPNQSHINNHSEKQLAAMTFNTFVWLQFWKLFVTRKLDEADEINTIKGRINRENLD
FT                   FFQHLFRNWYFLSIAFIIGGFQILIMFVGGAAFSIARQTPGMWATAILCGFISIPVGLL
FT                   IRIIPNVWIETIFPTKTFKKFLYIVGFGWLKRNKKNKDNEDEIDLEGGDGDSSGGNNNN
FT                   SDLKESKE"
FT   CDS_pept        complement(280586..283000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229959"
FT                   /orf_name="CD36_81210"
FT                   /product="Mucin-like protein, putative "
FT                   /protein_id="CAX42650.1"
FT                   /db_xref="UniParc:UPI000192D3DC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WD99"
FT                   /transl_table=12
FT                   /translation="MKLSNVAAAAVLASTSSATFLPIIEGLLDCIFPKPPPPTIPPSPC
FT                   KGYNCPPPKPCTTRIPQTHTTIVISTYTTGVVTWGGSVTTVTLTPGTTIATIPPSTVTV
FT                   TPGTETVTLTPTGPNTKPGTDTATVPTGPATTPGTSPTGPNTKPGTDTATVPTGPATTP
FT                   GTSPTGPNTKPGTDTATVPTGPATTPGTSPTGPGGNTLTTSVPDQSTVTITGPGFTTVF
FT                   TLTPGTNVITTPTGPATNPSGPGSETKPTGPATKPTGPEGSVVTVTVTESTVETITGPG
FT                   YTSVVTLTPGTNVITTPTGPATNPSGPGSETKPTGPATNPSGPGSETKPTGPATKPTGP
FT                   EGSVVTVTVTESTVQTITGPGYTSTVTLTPGTNVITTPTGPATNPTGPGSETKPTGPAT
FT                   KPSGSESKTSPTGPATKPSGTESKTSPTGPATTITTSVPEQSIITITGPGFTTVFTLTP
FT                   GTNVITSPTGTATGPSGTGSEATPTGPATKPSGSATGPSGPGGSVVTVTVTESTVETIT
FT                   GPGYTSVVTLTPGTNVITTPTGPATNPSGPGSETKPTGPATKPSGPGSETKPTGPATKP
FT                   SGPGSETKPTGPATKPTGPEGSVVTVTVTESTVETITGPGYTSVVTLTPGTNVITTPTG
FT                   SATNPTGPGSETKPTGPATKPTGSESKTSPTGPATKPSGSESKTSPTGSATKPTGSGTK
FT                   TSPTGSATSPTGPAGTVVTITVTKPTSETITGPGYTSTVTYTEGTNTVTVPTGTASTDK
FT                   PNTSSAPIPSPSKTTGTGTGATTTTDNSLPSGSGGVTWTPQPGWICQCVRV"
FT   CDS_pept        285256..285609
FT                   /pseudo
FT                   /gene_family="HOG000213058" [ FAMILY / ALN / TREE ]
FT   CDS_pept        285849..286517
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382830"
FT                   /orf_name="CD36_81220"
FT                   /product="Uncharacterized protein yjl055w homologue,
FT                   putative"
FT                   /protein_id="CAX42652.1"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI000192D3DD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA0"
FT                   /transl_table=12
FT                   /translation="MTQESIKVCVFCGSSFGNKPVYAEEASKFGKALADKKWGLVYGGG
FT                   STGLMGAVASGCATNGGYVHGIIPEALISRERTTDEEAFNAKLKSSIDNHDGSTPIPDS
FT                   KQYGKTTLVKDMHTRKRLMAQEANAFVALPGGIGSIDELAEITTWCQLNIHGKPIVVYN
FT                   VDGYYDNFFKMIQGFVECGFLSEKNGQIIKVANSVEEVLQIIENYEIPEGRFNLKWETT
FT                   "
FT   CDS_pept        complement(286971..287810)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000125184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382831"
FT                   /orf_name="CD36_81230"
FT                   /product="Carbonic anhydrase, putative "
FT                   /function="carbonate dehydratase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbon utilization"
FT                   /protein_id="CAX42653.1"
FT                   /db_xref="GO:0004089"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015976"
FT                   /db_xref="HOGENOM:HBG711150"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="UniParc:UPI000192D3DE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA1"
FT                   /transl_table=12
FT                   /translation="MGRENILKYQLEHDHESDLVTEKDQSLLLDNNINGMTNNIKPHPV
FT                   RVNSGNHNNFPFTLSSESTLQDFLNNNKFYVDSIKHNHGNQIFDLNGQGQSPHTLWIGC
FT                   SDSRAGDQCLATLPGEIFVHRNIANIVNSNDISSQGVIQFAIDVLKVKKIIVCGHTDCG
FT                   GIWASLSKKKIGGVLDLWLNPVRHIRAANLKLLEEFNHNPKLKAKKLAELNVISSVTAL
FT                   KRHPSATVALKKNEIEVWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEDYNPH"
FT   CDS_pept        288776..291388
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574520"
FT                   /orf_name="CD36_81240"
FT                   /product="ATP-dependent helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAX42654.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG717285"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D3DF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA2"
FT                   /transl_table=12
FT                   /translation="MTTSPPTQEDEQDEEFKLKQIIQEQNLIPQINNHNDDGGAFEQQQ
FT                   QQQQFNQLSKDKKMNRLNKLIEKSQIYSQIIADNILQTSLERKEEQNNEPLPPPPPPKP
FT                   YSKQELDSQPTKKRRKTKSKTKSATNVKHDIVSMLSTNISDSTKSTREAIEKSQNSSKI
FT                   TNNKQPKLITGGQLKDYQMDGLEWLITLFQNGLNGILADEMGLGKTLQCISFLSHLIEN
FT                   GINGPFLVVVPVSTLSNWFNEIRKFAPKIKVTKYIGTKQERNEIDLLQQQEITNIILTS
FT                   YEISIRDFNKLVKINWKYLIVDEGHRLKNSQCLLIKILKKLNVSNRLLLTGTPLQNNLN
FT                   ELWSLLNFILPDIFHDLELFQQWFNFDELTELAGELDSTNNEEDEETKNLIKLNIQETL
FT                   IKNLHTILKPFMLRRLKRDVIKNLPPKKEYLLHIPMTKLQKKIYYDALNDRLFDSLVET
FT                   NLKAFIKFNHEELFNGFDVDEYLQTRRQKDSFMDTGDLLKLRGSRSNRNPLKRSYKEAD
FT                   SDDEFEIIDDDSLTSRNKSTPTYDEALVKIRHIKSKSKIQSILIDAIYQDILKEARHLK
FT                   LQNLKMIQLRNICNSPFIYYNYPILDQTEVIRNSAKFQILNQLLPPLLSSGHKVLIFAQ
FT                   FTQVLDLLEDWLEESSSLNGRICRLDGSTNHQIRDEQISQFNNNPKFKVFLLSTRAGGL
FT                   GINLVAADTVILMDNDWNPQMDLQAIDRVHRIGQINPVKIFRFVIKDSIEEVLISRSGS
FT                   KRFLERLVIQMGQFKFSNINKKITTGATATVVGTGVDEQSTMKNDWSINEMMELSKIHF
FT                   KSTQNDQFNQDSGENDKILLSDQEIEELLDRSMECYNSIDDSKFDKVKIFETVNNMDK"
FT   CDS_pept        complement(291708..293384)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574521"
FT                   /orf_name="CD36_81250"
FT                   /product="Glucoamylase, putative"
FT                   /EC_number="3.2.1.3"
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide metabolic process "
FT                   /protein_id="CAX42655.1"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0005976"
FT                   /db_xref="HOGENOM:HBG396553"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000192D3E0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA3"
FT                   /transl_table=12
FT                   /translation="MRSLSLSFNLFIIFIINLGYVNSFLIPIKGLNLLPLQQQKHQQSI
FT                   FSNNFKSTPSPTSFDDWLVFQKQVCLNSILNNIGGDFTIDNKDLLPGVVIASPSTSNPD
FT                   YYYQWTRDSAIIINILIDHVSQTPLYFKKNSTSSLIRIIESYIFNNQVLQQLPNLSGDV
FT                   DNLQNLGEPKFHVNLTAFNESWGRPQRDGPGLRSITIMNYLSLLNNTEQITTFSNLTIN
FT                   DTQKIYHDIIKPDLQYSIEYWQFEGFDLWEEIKGIHFFTSLIQLKSLTMGLKFAEFYND
FT                   SFEFRLDLMNSIKLLTKYIELEAGFINGADSDDDESEQQLLSKSYIISSPKFFYTKSRS
FT                   GLDIATILAVLYTHNNNDEVDDFPFDVDNGLVLTTLRYLIQDMTFRYPINFQDNFQGVA
FT                   LGRYPEDIYDGHGKSEGNPWFISTATASELIYRLIYKLKLNNQDIIIDQHNIEFYEQFI
FT                   QSITAISSNNKQNLKDHTISGHPIMIINKDDQLYDELINKLFHYADGFLKVVQKHIDNN
FT                   GDMNEQFNKYIGFMQGAKKLTWSYGAVFTAINWRNKTLSIL"
FT   CDS_pept        296777..299563
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574522"
FT                   /orf_name="CD36_81260"
FT                   /product="Fungal zinc cluster transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42656.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396554"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D3E1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA4"
FT                   /transl_table=12
FT                   /translation="MESNLSNTESPSPSPSSPSPSSHTTPATTNTTNNENLVNQITTST
FT                   TTNTTPSSGNIMTTTTTKPKRQRRSYSCGPCKLLKIKCDLQIPCTACKKFNRINRCLLQ
FT                   PPQPPSEQELSKIQERKKRTTIKKMKLSNEFVQAYNVNPNALPSMISTVESTSKNYEKK
FT                   TQKYKMNQISLDKGSPSKENNHKISNQLSNSNGSRQDTQLSKTQNSIPPHSLIEIQRHH
FT                   LSFQQPQMNKQQLHPISYITSVSSPSSTLTSTTFNFPQNSQQEDVIQYLLDMDSQKNID
FT                   LTMVDIKRIKRLLPNDFALFKNMFDCYLNTINPIAIDMQDFSEIFKQSNLVYNKLLSID
FT                   DENPRNLSINVPFTLIELRNLSLFFLILVNGLLFDFRGSNNKTTMDNARHQNHNNHNTN
FT                   FLLERRLYKSKNDMIEDWIKISKFIKLKVLAYESLTDIIFLIDWYMILKNYYDYENMVV
FT                   ENYLEFNNLLNYLVLNNDFINTIEDPYNEVGRNPNDDDDVDDDKDTTTVLSSVEEKQVV
FT                   YPDTRHFKVLSKYWIQLRLIEIDYTFFQFKGSLLFANQLKGTVVPHKKILSTLYKDIEL
FT                   DPITTHLMKIWGLYYKRSKNTTSVREIIKDYLLLYCNMMGTLKDELNEFETTKPLESPN
FT                   SRSINLKDIELLIKNQRLLHLFVRWLSFIRIESNYFPSLRYTTYLTTIMNLFNHFNYLD
FT                   DRSNSNVLSMIFNNYSLNNIKLFYQCLVFQGIFLVLLKNALNGNNIYPNSIPKFKINLE
FT                   KIYQFSLHQYQTTLNKILNHEICRELSENITLFKLITNLSIEFNQYLINPITNNNNNNN
FT                   LNSKEKDLDLDLTDLIYDLKSKISSSNWDLLLNYFFGSKDNFARYIEKIWDLFQYLKID
FT                   PTTTTVSTPTTNIPITSKIYLNDHLIDEVIGKFSGFKFDEDVVNNYFKHCVEPNIFE"
FT   CDS_pept        300095..301480
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574523"
FT                   /orf_name="CD36_81270"
FT                   /product="Mitochondrial ornithine carrier protein, putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42657.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG396555"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D3E2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA5"
FT                   /transl_table=12
FT                   /translation="MNNNNYSLLSLPPPPPSSSPLQAKELCNLLNCFLFHPIYNDSTLS
FT                   FNDNSQKKTNTSTTSNQTVSLSAAGMRALIYQLQSIYLRTPIKLFRPSRFDYLAYVRAL
FT                   ANKHDNIENKPYRFRTHSSLGMIINVVRKQGWKFIPDQILPPLIANSATGVILYATYLT
FT                   TLDYYTKQHNKTKTKTELQETDGETTTTTGRANFNWYAPIDTWRAGFVAGAVQSLAAAP
FT                   VDAIYTRSTVAEMLEGSHENLWVFGFNKLREIGLIGVFAGYGFSLVKESVGFAFYFSTF
FT                   EIIKTQGYNLTYKLINYYKKSEQLIKLNLKKLFKWDDDKIDEKLEKLEKYRSMKILKSS
FT                   FILIAGASAAFSLLAVQYPISKIQKIHLSRLEALDVYNASRFVGNSSPFFKLYYNSYVD
FT                   TYKQVLRMKQRANITWFEAAYSGFVRNALTTIPATSIALLVFEIMRTKLTDNFEDYNDV
FT                   LEA"
FT   CDS_pept        complement(301619..302431)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574524"
FT                   /gene_name="URA3"
FT                   /orf_name="CD36_81280"
FT                   /product="Orotidine 5'-phosphate decarboxylase "
FT                   /EC_number="4.1.1.23"
FT                   /function="orotidine-5'-phosphate decarboxylase activity "
FT                   /biological_process="'de novo' pyrimidine base biosynthetic
FT                   process"
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="CAX42658.1"
FT                   /db_xref="EMBL:CAC27824.1"
FT                   /db_xref="GO:0004590"
FT                   /db_xref="GO:0006207"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="HOGENOM:HBG326699"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniParc:UPI0000132CFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C150"
FT                   /transl_table=12
FT                   /translation="MTVNTKTYSARAETHASPVAQRLFRLMESKKTNLCASIDVDTTKE
FT                   FLELIDKLGPYVCLIKTHIDIINDFSYESTIEPLLELSRKHQFMIFEDRKFADIGNTVK
FT                   KQYIGGVYKISSWADITNAHGVTGNGVVEGLKQGAKETTTDQEPRGLLMLAELSSVGSL
FT                   AYGEYSQKTVEIAKSDKEFVIGFIAQRDMGGQEEGFDWIIMTPGVGLDDKGDGLGQQYR
FT                   TVNEVVSTGTDIIIVGRGLFGKGRDPEVEGKRYRDAGWNAYLKKTGQL"
FT   CDS_pept        complement(302877..304661)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093826" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535602"
FT                   /orf_name="CD36_81290"
FT                   /product="Transcription factor involved in iron
FT                   utilization, putative"
FT                   /protein_id="CAX42659.1"
FT                   /db_xref="HOGENOM:HBG396556"
FT                   /db_xref="UniParc:UPI000192D488"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA7"
FT                   /transl_table=12
FT                   /translation="MLDKLNRKQSKERIVTKIPTSRTTQIDKNQLENTPKDNESNHANR
FT                   GIHPDESYTSDTSFAPTVLSLIEDGTLTRSSTNRQRHGKTSFKSFFRTMSLKVNSKTRN
FT                   KERKTQEELAAEKALAELRNLPRNPLDLELNELHVASNFNEVRKLIDDIFIDENQDAAS
FT                   RAIRISTQNKSFSSMEKPYGLTKIKSLQTEDDYSLPITSFIIETLEENSINIEPSQHDN
FT                   ATTNTDILIEAEDEKEEEEEEEEILNYDDLDVISDNMNETDPGSSISTSNDMMSTTNAT
FT                   ENGPIIVGGSTERIDTTNIDKRKLVVVNSTPNDNDYYATNDINANFITPRPSNESVETL
FT                   AGVYKDYEATDTTNTNADATEAADINAETSNAIDTTTNTTNEAIANADTTNTGNASEVM
FT                   IDTTTSTTDNDEEEIEKTTDSNMATNDNVSDKIANTDVESSSDNSFDATTANTTNTNNF
FT                   NNIEVNTEVTNTTVDNTTSAKFDSTDISTTTATAIPTAVDGIPIADEITNTANSNRIST
FT                   ATVDSFVGKTGENYESFITNAGKDFNDNNANLKTPTDNSTTANLQSGASIKKSNTKTGS
FT                   SEQNPFQKKLMNYLNSLN"
FT   CDS_pept        complement(305540..306454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574525"
FT                   /orf_name="CD36_81300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42660.1"
FT                   /db_xref="HOGENOM:HBG396557"
FT                   /db_xref="UniParc:UPI000192D489"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDA8"
FT                   /transl_table=12
FT                   /translation="MLRTNNLLILSVFSFLIINVKSDLGGPCYSVSSMEGQACGVGVHP
FT                   VTQIMTDCLCHIPGYWEQYNRCAELIAGEHNEPVNGAEVCSRASEYAANPAGFTGNKNF
FT                   FEGSTTILDLVMFAFPTYSPGVTNFLDSSSNDLTTTNSDEINSSLTTDESVPSFSSNYI
FT                   EIPSETSVEASITIQPSTIEISETTPVESSEFSSIISSSPLPIVSESGVLNSTQIVSTP
FT                   VVIISPTPQPSLETTSSQSSVPDIANTSSTTTDTTAVDETTINNPSSVALPTTIETAVF
FT                   EGGAMGYPSISIAIGLVLIVYLI"
FT   mobile_element  306943..308697
FT                   /mobile_element_type="retrotransposon:iota I, Tcd23, LTR"
FT   CDS_pept        307270..308457
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574526"
FT                   /orf_name="CD36_83320"
FT                   /product="Retrotransposon tca3-like polyprotein, putative "
FT                   /protein_id="CAX42661.1"
FT                   /db_xref="UniParc:UPI000192D030"
FT                   /db_xref="UniProtKB/TrEMBL:B9W8T6"
FT                   /transl_table=12
FT                   /translation="MARNQKKQEQESVPETPATTSSAAEQAAGQTIDQGPEAQMFVTAD
FT                   QFAEFRQQVMEMFKQQSETITNQIYKVINETNAAQAEAIAVNRERENVLDEQAKRIVEG
FT                   AQEKFDHVDEHVDAQAEFIQATAQKVDELAAKMEKQRSNPTFGHDNDAPPGQWNVPPTA
FT                   DHAFGPPPSQAYGAPPNEFGFEPYEDEPSPVSPREIAAQIRRVMPTFMVQAFPPSPPEA
FT                   EFIEEVAMLRLHELVVKGKSVDKHNDAKTQKMAYQKMMSAPFGIPANFQKGQWVYRRRK
FT                   KSAKNQYNFDGPFLIEEVRNNNSYIISRNGKREKGTYHHDMLKPAFALEDSPITALSNF
FT                   QKSMQEIEHRVLGKMFDEIKVRVIMLSDIMKNRKPVKIDAVMTHPQFYERERVML"
FT   CDS_pept        complement(309026..312370)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574527"
FT                   /orf_name="CD36_81320"
FT                   /product="ARF guanine-nucleotide exchange factor, putative "
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42662.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG396558"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI000192D48A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB0"
FT                   /transl_table=12
FT                   /translation="MEISKPPTPLNIVGKPPLRNANVHHHKTALVSVDPITLAINECMI
FT                   MASAMRKSNRWAQGGAAALFSSGDIFGDDDDDDDDEQVEEVEEDNDGDTGEEEGGVVKG
FT                   EQNGSSNNLGIKATNLDRPNASTNVAVSPRKSSTTQGNPLLASFLQLKSILIDTKNIYD
FT                   IDSLTLLQPFLMVIKSSSTSGYITELALNTISKFLNYDIISFKSKNLQTSLIQIISSLT
FT                   HCRFEAADQNSDDAVLLKVLRLLERIIEDELSSLLPNDVVSEVVQTCLSLACNKKRSEV
FT                   LRRAAEMSMDSMTVEIFSKLKDVDPELDNGDDLQTNFSDTILPEDRIGGTDAPTEINSP
FT                   RNSISGKENILMEDNDEDKSEENQKKQETLPQEPKEKSVDETKDIKQKEETHVETSSIV
FT                   DNSEKSEFDVYSNEEPYGIICINEFLGILVSMISPSNQYQHMESTRVFALSLINTAIEV
FT                   AGIEIPKHPSLLNLVTDPISKHVLSIITTTESPALLRASLKLFTTITIVLDQHFKPQFE
FT                   LSISLIFQSILPQSEIQMKGSSHMSFRNPISKEILIESLSLLWIRSPSFFTNLFIDYDC
FT                   DFEKSDLAINILQYLCRLSLPESAFMTTDNVPPLCLEGVLSFISGINERSKKFKETKQN
FT                   NDLVEKRKQKIAFIQCTELFNENPKQGVKQLAIDGFIKDANDLKEVANFLFSKSGRLNK
FT                   KVLGEFLAKPSNSELFGHFIDLFDFHDIRVDEALRVLLKTFRLPGESQQIERVVERFAE
FT                   RYVECQAQGRINPDKSTSVETEVVSPDKDSVFILSYSIIMLNTDLHNPQVKKQMALDEY
FT                   RRNLRGVYNGQDFPEWYLSKIYFSIKSREIIMPEEHHGTDKWFDDIWNNIVVTTSSIQT
FT                   FSDIKIEEVDKVLLSSVFPQIISTIFHIFHHAREDQVITTLIGYVYKLTQICLKFELHS
FT                   EIRKIVDKLIKFTTLTHTPKKPNEILITEVKLDNKTAIYVSDYACSFGRDFKAQLSTVV
FT                   LFKIIKKNNLKLKHWDKIVEIIEKLYQYSLIFDENIPSNDKDTKEDNDETTSGESDNSI
FT                   LKLLSSKDIKKLPIKRITNDSFLSILKNLIDNQPTEEEIQSTLAAMDCIKSLDIPNVLR
FT                   IIAESKK"
FT   CDS_pept        313561..314769
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078562"
FT                   /orf_name="CD36_81330"
FT                   /product="EH domain-containing protein, putative "
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX42663.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG333510"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000192D48B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB1"
FT                   /transl_table=12
FT                   /translation="MPRLEESEIKKYWQIFQSLKPENNKLTGDQLSSVLKNSQLPQQQL
FT                   SAIWELSDIDNDGKLDFEEFCIIMRLIFDVINGKLPNVPSELPSWLIPASKSAIIQANK
FT                   AVNQGNNNFGNDGIDDDLDDDDKLSNDFDWYISPTDKSIYEKIYDSKCDSFGRIKYSSL
FT                   NELYNGLTNVPNSEISSAWNLINPKSFETIDKDQTLIFLHILNQRENGKRIPRGVPASL
FT                   RATFSKEVPNYDLSAQVKPSISTTTEIGKKSFAENYLNKIGGGQNTIINNGRNEKGTDF
FT                   SATQGTDWEEVRLRRELQDLEKLLDKVQNDTINHKHNNNNNNTNGDNDMLIKYEFEQLL
FT                   KYKQDQLNSTASTKNNSNNSTDLSSIKQDIEEIQNQVNTLQEYLTTKNQELLKLNQQIE
FT                   SLK"
FT   CDS_pept        complement(314803..315645)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574528"
FT                   /gene_name="ALI1"
FT                   /orf_name="CD36_81340"
FT                   /product="NADH-ubiquinone oxidoreductase subunit,
FT                   mitochondrial, putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis, light reaction "
FT                   /protein_id="CAX42664.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0019684"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG727675"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="UniParc:UPI000192D48C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB2"
FT                   /transl_table=12
FT                   /translation="MMISRTLLKRSLPTVQFLRPFTRSTIIRSAHEEDLVNLNELPRKK
FT                   SLEENYVPLINPTEKYKIQIEELHKFGTYIMACLPKYIQQFSVWKDELTIYVAPTAILP
FT                   TMLFLKNNTSCQFKQVSDITAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETTPVP
FT                   SITPYFNGANWFERETYDLFGIFFEGHPDLRRILTDYGFEGHPLRKDFPTTGYTEVRYD
FT                   EEKKRIIYEPLELTQAWRNFTVGSSVWEPVGEGKDFTPQSFKLPTPEPEPEKESDEKK"
FT   CDS_pept        complement(316825..317208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574529"
FT                   /orf_name="CD36_81350"
FT                   /product="Oleate-induced peroxisomal protein, putative "
FT                   /function="sterol binding"
FT                   /protein_id="CAX42665.1"
FT                   /db_xref="GO:0032934"
FT                   /db_xref="HOGENOM:HBG599482"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniParc:UPI000192D48D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB3"
FT                   /transl_table=12
FT                   /translation="MSVEVDGFNASALFKELNEGLQDKSKAQEAIKGVNAVIIITLKNK
FT                   EGKDQSWVLDLKKEGTLTKVDGSIPKGDVQLLLKDADFVKLANGKANGQKLFMNGKLKV
FT                   KGNMMKATAIESVFKKLDPRPKL"
FT   CDS_pept        318913..319569
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574530"
FT                   /gene_name="RRT14"
FT                   /orf_name="CD36_81360"
FT                   /product="Regulator of rDNA transcription 14 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAX42666.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396559"
FT                   /db_xref="UniParc:UPI000192D48E"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WDB4"
FT                   /transl_table=12
FT                   /translation="MSFNSKASKYQAENTVDKLFSNILHTTTPKSVSNTNTKTKTKTKT
FT                   KTKPISSTQLLVNQLQSSNTNSNSNTKRKKHNINKRINKTLLEEKKFSKFIKYNHIKQK
FT                   SIKSESDEKYLHKLIRKNINSLNKINKIDDLLIDEELNQIKLELLANESNVGNVGIGHF
FT                   KGGKRLRKKLLNNNKEQEEFDGFGNISNNKGKKNSHPGLTPGLAPVDYEEEEEEE"
FT   CDS_pept        complement(319707..323222)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574531"
FT                   /orf_name="CD36_81370"
FT                   /product="DNA repair and TFIIH regulator, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42667.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG398445"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D48F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB5"
FT                   /transl_table=12
FT                   /translation="MVEHNIPILINQYIAASSGNDEEAVSNYIFELSNLITNDELSLLQ
FT                   FIQHLGPSLTSDKDLIRSKSIECLSKTIISLSDSKLTKQDINVLMEFLLNKLIDNDQIC
FT                   LQYSLMGINSLICKKNFLADTNIEKILQNLYKNYDPKKNLAKIRFETFQILLNLLNQFN
FT                   QYLKSSIQLTNLYIKTFIHIASGEKDPRNLLLSFELNSKINENFQFLVDNNELHQQFIT
FT                   DLFDICFCYFPISFKPPSNDPYKITSEQLKVALRKTIASQSKFASEAFPNLIEKLTSTN
FT                   PTIRNDTLKTLQLCIENYSNNDPTIIEQYWMTIWNALKFEILHNDIRSNFNPTNNTIVA
FT                   LDYDEIDDNDEFKPLVLTLVILNQLIMKLPQPEIMLHTVVEELKPNLEIIKEKSIKSSL
FT                   ILSSLGSTSIENLNYIVDFLFQYQVWGKFLNIDKKEEPNQKQEIDTNDDISLNIAKQRD
FT                   LIDSIGFVLTAYQVLKPTTTNCHLLDYKDYILIFLGQLLNITSNLEKTLKCKIIQQLIK
FT                   LIKLPGFLNINELELILGNYFKDFFLLGTTTTTSSSSSSAGKKKDVILQEIINGLIEVS
FT                   QDSQITSMTIEFIINPILNQLLNNDDTEIDIETFQFQLEIVGDLCINYQILEVISIRLL
FT                   NKLSLIINNQSNDNLQLYKLIINLFIESIKKIESIQQFLTNSWYKHFIPKFMENLLIIL
FT                   PVKKSFFDDNDYKSDNYELFEIVGDLLGLIIKFIDVSKHQEILDQLNQAFITNNDQTNE
FT                   NYGLGPFKYPSNLLIEPTNYINIYNKILSSIDKSCVFKTNIDQQVIELVINLIYKIGSK
FT                   DEYLRLQYLQTLCLLINKFIKNVDIDIIESILKLKLLEEFNHKEFPITEKDFISFEIFI
FT                   WILKGLIIKLDKLGINYLNQLLELFVITKNYKFKQLIGKSLQILFIDLKIFTNEKITST
FT                   TTTTTTTTTTTNSVDTSSNDLKSSNQLISKVKNLQIKSLYKQHIFVIILPYLINNDDSN
FT                   NFGTDNDFNLKFNSLSLIIENLSINGNNNILINQLSEILPITLYSLIKIPIDSNSNSNL
FT                   LASLIILNIILKEEEKEEKEKEKDINNTNLSLLTKDNIIELIPILIKLITTTTTNRKSK
FT                   SKSNSSNIDIKILSLKNLKLIIEKFDDIINKSKLLNDLLPGLDDKKRVVRKLTIDLRQL
FT                   LYDSK"
FT   CDS_pept        complement(323689..324921)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574532"
FT                   /orf_name="CD36_81380"
FT                   /product="3-ketoacyl-CoA thiolase A, peroxisomal, putative "
FT                   /EC_number="2.3.1.16"
FT                   /function="acetyl-CoA C-acyltransferase activity "
FT                   /protein_id="CAX42668.1"
FT                   /db_xref="GO:0003988"
FT                   /db_xref="HOGENOM:HBG370930"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000192D490"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB6"
FT                   /transl_table=12
FT                   /translation="MSSKQQYLKKNPDDVVVVAAYRTALTKGGRGGFKDVGSDFILKKL
FT                   TEEFVKKTGVDPKIIQDAAIGNVLNRRAGDFEHRGALLSAGLPYSVPFVALNRQCSSGL
FT                   MAISQVANKIKTGEIECGLAGGVESMTKNYGPEALIAIDPAYEKDPEFVKNGIPMGITN
FT                   ENVCAKFNIPRDVQDEFAAESYQKAEKAQKEGKFDDEILPIEVFQEDEDAEDEDEDEDE
FT                   DAEPKEKLVVISKDEGIRPGVTKEKLAKIKPAFKADGVSSAGNSSQVSDGAALVLLMKR
FT                   SFAEKNGFKPLAKYISCGVAGVPPEIMGIGPAVAIPKVLKQTGLSVSDIDIYEINEAFA
FT                   GQCLYSIESCNIPREKVNLNGGAIALGHPLGCTGARQYATILRLLKPGQFGVTSMCIGT
FT                   GMGAASVLVRE"
FT   CDS_pept        join(327741..327755,327875..328387)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574533"
FT                   /orf_name="CD36_81390"
FT                   /product="ADP-ribosylation factor, putative "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42669.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000192D491"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB7"
FT                   /transl_table=12
FT                   /translation="MGTLVSKLFKNREMRILMLGLDNAGKTTILYKLKLGKTSKTVPTV
FT                   GFNVETVKHKNVSFAVWDCGGQERIRPLWRHYFTGTNALIYVVDSSDVDRLEESKQELF
FT                   RIVTDKELTNCLLVVLANKQDVDGAVKPKDLIERFQLNKLTGEHTWSVIPTIAIDGTGL
FT                   VETLNWISSHSK"
FT   CDS_pept        complement(328575..329366)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000276369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574534"
FT                   /orf_name="CD36_81400"
FT                   /product="Ribose-5-phosphate isomerase, putative "
FT                   /EC_number="5.3.1.6"
FT                   /function="ribose-5-phosphate isomerase activity "
FT                   /biological_process="pentose-phosphate shunt, non-oxidative
FT                   branch"
FT                   /protein_id="CAX42670.1"
FT                   /db_xref="GO:0004751"
FT                   /db_xref="GO:0009052"
FT                   /db_xref="HOGENOM:HBG515603"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="UniParc:UPI000192D492"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB8"
FT                   /transl_table=12
FT                   /translation="MFKRNLYHQITNKITFTQLIIRNMSSTSKVESAKKLAAYKAVDEN
FT                   FPKDAKVIGIGSGSTVIYAAERIGQLSNKDSFICIPTGFQSKQLIIDNGLKLGTIEQYP
FT                   DIDIAFDGADEVDPHLNLIKGGGACLFQEKLVATSAKKFIVVADYRKKSDKLGQLWRQG
FT                   VPIEIVPNSYSKIIQELSKKLAAKNVDLRQGGKAKAGPIITDNNNFLLDADFGEIEIEK
FT                   VEKLHEQIKLLVGVVETGLFTNMADKAYFGEEDGSVSVWSK"
FT   CDS_pept        329955..330515
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574535"
FT                   /orf_name="CD36_81410"
FT                   /product="Ribosomal protein, small subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42671.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG320156"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniParc:UPI0000036CEC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDB9"
FT                   /transl_table=12
FT                   /translation="MSSKILSENPTELELKVAQAFVDLESQADLKAELRPLQFKSIKEI
FT                   DVNGGKKALAVFVPPPSLQAYRKVQTRLTRELEKKFPDRHVVFLAERRILPKPARKARK
FT                   QQKRPRSRTLTAVHDKILEDLVFPTEIIGKRVRYLVGGNKIQKVLLDSKDSTAVDYKLD
FT                   SFQQLYSKLTGKQVVFEIPGESH"
FT   CDS_pept        complement(330795..332669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185865" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535603"
FT                   /orf_name="CD36_81420"
FT                   /product="SH3 domain protein implicated in the regulation
FT                   of actin polymerization, putative "
FT                   /protein_id="CAX42672.1"
FT                   /db_xref="HOGENOM:HBG396561"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000192D542"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC0"
FT                   /transl_table=12
FT                   /translation="MSIETISIGNELKDSYKSTSKWVTNGINWLQDISDYYQERSNLEK
FT                   EYSMKLKELTKKYFDKKSKLSASLSVGEEPAITPGSLENASLVLWTDLLTQTEAIADEK
FT                   SNLSREFQSKIADNLITLKGKCERVLNLTNLINDYLVEEKSKFEDDVNKAKKHYDSLCQ
FT                   TTETARDKNEKAPNEKHQKKLDEKQIIMNNGKNEYLIKINVANRLKDKYYYQDVPEILD
FT                   YLQELNEDRVELMNKLLKNASIIERNSADKIKEKLHAIDQTIEQNNPKLDITMFIKHNA
FT                   VDWKEPQDFYFIPCSFWHDDESLIIKEPELTELKKKLSIASNEYYKFEQSCIDAKQKLE
FT                   ESTTKRKHDNANITLKFDTGLQSSLSILHKFMKEDTNRVKNEVEIEIIQNFAGDKDLTY
FT                   VAPVKEKKSRFGFLTGNHKKSQVGEATTTTKQSDASSDVHSLNPVKTSTSLHSGIFDLR
FT                   RNKSIASTVSGGTAGNGSTIVQARTLYDYTATGSDETTIVAGDQLSVVEEDDGSGWTTV
FT                   VGPQGQGLVPTSYIEITSRAAPPQQQQQQQQQQQKKKGPSVAPRRGAKKVQYLEALYDY
FT                   TADGDDEISIRAGDRIVLVQDDTDGSGWTEGELNGQTGMFPTSYVKKI"
FT   CDS_pept        333416..335329
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078563"
FT                   /orf_name="CD36_81430"
FT                   /product="Actin patch protein, putative "
FT                   /protein_id="CAX42673.1"
FT                   /db_xref="HOGENOM:HBG396562"
FT                   /db_xref="InterPro:IPR017210"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniParc:UPI000192D543"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC1"
FT                   /transl_table=12
FT                   /translation="MTARDEGAIPLSRRQRLMGLARNTRDNYIPKITGSVSSFASGASR
FT                   AFTNTDVYDENGRILLPKDSTIQLFPSYTRYQDGKYFVDVQGWVFTPGVMNRKNRVVLS
FT                   VVKQIMKQRETSRAALNSIENDSTMKQEVFNPDSTSSDAESIISVDSSHSSQSSNASIN
FT                   PDDVIKERLSSFFARSIPNTELSITIGSESNVDKLKQLSISTDGYGHFETTIEVPYKPS
FT                   VIQASSKLVDTVFAFQDIKVYSNSGIGIISDIDDTVKLTGVIGEKMVLLRNLLTNEVSS
FT                   WNIPAVIKWYQNIYKRENVNFFYVSNSPWQLFNTIHEYFSYTGLPPGSVHLKRYSGNII
FT                   ASLLEPSSSRKRRALHKILQDFPDKKFVCIGDSGEHDLEAYVDLARSFPNRILSINIRY
FT                   VEDSFSDDNDQKIYNEVIRLITLKRKEIPKTTETSKPSVNKQISSPPSDDQLEDLIDLS
FT                   DTPIKQTPKKLPPMVPKKPTKLKGQNMTRKPPQPPPPPSRNKGSTLTHSYTDTVLLSPD
FT                   STTSQQQSQQSLPTSLPSSSNIASDGNSINEELPPLPPRRRTSPSINSANSHDSELDSI
FT                   CNSPGFIELEEYDQKGANWIKRIISSIHQLEGVDTKLNIFKDEDDAFFKNSCIELDELK
FT                   KK"
FT   CDS_pept        complement(335455..336516)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229960"
FT                   /orf_name="CD36_81440"
FT                   /product="Translation machinery-associated protein,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42674.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG737197"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000192D544"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC2"
FT                   /transl_table=12
FT                   /translation="MPPKKKGNQPSDKSKAKAKAKSAEDKSFGLKNKNKSKKVQQQINQ
FT                   MKAGIDGGLAKKKEAEAKRKAEEKKAQEEAKKEAAALFGIQQQKVPFGVDPKSILCEFF
FT                   KQGLCTKGNKCKFSHDPNVGRKVVKKDLYTDSRQEEKENDTMDNWDEEKLRKVILSKHG
FT                   NPKTTTDKVCKYFIEAVENGKYGWFWTCPNGGNDCKYKHSLPPGFVLKTKEQKKLERLA
FT                   AENEPKITLEEFLELERSKLDKSKFTPITAESFAKWKQEQNSKKESQRKEDEKKGKRVL
FT                   TGREVILEKFSDKYYTEEDNGETWDLSQFKSNLPDDSDPNIKDYGDGSKVQEYYQQENN
FT                   KSESLENKDAVTA"
FT   CDS_pept        complement(336849..345338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093831" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382832"
FT                   /orf_name="CD36_81450"
FT                   /product="Cell morphogenesis and proliferation regulator,
FT                   putative"
FT                   /function="binding"
FT                   /protein_id="CAX42675.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396563"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D545"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC3"
FT                   /transl_table=12
FT                   /translation="MIEIPDLDELSLQNYSGSNNAIPEENHSDDENQQQQQQQQQFILE
FT                   PQHSIRSLSIEENGYLQHQQNQLQQYMQQQQQQNTLTPEPPTILDFTKDQLPPSATSFQ
FT                   NSTIDSDILGETIALYNNSANSSNIQKSQPQLLQESSDHLTEKEPSTLSASPVPMLDHE
FT                   PQMIDARLERIEHEVDTFKKRENNHQHTQMQPYTQDTESGLSLGTEDSQNISSQKVDYV
FT                   QTKNSSLEFDAPIGLAYMPDNLEEHKTSFKLQQPPIVTDYHDTTTPDLDNESNDRLGSL
FT                   ETPLMTGFDFNLGANTSSANQLSSPMSTFPLHNRVEPSPQLPPPMSSASLQKLTLQNGE
FT                   EFGSIRRDLATDSKTSAEYTLHIIFTQFVRHAERKLNLCLDYPLNEEPPILDLIAEGVD
FT                   AEFDKIISALGYIARRKPKPVIDSVMFWRKSKSEVASMAATEVEKAVGVAQTNLLKISK
FT                   TSSSTTTTSPISPSNPGIAKNSNSASSAKRSLSLMRKKSFSRIAHRRNVSSSAAIQSSS
FT                   NVPESESVFMKQKQFYDDQISQAKETAVHADRKSLASIYILCRVLIEIVKQTPLSVMGS
FT                   DLSSKLEEIVYTQLKTTDPISTSQSLVRAANWNLFAELLGYMSRERFVSVNDRFIADLE
FT                   KVPQQIRHEDEPKLYLLINGMKYLKLTIYPLEEFEESAEFIQSLAKFFDKTTNETVLYA
FT                   YCEVFSHLFLPLANIITAEANYPSWVEGVEKVYHKAFKLWRQSLGSTSSPTSLTLPTSN
FT                   TSSGVSSNNGWSHSLTLMASALSVSRKELFSEVWINVINENSFKLKPKVEAEDKTTYIM
FT                   SITRLIWVYLNRLPDTLNNTIKRLDAIFELLFFHNNATSKKHQWISSDLFLIGSLIELI
FT                   RIVGYNHLNYVLEQVLIRLLNMSFNGTSLENAFPEKLIIVIKSYLAILKDYEIGDKPSF
FT                   PAEFPNEQKKKVNEFLFISKNSTNSAAHEEICRTLVSLLRILDNQYGSGFNNENNSLFS
FT                   LGSSKSQSSFGFHFNYDPTPQTTKEVHIQLFATVIEAIPWGIVGASGDNNQNLIPFKQV
FT                   VDILIRGAIHPDSRISVTSIKSLKYLASKKNPTSLMTIYAKHAFHFSDKTGPTYDTEYL
FT                   YSDQFTKLLKLYTELLDCWLLSFQDLLEKKKADQPIGALAGNDKSNNRDALNNLYKINR
FT                   KNADLSDSHTTKLNPSDEFEWKTIITAIEDIEGNGLFFLCSQNPKTRYYGIKVLKLVEQ
FT                   FDQAVYNITDSSTDSSSGTKQHSRSSSKFAADVGTRLVHILEDLDFVELIQPYRKELSV
FT                   PERTRLTKLKNKKNILIRLAESEYGIDSAIWLRLYPKVLEIFFDRCPMPVAMCRNLVCV
FT                   CLVQMHEFVLEFSDSYKSYTSSLFSKSPTNVPPEVLVNQWKLYLIFACSTLTATNDQKI
FT                   SFPNQPTHGRKKSLQMFIQHQKITSAKSVFKMVLPLLRSSQPMVKESVIVGLSHININI
FT                   LKSFLENIPLAVEEWNTNIKTRNLQDDTFRLEIVHILANLTEKFGSHELIYTDDSIVAN
FT                   LVAIVKNVKNFLSEPAIQTNFECQKLRRYFCGFLENVYAGLEAKSDLEKWLPFEARVAC
FT                   FNYLKEWCGYGDSSAVTEERYNAIIGRIKTEKAGPSALAILEIERKKLQLASLKCMAIL
FT                   CSGQIKKKIEIPGNLAVVSFDIPGLLNWIQALLESDVEKIKEIGHCALRNVIEKNFEFQ
FT                   DIISAVVERCYISQKSLESYFCLFVEIFMAKNKFEIVQDELICLASVFAANESFEVRKS
FT                   AIALLKYFEKKTLGTESLERYTEAICSKSPVVYKKVLFDLSNDIQNMKPESLYNRISYL
FT                   TQNMNLIFPAAREAVLSLLVPMVSQVILNYENPLPEKDSNTDIHEKLFDNSSLMVLSNL
FT                   FEITVNYSSSMSNQIEVLWISLSNNVQNIDKIVEFLLQSSLESKNPSFVEQSRQIIDYL
FT                   AFARSDPAYIIDKLINNLQPRMMVPPQLGNKSPVPINKDYPYVCDIKKVVQTNEKDVIF
FT                   SLGQLSMVFLVDIVTLKNDLMIEKLPLLLHVSLSLMDHYLPIVQEQAGTFLVHLIHALV
FT                   RDDPKAQETVSSLRENDHIKHLWVYDDLNNDKRGARTPKNMDLLIRSAIKMFAAVAPNI
FT                   QDDWSRVSLHWATTCAVRHIACRSFQVFRSLLSFLDQSMLKDMLHRLSNTISDETVDIQ
FT                   GFAMQILMTLNAITAELDSEKLIDFPQLFWSSVACLSTIHEQEFIEVLSTLNKFISKID
FT                   LDAEDTVACLTKTFPQKWEGKFEGLQQVILVGLRSSTSWEPTLKFLDKLIVHKDSLIIG
FT                   MGDSRVLTALLANMPRFLHHLSEESVTPEIENTAMALSQLAEDSGKSALAKLLVSFAKR
FT                   RFRSKSDFLDQSISCIKNAFFPEYQAQTLVLLLGLLFNKIPWVKTETLGLLQSIFPLVD
FT                   LQRDEFIGVGADLISPLLRLLLTDYAEWALQVLDEAEIIPGSQSDKDILRMSLGSTSMK
FT                   KEYENTATLFGIPDESGWSIPMPAITAATTRNNVHAVFSTCTVNNIVDENVEQEEDGSD
FT                   IQFHSEEYYGPASDQTQFVDSVSVNVEDREASLSNVWAALDDFDSFFTKESEQAGHIPA
FT                   VANRAMRRNQAHPRYHVHSASVDTKYSNSSDTLMPMESAPNVYDKKASVILNRSLARTT
FT                   SNTSFRANLADSIGGTQVASSSTHSNKRSYIPFRSSRHSNKTRAEVFSTPKMPLSSGFD
FT                   AHDLDQTPSSIQSTAISSPTLSVAHNDGDHELASNTNENVTRFEGILGTKKRSKKGIRQ
FT                   NSPNESTTNISPELSTNNSFRNSHVSSIASPKGTAPVISSPIQIVGATVAAAAATPNSG
FT                   KEKKRISQKFR"
FT   CDS_pept        348388..348975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574536"
FT                   /orf_name="CD36_81460"
FT                   /product="Mitochondrial protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42676.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG395789"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniParc:UPI000192D546"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC4"
FT                   /transl_table=12
FT                   /translation="MKLITENEKSDHKSHIMKQGSKGFLIGSVVGLGLIRYFKFKQPLK
FT                   YNSFNWTIKACLYTMPTLGFTAFLTDNGGTQFFKSRYRSPHLQQEKQVKSQQLDNLSMS
FT                   ERIIYRLNEHKYKLVVGAWAGFLFGAWRVINKDLLLTKTQKLIHARVYAQAFTIGILLS
FT                   TLYLNMKEVELNNKLPQLPQSWERVLKEKGEL"
FT   CDS_pept        complement(349414..350805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535604"
FT                   /orf_name="CD36_81470"
FT                   /product="Cell wall protein, putative "
FT                   /protein_id="CAX42677.1"
FT                   /db_xref="HOGENOM:HBG398421"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniParc:UPI000192D547"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC5"
FT                   /transl_table=12
FT                   /translation="MKFSSTTLLAVLASLSATVNAGCSFEGGNYYCSETKKVVYKGIGF
FT                   SGSYQDVTNMDENTGKCTQKSYSFSGNLSPLDEELSVHFRGPLKLLEFGVYYPSSNGNS
FT                   KRQVDEQDCNTKHVHHKHKRATEVVQVTQTVFVDGNGNTVTSQALQTSTIETNSAASSP
FT                   AANNDANSGSGSGSGSGYGSVSALDGEGKAYRTDISTKSAPTSTSAQPSSSETASADGA
FT                   WTRDSHYTPGSTDNCVFLNYHGGSGSGVWSANFGNSLSYANSDNSGGSSTPVALGETTI
FT                   KSGEEFIIFSGSKCGSSSDCGYYRDGTVAYHGFKGTSKIFVFEFEMPSDTNGNGYNQDM
FT                   PAVWLLNAKIPRTLQYGEATCSCWKTGCGELDLFEVLSSGSSKMISHLHDGQGSSQNSN
FT                   NGGGGSQDYFARPTSGSFKGAVIFNGDEIHIVQVDSNTDFGSSLDEDTVNSWLSESGSV
FT                   ATIGY"
FT   CDS_pept        354848..357151
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574537"
FT                   /orf_name="CD36_81480"
FT                   /product="Pre-mRNA-splicing factor ATP-dependent RNA
FT                   helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX42678.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D548"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC6"
FT                   /transl_table=12
FT                   /translation="MANEEKRSNKRQKLIDNYEAEKIAEASEESLKAHPHASDKIELIH
FT                   HDQGEFKGLTRHQTTAEQAQKLENGPKNPFTGHDFTTKYFDILKTRRDLPVHAQRAEFL
FT                   KIFHSTQIMVFVGETGSGKTTQIPQFVLYDEMPHLTGKQVACTQPRRVAAMSVAARVAD
FT                   EMDVELGEEVGYNIRFENNSGPKTILKYMTDGMLLREAMEDHDLTRYSCIILDEAHERT
FT                   LATDILMGLLKQVSVRRPDLKIIIMSATLDAEKFQNYFNNAPLLAVPGRTHPVEIYYTP
FT                   EFQRDYLDAAIRTVLQIHATESEGDILLFLTGEEEIEDACRKISLEGDELVREQNCGPL
FT                   KVYPLYGSLPPHQQQRIFEPAPINPNPNGRPGRKVIISTNIAETSLTIDGIVYVVDPGF
FT                   SKQKVYNPRVRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKELIEQSYP
FT                   EILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLQCLSDEGDLTALG
FT                   RLASQFPLDPMLAVMLIGSPAYSCSEEILTIVAMLSVPNVFVRPASARKRADEAKLAFA
FT                   QADGDHLTLINVYEAFISPEASEIGTHKWCRDNFLSYRSLTSAKNVRNQLQRLMQKYDL
FT                   QLISQYNQVPEFEYWENVKKALVAGFFMQVAKKKSGNKGYLTVKDNQDVLIHPSTVLSK
FT                   EGEWLIYNEFVLTSKNYIRTVTVVKPEWLVEIAPKYYNLDHFAKGDVKLSLERVVERVG
FT                   NMKKLDKKKKKSKN"
FT   CDS_pept        357489..359207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535605"
FT                   /orf_name="CD36_81490"
FT                   /product="Mitochondrial protein, putative "
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX42679.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG396565"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000192D549"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC7"
FT                   /transl_table=12
FT                   /translation="MDFSTTAAVGVDIGTGSIRVYYNETLTSLPITTENDKYITQSSFE
FT                   IYSKLISLLSSPPLDWNFGSISITATCSMVVLSKIIINGETYLTPFSLSKSHPNSDVLL
FT                   WMDNSATLQCNQLNGYLTVANKDILNLLGGKFVPELGLPKLKMINDNFVEENTRDGDGN
FT                   SDLVCFELYDWISYLLKVGGFKNINAHFNGDDYSDEKLIIPYIPSRPFDSGYAIDGSIK
FT                   GWPYQFLQEMGITVEVGRSESGIGNRLLPIGTPIGKVDKSDIIIGHGCIDCYSGFMNMY
FT                   RSLPSDKGSTFSTVSMIAGTSTCFIYSTETLMEDTNRNWAAAPSYIPTVWGPVEIGKSG
FT                   LYLYEFGQPATGKLFEEFLTIGFVQLEQETKNLELKHHKPIHELIKGYFYYGDVYGNRN
FT                   PYSDPKMSQMIIDNNNDILPNVITTNNQNGESANVLPQVIKYILILEFLVFQTKQLLEP
FT                   LSDVSQIIINGSQSKNTRFLKLLSTVTGLPIVIAKNAVARGAHLMALIGKLCSLGWNYD
FT                   DAFDQVIQSNNDECVGNNDIVDVREDYYQLLMTKYEIFKDMASAQQRYRKLMGDI"
FT   CDS_pept        359863..362967
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574538"
FT                   /orf_name="CD36_81500"
FT                   /product="Fungal zinc cluster transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42680.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396566"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D5F6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC8"
FT                   /transl_table=12
FT                   /translation="MNNNNFIFNSGDNNNNDDSNYYSQANNSGHLLPLVQGDSMSTFNS
FT                   TSPTSSISPSNNNTGLNNNQSQVSSESVLSNFFHTTNNSNPSLTKLTNRHTTSKKPKRK
FT                   RATNIRACDTCAAKKVKCDANRPCGQCRANNLDCTHTRERKKTGPKTPTQKALESINNL
FT                   TEVIEINANGKRRNLSRTGSNNSAVTRCSSNELTHDRTETENSNQPLSSRNSASPPIST
FT                   GSSIRQFNTSRQISGNNGNGDTNETNNNNNIHQQTLEQLQGKLSINDTSTTKSGKFAAS
FT                   IPSATTIEDYIVTPFHLMENINLIGEEPSIHELVRPLTVDSVILNYGRLVEFLVSNYPD
FT                   SGDGNYQNNPRYQELNLINHHDNSLYLSTLLIILTLNQIIAEVLIKLKKQKFKKFVRYP
FT                   KKYLLSRPFKNFKNLCHFKVLEIFTLIEKNFIVPPVIPQNRAHRPSFASSNNTGSNEVH
FT                   TSTIVTNNHNNNNNNGQTHSFMHLTHYQIYYNLSLSSIQLCNYYHILNLTNTLNYTNSN
FT                   EYNYGNEAQEHQKILYMHRAITYFQLINFRNSDVIDLVQELYELLYSCERYYVVMSSHN
FT                   YNINVTRNNDIILQLRSNKYKGTNYTYELMRFLDSKQMIDELCYKSNFNVLLNYTKPVS
FT                   GYFELKTAIDKLNAIEPIHKIIHNIVLFKLLLIKPLNFVETKHEIVTIIRNLNLLLEEN
FT                   DSDTFKVKISNYQIIQPMLHCLKSFLEIKQVEVKIGTPQLDLSDQVLLVQFSENLILHF
FT                   PFFNNINKLIRAHKILNNWFLNLSEIKKDELEVQNEKSQQQPKPQSFEQPIEPPPQQQT
FT                   QEQQQSASHNLENDLQNQIFTPTSNSFSMNIPMHNAVSQMSPNLSQVSSQQKIASQINL
FT                   NELLRDLNGTPSSTTDFINQYSTYNIPDNLVNAISNSITQHQADDEEEEVIDNDDEDDD
FT                   DDNDQDQFFSIVPQNQHGHKFANLQTPQPVSNLGSSGVRLNNGSVSTATPPGATSSGGG
FT                   NNTGSFLSLFNATNFVDDQTDGTNGAAGMGNSFFNLYQLNNLPEK"
FT   CDS_pept        363795..364883
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574539"
FT                   /orf_name="CD36_81510"
FT                   /product="Serine/threonine-protein phosphatase type 2A,
FT                   catalytic subunit, putative"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="CAX42681.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI000192D5F7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDC9"
FT                   /transl_table=12
FT                   /translation="MDLDTDVPMEDVEEQQQHEQHEQSISKQPPTKSLTTLQGTGATAT
FT                   SSAQQQRKDLDGSSINQLDVWIEKLSKCEPLSETDVKKLCDMAVEVLQFEENVQPVQVP
FT                   VTICGDVHGQFHDLMELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVCMKVRFPNR
FT                   ITILRGNHESRQITQVYGFYDECLRKYGSATVWKLFTDLFDYFPITALVDNKVFCLHGG
FT                   LSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQF
FT                   NHTNDLSLIARAHQLVMEGFSWSHQENVVTIFSAPNYCYRCGNQAAIMEVDEQHNRQFL
FT                   QYDPSVRPGEPTVTRKTPDYFL"
FT   CDS_pept        365360..366721
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574540"
FT                   /orf_name="CD36_81520"
FT                   /product="NADH-ubiquinone oxidoreductase subunit, putative "
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42682.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D5F8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD0"
FT                   /transl_table=12
FT                   /translation="MSDILFGIIFPANQRQQNLYYEREKKKIAPNKKTTIYCFIYLVTF
FT                   QEQLSIASIPYIKPTHPLLHITMLKVSARPISRSIGVSSRRSVYTSVLESDINITKNGK
FT                   VNLGVGAGGRSSRTGYTATVFGASGFLGRYVTSKLARHGTTTIVPFRDDMKKRFLKVTG
FT                   DLGVVNFVEIDARNLQSIEDSVAHSDIVINCIGVDYDTKNFKMADINIALAERIAEATK
FT                   KANVPRYIHVSSYNADPKSESVFYATKGIGEQVVRDIIPDSTIVRPAPMFGREDSLLNY
FT                   LGPKVKMWTPNKNAKEVWPVYVLDVAKALEKIAYDDSTAGQTFELYGPEKVTFQEIRNM
FT                   IHGITENYAQVGPWSYQFADYAIPLPLAKAIAKVQQLVWWNLTNPDQVQRLVINQKIDP
FT                   NAKTFQDLGIDDLTRLPDVLFSYVKQWRHPLIAQKGAPGKKALERLRDVQHFTP"
FT   CDS_pept        367003..367563
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574541"
FT                   /orf_name="CD36_81530"
FT                   /product="Conserved hypthetical protein "
FT                   /protein_id="CAX42683.1"
FT                   /db_xref="HOGENOM:HBG325003"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="UniParc:UPI000192D5F9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD1"
FT                   /transl_table=12
FT                   /translation="MALPTIQSFKKSSSEDKRQVLDHLFEPCNTLSNFVFIKVLHQQYN
FT                   TYPEFINIVRKELLEFLKQSETFQSQYQGEINPVINEIISAHPRLGEPKKETLSVHSNN
FT                   EQKTLNSDPEIIKKLKELNAAYEKTFPGLRYVVFVNGRTRHEIMDNIQKRIDRNDIKLE
FT                   RVEAFNAMCDIALDRANKLGIKL"
FT   CDS_pept        368180..369913
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535606"
FT                   /orf_name="CD36_81540"
FT                   /product="Vacuolar ATP synthase catalytic subunit, putative"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="nucleotide binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="CAX42684.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG288114"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI000192D5FA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD2"
FT                   /transl_table=12
FT                   /translation="MIGCAMYELVKVGHDNLVGEVIRINGDKATIQVYEETAGVTVGDP
FT                   VLRTGKPLSVELGPGLMETIYDGIQRPLKAIKDESQSIYIPRGIDVPALSRTVQYDFTP
FT                   GKLKVGDHITGGDIFGSIYENSLLDDHKILLPPRARGTITSIAESGSYNVEDTVLEVEF
FT                   DGKKHKYSMMHTWPVRVPRPVAEKLSADYPLLTGQRVLDSLFPCVQGGTTCIPGAFGCG
FT                   KTVISQSLSKFSNSDVIIYVGCGERGNEMAEVLMEFPELYTEISGRKEPIMKRTTLVAN
FT                   TSNMPVAAREASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQG
FT                   FPAYLGAKLASFYERAGKATALGSPDRIGSVSIVAAVSPAGGDFSDPVTTATLGITQVF
FT                   WGLDKKLAQRKHFPSINTSVSYSKYTNVLNKYYDSNYPEFAQLRDKIREILSNAEELEQ
FT                   VVQLVGKSALSDSDKITLDVATLIKEDFLQQNGYSSYDAFCPIWKTFDMMRAFISYYDE
FT                   AQKAVANGAQWSKLAESTSDVKHAVSSAKFFEPSKGQKEGEKEFGNLLSTISERFAEAS
FT                   E"
FT   CDS_pept        complement(370233..371282)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093835" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382833"
FT                   /orf_name="CD36_81550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42685.1"
FT                   /db_xref="HOGENOM:HBG396567"
FT                   /db_xref="UniParc:UPI000192D5FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD3"
FT                   /transl_table=12
FT                   /translation="MIHSRVNSLNLTSKSLPLDDKGLKSVTLPLTSPAIPMPMPMQHEN
FT                   IQQISPKLVQTLGPTNVLSPTNIQLPNNSPSSFEVTSQSTLQSPFHSSIISPHYPPYEP
FT                   DLYYPSRNQRQLNLNHHNHHQQQQHQRPQRQSSLTSGFNRCDAFYDFAEDRYSRFRPSD
FT                   SQHNNNAILSGLHPFQQENYGLPKKTFLQSVSNWFKFKTPESEIIIERNGEYIQNSNKS
FT                   TDTNTIITGTGTGTGTGTGTGTANVSGGGGADDDAAAAAEVSINQNEPYETTPQPIYTP
FT                   RGIPINEFQLNFNKENQDSVVRRNDEIINSFDDEVRDLINGADNFLTSCFQGCWDIGKL
FT                   INDSFVELC"
FT   CDS_pept        complement(372559..373635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093836" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574542"
FT                   /orf_name="CD36_81560"
FT                   /product="Uncharacterized protein ydl183c, putative "
FT                   /protein_id="CAX42686.1"
FT                   /db_xref="HOGENOM:HBG396569"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniParc:UPI000192D5FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD4"
FT                   /transl_table=12
FT                   /translation="MITTRSIQKYHSLYRPCIITCRRSQSTRSTNTPLSQVPNKNSIYV
FT                   ISIPITTSKSYIYCNHRPTTLSPKQLANIPLIYKLENKLINLASKGWSKLTNSKQSINQ
FT                   KIVSSIKKLLDTIPYEENCLKSFPSKSTMIREINEESSDFTESNNNDSSQSQVHKIVQA
FT                   QVDDLKINTDQLKPIPLYHPQFQNPSVILNQLYSFEEENKKKHKNQAILCAIGIPITLP
FT                   FALVPILPNVPGFYLAYRLYCNIKALLGLQHLNYLLETKKGGDPEIANQATVNDTSHIA
FT                   FKGIEGLNQLYLQHNNSNLLYESIEDEEKEIVIINEEIINQIVETFELNNLKEDLLKAL
FT                   KQETKRLNRDIKVHDQVE"
FT   CDS_pept        374960..376162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574543"
FT                   /orf_name="CD36_81570"
FT                   /product="Uncharacterized membrane protein ydl133w,
FT                   putative"
FT                   /protein_id="CAX42687.1"
FT                   /db_xref="HOGENOM:HBG396570"
FT                   /db_xref="UniParc:UPI000192D5FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD5"
FT                   /transl_table=12
FT                   /translation="MTEEDDKQTNYFDSHPGTTRNRSTTSPSTLDEHQSNVESVDIPLD
FT                   PFSNIVINSYSHKANVVPPYVLDTLSKAYHRNHLHQTNTNISDQVTSKTLTFETDADKS
FT                   NTVYSGIVHDPYIRAMDGDWFKFMQSIRHQTAYTHDKIAYDPELLKEYDLNGTWGGDER
FT                   LKDEFVNNINNGGVISDSEKRGFLGFFGKEKGENDTRMRSTAGYWMGENRSQLKPTLKK
FT                   IFLFNPLVPLLLRILIIIFCAIALALAGSIFIYSKRDYEGHKVEQQPSTIMALVVQSCA
FT                   LVYVIYIAYDEYTGKPLGLREPMSKMRLILLDLLFIIFSSANLSLAFNTMNDDEWVCRA
FT                   NKTPGLSDIGLVFPTIGSICRRQRALSSFLFMVLVLWVITFTVSLLRVIDRVNTPGPRN
FT                   V"
FT   CDS_pept        376782..379043
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574544"
FT                   /orf_name="CD36_81580"
FT                   /product="Cell division control protein 53 homologue,
FT                   putative"
FT                   /function="ligase activity"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="cell division"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAX42688.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG622322"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniParc:UPI000192D5FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD6"
FT                   /transl_table=12
FT                   /translation="MSSTLPPFSDLNATWTFIQPGLEFILGAHGEQGVTATMYMNCYTA
FT                   IYNYCVNKSRRGTTPVSISNNSDNNSYSLAGAEIYKKLEDYLTDFIKNLKRLPNESFLE
FT                   FYVRKWTRFTIGAVYMNNVFDYMNRYWVQKERSDGRKDVYDVNTLSYIKWKEEMFTPNS
FT                   NLLIEQILNLIQQQRDSMIVDTNLISTAIKSLVFLSIDIQDLKKPNLIIYVNSFEVPFL
FT                   NATMDYYSKESGAFLASHNVVDYMKKCETRLAEEVSRSNNYLEERTKKPLLEVLNAALI
FT                   EKHANEMYNQFLVLLEQNQIDHIQRMYKLLARVPKTLDPLADTLEEYIKKEAAAALEEI
FT                   QTQAENSEEKKKTVEPKVYIHTLISIYNQFNDIVIRAFNKDTKFIKSLDNACRHFVNEN
FT                   PIARPKPRIPCRTPELLARYADGFLKSNSKDDEMNSDNLMIVFKFIGERDSFEEHYRRL
FT                   LAKRLINGTSKSEEMEENVIHLLQEANSVEFTSKMTKMFSDIKASDDLKIKFKDRSNVN
FT                   VGFDFSPMILARSTWPFHFSQDYKLTLAPELQETIDSLKTMFLEQGQGKQIEWLWNHGR
FT                   AEVKAYLTKGKGGKPFNFIVSQVQLMVLLAYNKSKSYTLDQLVEIVGIKKETLQNHVSP
FT                   FVKFKLLKEEGDQLVLVDHYPSRKNKVSFISAITKTKEDEGEEIAKEVQQSRMIFLEAS
FT                   IVRIMKSKKSMKPNNLLNEVLVQAGNRFSAKNIDVKRAIDSLIDKEYLKRNGDDYEYNS
FT                   "
FT   CDS_pept        complement(379318..380979)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574545"
FT                   /orf_name="CD36_81590"
FT                   /product="Serine/threonine-protein phosphatase T, putative "
FT                   /EC_number="3.1.3.16"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42689.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192D5FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD7"
FT                   /transl_table=12
FT                   /translation="MSSPKEEAVEWKDKGNNLLKQHKYDEAIEAYTKAIEIDSENAIFY
FT                   SNRAQVQIKLENYGLAIQDCDLAIKLDNNFLKAYYRKGVSLMAILKHKQALENFKFILK
FT                   KLPNDKLTLENYKQCTNYLKRQAFEKAIAGNDDNESIFNKIDYQSIQIEKSWSGPELNI
FT                   TTSTSTTSTTSTTTKTEDKKSDVIVNIEGLNHDYLKYMIKLFKNGGKLPKRHVFAIVAK
FT                   VYEILKNENTMTEISLLHSQIDFTSNNDKINNSNGKNDQIIGGKKLTVVGDTHGQFYDL
FT                   LNLFNKFGHVTQDHIYLFNGDFVDRGSWSCEVALYLYVLKILYPKSIFINRGNHETNDM
FT                   NKTYGFTDECEFKYSKKIFEAFNQSFGALPLACLINQTYLCMHGGLFSNDKVTLEDIKS
FT                   INRFPNNGSSQPPKEGLAMELLWTDPQEINGRSPSKRGIGMQFGPDITERFCLSNKIRK
FT                   IIRSHEVRMNGIEVEQNGRLMTVFSAPNYCDSTGNLGGVIHIEENSNYKKELDDGQGYK
FT                   HVEEKNCPWILTTETFEAVPHPDLKPMAYSKGGFGF"
FT   CDS_pept        complement(381487..385155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382834"
FT                   /orf_name="CD36_81600"
FT                   /product="Alpha subunit of COPI vesicle coatomer complex,
FT                   putative"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAX42690.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG328393"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D600"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD8"
FT                   /transl_table=12
FT                   /translation="MKMLTKFESKSSRAKGVAFHPKRPWALVSLHSSTIQLWDYRMGTL
FT                   IDRFEDHVGPVRSVDFHPTQPLFVSGGDDYTIKVWSLNTRKCIFTLNGHLDYIRGVSFH
FT                   HDLPWIISCSDDQTIRIWNWQNRQEIACLTGHNHYVMSAQFHPTEDLIVSASLDQTVRV
FT                   WDISGLRKKHSAPTSSVRAFEDQLQRQQLPQQDIFGNINAIVKYVLEGHDKGVNYASFH
FT                   PTLPLIVSAGDDRVVKLWRMSDTKAWEVDTCRGHTGNVLSAIFHPHQDLILSVSDDKTI
FT                   RVWDLNKRVPVKQFRREHDRFWLIASHPTISLFAACHDSGIMVFKLERERPAHTIFQNK
FT                   LYYVNGEKQIQTYDFNKQENSLPMLSLKKIGKTWSFMRTLSYNQSDNSVLVVHGEGDNG
FT                   NYALITLPKHVTGAIEPTDIRQGEANFATFISRNRFVTYVKSTKTLQVKDLNNNATKTV
FT                   QLDSSIIDVLPGSPGRILLVKAHSVINYDVQQRKELAEISVNNVKYVSWSSNGQYLALL
FT                   SKHTITIANKDLELITSMHETIRIKSAAWDDTGVLLYSTLNHIKYTLLNGDNGIIKTLE
FT                   NTLYITKVQGNLIHCLNRQGQVETITIDPTEYRFKRALVNKNFGEVLRLIKNSTLVGQN
FT                   IIGYLQKKGFPEVALHFVQDPETRFELALECSNLQVALEQAKILNNNQIWEKLSEEALL
FT                   QGNLEIVEYVYQQLHHFDKLSFLYLYKGDEERLDKMSTIAQHRDDTSSLVQNTLYNNDI
FT                   KKRCQVYIQNGMLPLAYTLAKSNGLNELAEQILQEANISEKDVELPELGDVVPLPKPIA
FT                   EPVGNWPLKDSELSYFETALITGKIENLSIEDTGDNFIEGQTFDSNTGNIDDNLGFVVD
FT                   DDRDVDNEEGGGGVGVGEEDVEAWDLDEELDIDDDDIVDENVPEFVTTENEIGDWLRNA
FT                   KTPATYVAAGGFEQAASLLNKQIGVVNFEPLRTRFNQVYGASKLYLPGMDELPAMKTYI
FT                   RHDNDEDNPRKFKPVVPGYDKLEELLSLGFKKFKANNLEEAISTFRKVIYTITILNVDD
FT                   EDEENKCHEILRLCREYILGLSIELERRKLPTSDVKRNLELAAYFTRAQLQPPHKLNAL
FT                   QVAMTQSFKNKNYASASYFAEELLKISNSGPRAEQATKLKNKADTIANDAIEINFDPYA
FT                   EFDICCGSFTPIYKGEPSIKEALVGATYKPEFKGKLCNITDITAIGVPSSGLRIKG"
FT   CDS_pept        complement(385652..387097)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574546"
FT                   /orf_name="CD36_81610"
FT                   /product="Glycosidase, putative"
FT                   /EC_number="3.2.-.-"
FT                   /function="chitin binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="cell wall"
FT                   /protein_id="CAX42691.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="HOGENOM:HBG736732"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniParc:UPI000192D6AA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDD9"
FT                   /transl_table=12
FT                   /translation="MKFSILHFAFLATLSNIFTAVAASDDTITCSADSHCPEDKPCCSQ
FT                   FGICGTGAYCLGGCDIRFSYNLTSCMPMPRMSSFQETFDSKDKIKEIELQSDYLGNSTE
FT                   ADWVYTGWVDYYDNSLLLQMPNHTTGTVVSSTKYLWYGKVGATLKTSHGGGVVTAFILF
FT                   SDVQDEIDYEFVGYNLTSPQSNFYSQGILNYNNSRNSTVNDTFEYYHNYEMDWTEDKID
FT                   WYVDGEKVRTLNKKDTWNETSNRFDYPQTPSRIQFSLWPGGDSSNGKGTIEWAGGLVNW
FT                   DSEDIKKYGYFYAHIKEIYATTHDLPNNVKLDGNSTKESDYHAFLYNSTDGNDSNIILT
FT                   TKKTWLGSDDATGFDPQNEDDNDNNNNSKAQETTITSTSGSSTITSVKTDSTKKTANVP
FT                   AQNTAAAAQATAKATTAATTYNPSAGVGGFVQDSKSSDSGSSSSGSGSGSGSSSQGVAN
FT                   SLNNNVVSGIFASICLGVLSFFM"
FT   CDS_pept        complement(391532..394636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574547"
FT                   /orf_name="CD36_81640"
FT                   /product="Vacuolar-sorting protein, putative "
FT                   /protein_id="CAX42692.1"
FT                   /db_xref="HOGENOM:HBG396573"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI000192D6AB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE0"
FT                   /transl_table=12
FT                   /translation="MYPICPDTSLYTIVLFACNEHHTSQTMIVVQSVLKNGISLSLEAK
FT                   GERGAWLEEPVTSTTTIFLRLEILVLKTSPHFSSDLYLGESRLLQVGFVFFYTLESQMK
FT                   THLLVVPSKKTEEVNWVKPLNNYLLSIYGNTSQYQDDINSLNKLRQDIRGVNADDTGLK
FT                   LYYGYYSKLELIDLRIPFHDLNKSKKLQFEWFDSFSSLPYTQNSLAFEKVNVLYNIGAI
FT                   LSKFAQFKYNESQQLNGPEGETAFKQSISMLQQSSGIYQFINENFLHAPSQDLAQSTIK
FT                   FLSKLMIAQSQEIFTLKVISGDLNQSKNSLIAKLCKSTSVLYEDCYNMINKNKKESFKI
FT                   TNESYDGGEYEEEDEDDDDEDDEGFLERPEDTDDSDNRYVAAELDSSWISIIYFKYEYY
FT                   KSLAYYFNGLHLDANRKYGDAIAYLTKSQEVLNGVHSSTLKQVSKGSGDVYELLDNYKY
FT                   QKDAVTIRLNDLNKDNDLIYHDIVPNLVTLPEIKPMDSTKIIKLADNAIFHEINEKNYN
FT                   NFLVNVVPVNIHELSSYYSEEKSQYLRNEIDHFEVSNEEVSSVLEYLKLPKALVSIKES
FT                   LKGTNSRGNNNGDIEELLSRSVIDKVNEISSQYSNDIQRKIAIENSRKEIYQLIKLLTE
FT                   NNCQDDAIQLKKILYDASVSDTKLFALIDETYHRTLGSGIQSHEFKSLFNNTVDNKSNQ
FT                   DSEISLLDIDDNNDTNQDKQIKNIEDYLNDLNNIKQNKFKLIEKLKKEIHNDDISDILV
FT                   LNMKLKSTNEIKSIIFPEELKKFHPFTNELDKLINKEKSIIEQLKIIWDKLISNPQIKT
FT                   LQMATNSKTQLIVNQSEKIDQFYGNWLKYHNGLIAGEKFYSQLLDRFKDFRNNIDNQLN
FT                   KGMRSLNIGQQFPTQPMLNRTQSSGLQSNYTGQSNISISSQPSGGYNQQQQPQSQSQFS
FT                   GGYNQQYTQPQGGYSQFQGQTQTGYQRQPPPPPPQLPPKQTMGSYNFAPTQQPPPQQQQ
FT                   QQAQPQPQPHSYPYPQQRTPQNESNLIYDNPSTYNPNMYNFFSSK"
FT   CDS_pept        395084..397462
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229961"
FT                   /orf_name="CD36_81650"
FT                   /product="Mitochondrial respiratory chain complexes
FT                   assembly protein, putative"
FT                   /EC_number="3.4.24.-"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42693.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI000192D6AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE1"
FT                   /transl_table=12
FT                   /translation="MLAVNSARLLNRAVVSRSMLCRSAIPRHFSTYTPLAFRTSRQLFN
FT                   KSNNNNKKSDNDPEKDSERKPKKDQNKDEEEQLREELKKKFAAKHPGTNPDNLKIYKFD
FT                   LRTMGNYVLLFGSTILTFYLINRTSESEIQQLTFQDFITNYIEKGLVTKLTVVNKAVVE
FT                   AELIPGAVSNISHNRNGKPYVIFTIGSLEFFEDEMNKVQERLNIPINERLPIVYEDHTS
FT                   WLSYIMPILPTVLLIGGLYYLTMRRMPGGAGGAGGAGGPGGIFKIGKSKAKLFNQENEV
FT                   KIKFKDVAGCDESKEEIMEFVKFLQDPHKYEKLGAKIPRGAILSGPPGTGKTLLAKATA
FT                   GEAGVPFLSVSGSEFVEMFVGVGASRVRDLFKTAREMAPAIIFVDEIDAIGKERGNGRM
FT                   GGNDERENTLNQLLVEMDGFDTTDHVVVLAGTNRPDILDKALLRPGRFDRHISIDVPDV
FT                   EGRKQIFKVHLNKLKLKSVQDIDAKQKDVDFSKYQQLKNEEIEKLAGRLAALTPGFAGA
FT                   DIANCCNEGALIAAREDAPSVDTYHFEQAIERVIAGLEKKSRILSPEEKKTVAYHEAGH
FT                   AICGWFLQYADPLVKVSIIPRGQGALGYAQYLPKDQYLTSQEQFKHRMIMTLGGRVSEE
FT                   LHFDTVTSGASDDFKKITQMAQQMILKLGMSDKLGQICYDTGSDNGNGFKVHHNYSETT
FT                   ARIIDEEVKRLIDESYEACHKLLTEKLDLVDKVAEELFKKEVLTREDMIKICGPRPFPE
FT                   RNDAFDKYLQGGDAFKGKPKSKDQNNDDANSPSSAPETA"
FT   CDS_pept        complement(397631..399493)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574548"
FT                   /orf_name="CD36_81660"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42694.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396574"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniParc:UPI000192D6AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE2"
FT                   /transl_table=12
FT                   /translation="MNTGVENDFKYLHNRNLQQLPSDTKNPSQNIPYNYLSSDEDIEDE
FT                   YYSDDESQNQLDHEINQLINQQNERQFKHKFKQMENQSLQRFKSQWDAIIDKYSKIDDS
FT                   TQSDEIDIVTGELITNNGHLDKLNQNHNHNGDITKMDIWRQDYGQQWENWRQRDFRMKR
FT                   VAKQRKNEQRQILKKLDLFNKPIYGYSKFEKLEENDFFKQSPTKSKVPSGIESDESPTK
FT                   KRRVFTEKNAISKNSSDSEFLEEEEEEEEEEEDDDGGIENESAYHKTVIAHQKLSKKES
FT                   DKVLHVPSGDNFSPCIDERSFRSESNESQSEDSQDYESNLSPDISDDDAYQSIIINDKK
FT                   YIPKFKEHFDESETESISKTPNPQLSSEETPGSSSQTEEISPSPHPESTFDDEYSIIEE
FT                   PYYFLNSKSTPLPTIFNCAFIKCHYCTGNKKLYESHLLQSHNSVLAEMGYPINLNSQNI
FT                   ANTDSDNENVNTEFAKRIIDVDLNRLYQVFPKTYELPPQKEALTCSKKLANGQTCQKFY
FT                   LVQEQLDQHREVGDECTDKRQVLFCPILGCGYLTDGGYKEWREHMITTGHSQEEIEVKE
FT                   NLEKLVSRPIATRKVSVKIPKFTETDFKVSFIDQGYESIDELFN"
FT   CDS_pept        complement(399678..399944)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574549"
FT                   /orf_name="CD36_81670"
FT                   /product="Uncharacterized protein YLR218C homologue,
FT                   putative"
FT                   /protein_id="CAX42695.1"
FT                   /db_xref="HOGENOM:HBG448039"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="UniParc:UPI000192D6AE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE3"
FT                   /transl_table=12
FT                   /translation="MKPEPSNTTEPIEEKEEQREDEGEEEEDDEPDEWDQRIMDTGCHK
FT                   ENLQLQLCHADTGDWRQCTKELQAFKECWEKNKNNERTSTVDY"
FT   CDS_pept        complement(400154..403897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078564"
FT                   /orf_name="CD36_81680"
FT                   /product="DNA repair protein Rad16 homologue, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAX42696.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG396575"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniParc:UPI000192D6AF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE4"
FT                   /transl_table=12
FT                   /translation="MLSNNNIKQKVVAITNDLDKLIPFGTLNFHNLPLDITDLQGIKSS
FT                   CVSSKVDNELQQWSWLDIDYLIYLLSINHKKINPILFTLQYLLKKNYIQATYKAVKITQ
FT                   PYNSTKKNRYLFSMCRVRLFSIPADVEGARHIRECQQFQSRSSKLDKQYVHHFEQLLRY
FT                   LDFSNSNWYISKQLSIEQLLHQGSLLLIDCKCTVKSETASNDELKFHLQRWSNKQPVLR
FT                   FTKNNKSNTNQLSNTDTSGDRIKNIYDQIPSPDLSKYTISKENYKFMKQSKADIPSTED
FT                   KLSILANDAKYQDMIKVDGIKSTLYPFQARSVGVMLERECITRRTIMPNFIKLESPLSS
FT                   TFYFDLFTKSIHLQPDVMTLPLGGILGENMGLGKTLMCLSLINLTKYEITKIPSDNFLL
FT                   YNEIEINDEMKTLADICREKVIYSSAPWKLYNLPTSVRSNLANHPGYFCIDLNDHENNK
FT                   RINKSGFPNNRNGSGMGKRAVRSTGTRPTSYLKLYMSSTTLIIVPDNLFIQWVDEIAQH
FT                   VEADFLKILCAANYIKDDQIKDQFIQNPKFVNTIPGNPVELIEYDVILISQSCLNKSFA
FT                   NKTKSGPKNDNNHVPPLRQVYWKRLIIDEGHVVQSKTSNAAQICRSLFSERRWAVSGTP
FT                   TSGLTKIYMEKEKEVDKDEQENLHQTQNNIHVLENQFFAKTELQRLGVIISNFLKMEPY
FT                   YTQSRLWTQDIVNPLISSRYGSELIFSNIVNSIIIRHQPNQTKIKLPHFHHEKVILEPC
FT                   FQDALSLNLLAAVLAVNAVTSERTGIDYMFHRSNRQQLRRLLSNIQRATFYWTGFQQQD
FT                   VETLVSICDEALSKPGKYSESDIELLRRSKSIALIALNNQRWAVAQSIHELGYYISQDE
FT                   SNQYVSSVWRTSAYTPYIGVFSAPQLLRLQIFWKENWFLSFENEQAFRDKFENTAKTFW
FT                   DQYLQQEFNKNDRHVAMDKLIKKNSVGELHTVDSISKSFDVMTSEEAIDNMPHPQSPPK
FT                   KKRRVTFADEIIEEDERKQAESQQSKGVSVDECNDNKNIENSNRSIPPFDMTRLFRDMN
FT                   ILGTSSAKLTYLATSLLENQRNRIKSIVFFEFEDSAYYLIELLEILKIRHIIYANFITP
FT                   VKRAQNLYDFSNYDVDKEENQGGICLIMNIAHSSHGLNIIAATHIYFINPVKQESIEAQ
FT                   AIKRAHRIGQKKEVTVKTLYLKGVDELKILSKNEKLKNSKNNKDSFDAKEKEDNDNLLE
FT                   FLDFDNSEHEYAAFSNPISIFS"
FT   CDS_pept        complement(404543..406099)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093842" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574550"
FT                   /orf_name="CD36_81690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42697.1"
FT                   /db_xref="HOGENOM:HBG626380"
FT                   /db_xref="UniParc:UPI000192D6B0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE5"
FT                   /transl_table=12
FT                   /translation="MSSKVEIQTKPATATPSLSPPSTSSASASVSVPPSSSKSTITTNK
FT                   TPAQKDEVPMKRKNSTGSNGSSSSSTPPKRHRPMSLNLGVPDNADVALRIVSPGLPPLI
FT                   NESMKTTVQLSKQIQQQQKNLIAARHGKDPEDEELPQSQPQAQQPTSVAVPASGAPIRQ
FT                   TVQLPPLNQRPVPKSPVYASDDSDLNRLSNVKKLKRSNVPPPLSIGDNSSSGSSNNLRP
FT                   SIHSAPIRSRATTRPVPRIIPTTRIVPQLAIPPQPQFYYVTTPYQQFYPAQIVGATPTQ
FT                   PVSQPLARSQLRQVNPRVRMIPLTSTTSHFGRRAMQQGPQQLPPGAILQQQSLPLQQQQ
FT                   QPPQQQVIPSQSTAPKTKPNAVTDVFRGDFHKAAPLHSQPLSAQREYFENSVHDEPQKS
FT                   QVISIAESQEISGSITINGSNVFNFRIFNKNEEEESNDSEGTSKDNTSEKKQAGTLEEK
FT                   EENTDKEGKGKSISTNEKSNASEDKSNKSSKSEDLEEDNKKKFLKICETCWDQVFNKRD
FT                   D"
FT   CDS_pept        complement(408506..409798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574551"
FT                   /gene_name="KRE2"
FT                   /orf_name="CD36_81700"
FT                   /product="Glycolipid 2-alpha-mannosyltransferase, putative "
FT                   /EC_number="2.4.1.131"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42698.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI000192D6B1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE6"
FT                   /transl_table=12
FT                   /translation="MVSTRSNARLIRFGIFALVLIGCGYILTRGSSFQPPSYQKTQSPA
FT                   AHEKQTGNVAAGGASSAGSTAQVPLGKNRGPIPKAIKGAGEGGSDAPVPQQDIPDSYTL
FT                   NDKIKATFVTLARNSDLYSLAESIRHVEDRFNKNFHYDWVFLNDEEFNDEFKETVGSLV
FT                   SGNTKFGLIPKEHWSYPSWIDQEKAALVREQMREKKIIYGHSESYRHMCRFESGFFWRQ
FT                   EILNDYDYYWRVEPDIKLYCDIDYDIFKWMKDNNKDYAFTISLPEYKETIPTLWDTTKE
FT                   FIEKNPQYLAKNNLMDWVSDDKGQTYNGCHFWSNFEIGSLAFWRSEAYTKYFEHLDKAG
FT                   GFFYERWGDAPVHSIAAALFLPREKVHFFEDVGYYHVPFTNCPVDKEVRKARNCNCDPN
FT                   KDFTWRGYSCTTKYYTLNNFKRQTGWEKYTN"
FT   mobile_element  complement(411791..411979)
FT                   /mobile_element_type="retrotransposon:solo LTR, phi H"
FT   CDS_pept        join(412071..412577,412576..412815,412817..412993,
FT                   412995..413621,413602..413733)
FT                   /pseudo
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(413916..415292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535607"
FT                   /orf_name="CD36_81720"
FT                   /product="Glycolipid 2-alpha-mannosyltransferase, putative "
FT                   /EC_number="2.4.1.131"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42700.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI000192D6B2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE7"
FT                   /transl_table=12
FT                   /translation="MKPSIFYSSRQPYLKYLAIILTTITIYVLTHSNYSTEPNINDVTT
FT                   KPISETIPQPPNPSSFPEQQQHASQEQIVKVPDELKNKPQDLVVDNGKDQKLVESGVPS
FT                   SSPHQDKEDANKGKNLQEQENSFSKNPVKSEKVKATFVTLARNSELYDLIKSIRNVEDR
FT                   FNRKFNYDWVFLNDDDFTQEFKDLTTAIVSGKTKYGKIPKEHWSYPEWIDLKKAEETRK
FT                   SMKLQKIIYGDSESYRHMCRFESGFFWRHPLLDDYDWYWRVEPSIDIHCDLNYDLFKYM
FT                   EDNNKVYGFTISIHEFRATIPTLWDQTKKFIKENPQYIAENNFMDFISDDKGESYNLCH
FT                   FWSNFEIANLNFWRGEAYRKYFDYLDKTGGFFYERWGDAPIHSIAAALFLPKDKIHYFE
FT                   DVGYKHSVYTQCPLNPQFRYEHKCHCNPDNDFTFRGYSCGKKYFEKMGLEKPKEWERYQ
FT                   "
FT   tRNA            complement(416623..416696)
FT                   /gene_name="tRNA-Val (AAC)"
FT   CDS_pept        417603..418637
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229962"
FT                   /orf_name="CD36_81730"
FT                   /product="Mitochondrial ribosomal protein, small subunit "
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42701.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396577"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniParc:UPI000192D6B3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE8"
FT                   /transl_table=12
FT                   /translation="MIRRSSLIFTRSISTSFSLPVNKTLEIFKATNANFEGLFTNNAIN
FT                   QLWFQRGQQLVQNLNQHLAQTNNGLLSDTNTSGTNDNGNENIVNYSLNEIVSITMNKPE
FT                   LFHIHKNATNLYNLQFFFENIRQLEQQPQEIIPSGPEVLLKTPKDQFKNVPSDKELVDW
FT                   IEHSFGSIQELRNLIINSAKGIKGDGTVWLVAESTMSENYLSKSNFSSPLFHNLAIVNT
FT                   YNGGMIDDSERSGQLRRMKSVLQQQQQQEEEEEGEGKSTENKQKNNSTSEFELGSVEQA
FT                   ELETAFHNKRLVPALAIDVSPRNYLIDYGAYGKQQYLENVWECIDWDIVLRRLPPRSKQ
FT                   VITV"
FT   CDS_pept        complement(418908..420479)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078565"
FT                   /orf_name="CD36_81740"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX42702.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D763"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDE9"
FT                   /transl_table=12
FT                   /translation="MSSEKVKRVEADASDLLASLSLNKSADKPEETKKGSTPDPSDLLA
FT                   GLSLKKDDSKKPEEKKDVAEEPEKVEIKDDKKDEVKDDKKEELKDEVKEDAKDEPKEES
FT                   TNLIKSSYEVKVKLADIQADPNSPLYSVKSFEELGLSPELLKGLYAMKFNKPSKIQEKA
FT                   LPLLLSNPPRNMIGQSQSGTGKTAAFSLTMLSRVDPNINMPQCICLSPTRELARQTLEV
FT                   ITTMGKFTNITTQLVVPNAYQRGSSVNAQVLVGTPGTVTDLMRRKQLNLSKMKVFVLDE
FT                   ADNMLEAQGLGDQAIRVKRGLPNGTQLVLFSATFPTEVREYAERLVPNANSLELKQEEL
FT                   NVDGIKQLYMDCRSEQHKFEVLCELYGLLTIGSSIIFVERKETADVLYGKMKKEGHTVS
FT                   ILHGGLDNEDRDRLIDDFREGRSKVLITTNVLARGIDIASVSMVVNYDMPIDKYGKPDP
FT                   STYLHRIGRTGRFGRVGVSISFIHDKRSYDILMAIKNYFGNVEMTRVPTDDWDEVEKIV
FT                   KKVIKS"
FT   tRNA            complement(420655..420729)
FT                   /gene_name="tRNA-Lys (TTT)"
FT   CDS_pept        421145..422896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535608"
FT                   /orf_name="CD36_81750"
FT                   /product="Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-
FT                   glucosyltransferase, putative"
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAX42703.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG560959"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="UniParc:UPI000192D764"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF0"
FT                   /transl_table=12
FT                   /translation="MAKKKTAGPQPSYSKGRTKITTETETISTQTDSEATTTTTTTTTN
FT                   RYSLLNIWVISLALKILLFIGYHSTDFDVHRNWLAITNKLPISQWYIENTSQWTLDYPP
FT                   FFAYFEYLLSLLVPQFVKDDGCLDIVEIGQYGLPTIYFQRITVIISELILFYALQTIVN
FT                   TSPTLSAKRRMYVATASLALSPGLILIDHIHFQYNGMMYGILLLCINSARLQQYVLCGF
FT                   WFSILLCFKHIYLYLAPAVFIFLLRGYCLKFNWNKRKNCFINIVNFIQWINLFKLGGVV
FT                   ILVFAIAFGPFYNVFPQLISRLFPFSRGLTHAYWAPNIWAVYSFLDRVLIQVYKKIPMS
FT                   KYPLLKIFQFDPTLLANNELLKTSTRGIVGDIEFFILPTITPKLTFLLTLFYQIMALIP
FT                   LFIQPTYRRFVGALTLCGYASFLFGWHVHEKAILLVIFPMTLLVARDKRLLTPFNLLVS
FT                   CGYGSLFPLIFTCNEWLIKVVYTYTWYIIFYFNFRKVVRPSRNNIGRGSGIILDRMVNL
FT                   YILLFNVVVIITSLFDLFKHKYPVLQNFEFLNLMIYSVYCAIGIISSWNGFCWLYFVDD
FT                   GIWNQDQ"
FT   CDS_pept        join(complement(424814..425097),complement(423238..424255))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574552"
FT                   /orf_name="CD36_81760"
FT                   /product="Uncharacterized protein ydr348c homologue,
FT                   putative"
FT                   /protein_id="CAX42704.1"
FT                   /db_xref="HOGENOM:HBG512136"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniParc:UPI000192D765"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF1"
FT                   /transl_table=12
FT                   /translation="MYQQPSNHSYSSTDSLRWSSNNPFRQASISQTQPRNNFDEWVDKN
FT                   KQLLDLSSDDEEDDAGAVGFHQSTESFGRPSAFPPTPVRADSDSSINYARMSKNPFASA
FT                   LSQSEDKPRAQTSNKPSRAPPRPPKPSQKQPPPPSYEEAAGPEAAKKSYPREKEGRSDE
FT                   SRERRRENSRSGHSRENGHSRSHGREQGHGHDRERRSHRSKKSPSKKKSDPVKPKNLDT
FT                   IDKLDVTGFVGFHHDGPFDACAPHRNVKKEKAPVMAFPIDGPNNSIAGGTNMTKDDQLN
FT                   LAFGNYHDEAPVIKTNRTQNDPTSSIYTPKLNPSVINFDSNTNSTPIHGSTTAGLGSTT
FT                   FLDGAPAPKGDELLNPNVGVGRKKSIVQRLRKNSGSESTSRRSSNDGLHPPSPPYQEPR
FT                   RGSLNTLELDSGDNELKPPGNSFIRRVRSLKVRK"
FT   CDS_pept        complement(426790..428487)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574553"
FT                   /orf_name="CD36_81770"
FT                   /product="Phosphatidyl inositol 3-phosphate binding
FT                   protein, putative"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42705.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396578"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI000192D766"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF2"
FT                   /transl_table=12
FT                   /translation="MADTKVLSPTIPSQDEVMTQSQQQQQVNQKYSSGSTQSPTLTPDS
FT                   QQFSKNSQKQPRYDRKPLTPSAILQDYNNNTQSSSEQKMVSTASTTPISTNNNTPKRGK
FT                   QQQQQQQQQQQSEELGSFSFTKKDIVKVNSVASDLHSNITSSICRSDKSSCRNSTGTST
FT                   STTISNNNNNNKNNTDDDLTFKDFDYDEQIRFPRVNTYYTYSTKKTSFSSNEDKPSTKS
FT                   HPSSDSIFKHVTKEEQTQGQLNEGDKEHEHDYTPANFDLNQPLRRYSVPLQLKESPEEQ
FT                   LLHKFAENNKIYERSMKSGPESASESESESESNIDSPPQLRLKNQTSFLKTKEINYNKH
FT                   LKPLYQLKKPLLTPAVLRPAYTNEHENLPPPTVIPPTSSYTIIIPNSDYFHSTGGLPNC
FT                   TNEPVHDHWKDNALTSNCMWCVKPFHNPIVSMICDVPRRHHCRFCGLIFCADCLVNKTI
FT                   LIDHEARFVIPILSNTTETKLQQFFTNSKSKVCKKCGMVYDNLIEELNKSETEYTTSFV
FT                   LVDNPFRKDHSKGNDYSFAQQQLEQQSSHTEKRLSVADVPNDWVWSSF"
FT   CDS_pept        complement(430868..431035)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574554"
FT                   /gene_name="PMP3"
FT                   /orf_name="CD36_81780"
FT                   /product="Plasma membrane proteolipid, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42706.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI000192D767"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF3"
FT                   /transl_table=12
FT                   /translation="MNSEKIIEIIIAIFLPPVAVFMKCGATTPLWINLVLCIFIWFPAI
FT                   LHALYVVLKD"
FT   CDS_pept        433342..435666
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574555"
FT                   /gene_name="POX2"
FT                   /orf_name="CD36_81790"
FT                   /product="Acyl-coenzyme A oxidase 2, putative "
FT                   /EC_number="1.3.3.6"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAX42707.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000192D768"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF4"
FT                   /transl_table=12
FT                   /translation="MLQNLSHFDISYLKINLSAPLFPFITSIFFFVIFHISLLSTFNIK
FT                   HFISKMAMLTKSIHDEDHVEKKDPDTTPRTVQNVVSSRSPPNPAKDIAEERNRTDWDLK
FT                   EMHEFLEGDEAKSEQVLRLYQSIERDPILQTRPEQFDITQKEERELVATRINQMTKYME
FT                   IESAEKFRRRLQLMTIIDPSMGIRMLVNIGLFINCIKGNGTQKQYDFWAKSKEGAIVKQ
FT                   IHGSFGMTELGHGSNVAGCETTATFDEKTDTFIIDTPHIGATKWWIGGAAHSATHTVCY
FT                   ARLIVKDVDYGVKTFVVPLRDSNHNLLPGVAIGDIGAKMGRHGVDNGWIQFTEVRIPRF
FT                   FMLQRWCKVDRQGNVTLPPLEQLSYISLLEGRVGMATDSYRIGARYITIALRYAVGRRQ
FT                   FANGKGKEETKLIDYTLHQRRLLPYLAMTYAAALGTDRLERQHEELLENLDKALATKDK
FT                   LLLKNTINGTKSMFVDSGSLKSTLTWFAADLINETRQACGGHGYSSYNGFGKSYDDWVV
FT                   QCTYEGDNNVLGMSAGKTIIKTVQQVLNGKPLQDSTLEFLNDAPTLAKAKKAVIRIKEH
FT                   VDDVDRVLKAIAGLISKFSSDLIAVSHQSWDSIGPQRVILSKLRCHYYLLETFNERLND
FT                   KIKAKSPARPHLENIIKLYYVTNILGPFIDEFLRFGVISPKVAKYITGEYPQRLCAIAR
FT                   PYIIGLTDSFQQPDNIINSLIGRYDGNIYTNYLDSVKDINNPLNHKAPYSEDLEAMLNR
FT                   QSIPQRERFERSKEAAAQLSK"
FT   CDS_pept        complement(435846..436433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229963"
FT                   /orf_name="CD36_81800"
FT                   /product="Uncharacterized membrane protein yhr140w
FT                   homologue, putative"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42708.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398446"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniParc:UPI000192D769"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF5"
FT                   /transl_table=12
FT                   /translation="MTRQGLISLVSLAICCSGLYDCFQLELPPGLVKGGHFQFLTNVSL
FT                   MLTIIYILQSIVTPTSYNLRLQYNVVSNLEFSVTVSYWVMHLILPHLLNTNSFERNFWL
FT                   DFKIHIWPYVYLIFDNHERVKPKKSWTLTGVIIVMYWCYIERVVSTNNDGVTRFPYPFL
FT                   NNKTLVERFFRITGMWLLSCLNYFVLGFRNSL"
FT   CDS_pept        complement(436758..437132)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229964"
FT                   /orf_name="CD36_81810"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42709.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398446"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniParc:UPI000192D76A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF6"
FT                   /transl_table=12
FT                   /translation="MLHTLISNSYWTMALCFPSMVTEDEVERNLLLDLQVHFFPYIYLF
FT                   IDNQPSVSLKESWGWTIGYILVYWIYIEWECGRHAHDGVSGYPYPFLKGRGVLGRFGCM
FT                   SVFAAIGCCNYFVLQLRNRV"
FT   mobile_element  437108..443461
FT                   /mobile_element_type="retrotransposon:kotuku B, Tcd32, LTR"
FT   CDS_pept        437429..438541
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229965"
FT                   /orf_name="CD36_81820"
FT                   /product="Putative retrotransposon protein "
FT                   /protein_id="CAX42710.1"
FT                   /db_xref="HOGENOM:HBG398447"
FT                   /db_xref="UniParc:UPI000192D76B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF7"
FT                   /transl_table=12
FT                   /translation="MGPKNKSSIPDDNQLSSDDVEMVSPIHDPYIGLPSEQFRKQQHTR
FT                   IEWETHSNIILKGALEPWDNKKGKQFDGTEKVEIFEAAFQAFPGIYEYTKNPSGGFQVM
FT                   RDMNVNYTNDAEKNFIAEHIKSIQNSIVKAIISRILFKAKAPETLEEMIDYYEKLCKKV
FT                   APELLFSYFERLVSHYLSVDEPKLTAPTTLMNRLRSPGQLILNESIARFCSHLNSGIVT
FT                   QFQMFYKYKAIAMRYCGYIVGQMNDVRNGKPFDYDRLTNEIDLDPVIEQTVTERHKEEI
FT                   ARIKSNNSVQNSVNSMYNTHQNNNNSNYYNNNDKNNKNNKNYKNNKNKNNKNNYNKKGK
FT                   VSKVSNETSDYEKLKRDLVRMMDDLRKEKE"
FT   CDS_pept        438566..441937
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574556"
FT                   /orf_name="CD36_81830"
FT                   /product="Retrotransposon tca4 polyprotein, putative "
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAX42711.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="HOGENOM:HBG398448"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000192D76C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF8"
FT                   /transl_table=12
FT                   /translation="MLSYFISNIQSQALKSDFVDYDPMSLKYDSGASRTVVGNKKLLSN
FT                   YDSEAQQIFELPNGQKIRSHGSGDLVINVNHHELVLKDAHYIPGFKINLVSCGQITAQG
FT                   YDVILSHKMLLCVNFNEKHVIFAKQSLNTNLFTGPSRGKVYSNGKMFMDNNSFIEDEGE
FT                   RKGYLNSINAMTKIVDPRIDQVVANPDGRKDLYYYHLITGHMSIRSLIRLHEQGRIKCS
FT                   IDDQDAKDQIKGCKQCILVNAKQHSHNKTTQSPPERSLYRFHCDIMGPYHVGHVKYYIT
FT                   LITDHYSGFSFTIVKTEKRFTKEILDLFEHLHADLYPKKIARFRSDNAKEFPTEAELGT
FT                   LRIKKEVSPPYSSEMNGMVESHNNVVKKQMLYVMLNFPNRYKELLIFFCEIVAYAVFIK
FT                   NHTPSERVETHKGWTPHELFYGRRYRPNYHQLGVDVFVILSNKQEAEALGVQFIKGFHR
FT                   GVPGIFLGYGNDSNVYLIQLVDGNYTRRLFVNVRFLGSMNNINTFLDTFGEKMRKNMDE
FT                   SGNFPFFEDSSRNELLNGRYVPYEDHLPTQGTSSQDVSSDRPTTIEPTATNINMDELIA
FT                   EVPDEFLQNNIAGDFLTQQGFTFPSLQVTGKLLEHQSGQSLAPYNWMSKDNMEYSKMGS
FT                   DHKYLGQNDTENIEPNKNQQVDISEPSFQSSMANKPNESDLGVLPTADGIRHGVPNARG
FT                   ETTQDGTVSSNIDMHQPYSTIPTHRPPPPVGKNVQFSGVNNDSTTLLPSEWGLPPQQHL
FT                   SNGGAYESSPVSNVTTSVRLSASTMNIDVGNKNSIKRTKIDRHPLLPNKETVNEISVRI
FT                   EALKNEHNLNKTLDTIADSYLFTRTSELKNENMAYYKGNGRVSKPPMLLNNLKIIDELI
FT                   PPTKHISSIEARLETSTGDLNDIENDIDLSVYGVEKYVDYTDENWRRSMDNEMKKFKEM
FT                   NVYQVVKKKKNFRMIPAKWVHSYKPNDPKGEFFRSRCVVQGFRQIPGLDFDKNCVSSPV
FT                   TDLTTIRVLTAIAVESKAQIHHIDIKSAYLNATLPKDTPIFVKPPPGYDDGIHCWRLVK
FT                   AVYGLKQSGFEWHSHVSKTFKKMGLYQCENVEGLFMLEKVMKKYTLLYTSMTYSSLPPV
FT                   ISSSINSWTIWRQNSV"
FT   CDS_pept        441907..443136
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574557"
FT                   /orf_name="CD36_81840"
FT                   /product="Retrotransposon tca2 polyprotein, putative "
FT                   /protein_id="CAX42712.1"
FT                   /db_xref="HOGENOM:HBG398352"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000192D76D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDF9"
FT                   /transl_table=12
FT                   /translation="MDDLEAKFSLNYIGEISEYLGIEFQKNAFGYELHQNKFVKRLIEA
FT                   FPTEIMKGADLPRTPDNIFKNDKYKIIDDNTGKPLKNQKDIPIPDEYIYEDSNSPRLDK
FT                   EHHDLYRSIVGMLLWLTNNTMPSISYGTNALAAKCHEPTENDYKHLMQMIKYLYKNNNE
FT                   RLIMRRNQTKDISEDSHVIYAYSDASFAADLDRHSVSGFAIYLNGNLVSWGTKKQRSIT
FT                   KSSMACELIALGETVDRSMIIRQIVQSIGYSAPKIIIFEDNQPVIMNSYNRKSSAIRRS
FT                   VDICLKTIRQLILEYKLLSVVYINTKLNVADLLTKAVNNNTMKTLKPLLYDKGNLDGVR
FT                   KLIKDNFTSHRPVEMGQHSLVYNIITPTEEIKESYYVAPDNVQSKVESRNNKHPEISGG
FT                   IARIKRLSMP"
FT   CDS_pept        complement(443415..443708)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229966"
FT                   /orf_name="CD36_81850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42713.1"
FT                   /db_xref="UniParc:UPI000192D76E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG0"
FT                   /transl_table=12
FT                   /translation="MGTTIIIFRIVSLLFLGNGFIQSISTKLPAQLIKSGQFQFLTNCS
FT                   LLTCLVYVVSTFFMSAKQIHWFYNLVSNLEFNVLFSYLFEIESDTCVGERCL"
FT   CDS_pept        join(444553..445503,445503..446354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187784" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574558"
FT                   /orf_name="CD36_81860"
FT                   /product="Dipeptidyl-peptidase, putative "
FT                   /EC_number="3.4.14.4"
FT                   /function="aminopeptidase activity"
FT                   /function="dipeptidyl-peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42714.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008239"
FT                   /db_xref="HOGENOM:HBG324368"
FT                   /db_xref="InterPro:IPR005317"
FT                   /db_xref="UniParc:UPI000192D76F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG1"
FT                   /transl_table=12
FT                   /translation="MFNIIWSIPYNFWLMSETINHLETKSIPCLEPETFDKLIKIVDDT
FT                   KVSELYNKVKEALFSTEKGLLGYAESGHLSNYYPNSETITKNEINSVNQLLAENGIMPE
FT                   NTRVEKKSDSEFTVHVASSETTNKTTYYPKDKLTSKDGKINVTFKFGDHHEQFQKILEN
FT                   LNKALPYVANETQEKLLKYYIESFSTGSMNAHKQSQIEWVKDLKPEGESNIGFIETYRD
FT                   PSGVRGEWEGLVAIVNHERTAKFSKLLENASTFIKELPWDKIYEKDTFTPPDFTSLEVL
FT                   TFAGLGIPAGISIPNYDDVRLNYGFQNVSLGNVLSADPKNPKQREVITFIGDDLQDEFK
FT                   KWRDEVFEVQVGLHELLGHGTGKLLQETSPGKFNFDNKDDRIKSWYGPNDTWSSLFGTT
FT                   SGSYEECRAELVALCLILKNPDQVFPIFNIENKDDQTIVKFISALLMIRAGLIGLEFWD
FT                   PSSSKWGQPHMQARFAIMKQLHKANVFKFEYSNPDYSDLEIVVNTSKLDDGTAVDALGE
FT                   FLSNLHIFKSTGDVKQGLEYYLNKSQVDPEYSRFRDAVLKQKKPRKMVIQANTFFNETT
FT                   DDIDVVEYEESEIGMIQSYYDRKV"
FT   CDS_pept        join(complement(450857..451237),complement(450150..450875))
FT                   /pseudo
FT                   /gene_family="HOG000093772" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(456659..456937,456940..457170)
FT                   /pseudo
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT   mobile_element  complement(463104..468415)
FT                   /mobile_element_type="retrotransposon:nu M, partial Tcd3,
FT                   LTR"
FT   CDS_pept        complement(463428..464528)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574559"
FT                   /orf_name="CD36_81890"
FT                   /product="Retrotransposon tca3 polyprotein, putative "
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAX42717.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000192D834"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG2"
FT                   /transl_table=12
FT                   /translation="MDYSGPYFNTVQHRYILVAVEYVTGLTIAVPTLHKDADNAISLLQ
FT                   SIISIMSAPTELVTDQGKEFSSEALAVLCEQNNIQHHTTSAHHPRGNGRVEKVNHLLKK
FT                   ILKALTNDTMQDWDFKLYNALRIYNATPTIFNYTPLYLAFGIEPHHNLNQLQKDLIENL
FT                   QRELPPEVPSTEEHEDNPNNEQQEEGREQQISREEQEYGRDLVHLRIYELEAIKRARKV
FT                   HTNLKTRRNAVQNMLKEPYGIPAPFTKGQWVYRIRAKARKYESNFDGPYQVQEVLGKGA
FT                   YKLRDITGREKGIYNQDQLKLAYSADNDPIQVFSSFNKEYDRVQQKLLDKIRSERDHQL
FT                   NCLSVQHLHRQRRLLDISSCLDSNSQ"
FT   CDS_pept        complement(464716..466128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574560"
FT                   /orf_name="CD36_81900"
FT                   /product="Retrotransposon tca3 polyprotein, putative "
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAX42718.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI000192D835"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG3"
FT                   /transl_table=12
FT                   /translation="MYNYPTHTKDLLSTLSDSSYFSVLDLKKNAFYQVAILKDSIKYFG
FT                   ISTSEGNYCFTTLPCGAINSTTIFTNFVRQILEGIPHIFISMDDILIHTKNLHEHVSLL
FT                   RTIMEKLNEHQLQMNYNKMQLLTTKINFLGYTIQANKISPHISKIQAIQNWELPTTTTQ
FT                   IRAFVNFSNHFRIFIPEIAKFTNPLNEMLKNNNGKNIKIEHTQASIDGYKALKPAIIGL
FT                   PTLQLYNPNLPTIIFTDASHMVVGGYLCQPTFRNDKEVLVPIAFSSHKLTETQSRYAAM
FT                   EKELLAIIVILEKFRYHCSNTVEIYTDHQSLASFLDKKTTPPPRVARFLDLIGSFSPKV
FT                   YYLRGEENFVADIITRYQTQNIKELVDEGKILKKTFSVKRNLKQPLVPRLETIELENLN
FT                   ESQVHKIQNSLEQQQQQQQQQQQQEELEDNNEELPLQSFKLINDELHVIINNQLLKYLP
FT                   RSEYNDICQTNS"
FT   CDS_pept        complement(467041..467676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574561"
FT                   /orf_name="CD36_81910"
FT                   /product="Retrotransposon tca3 polyprotein, putative "
FT                   /protein_id="CAX42719.1"
FT                   /db_xref="UniParc:UPI000192D836"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG4"
FT                   /transl_table=12
FT                   /translation="MQMHKLSCLKLSPFQVRQSGILLTPYKESYRQLKQYNNGFVSVRA
FT                   HVFSHLHKYFPEKIFEADWLSKPESKFWTDLDLMVGSAIFQPPASSSNIDAINVIPSAY
FT                   NNNPQSYDRNNNQQSSYNRNSNYKLKTFYPKPFDKPRFDKPPYRNDQIYYQNTSNSSIK
FT                   YNPRGHNPFHNNQQKGKPPYRPYKRRGYVWNKGKRSQKIYELSIDPET"
FT   CDS_pept        complement(467788..468162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574562"
FT                   /orf_name="CD36_81920"
FT                   /product="Retrotransposon tca3 polyprotein, putative "
FT                   /protein_id="CAX42720.1"
FT                   /db_xref="UniParc:UPI000192D837"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG5"
FT                   /transl_table=12
FT                   /translation="MPNEKVINTPRDPYQTTTTGSDQRFRSQQPNIGNTLAQDLALIPN
FT                   LDPEISRLIKGYLPFITLHEVNIIGGPVGKPPNFRPDLVIHNPKDPEKIQKTYVTSIVY
FT                   AIITRSISSLPDDIGTIFAG"
FT   CDS_pept        complement(468098..468556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574563"
FT                   /orf_name="CD36_81930"
FT                   /product="Retrotransposon tca3 polyprotein, putative "
FT                   /protein_id="CAX42721.1"
FT                   /db_xref="UniParc:UPI000192D838"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG6"
FT                   /transl_table=12
FT                   /translation="MQNKYKKRHKSIKQVIKKYDIRHEKIEKRSKTIKKKKKIKEHKKE
FT                   LKKDIKAVVGEEKEELHKVEDFVLKDQEELRSVEKTVLKEEEDSQKVEESMEKEKQELH
FT                   QDEDFILQRDETVKKLEEEINRIGEKLNAQRESNQYPSGSISNYNHGF"
FT   CDS_pept        complement(470539..471084)
FT                   /pseudo
FT                   /gene_family="HOG000093772" [ FAMILY / ALN / TREE ]
FT   mobile_element  complement(471086..471588)
FT                   /mobile_element_type="retrotransposon:solo LTR, lambda C"
FT   CDS_pept        complement(472123..474252)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574564"
FT                   /gene_name="POX1"
FT                   /orf_name="CD36_81950"
FT                   /product="Fatty-acyl coenzyme A oxidase, putative "
FT                   /EC_number="1.3.3.6"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAX42723.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000192D839"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG7"
FT                   /transl_table=12
FT                   /translation="MSFTKKNVSLAQGPDPRSSIQTERANSKFNPEKMNYFLEGSKERS
FT                   ELFKGLAQQMERDPVLFTDGSYYDLTKDQQRELTAVKINRLARYRETDSIDTFNKRLSL
FT                   VGVFDPQVGTRIGVNLGLFLSCIRGNGTAEQLKYWAFDKETSNIKGIYGCFGMTELAHG
FT                   SNVAGLETTATFDKENDEFVINTPHVGATKWWIGGAAHSATHCSVYARLIVDGEDYGVK
FT                   TFVVPLRDSNHDLMPGVTVGDIGAKMGRDGIDNGWIQFSNVRIPRFFMLQKFCKVSADG
FT                   EVVLPPLEQLSYSALLGGRVMMVLDSYRMLARMSTIALRYAIGRRQFKGDNVDQNDPNA
FT                   LETQLIDYPLHQKRLFPYLAAAYVISAGALKIEHTIETTLEELDQAVAKGDQRAIFKSI
FT                   DDMKSLFVDSGSLKSTATWLAAEAIDQCRQACGGHGYSSYNGFGKAYNDWVVQCTWEGD
FT                   NNVLGMSVGKPIVREVINLEDKGKKVRGSTAFLNQLKEYTGSNSSKVVLDSVADLDDVN
FT                   KVIKAIEVAIIRLAQEAATTVRKESLDFVGAELVQLSKLKAHHYSLTEYVRRVNEFDQK
FT                   DLVPYLLTIAKLYGATVVLDKFAGVFLTFNVASTKAITDLASVQIPKLCAEVRPNVVAY
FT                   TDSFQQSDMIVNSAIGRYDGDIYENYFDLVKAQNPPSKTKAPYSAALEAMLNRPSLEAR
FT                   ERFEKTDETAEILSK"
FT   CDS_pept        complement(476368..476922)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535609"
FT                   /orf_name="CD36_81960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42724.1"
FT                   /db_xref="HOGENOM:HBG396579"
FT                   /db_xref="UniParc:UPI000192D83A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG8"
FT                   /transl_table=12
FT                   /translation="MEHSNHEQTWKQATNDYKSLHKLIKDSTSIGSFAFKCQDVIINKS
FT                   TVDEEYYQSAKRFLLIINLLGIYTEIRLLIIDDLKKIPNFHLSYHSLSPEEQKNMVSQV
FT                   KSIQKWTSYCGININLAFLLELSGYIFTKQFKYNSHVLYQLYRKGEKNRQRRVEFLGLE
FT                   QQQYQQQQQKQHADKDKNYHT"
FT   CDS_pept        complement(478293..478463)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574565"
FT                   /orf_name="CD36_81970"
FT                   /product="Mitochondrial import receptor subunit, putative "
FT                   /function="receptor activity"
FT                   /protein_id="CAX42725.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="HOGENOM:HBG398762"
FT                   /db_xref="InterPro:IPR020266"
FT                   /db_xref="UniParc:UPI000192D83B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDG9"
FT                   /transl_table=12
FT                   /translation="MNVSGRIPPQGAKEEQSTFEKIKNSPAFTIGTQAALFGLGVLFIQ
FT                   SPLMDMLVPQL"
FT   CDS_pept        478706..479950
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574566"
FT                   /orf_name="CD36_81980"
FT                   /product="RaN GTPase-activating protein homologue, putative"
FT                   /protein_id="CAX42726.1"
FT                   /db_xref="HOGENOM:HBG330467"
FT                   /db_xref="UniParc:UPI000192D83C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH0"
FT                   /transl_table=12
FT                   /translation="MASVEVELGVTPETTYSISGKQLKFDSESDITPYIKELTEKKNVK
FT                   KVDFSGNTIGIEASKALSEALLKHKDTIVEINFSDLYTGRLNTEIPQSLEYLLPALLKL
FT                   PNLKLINLSDNAFGLQTIDPIEVYLAKAVSIEHLILSNNGMGPFAGSRIGGSLFKLAKA
FT                   KKAAGKDSLKTFICGRNRLENGSVNYLSVGLRNHKDLEVVRLYQNGIRPAGISKLVEQG
FT                   LSNNKKLKVLDLQDNTITTRGAIHIAESLSNWPSLVELNLNDSLLKNKGSLKLVEAFHV
FT                   GDEKPQLITLKLQYNELETDSLRVLADAIASKLPQLKFLELNGNRFEEDSEHIAKINGI
FT                   FEERGYGEIDELDELEELDSDEEEDDEDDEGEDDTLEEDLDLEQLEEELAGISLEDKDD
FT                   NVDEIAEELSKTHIK"
FT   CDS_pept        480170..484093
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574567"
FT                   /orf_name="CD36_81990"
FT                   /product="DNA repair protein Rad50 homologue, putative "
FT                   /EC_number="3.6.-.-"
FT                   /function="ATP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="Mre11 complex"
FT                   /protein_id="CAX42727.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0030870"
FT                   /db_xref="HOGENOM:HBG396580"
FT                   /db_xref="InterPro:IPR004584"
FT                   /db_xref="UniParc:UPI000192D83D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH1"
FT                   /transl_table=12
FT                   /translation="MSSIYKLSIKGIRAFHPESDETIQFGFPLTLICGQNGCGKTTVIE
FT                   CLKYATTGTLPPNSKGGAFVHDPSLSSRTVVTGQIKLAFKNVNGKSMITTRSVQASSKS
FT                   TKSATGATVTFKTLEGQLAIIEKGDKISVSSKNAELDSQIPVYLGASPAILENVIFCHQ
FT                   DESLWPLSEPSALKKKFDDIFEASKFTKVLDNFKSIKKDMATDIKLIEQSVNHLKIDKE
FT                   RAKKVQDKLHNMNESVEKYTEEITDLNIQIEKKEKQAEELFATNQEFQRTLSDYENLLT
FT                   KKQALEEQIERIEASIEILPDNDAELMNRQENFSAMTTEKSHKIDDLQLQSTKLSDKLK
FT                   NKTKQYNELIRLDGSFKAKKAEYDLNWEKLSDLVDKNAKVFNLQTGNDRVRNIAMFQTE
FT                   LNKRHNTLLNEQKSLLVDNKRKESERQSALQDVLNSISREEQHQEYATSVINTNNEKLS
FT                   VLRRKVEVGSNNEVELEEKRNDLDLTMKLLQEKKDLNEVRKLDAKISECNTEISKFEFE
FT                   LDELAKKLSTSNKQSDLRSKVLFLEESAKSKKAELSKIFANIDNNYFEVLGSKLDVDVG
FT                   ESLLSQKISNLEIKSEEQQKKVVTLESELQINKNSIDSILKTIEENNSKIDSLKVSITK
FT                   VISEDEINDYENVVNDLEDSYRNVSEDVNSAEVTRDFKNSAISFAEENKCCLLCKRLFE
FT                   QGGLGAFIQDLKQSVDEHKIQEIREQSLEIKKELEDVKSINLEVVNYRECLANVQNYEC
FT                   TLKELVDKSNQIEKELEQQRKDQQAIKHSIDNASSLKKPLSDATRINLEVSDIEFQLDE
FT                   LNEDLRGFGGSVVSVDELQRQQQEINMKIKKTRQNLNDYTESKYKAQRELQKLENRVKD
FT                   TKLQISNLERSLAEVTGIKNNISEAEDIVRDSEEKLKKIKSSLDALHVDKQMKLDALKD
FT                   TQNSIRDVEQEMQRKVESSHELLTSFTSLNDAVTYFDTNIAEKYEANALEMKELSQQCA
FT                   SLETKIDEYAQEIKLLEKEVMDASRIEHNILANIDYRSQLSRLEETELQLGSMDIEDAQ
FT                   SRKEEYQVESKKLRDALSSLTAEHAGKIGEVKQIKDQISSLKKELETEYKNVNQSYHEE
FT                   WIKLQTNLLVSNDIQIYSKALDNGIMKYHSMKMEEINRILNELWSQTYKGSDISTIAIK
FT                   SDVNLQAKGNRSYNYRVVMVKESSELDMRGRCSAGQKVLASILIRLALAECFGANCGMI
FT                   ALDEPTTNLDAENAEALAAALNRIIEYRKSQSNFQLIVITHDEKFLTHIQGDRFTDHFY
FT                   RIQRDESSKSRIYSLPIGRIQEN"
FT   CDS_pept        complement(484117..484791)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574568"
FT                   /gene_name="MUM3"
FT                   /orf_name="CD36_82000"
FT                   /product="Protein mum3 (Muddled meiosis protein 3)
FT                   homologue, putative"
FT                   /protein_id="CAX42728.1"
FT                   /db_xref="HOGENOM:HBG396581"
FT                   /db_xref="UniParc:UPI000192D83E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH2"
FT                   /transl_table=12
FT                   /translation="MSILGDDYSPIRQCEQFSLPIINFFSWFLVWRVPTIKILLHMLKS
FT                   DENWELESKSLSFVFSRLLRSKFSEWVVLFPEVNIWTTNGATLQGQVSHKYFLPKFNHL
FT                   LYPRFSAFFNIISILNQSKPHAYLNMYDITILYTRNGHGVASSQYKPPTLLDIFASAEP
FT                   ITVIVYVKIRSVSRIPTKRKKLEKYLEHLWIHKEKMISQLKAENDTHIQLRILQDDFSV
FT                   AS"
FT   CDS_pept        485439..487979
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229967"
FT                   /orf_name="CD36_82010"
FT                   /product="Multiple RNA-binding domain-containing protein,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX42729.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG412223"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D83F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH3"
FT                   /transl_table=12
FT                   /translation="MSRLIVKGLPKYYTEEKLREFFSKQGDVTDVKLMKKRNGESRKFA
FT                   FIGYKSADAAERAVKYFNKSFIDTARIDVEFAKTFSDPTVPLSFKEKRKRDEQRLKDEQ
FT                   ERLLEQELRTQVKKQKIKSTSEIDDEISNNPKLREYMEVMKPSHQVKSWANDTIADGSG
FT                   GPSVQDLENALNGNKDSSIGKPDIEVVKTMEDASDDEYNDFKELSEKRGENEGEEEEEE
FT                   MMISLGDLPANEKNKVDNESGENLAANENISDLEWLKSRSTRIKENGELPEISPEEKEV
FT                   NEDTAVTQHSDNESELTPEEQIIQKIEETGRLFIRNISYEASEEDFRKLFSQYGALEEV
FT                   HIAIDTRTGKSKGFLYVQFSKKDDATRAYRSLDKQIFQGRLLHILPADQKKDHRLDEFD
FT                   LKNLPLKKQRELKKKSQAAKSQFSWNSLYMNSDAVLESVASKLGVTKSQLIDPENSSSA
FT                   VKQALAEAHVIGDVRKYFEDRGVDLTSFDKKERDDKIILVKNFPFGTTIDEIGELFAAH
FT                   GQLKRMLMPPAGTIAIIEFRDAPSARAAFAKLAYKRFKSSILYLEKGPKDLFTREPTTN
FT                   EIASAPEQQQNEHAVEAKISANEILGESKQDDDIESVQGPTVAVFVKNLNFATTVQALS
FT                   DLFKPLSGFVVATVKTKPDPKNSGKTLSMGFGFVEFRTKEQANVAISTLDGHVLDGHKL
FT                   QLKLSHKQGSGASASSVKKSGKSSKIIIKNLPFEATRKDLLELFGAFGQLKSVRVPKKF
FT                   DQSARGFAFVEFNLMKEAETAMNQLEGVHLLGRRLVMQYAEQDAENAEAEIERMTRKVK
FT                   KQVATQNLAAARLAGKGKIDLEEKDEEDFDRDFQ"
FT   CDS_pept        488175..489158
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000958" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574569"
FT                   /orf_name="CD36_82020"
FT                   /product="Serine protease, putative "
FT                   /EC_number="3.4.21.105"
FT                   /function="peptidase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42730.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396582"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000192D840"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH4"
FT                   /transl_table=12
FT                   /translation="MFPFTKLTSNICLKNHFFSNGNLLSLSLKNMRQQKISSFRSNIQL
FT                   LQSNFIPIRGYIRETVYQQTRNSPLRRSSTWKQYNSFYNRSNWDKLKKPLLFTIAFCVG
FT                   TTLVTPYLFTYTPLSYFKRNPQSLLWSLIGINGAVFLMWRIPRLQWFTMKYGILFKDNL
FT                   QSPWTLLGSAFSHQSFAHFFINMLALQSFGSTLVAFLGVSNFTIMYLNSAVISSFASLA
FT                   IPMFLGSSLSVASLGASGAIFSVFGVFSFLFPASPVGLFFIPIPGGAWMLFLGTTLWNA
FT                   AGTVLRWGTFDYAAHLGGSIVGIAYGYWYNRKRKQQIRRRRHTLDF"
FT   CDS_pept        complement(489208..489822)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574570"
FT                   /orf_name="CD36_82030"
FT                   /product="Regulator of mRNA localization, putative "
FT                   /protein_id="CAX42731.1"
FT                   /db_xref="HOGENOM:HBG396584"
FT                   /db_xref="UniParc:UPI000192D841"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH5"
FT                   /transl_table=12
FT                   /translation="MAPRQSKTAKRNKTQNKTRTVDSEVFSDSAAKNLLADQPKLTPKS
FT                   KVKKISKLALKKQQAKIRLYGAKNGKEYREDQLDIPTLNKAIVPGVKAKRGKKGKKFVD
FT                   DNDTLTLNRLVKSINDKYDQVNESKLEKSRRLEEIRDLKRQEIERKEQLKKDKLEGKKD
FT                   ELRSKASVARSNRRKNAKARRAEDESQEDELPKNKKKVSFV"
FT   tRNA            complement(490099..490195)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        490741..492012
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574571"
FT                   /orf_name="CD36_82040"
FT                   /product="Formamidase, putative"
FT                   /EC_number="3.5.1.49"
FT                   /function="formamidase activity"
FT                   /protein_id="CAX42732.1"
FT                   /db_xref="GO:0004328"
FT                   /db_xref="HOGENOM:HBG552286"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI000192D842"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH6"
FT                   /transl_table=12
FT                   /translation="MPIEPIRYVAKVDLTKPGDQQPQLHNRWHPDIPFAETIKPGETVK
FT                   IECLDWTGNQIKNNDTADDILNVDLSRIHYLSGPFNIEGAEPGDALVVEIKDVQPLERQ
FT                   PWGYCGVFHKKNGGGFLDKFYPEAAKAIFDLEGIHATSRHIPHVKFTGLIHPGIMGTAP
FT                   SAEVLEEWNSREIGLINDIQQQHETNVANGPLETNSHAGSATGTLASKIAKEGARTIPG
FT                   RPENGGNCDIKNLSRGSKCFLPVYVNGAKLSVGDLHFSQGDGEISFCGAIEMPGVITIK
FT                   VSIIKNGIEKLSLKSPIFIPGDVQNHYGPSRYLTFEGFSVDEDGKQQYLCATTAYRQAC
FT                   IRAIEYLRKFGYNDYQIYLLLSSAPIEGHIAGIVDVPNACTTLGIPMDIFDFDISPEGN
FT                   FEEKDMKNCAFVEGAKHSVRYEYK"
FT   CDS_pept        complement(492060..493226)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574572"
FT                   /orf_name="CD36_82050"
FT                   /product="Alpha-ketoglutarate-dependent sulfonate
FT                   dioxygenase, putative"
FT                   /EC_number="1.14.11.-"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42733.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000192D8F7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH7"
FT                   /transl_table=12
FT                   /translation="MPSRYTRPSEALGGGTEYVSDSKGFVSIAPKSAQKINIESSAYLP
FT                   TWDRNESYEPYEFLEFHDPALRANKDLPNLFPKDGDYTTSNISPKLGTEIKGIQLSQLN
FT                   DAAKDEVALLAAQRGVLVFRDQDFIDKGPEFVTKYVSHYGPLHIHPTSGAPKGHPDIHV
FT                   VLSGDTKEYPFEKKTNLVVLHSDVSYELNPTALSFLAATNIPQSGGGDTVFVNTVEAYD
FT                   RLSPLFKEKLEGLKAVHSAVEQANFAIFKKGHVKRHPVENVHPIVRTTPLGQKVLYVNN
FT                   GFTRKIEGLKEEESSYLLNFLLDHIWKGHDFQIRAHWEPNTVVIFDNRVVGHSAILDFD
FT                   TTDSRLIIRASARGERPVSDLKDLNKPDENLVYHGAEYLGDRLENLKI"
FT   CDS_pept        494005..496587
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574573"
FT                   /orf_name="CD36_82060"
FT                   /product="Protein transport protein Sec23 homologue,
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAX42734.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG396585"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI000192D8F8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH8"
FT                   /transl_table=12
FT                   /translation="MSRKQEEIAHPSVNFNWNVFPVTRLEESQMSTPLGCIYSPFNSSN
FT                   VPPQTKSLPISCTTCQAVLNPFIKLDRKNGMWWCPFCQKRTYLPESINIPEIATTVEDW
FT                   PIEMRETSTTIDYELPHDIIENTTMSFPLTYYFVIDRYQPSEENSLARLLDSIVSTIKN
FT                   IPLGSMIGIMTFNKSVQLHKINTKETVEISSNDISNCDKYWKLFEKSAVDQLLNRLGLT
FT                   GRSPELDLNDLLRNEYLIELSENNIDSIINYILNIKPTYTEKHKPPRSTGLAHYVYSIM
FT                   LSQSGLKNFIGKVLFFTSGACTEFPGKIVDGNSSIRSHKDIYDLEAPFFPEASKFYTVL
FT                   SYIANGQSIAQSIEIVKSSSSKTTQYNIDQTSPVWAVNLYAGSLDQIGAYEMKPLITNT
FT                   MGSFFLTETLGSYQIKDMIIEAIGLSHHKAVLEVSTSIGLKTSKLIFSGGYALPSSYHK
FT                   SSKYNHLYHIKIDDELGEFDSPHAKKVFTNRWKFNELKENDTLSLFFKMESAKSTEDLS
FT                   NGSISEVFIQFSLKFWDVVKKKWITRVTTVRKPTTLSYVKTSTGKQKHQSMILKEHKFT
FT                   LGFDQRVWTILLTRLLINKIDTNLGYSSFDELVELIDRTIIKLLHYFGGITVTNNHTAS
FT                   SNPYYRLQTMYELNQKFKELPSLIYSLRKNSDLIKIFNSSPDETTYYHSWFLKMNMPFS
FT                   IKVIEPVLINTTDSITRLPLDSTCFDLAPNDSFLILDTGFTLTLYYKCHHQNKLNLHPS
FT                   DNDFMIENKDPKLPWDIIEKYISERQVIPRIVVTQTNHSQSRFLMSRLNPTASDSTKEN
FT                   QSQVDSNKGGFWSFWTSNNRKSSNLIAEDISLKEYYDDLIEQVQKFKI"
FT   CDS_pept        complement(496596..497540)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574574"
FT                   /orf_name="CD36_82070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42735.1"
FT                   /db_xref="HOGENOM:HBG620655"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="UniParc:UPI000192D8F9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDH9"
FT                   /transl_table=12
FT                   /translation="MSLKSVPQQKGIVHTYGFNLTAFEFTTSDSKKTSPNVILFVGGLG
FT                   NGLLNVPYLPQLADSASNEFQSADGGSWSLVQVLLSSAYQGWGTSSLDRDAFELQSAIE
FT                   YFRSERGGNRQKIVIMGHSTGCQDVIHYLTKTLYKENIPETSQVQGGILQAPVSDSEAL
FT                   SSGRDPAKYEALIQRVYEEYISKGRENEILPQEYRKITWGMPTSAYRFYSLASKRGDDD
FT                   YFSSYLTEDDYKNSFGKVNKPLLVLYGSIDEFVPEYVDKEKLVSKWKQSTPSQYWSEHS
FT                   QIIKGATHNLGDGSDAGVIDYLVSVVKKFISDL"
FT   CDS_pept        498588..499970
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229968"
FT                   /orf_name="CD36_82080"
FT                   /product="Protein Ste50 homologue, putative "
FT                   /function="kinase activity"
FT                   /biological_process="signal transduction"
FT                   /protein_id="CAX42736.1"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG396586"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI000192D8FA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI0"
FT                   /transl_table=12
FT                   /translation="MTSPISNDSFLQWDAAQVSTYINSILPHEQRRIGNVFLDNNVDGS
FT                   LLPFITTEHLKEIGIISLKTRLVIKKGISDLIAAHYSKYPPKSFSDPDYKLNHVNINNN
FT                   YTTVESLNLSTVLMQDMMKKLSYELHKQKSTFVASSPVSPTHDEMKKLNDNFIKLKTDL
FT                   IPIIRLLKDSKPLPTPTLDPGPAASMDSPSYFSSHHHLEHDSFEKGLSRSGSGNAMASN
FT                   NRTPTTIPSPSSNRFSSGSLLSMGTGKIMSQSVPKYPENKANNDFTLQKLGLPRNNSNK
FT                   SLESHDRQQNAAGVRPRLVQNPSSSSMHTVTSPNGIPPQSAAAVATAAINGHGSGYIPQ
FT                   VSTPPNQLGHHHNPGTEPLKQLRASTDDSCLKILQQAMKRHHIPREDWSRYVLVICYGD
FT                   KERILKLAEKPVVIFKELQELGKHPAIMLRQLADSSTDDSGPESAIYNDARIGTEIPGG
FT                   TL"
FT   CDS_pept        500296..500793
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574575"
FT                   /orf_name="CD36_82090"
FT                   /product="Ribosomal protein of the large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42737.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniParc:UPI000004F9D6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI1"
FT                   /transl_table=12
FT                   /translation="MPPKFDPNEVKFLYLRAVGGEVGASSALAPKIGPLGLSPKKVGED
FT                   IAKATKEYKGIKVTVQLRIQNRQATASVVPSASSLVITALKEPVRDRKKEKNVKHSGNI
FT                   PLDEIFEIARKMQHKSFGKNLASVSKEILGTAQSVGCRVDGKNPHDIIDAINAGEIDVP
FT                   EN"
FT   ncRNA           501085..501255
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR80"
FT                   /db_xref="Rfam:RF01269"
FT   CDS_pept        join(501798..501813,501883..503000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574576"
FT                   /orf_name="CD36_82100"
FT                   /product="Acyl-CoA-binding protein (ACBP)/diazepam binding
FT                   inhibitor (DBI)/endozepine (EP), putative "
FT                   /function="acyl-CoA binding"
FT                   /protein_id="CAX42738.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="HOGENOM:HBG396587"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="UniParc:UPI000192D8FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI2"
FT                   /transl_table=12
FT                   /translation="MSDSVDRVFVKAIATIRALSSRSNYGSLPRPPAENRIKLYGLYKQ
FT                   ATEGDVDGVMPRPVGFTAEDEGAKKKWDAWKREQGLSKTEAKKRYVSYLIETMRVYASG
FT                   TSEARELLNELEYLWEQIKDLPSSDEETDHHIPLPSRSPTFSQTDRFSNRTPSITGART
FT                   IGTSNLNNIYSHSRRNTTLSLNEYVQQQRMQHQNQQQLHDTTSQPGATGGGGGGGGGGG
FT                   SVYSLPGRMGANNVIEDFKNWQSEVNMVINKLTREFVNSRREVQGNENGDPSSGDRDEE
FT                   LDDIEIIKRRVIHILKFVGWNALKFLKNFAVSLITFMFIVWCIKKNVHVERTYVKQPAN
FT                   NATKSKKELIINMVLNTDENKWFIRLLSFINRFVGFV"
FT   CDS_pept        503346..505574
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229969"
FT                   /orf_name="CD36_82110"
FT                   /product="U3 small nucleolar RNA-associated protein,
FT                   putative"
FT                   /protein_id="CAX42739.1"
FT                   /db_xref="HOGENOM:HBG396588"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D8FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI3"
FT                   /transl_table=12
FT                   /translation="MDIHRCRFVDYTPHTITSLAFSRKSSLTSLPTADVRLAVGRSNGD
FT                   IEIWNPRHNWTHELTLPGSKGRSIEGLCWSYNEQDPSEPPRLFSIGGSTYITEWDLATG
FT                   RPLINYDCNAGIIWCIDINPRNDRLTVGCDDGSVVIVDISGGRGSLEYDLICQRQDARV
FT                   LSVKWAGNEHIIGGCADGRIRSWSSEGDTKGRLVATMKVDKAKTESTLVWSLTVLPNKR
FT                   HFVSGDSTGSIKIWDLTRFTLLQTFKVHDADVLCLVHDVKEEKIFSAGVDRKIHQFDLL
FT                   KNKNSLKWTHSFNRLLHSNDVRSLAIFENKSYNLLVSGGVERAIVIQNIETFYDGKYKK
FT                   LLINQQQSNTLIVPDSKLIILWQDQTIKVWKVLPTGKHVLMSKLTLSADENITSVDFKD
FT                   NLLVVAKMTSVRFFELIEIDNKFKVQKIRDDKFDSLIEGAKIVKFIDANKVLILTSDEE
FT                   LYTFDIDSEEGKIELNGEIELLESNQQQQQQQQRKNQHLSRINNLVLTPNRKQIIISRF
FT                   NGFIEVYPVLNTESEAYVLTKLSSYPHLIECVNDEKLVVVNEENKIFEFFINDKDGQLL
FT                   TPWSRRNSEFLPRQFMSLQDKPEGMFVQQEKLWVYGSTWLSFFDLSMNIPISKVYKNTS
FT                   TSKKRNHDGLSMNEEIGELEDETEELIESSLKQSEIDRLRQQIQIEDKDNQNNAADKGK
FT                   TKKPFWITEKYRPIMKAANFGEGDIIVVERPYSSLQTGPAFDLPKIKV"
FT   CDS_pept        complement(505666..506883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246732" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574577"
FT                   /orf_name="CD36_82120"
FT                   /product="Putative mannan endo-1,6-alpha-mannosidase,
FT                   putative"
FT                   /EC_number="3.2.1.101"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /protein_id="CAX42740.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="HOGENOM:HBG396589"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000192D8FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI4"
FT                   /transl_table=12
FT                   /translation="MSFPPLENPNLEGYEIARQLWIEYYNQHEGTFVARKKCNGCYNEN
FT                   RFVVWAVAVAAQAIVDGARIYPELKPLVAPAIQIFQKYKNNHVKGYSAAENSGNDRDIY
FT                   YDDDAQVASAIITAYEVTGDKQFLDQGRELVRFLMSGWNDKPDAKTKGGVHWHVSKSYL
FT                   NACTTAEVAKACLQISKFLPQEAGVYIDFAAKCIDWQIKVLQDPGDKLIKDGVSDKDTN
FT                   VNDVKWTYNVGTTLSAASHLYFITKDSKWKQIAEDLAKAGINRGVFFYDRDFDNSKRYW
FT                   RDSSYFVQLLIEGLADYLLYVGNEVPGELVGQIEEEIKRHLIIFYEFMKDPKDGMYIQS
FT                   FEPHNTYREVYDQKYKKFFGDGKGWGLKGEDKDDQGNPSKCLMGYAAAARVFFQGARVV
FT                   PHIDSY"
FT   CDS_pept        complement(507478..508608)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574578"
FT                   /gene_name="ERG6"
FT                   /orf_name="CD36_82130"
FT                   /product="Sterol 24-c-methyltransferase, putative "
FT                   /EC_number="2.1.1.41"
FT                   /function="sterol 24-C-methyltransferase activity "
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="CAX42741.1"
FT                   /db_xref="GO:0003838"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG316404"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="UniParc:UPI000192D8FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI5"
FT                   /transl_table=12
FT                   /translation="MSPVQLAEKNYERDEQFTKALHGDSYKKTGLSALIAKSKDAASVA
FT                   ADGYFKHWDGGVSKDDEDKRLNDYSQLTHHYYNLVTDFYEYGWGSSFHFSRYYKGEAFR
FT                   QATARHEHFLAHKMNLNENMKVLDVGCGVGGPGREITRFTDCEIVGLNNNDYQIERANH
FT                   YAKKYKLDHKLSYVKGDFMQMDFEPESFDAVYAIEATVHAPVLEGVYSEIYKVLKPGGV
FT                   FGVYEWVMTDKYDETNKEHRKIAYGIEVGDGIPKMYSRKVAEQALKNVGFEIEYQKDLA
FT                   DVDDEIPWYYPLSGDLKYCQTLSDYLTVFRTSRIGRFITTESVGLMEKIGLAPKGSKQV
FT                   THALEDAAVNLVEGGRQKLFTPMMLYVVRKPVEKKD"
FT   CDS_pept        join(complement(511724..511754),complement(509528..511593))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574579"
FT                   /gene_name="PSP2"
FT                   /orf_name="CD36_82140"
FT                   /product="Psp2 protein homologue, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX42742.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG396591"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D8FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI6"
FT                   /transl_table=12
FT                   /translation="MSLQEFFEDEYADVDMASISVPIEKGPFHDGDSFNQRHLGDPVIS
FT                   GPPYIVKLLNLPVTANDSFVQDLFQSRFTPFVKFKIVTDPASNILETHVIRQVAFVELE
FT                   SASDMSKALKWHDLYYKANRRVTVEVADFNDFQNCIKFNQEHEYEIMQIQQEFIAQKQQ
FT                   QRQPRHMALLDDFERNQRGPELPLHHQQQQQQPHHHFNPNLNRPSGRSSLPTNEMSHSR
FT                   RLSFEAQLHPHQQSHEQRIRQPSFDNAFSDTPNPPFGGGGGIRQHTHPINPPVAPTSAP
FT                   ASKPFVTPISSASSTSKPKPNPFGGAKPVDTLSKQQEIEKKLINLNKTTVQTLGDEENP
FT                   DEVQATIKKFRENGSPKLRRASVGSRRLSSEKRPSVSILKRDLPEKQQQQPQNSNTNQT
FT                   ALHQPDQPQNHSPNVSSTQPSAESPSVETQPLSTNPYTSNGTGKSLAQLLSEQSDIMST
FT                   PPMTGKKTPRSNSNKKPVVAAKPIILKKKIATSPPVQRIDLTIKESEYLKKNVNDLQKS
FT                   VDENLENKLEKLDLNSKTLQENGTKESTKTTIDFPKRENNREEDRPNFKNLDQLVQKRN
FT                   DSRASSSSSNSRRFEFSRGSREENEQVPSKSSQNNSEESLKLAISGTDDQQDLSSTNAR
FT                   LESGMWERGRGRARGGFRGRSGFRGRSGFRGGPRGGPRGRGGGASANYNLHYVRSKPTS
FT                   GETN"
FT   CDS_pept        complement(512613..514259)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229970"
FT                   /orf_name="CD36_82150"
FT                   /product="Vacuolar aminopeptidase, putative "
FT                   /EC_number="3.4.11.22"
FT                   /function="aminopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAX42743.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG630643"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniParc:UPI000192D900"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI7"
FT                   /transl_table=12
FT                   /translation="MQTHIKCNFQFYFFSSPFLLFSQLIYQYCLKMSNIDDILLGISES
FT                   LKRLQKVSEEAKAENPQPVQIQNLEINSTKKFTDNYYSKVADDYIEFTYKNPTIYHVVK
FT                   FFKSELESKGFTYLPESESWADLEAGKYFTIRNGSSLAAFVVGKDWKASKGVGAIGSHI
FT                   DSLTTVLKPNSTKAKVDGYELLGVAPYAGTLGSVWWDRDLGVGGRLLVKDGKGKVSQHL
FT                   VDSTPHPIAHIPTLAPHFGAPANGPFNTETQAVPVIGFSGENDKEEEEPTEEEKNAPLY
FT                   GKHPLKLLRYIAKLANVSVADILQWDLQLYDVQKGTKGGLNKEFVFAPRVDDRVCSFAA
FT                   LNALIDSTVDNNLANDSFSIVGLFDNEEIGSLTRQGARGGLIELVVDRVLSSEFYNPDG
FT                   LDIQESLRLTYANSIVLSADVNHLFNPNFPGVYLEHHKPLPNVGVTLSLDPNGHMATDS
FT                   IGLALAEELARKNGDKVQYFQIRNDSRSGGTIGPAISTSTGARTIDLGIPQLSMHSIRA
FT                   TLGSKDIGLGIKFFYGFFKNWRDTYDNFVDL"
FT   CDS_pept        complement(514456..515595)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574580"
FT                   /orf_name="CD36_82160"
FT                   /product="Deoxyhypusine synthase, putative "
FT                   /EC_number="2.5.1.46"
FT                   /function="deoxyhypusine synthase activity"
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="spermidine catabolic process to
FT                   deoxyhypusine, using deoxyhypusine synthase"
FT                   /protein_id="CAX42744.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0034038"
FT                   /db_xref="GO:0050983"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI000192D901"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI8"
FT                   /transl_table=12
FT                   /translation="MSNSGKLPGLASDAVLKHSIPVPEDFQEVKGIDYSQDNAYNMRAK
FT                   DLIKSMSTMGFQASSLSQACEIIDNMRSWRGKHKDTLETHEQTGEFDDQGYQKTTIFMG
FT                   YTSNLISSGLRDTLRYLVQHKMVSAIVATAGGIEEDLIKVLAPTYMGDFTLPGKGLRDQ
FT                   GMNRIGNLLVPNDNYCKFEEWIVPILDKCLEEQEEAMKKLGSEGLNADSEAVWTPSKLI
FT                   DRLGKEINDESSVLYWAHKNKIPIFCPALTDGSIGDMLFFHTFKASPQQLRLDIVADIR
FT                   KINSMSMAASKAGMIILGGGLIKHHICNACLMRNGADYAVYINTGQEFDGSDAGARPDE
FT                   AISWGKIKAEAKSVKVYADVSLVFPLIVAATFASEKPQN"
FT   CDS_pept        complement(516058..516480)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000140337" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382835"
FT                   /orf_name="CD36_82170"
FT                   /product="NADH-ubiquinone oxidoreductase subunit, putative "
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="electron carrier activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42745.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG714446"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniParc:UPI000192D902"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDI9"
FT                   /transl_table=12
FT                   /translation="MSTSIFRTLKNIYSSGLKRAAWQIQHHNDTKRGWLVGIDDFGNKY
FT                   YETDAPEEIHLRTRWVEYAQWNQDMSQVEPGWHYWLGYGTNTPPNALIGDAKTTRAYPL
FT                   PAHHKPNLTNTPGAYVCYNTAKPKFKSWTPEVKERA"
FT   CDS_pept        join(complement(519468..519486),complement(517015..519398))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574581"
FT                   /orf_name="CD36_82180"
FT                   /product="N-terminal acetyltransferase C complex subunit,
FT                   putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX42746.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG396592"
FT                   /db_xref="InterPro:IPR007244"
FT                   /db_xref="UniParc:UPI000192D9BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ0"
FT                   /transl_table=12
FT                   /translation="MFLQSLDRLAIDESKRDFIYDTDDDDDLIDITKEVFASLESITNN
FT                   KVVKSPYFELLEGTRALEVLNPKLDTGLIELTREELTFDCSKPQEVNVIINIQTKLLSN
FT                   LINWLESDSLPVTVLSCRYVQTLLVNYLNHENSGLGKFSFYNSRLSPVDHSKDDLNYQL
FT                   IHRVLKTFIMGLCKFIGFTIYLSRTVLYEEEDLNTKSMNLNFFDDISPGYFIEEINDCI
FT                   EWILSNDEIVEADTLITQLKIVANLVKFENTFKITQRTSFMENDSQTSSFGFDFCLDAI
FT                   NQITKLQTIKFDDSVIPTGSFSKFIQIDLENKSIPAELTNINLETTWDCLTNIFKTIHK
FT                   FTNQANSIKSINQLYDFLQYNVKFPIDNVSVFARGFFQLYFIRDDKSIFGSNNVNLPNL
FT                   VVDWIENVIGKNTIMLGKIENNLSQIKDSAKAEIIKVHNANTTDLESGMYHYLTTFASN
FT                   PCRSQQLLSKGLILWDTLQVGWESFEYEMYKGFGVGDEFATGELSISVTSYVYFGKLQM
FT                   MLELLLNGISLDLYKPFEMYLIYWYADYLILNIIEHLENRVSQILLGKINHLETNIPKK
FT                   IKKLKAGSKKEQLKELNLYNQQVIIPQLTATLNFNQDYLIKSLKALRNLTQCQLKYLSV
FT                   LSKLQIIDYTKGPINNLTSMENLYHLRMKPWSSIGVPMFPTFEQYQSALTTNTIPGTNN
FT                   KVTLMKCLELLASAKNNLVVVEKEYNQLIDYIKRDTKNNFLPDSSIITWYEELISSMGQ
FT                   INDNISQISKIISLNKNDLDLKNKYKISITKGCHKYFPNISIISCTV"
FT   CDS_pept        521198..522685
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574582"
FT                   /orf_name="CD36_82190"
FT                   /product="AP-1-like transcription factor, putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX42747.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG396593"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR013910"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniParc:UPI000192D9BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ1"
FT                   /transl_table=12
FT                   /translation="MTDIKRNFSDIASPANLDDTKKLHVDTTTTTKVGRKPIETEPKSK
FT                   RTAQNRAAQRAYRERKERKMKELEDKVRLLEDANVRAITETDFLRAQVDVLKNELAKYT
FT                   GGSDFSDLNLPTKVGHLSHPNNHHSNVSTGTPHGSISSSNSVASLDNEKPSSASSVSNN
FT                   SPGFAFDNPWSKDNLQKLKQQQKVPQGVPDLVSGSSSSSTPLNDNLLVTPDSLTSLSTS
FT                   SKYTGQNNVPTNLDFTNQFDEQVDPFCVKLNEACGTKSNPVPKFKRSTSKTNTSTTNTS
FT                   PLAHLVSPESQQYNNPTNAEFMNDPFFNGMGADYNFNFDTKNGSIQDPLSFLQDDNFDL
FT                   ALAFGDPSPPGNEAEADPISLLTTEESIYDPLANNNNNNNTNQLCSTVKTDDVNTDFNF
FT                   NDFVKNSLPEKQEKGKYEPPSSSKITTIEEDEVVPAPPQTLKCSEIWDRITSHPKYTEL
FT                   DIDGLCNELKSKAKCSEKGVVINTADVNQLLERSIKQ"
FT   CDS_pept        complement(522930..526655)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246733" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574583"
FT                   /orf_name="CD36_82200"
FT                   /product="Condensin complex subunit, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42748.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396594"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D9BD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ2"
FT                   /transl_table=12
FT                   /translation="MEIPPKPTLKAIKKFKTLDEIKYAMKHVFQDAQLGLAGHRKLVVI
FT                   LKNVFKKVIELNQIHFFAMCFTKLLSKILPLKRGVLAGDRIVKFCYSFVNGLVKDANEA
FT                   KRLQQEEKEEKEEEDPEEEEEVDQETPNSEFISYLIKYLLSGIESKDKSVRYRVVQTLA
FT                   YLVEFLTEIHENNTLEALYTLLSNRLQDKESSIRIQAVVALSHFQLFEFSIEGDTEEVE
FT                   DEFISSNQIKSKLINSIQNDDSPEVRRAALMNLVKTPDTIPILLERARDSNSINRRLVY
FT                   SKVARELITDLDDLEFEDREFLLKWGLNDRDETVKAAATKMLTTYWYQAVNEDLLELID
FT                   QLNVKSVIAEQAILAFFKTKPEVLETIKIDESYWKNLTTEKAFLMRTFYQYCNENKLHA
FT                   LMDANFPELLDLSITLEKYMTVRLKTINENETLVKEWETYNSKIDELDDQIFSLENQIA
FT                   RINTDADNFRKNLSNIEEDIIEINIAKDLFKERIKQLKNNTGNLDDLVTEENQDIANQI
FT                   KDFSVEDLQLQLEDINNNLDEIEHQPEEIMAKLENLQTKYDSCIKALETTTQLKIHTEE
FT                   NFEKEHENDCIPFIDALKELEFIINQLLLIVKDFDYGDEMARRKLLHIIRTTLTEDKLP
FT                   DALIAVALRVLRALSINEKDFVSMAVEIITDIRDSRDDEEFHSAAATFDDDDMENEDDD
FT                   DESQQSSLSTAANKKRRIEPDMPPNDIVLRCLTMTQHVLEVITYSLDDHLSLSSIYSGI
FT                   VNYAIQNESKKKLYLSGLTCLGLYSLIDSKIARIATSTLLSAMRSNGDEVKEIGMKAIV
FT                   DILAVYGMSILDKSSKYKYSRMFFKVLNSFESPKLQCIVAEGLCKLFLADILYKTDKRS
FT                   LFGNVILQGDPTTTTTNKGDDDDEDDDDDANEEEETDREHEKHLFEAIVLIYFNPHTKS
FT                   NQELQQILSFCIPVYAFSRINHQINLAAVSGDVIYRLFTESENELLSPNVIIPQLISWC
FT                   DPRNLVKLSNDEINQATSHLWQCVYLLQVVEQVEARNVKRCIINNLNKFHITEKLESNQ
FT                   LQALIKALDTTIELFANNENNPNFILDKPTKKNFDTFIDSIKNKLEIAQKREEMESIRG
FT                   GSDTNSILHELDDLDIGTGESSQISIKSETETRDSDRSSQVSKTTSLETSYQEEEEQED
FT                   EKANVGNQLEVDKSITFKKEDKEKELIETSPDQEQEQVESKKVIDNKVKDSLEDIDKFL
FT                   EEADDVDYGDISMDSD"
FT   CDS_pept        complement(527033..528523)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574584"
FT                   /orf_name="CD36_82210"
FT                   /product="Nucleotide binding regulatory protein, putative "
FT                   /function="GTP binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /protein_id="CAX42749.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG444960"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniParc:UPI000192D9BE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ3"
FT                   /transl_table=12
FT                   /translation="MGSCASKSADKGNGTSQNQQSGQSTQGKRQQQSQAIQQKNKEKQQ
FT                   QRQREQQEKHSQQQPQSPTDSNADGTLKNGSDFYETLKHPSDSSNDNGHHLKEKHSQEL
FT                   SNGTANNNLITNPVDAAGNSNPSKDVKVLLLGSGESGKSTIVKQMKILHSDGYTQDELE
FT                   EYRPFVYKNILDCIKNVINAIIDLQPDLIKKPDSPQLEEDREDDLKVTGLTSENNHVPI
FT                   TNGSAINEPPKHRKHILEYDMLNEILDYDYPLDSNQPFNADVAINIKKVYETPEVKEFM
FT                   LQRQGEFYLIDSTDYFLSNLDRICLSGNYEPNVMDVLRTRKKTSGIFTYTFDLGNGLNM
FT                   NLFDVGGQRSERKKWINCFDNVSTIIFCVALSEYDNFLLEESNTNRLEESLALFDSVVN
FT                   SRWFARTTVVLFLNKIDVFAEKLKYSPLENFFPDYKGGPNISNGVKYILWRFNKLNRSG
FT                   LNIYPHVTQATDTSNIELVMAAVKQTILENSLKDSGIL"
FT   CDS_pept        complement(530611..531009)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574585"
FT                   /orf_name="CD36_82220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42750.1"
FT                   /db_xref="HOGENOM:HBG396595"
FT                   /db_xref="UniParc:UPI000192D9BF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ4"
FT                   /transl_table=12
FT                   /translation="MYIRLFSLMIGFFAININSNNSPNNSPPSFMKPLDDKQLFPYTTI
FT                   FSKAINNRSIIECMKLSESTSFKIKNCTISNGGSGNSNSTGTGTTNGQYKSCLCYYIKL
FT                   IQQECKELNSDQSWQLQLLQYPECFSPP"
FT   CDS_pept        complement(531341..533158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535610"
FT                   /orf_name="CD36_82230"
FT                   /product="Kinase subunit of RNA polymerase II carboxy-
FT                   terminal domain kinase I, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42751.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D9C0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ5"
FT                   /transl_table=12
FT                   /translation="MSDRYRPRGPKNQQRSGYQSRSSYVPQRRDNRERDSYIPSGPKRL
FT                   AERDNYRPDNDQYQQQQQQQQQQENRPAQHRESSSNSTYSSSSSSSSFGVVNPPKGPKQ
FT                   SYVSGMKRPLPSGPASFRKRRDFISNTNRIAIPKGPRQGFKEIDGAGNGTGNGNGNGNG
FT                   NRNRNERQSVIVKQKLSFEQIYCIKTTNTPNIYQRVSQVGEGTYGKVYKAQHKLTGEYV
FT                   AMKKLRLESEKEGFPITAIREIKLLQSFDHANVVGLLEMMVEYNQIYMVFDYLDHDLTG
FT                   LLTHPDLQLQECHRKFIFKQLMEGLNYLHKKRIIHRDIKGSNILLDNIGRLKIADFGLA
FT                   RTMKIVNANEKPDYTNRVITIWYRPPELLLGATDYGREVDVWGVGCLLIELYCKMAAFR
FT                   GMDEVSQLCRIFNIMGTPTLQNWPEIDRLPWFEMLKPKINVKSKFSQKYSESMSPQAFK
FT                   LAEQLLQLNPKLRPTAEEALNHEYFQQDPKPEPLYFLKDIQGEWHEFETKKRRRAERKR
FT                   IKEEEDAQLAASKKSAAVADASVASATNSVKEIESVDAITYSEKLANGDDNKKSSEIEI
FT                   DSKNIDNIGNNSEEQHNKTEEKSIDTKTT"
FT   CDS_pept        534819..535043
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574586"
FT                   /orf_name="CD36_82240"
FT                   /product="Uncharacterized protein YIL156W-B homologue,
FT                   putative"
FT                   /protein_id="CAX42752.1"
FT                   /db_xref="HOGENOM:HBG398360"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniParc:UPI000192D9C1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ6"
FT                   /transl_table=12
FT                   /translation="MFKMIGRLAHISFDLVLISGFLAGVKRTTGITPNLDTIENKDIQY
FT                   YATKYLNLGESVFDNTAAFLGNSQYFTRK"
FT   CDS_pept        complement(535464..537599)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078566"
FT                   /gene_name="GFA1"
FT                   /orf_name="CD36_82250"
FT                   /product="Glucosamine-6-phosphate synthase, putative "
FT                   /EC_number="2.6.1.16"
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42753.1"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="HOGENOM:HBG645312"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000192D9C2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ7"
FT                   /transl_table=12
FT                   /translation="MCGIFGYVNFLVDKSRGEIIDNLIEGLQRLEYRGYDSAGIAVDGK
FT                   LTKDANDEEYMDSIIVKTTGKVKVLKQKIIDDHIDRTAVFDNHVGIAHTRWATHGQPKT
FT                   ENCHPHRSDPKGEFIVVHNGIITNYAALRKYLLSKGHVFESETDTECIAKLFKHFYDLN
FT                   VKAGVFPDLNELTKQVLHELEGSYGLLVKSYHYPGEVCGTRKGSPLLVGVKTDKKLKVD
FT                   FVDVEFEAQHQHQQPQQPQINHNGATSAELGFIPVAPGEQNLRTSQSRAFLSEDDLPMP
FT                   VEFFLSSDPASVIQHTKKVLFLEDDDIAHIYDGELRIHRASTKSAGESTVRPIQTLEME
FT                   LNEIMKGPYKHFMQKEIFEQPDSTFNTMRGRIDFENCVVTLGGIKAWLSTIRRCRRIIM
FT                   IACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSI
FT                   LALQYCLDRGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFA
FT                   LSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGY
FT                   QFATALEGALKIKEISYMHSEGVLAGELKHGILALVDEDLPIIAFATRDSLFPKVMSAI
FT                   EQVTARDGRPIVICNEGDAIVANDKVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNR
FT                   GIDVDFPRNLAKSVTVE"
FT   CDS_pept        539423..540604
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574587"
FT                   /orf_name="CD36_82260"
FT                   /product="Uncharacterized protein ydr282c homologue,
FT                   putative"
FT                   /protein_id="CAX42754.1"
FT                   /db_xref="HOGENOM:HBG396597"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniParc:UPI000192D9C3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ8"
FT                   /transl_table=12
FT                   /translation="MLRVNTLSRCFKEMKFMRPLPFYRFHSSTTTSSSSSSSSPSLPIT
FT                   NIKRASKNIPKKKIGAQKLRRTDDSKFQHESASYILSLLNANRQETPSPKELEKYLSIV
FT                   TSVTVGDSIDFDKLLTQIKGYEYQIVISEEVINISTSTTNLMILSNGTLVGWNLTEEEI
FT                   VKFLPILQDCIENKFDAFESEEIDWIELKQQLPQDPLNQGTSYLHGEIMVIQGPTMEKR
FT                   LLDMAAFAIGLSRSTRLSILETQLEDYLQLTKKNSEILAMGKQITTTESEFLKLTGQLF
FT                   LLRGKLNLYSELIDTPDLYWSEPTLEKIYYSISKILDINSRISILNRKLDYATEEQRAF
FT                   LSVLNEKKGTRLEWIIIWLILIEVCFEIFHFYEKYEEKQNKKKKTKEVLYDNE"
FT   CDS_pept        541523..545314
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229971"
FT                   /orf_name="CD36_82280"
FT                   /product="Cell surface flocculin, putative "
FT                   /protein_id="CAX42755.1"
FT                   /db_xref="HOGENOM:HBG396598"
FT                   /db_xref="UniParc:UPI000192D9C4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDJ9"
FT                   /transl_table=12
FT                   /translation="MFTGYLLLVLWIITLVHGDGSNDDQYCDDTGCYPIVCDSDGCYVD
FT                   YVVTETKVKTYTPPPITSEIWVTVPATTITTCYNCGSDDVIVTENVTSTFVTTLPDSTE
FT                   FTTVVDTSTTQSTLTSCGHVCTKTSGNSSSKDILSSLTISQSVQESESKSNSKSLIIRT
FT                   KTETVQDTTTFPTVTESVTSTTTEFHTVIEYTDSRSDTTATTEYTFSQTKKTQTVIVTK
FT                   ATTTTVGSQTQIYTEIYYITTTETIITCPDHDFATTLTGTETFVPPTTAPRPIETPTPE
FT                   PSTTSDIPSITEDSTITSVETTSTTESSTLPSSIESQSSSSSATTSVLDTSITSESSCY
FT                   SSYIEQSTSTQESSSIVISSSSSIGSCISSSVSVSSLVADSTTSSESSFISASDSTLMS
FT                   SSEEEISSSFTKSGSSSGVLSSSLGESSTAEQLSSSIDATSSVEETTSSVVSTTSTSNE
FT                   STTIDISSTISETSSSSEEASYSSVSEKTSVSSSSIESSSSDQVSKLSSSLPVVPTSSL
FT                   NESSTDSSSVSTSSQITSSSETPSLSSDFISGSISVSSSIPSSSQATSSIDSTSLSVSS
FT                   ITSSHSIPPPTYISSSTSKFETQPTPIISSISPITTILSTSITSHDTNCEAIITNISTN
FT                   TIIETITVNGNITIYTETQLSTYLTSNTNINCPNTESDSIEQKKTTTTSTQVIPTATIE
FT                   QTYTTTSNGSIIVSTETSTLETTIIITHCPECTIKSSIISGYSSTLEAESSQVPIIESN
FT                   SMELSGSTSSSTISESLELTTFTSIVSTTSESIYTTTSNESIFEITTTVTNIDTIVITT
FT                   CPTIIPTSLHSQSYSTSESILSSSSLVVPPSLSISESSVSTDESVSTSNNQSSSFSTEP
FT                   PLSSITITETTSRTTESLYTTTSNDSTHIFTTTIIDVQTNTIITCPLSSSLSSSSSSST
FT                   KNVYTSDSEASTVSFSLIKSKDIATSTTTSTIFQSTSTVTVDHHCSSCSEMVSGSSSVA
FT                   ANESTSSVSSVETEVTSTNSTSSTSSTSSSSFYSSESKSKSSLNIISMESSSDSIVSIS
FT                   QSHVTPVSTSSLETTMAAISPTISSNNLSSSSLVVTSVDVPDYVSSSVGTSSSLYVKTS
FT                   SSGIVSTVTELFTVSENTSGITTIDNTSITSEKVKDITTTSDTNSSSTTTSILSTSAIT
FT                   TTNTISPSLESKISLSDTTTLTLTSTLTYSINSNNTMKTSSLTTIGLNSLSTINNSTFT
FT                   IIPTMNIPITFEGNANNLQLLNIDNTWIIGLMIGLFMI"
FT   CDS_pept        547397..548992
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229972"
FT                   /orf_name="CD36_82290"
FT                   /product="Ammonium transporter, putative "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42756.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI000192DA7D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK0"
FT                   /transl_table=12
FT                   /translation="MSAEEVIKYISRRKLFTENNEYNEGYILLFTIASSMIWIMVPGLA
FT                   FLYSGLARRKSALSMIWIVIMSSFVGIFQWYFWGYSLAFSDTSNNSFIGDLHFFGFKNL
FT                   LGASDDKTTYPDIAYSLFQLQFLLVTLAIIAGGCIAERGRFLPALVFMFCWATIVYCPV
FT                   VYWIWGGGWASSYKSGALDYAGGGPVEILSGMSAFVYSAFLGRRNETLMINYRPHNIST
FT                   IFLGTSLLYVGWLFFNGFSCGNPSLKVAYSMMNTHLCGAFGAISWCLLDFRLENKWSMV
FT                   AVCSGCISGLVAATPSSGMIPLWASVILGITAGIVCNLSTKIKYLLRVDDSLDVWAEHG
FT                   MAGVVGLIFNALFGSATVIGYDGITDHEGGWIDHNWKQLYIQIVYILATMAYSGVVTAI
FT                   LCFVINKIPGLHLRIDYNGEEAGVDEDQIGEFAYDYVEVRRDFLDWGIPTVNPTYQNSI
FT                   NDQQQQQQISEEAQQQKKAAGLAGIDETEENQFEGIKIKRETQIIDGSPHSNSDSTSNT
FT                   SIQEKHEPVEYRPN"
FT   CDS_pept        549816..551873
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574588"
FT                   /orf_name="CD36_82300"
FT                   /product="Acetolactate synthase, putative "
FT                   /function="acetolactate synthase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAX42757.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323037"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniParc:UPI000192DA7E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK1"
FT                   /transl_table=12
FT                   /translation="MISRNLRNSSTKTLYGCILRSQIRSISKNNSQQAAAQSTSRPQPS
FT                   PAFNTATNTSSSTQTINDPTTSKHRSPISRKKKEGQLMDDSFIGLTGGEIFHEMMLRHK
FT                   VDTVFGYAGGAILPVFDAIYNSDKFKFVLPRHEQGAGHMAEGYARASGKPGVVLVTSGP
FT                   GATNVITPMADALMDGVPLVVFSGQVPTTAIGTDAFQEADIVGISRSCTKWNVMVKNVA
FT                   ELPRRINEAFEIATTGRPGPVLVDLPKDVTASILRESIPINTTLPSNALSQITKKAVSE
FT                   FTSEAIKRAAQILNKAKKPIIYAGAGILNNEQGPKLLKELADKANIPVTTTLQGLGAFD
FT                   QRDPKSLDMLGMHGSAAANTAIQNADCIIALGARFDDRVTGNISKFAPEAKLAASEGRG
FT                   GILHFEISPKNINKVVEATEAIEGDVTTNLQSFIPLIDSIENRPEWFNKINQWKQKYPY
FT                   SYQLETPGSLIKPQTLIKEISDQSQTYNKEVIVTTGVGQHQMWAAQHFTWTQPRTMITS
FT                   GGLGTMGYGLPAAIGAQVAKPNAIVIDIDGDASFNMTLTELSSAVQAGAPIKVCVLNNE
FT                   EQGMVTQWQSLFYEHRYSHTHQSNPDFMKLAESMNVKGIRITNQEELKSGVKEFLDATE
FT                   PVLLEVIVEKKVPVLPMVPAGKALDDFILWDAEVEKQQNDLRKERTGGKY"
FT   CDS_pept        complement(552469..553389)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093852" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535611"
FT                   /orf_name="CD36_82310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42758.1"
FT                   /db_xref="HOGENOM:HBG396599"
FT                   /db_xref="UniParc:UPI000192DA7F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK2"
FT                   /transl_table=12
FT                   /translation="MQLPNSSTSSSPPPPPPPPTSTFNSKKRFSLGSFRRTKRPTQPNQ
FT                   QSNAITTSTANNSINKSFNIPSNDTDSSTIKHGRNNSGHRLSKLFIRDNNNNNNNNNTN
FT                   DEGFLDDSSTIITPTIKYFNNISPSSNSSFLNNNNNNNNNNTINSSDNRKFKTLSFTNK
FT                   SPLSKTFKRAYTKIFKKSQVINNNEEPNLVIKKTMLHDILPSDSEDEVDEEEEEEEKVK
FT                   EEVVVVVEEEENNHKDNTNKQKEEITNHINQICIHKSLIFHNFLPTNKSNHTANLTIEN
FT                   QYSEPITSSPIIILDYINDLNLKYQ"
FT   mobile_element  554386..554431
FT                   /mobile_element_type="LINE:3D, Zorro3-like"
FT                   /note="3' end"
FT   CDS_pept        554526..556529
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382836"
FT                   /orf_name="CD36_82320"
FT                   /product="Protein Kri1 homologue, putative "
FT                   /protein_id="CAX42759.1"
FT                   /db_xref="HOGENOM:HBG396601"
FT                   /db_xref="InterPro:IPR007851"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="UniParc:UPI000192DA80"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK3"
FT                   /transl_table=12
FT                   /translation="MARKKSAAKKAREAAAAAATATATATAAVESSTSGNSKSLTSNNE
FT                   HAKDIKIEKPSLQKLPQDKKTLSPSDDDKVSDFDAYSTSSSSSEEEDEFGDLITEDVET
FT                   GINQVLQTIKTNPSKLLDPNVKFFEDPESIEYNETTKKHKPLYISDYNRMQLLDQAKGK
FT                   QTNEQEEEEEGTGSFDDQKTIDGQKSFVTVQKEEKDQLLAEIKKAFDEDIEDDSDEEKK
FT                   EEKEQDDDFFRKKDEKQFKNEAEDKDNIIGGSNLPDPNQDQQGFLNAFLDSKAWIPKKG
FT                   DKIINLDKIDQTYEEEFDEAVEKFENAYNFRYEDPNGGSEIISYARNQATLRRSKTNSR
FT                   KRQREKRQELKRQEDEIIQDLLKKKKTAKINKVVDRLSKIKQAIGGDPNNNNNSVVDDE
FT                   TIERVFGDSLLNDDFDDADWDNKMAEIFNEQYYEAELEKPTWDDDDDEIMGGDINSDEE
FT                   QEQEQEEEEGEVASNSESESESEEPPNKKSKKDLLKAKKSIKKEKQSLKEKAQAIVEAN
FT                   TLKLMDEIEEERGRQRENDGHEKEIKFKYREVSPETFGLTTRDIILADDKQLNNFISIK
FT                   KFAPYRPKELRLKDKRKYTKKKHLQEWKKETFKNLKLPKEIEQSGAGGDNDNDDDNDIW
FT                   IPNEDVSNNYYKNDNKKQKKNKKKHDKSRKQR"
FT   CDS_pept        complement(556701..558464)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000135353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229973"
FT                   /orf_name="CD36_82330"
FT                   /product="Arylsulfatase, putative "
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAX42760.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="HOGENOM:HBG651618"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000192DA81"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK4"
FT                   /transl_table=12
FT                   /translation="MTITSSPKQPNFLIIVADDLGFTDLSPFGGEIHTPNLNKLATGPN
FT                   GIRLTDFHTASACSPTRSMLLSGTDNHIAGLGQMAEFAQRHPEKFNNQPGYEGYLNDKV
FT                   VALPEILQDNGYHTFISGKWHLGLKKPYWPNKRGFNKSFTLLPGAGNHYKYITRDEKGD
FT                   QIPFLPAIYVEDDKELLNPEIELPDDFYSTNYFTDKAIEFIKQSPIENKPFFGMITYTA
FT                   PHWPYQAPQDKISKYDGIYNNGPEELRRSRLKSAIKLGLIDEKIIPHPIKTIRKTWDEL
FT                   TLLEKSKEIKIMQTYAAMVEILDENIGRLINYLKSINQFNNTFILFMSDNGAEGMLMES
FT                   LPLTNQRINKFINQYYDNSLSNIGNKNSFTYYGDQWAQAATAPHAMYKMWSTEGAIVCP
FT                   LIIHYPNLTSSNSTSGNSGGGSGNGNGGGRILKEFTTVMDILPTILQLANIQHPGEIYK
FT                   NRKVVKPRGKSWVNYLINKTNQVHDENTVTGWELFGQQAIRKGSFKAIFIPKPFGPEKW
FT                   QLFNIIDDPGEINDLSDLSQYKKILNELLDHWAIYAAETGLIELGSDLFEKEKIDGELN
FT                   EIVYRTILDNN"
FT   CDS_pept        complement(559290..562331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574589"
FT                   /orf_name="CD36_82340"
FT                   /product="Magnesium transporter, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42761.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG396603"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000192DA82"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK5"
FT                   /transl_table=12
FT                   /translation="MSDSESYYQNSTTNQPILHSDEVLNDHRNQIINDCAISDGDDNDN
FT                   DNDNDEVELEVEVEKQQQQQEQQQEINPENVKPLTHKSGSSIKKKSHIIKENKDKDKEK
FT                   VKVKVPNPMGLSSYDDNIIGGSGGSGHYKNRNYNMSTLRKEFYLKDTNDDDDDDNNNNN
FT                   NSTNNTNTTHLQIPTPIITNSNKSRRKSQLDNLPPLIKKKTIGRNNSNNFENDLVSPMT
FT                   KMKTNDSEDITNPTTNPTTTGIKLGIGATTLGAGIAPGATGTGTATGIGTATATATGRR
FT                   PSRSSIDSEADSHASRSSQETEEDVCFPMVGDHIRVNGIDFDEIDEFIREEREEALLQK
FT                   QMIAKNISRIDEFQNLSNTTSGASRHPYHSNNNNNNNKKGNNNNYSGGGSGGSSIAALK
FT                   YTPKNILKKTLSRFEITHENSSSSDEIYELKNHHFHHQKSPKYDDNDDDDDQLSLTSSS
FT                   SSSSGQVKFGGARISDGINGGSLPDRFSLFHSESEETIHAPDIPSLVSSSSSSSSGQSI
FT                   SVRDLFRNGEETWWLDCTCPTDSEMKMLAKAFGIHPLTAEDIRMQETREKVELFKSYYF
FT                   VCFHTFEADKESEDYLEPINVYIVVFHDGILTFHFSPINHPANVRRRVRQLRDYVDVSA
FT                   DWLCYALIDEITDGFAPVIHGIEYEADAIEDAVFTARDTDFSSMLQRIGESRRKVMTLM
FT                   RLLSGKADVIKMFAKRCQEEANSGYYQRQYNNNNNNNHLHHQHQHQHQQTHHTLPTNII
FT                   TSPITSTLNLNNLTTSTSTGGGALGVNFGPNPNPNPNLNPVGGNNNNNNNTNSPSPPQQ
FT                   PKDFPLGTGKSLLIPDARPRADIALYLGDIQDHIITMFQNLLAYEKIFSRSHSNYLAQL
FT                   QVESFNSNNKITEMFSKITLIGTMLVPLNLVTGLFGMNVRVPGEGGNNLGWFFGIVGVL
FT                   IFIIIGSFIFAQWWLKKLNNSIEGQKKINRPIFNHSSRRSIRSLGLRKHGNARGGNGNG
FT                   NGNGGAGVGVGANKSIISFPNKYE"
FT   mobile_element  565296..565680
FT                   /mobile_element_type="retrotransposon:solo LTR, titi B"
FT   CDS_pept        565972..567672
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093853" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574590"
FT                   /orf_name="CD36_82350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42762.1"
FT                   /db_xref="HOGENOM:HBG396604"
FT                   /db_xref="UniParc:UPI000192DA83"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK6"
FT                   /transl_table=12
FT                   /translation="MATYAKRRNGGGGGTFKRARLSSSSNTTNNNNNNNNNNKFSTSIT
FT                   TRSIQQNNNNNNNNNNNNKNGRNQIINDFLDIYNFQQSDSKSIENININDQLNLFELFD
FT                   NNDKSTSTSTSKNVNVNGNDIINVNKKKMIPKSKSKSSSKPKSRSKSRSNNTLKSKIKQ
FT                   TSNINQTSNNNPCVCLCPCPWDELLNNLEESSIYLPKISLIDENENENEIENKSDNDND
FT                   LQGEHIISTNIINLPNLNFDNEPIEQDIGKKYHHQHQQQHQQQQQQLIQPSSSLSSSSS
FT                   TTNTATTNTTTNTISLKPNKTYAQDRSYLILDQSYIDIKQELGESISRQYDFDKDIIQE
FT                   EDDNNNNNNNNNNDNNIVSNRVINVHDFRIKSGFTTTTSNTTTTTTSNTTSNYNNNNNN
FT                   PILQDIIDGLLSNSFNLQLSSLLEILSKPILNLTLSLTLTLIDIIIEYVLPLIDSNNKL
FT                   IKWLSSKIIFDIIQMRNLSKEEQEQEQEQEQEEQEEEERLGYNFDGIDQNKLNDIEKNL
FT                   NLDLKNIEELKIMINQIPKIYRSKVNELLNKQQQQQQEKEEKEEDLEFK"
FT   mobile_element  complement(567853..568124)
FT                   /mobile_element_type="retrotransposon:phi J, Tcd26, LTR"
FT                   /note="most of internal region and part of one LTR
FT                   missing."
FT   CDS_pept        complement(568707..568886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382837"
FT                   /orf_name="CD36_82360"
FT                   /product="Cytochrome c oxidase subunit, putative "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42763.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG398812"
FT                   /db_xref="UniParc:UPI000192DA84"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK7"
FT                   /transl_table=12
FT                   /translation="MNPQRIIELQKHYQNTPKPLWLRGRQSAFLVYPFYALFAVSTAIP
FT                   LYYSVRAVAGIKDE"
FT   CDS_pept        join(complement(570902..570943),complement(569368..570729))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093854" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382838"
FT                   /orf_name="CD36_82370"
FT                   /product="RING finger protein, putative "
FT                   /function="translation elongation factor activity "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42764.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396605"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192DA85"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK8"
FT                   /transl_table=12
FT                   /translation="MTDDTQIIKMWESMDHSLTSYLLSKITTNLECSICSEIMIIPMTI
FT                   ECGHSFCYDCIYQWFSNKINCPTCRHDIENKPILNIHLKEICHKIIESITDNIIIIGDD
FT                   DNDNNHLMNRKLECLKTYNLDVKNKSIFGDLFNNTVTTLIDCSDGVARCGNCHWEAHGS
FT                   ICSHCGTRFRRSTRIINGESEEDEDDENEDDEDDAFEDVVAGFRQSVEINEYDSDDSFI
FT                   DSRTANEIPVGSDSDNDSEIITHTTDNNNNNNNRNNRVNGNVDDNDSNENENENENENV
FT                   SDYDVEYVQHENGDIFPVIRNRNSDSFGNNSAIHEDWHGFESATSSVIDRAFSDDDDGV
FT                   HDDDDDDDDDDDVSLEHSMNDSQDSIHLSSPEQENIIQLSGDDDDDDDSYYDSEDIRDA
FT                   LDEMDNFNVDATDYDNNEEEQEEEEEEDDVVELSDYNSYSDDMVSDVDDNNNNNNDDDD
FT                   VDDDVDGWW"
FT   CDS_pept        complement(571431..574013)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383085"
FT                   /orf_name="CD36_82380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42765.1"
FT                   /db_xref="HOGENOM:HBG396606"
FT                   /db_xref="UniParc:UPI000192DA86"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDK9"
FT                   /transl_table=12
FT                   /translation="MSNISSLMGKQVIKNTEQLFHTRIRQISNNTVRIYLSRLSPSSQI
FT                   KLCHYFSTDNSRVQQVYSPTCFDWISRRTDQEDSTTKISKSIPSKDNYQSLSFQQHQFI
FT                   EEMVELIKQGKSISDKMLHTTMMTNQLSPELITIIIDKSFENCPSMPQTSTGIEIPYFK
FT                   TANKIHYDIPYYNFINSRIPILYELIKSNEIEDKFNNSSILYPYRIWLYYHMNDIESMK
FT                   LLEKKINQEQLNEKTVLYYLSTFINRYEIIEFKKRFHKLIINTQFNLSNSLINSLTPQL
FT                   IGHDCLFEHLFFIYQLWMNSPKCQPPSIKTISLLLLEFYRFGTSHELKEFKRLIKKYQH
FT                   HHHHHHHHHQEYYNHYLIQTIDYQYEIINREYLSFTKNITKEDLQFIESIAPKDVHNNN
FT                   GDDENVIEFYHRWLYFMIRYSKSMDNINFIFKLYKRSVVTPESTKTINFFPPRFFKILL
FT                   DYYVKHDQFIPMLQLIEASKTSIAYDPSYLILIAKTFIYSYSRFAPQFIDRLNGWIGKS
FT                   SFQLKKSWSPFHPYRIYEPLNRIKYNEPQWEEFRYDRRSKGNRYNNNNNQDNESGLQLQ
FT                   QQQQQQQIEFRVNQGFQNLINRGIRPDINLLLETFKFTTNDLNYRLQIKSLMMETRQYN
FT                   HKNSKFMELISLNHPSLQQEDLLRYYITNNNNQLNDSHKFLFIKMLIDYQLYEEAQNLI
FT                   DSIDGNDTGTINNNNNNNNNNNNNNESNLLDKYKMLKLILQLKIYVLTDQFELIINSLN
FT                   KFAIHEKQIYLTPYLLDQTLLIENMLFKNLQSIQKQTTFIKNNSLNEYDQQVLLSEGKK
FT                   SLMKLRHFIGDVKLMLENDENEIMELIDKTIYILNQWKDNTTTTTTPH"
FT   CDS_pept        574888..577200
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535848"
FT                   /orf_name="CD36_82390"
FT                   /product="Clathrin associated protein complex large
FT                   subunit, putative"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAX42766.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG718694"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI000192DB2C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL0"
FT                   /transl_table=12
FT                   /translation="MSSSSYKQTINKNFNKVNSILERKLRKYLVGPKKGETFELKNGLV
FT                   SQYKHERKDAIQRVIQAMTVGKDVSSLFPDVLKNIATYDLEQKKLVYLYLMNYAKTNPE
FT                   LCILAVNTFVQDTEDPNPLIRALAIRTMGCIRVAKMVEYLEIPLQRTLADENPYVRKTA
FT                   AICVAKLFDLNPEMCVEFGFLDELKKLLSDPNPMVVANAINSLSEIRDMNTNENLEILA
FT                   FNREVINSLLLCLNECTEWGRITILNTLAEYDTNNAEEANHIMERVIPQLQHVNPSVVL
FT                   SSIKAILHHLNAIPVTAQRSNILKKLSAPLVSLVSTSIPEAQYVGLKNIRIILEKYPNV
FT                   LSKELRVFFIKYSDPLYLKLEKLEIMIRLASEQNSGLLLGELKEYAMEFEPALVTKAIK
FT                   SIGSVAIKLQESAVKAINLLHEIIDERGGELIINEAVVVLVNILRRYPGKNDLATLIIP
FT                   VISNHVNELNKTEALSGYIWLLGEYPKYFSGLYEKLKNLVDGFLEDDSVLQLNILSTIV
FT                   KINLELSSSNGGQYSNLLQKILELATKDCENADVRDKAYIYWRLLSSSSSEDQQKKILL
FT                   TKLPPIETTISSFSPSLLETLLDELSTLSSVYYKPAKTFIDPNAYSRVPVEKKNKTKIE
FT                   DLKNMAKEEIITNARNDNLLDFDDDEEEEGDALSGSNGDGNGNVGNLLDELNDLFSTPP
FT                   PPPSTSQSTQSQTTGGQTSTNDILSLFNTTIPHQSTQSSSTHGIENLSVSGNASTTTTN
FT                   KNKNNNNNVNNDLLDLF"
FT   CDS_pept        complement(577337..578284)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575576"
FT                   /orf_name="CD36_82400"
FT                   /product="RNA polymerase II mediator complex subunit,
FT                   putative"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX42767.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG396607"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="UniParc:UPI000192DB2D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL1"
FT                   /transl_table=12
FT                   /translation="MSIDNNNNNTTTTTNNEDLISSLYPPPPPYYKFFTKENLQKLSTW
FT                   QENNKASLPSEVKVEEVPNQENTDHNSISVEEDNSIPPGELRFLIPPKQPEGLQYRGYG
FT                   NIWLFEDKLPNLKDSQWEQLYNNNNNNNNNNNNNNTAAPTTTTNDTNININGNHDADTD
FT                   DSTGDENLTSETKIKELHKLMDSLLLNFLELIGILSIDPIKYEKKIHDINLILININHL
FT                   LNTYRPHQSRESLIMLLKNQIDYKFLEIDQINKKCHEIKSKIKNLINERIVTINDGDKN
FT                   DKRGESGGIDGDSDSIDEKEQLKQDIINRLLSSI"
FT   CDS_pept        join(578718..578751,578840..579165)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575577"
FT                   /orf_name="CD36_82410"
FT                   /product="RING-box protein Hrt1 homologue, putative (E3
FT                   ubiquitin-protein ligase complex scf subunit, putative)
FT                   (Ring finger containing subunit of skp1-cullin-f-box
FT                   ubiquitin protein ligases"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42768.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG381683"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192DB2E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL2"
FT                   /transl_table=12
FT                   /translation="MADEQDRMDVDEIEVKEPTPKPTSTSKPRFEVKKWTAVAFWSWDM
FT                   QIENCAICRNHLMEPCIECQPNSMNNNNNTSEECIPAWGVCNHAFHLHCIRRWLKTRNA
FT                   CPLDNTDWTYQKFGN"
FT   CDS_pept        join(complement(580331..580432),complement(579404..580270))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535849"
FT                   /orf_name="CD36_82420"
FT                   /product="Prephenate dehydratase, putative "
FT                   /EC_number="4.2.1.51"
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAX42769.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="HOGENOM:HBG693866"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniParc:UPI000192DB2F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL3"
FT                   /transl_table=12
FT                   /translation="MKISQSHFQIKQSKAQPMTLKVAFLGPEGTYTHQALIQQFGTTKN
FT                   INIYPQQSIGDCFQSLDEKKVDYAVVPFENSTNGQVVFTYDLLRDWFLQTSTPPKFRIM
FT                   AEQFVSIHHNLLTNAQKIEDIKTIYSHPQVWTQVNKFLTSLPQQITKIDVGSTSKAAEI
FT                   VSQNTKASDCAAISSYMSSELYKLPILKEGIEDNQSNTTRFLILGYDSPVSPPPPSCPD
FT                   DNDNDKKNTTIVSSIMFTLNHDDPGALCDVLVKFKEYGITLTSINSRPANLKPWQYVFF
FT                   VEMIGDIIHQEGLIEKIKESCLELVILGVFQRSWRYNNNDQ"
FT   CDS_pept        complement(581048..581623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575578"
FT                   /orf_name="CD36_82430"
FT                   /product="Ribosomal protein of the large subunit, putative "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42770.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG606796"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI000192DB30"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL4"
FT                   /transl_table=12
FT                   /translation="MKYIQTDQILDIPEGVTVDIKARVVKVTGPRGELTKNLKHIDVTF
FT                   NKINNRAIKITVHNGDRKHVAALRTVKSLIANLITGVTKGYKYKMRFVYAHFPINVNII
FT                   KKDGEDYVEIRNFLGEKRVREVKIHEGVTMEISTTQKDELIVSGNSLEAVSQNAADIQQ
FT                   ICRVRNKDIRKFLDGIYVSERGTIVEDI"
FT   CDS_pept        complement(582085..583182)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230212"
FT                   /orf_name="CD36_82440"
FT                   /product="Cytochrome c peroxidase, mitochondrial, putative "
FT                   /EC_number="1.11.1.5"
FT                   /function="cytochrome-c peroxidase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAX42771.1"
FT                   /db_xref="GO:0004130"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG597790"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="UniParc:UPI000192DB31"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL5"
FT                   /transl_table=12
FT                   /translation="MATFAPNISKITKTSAKFNYGRIAKTFLGVAGSAAIATYFYNNGN
FT                   PFNNNNNNNNNGNSKNVAKALFGVGTGANIKTAKVPEGKTANDYQKVYNDIATKISENL
FT                   EFDENSGYYGQLLRLAWHTSGTYDKSDNSGGSYGGTMIFAPEEFDPENAGLQVGREFLM
FT                   EFLVKYPWISRGDLWTLGGVAAVQESGGPKIEWRPGRVDDNTASKVPPNGRLPDASRDG
FT                   KYVKDLFARMGFNERETVALLGAHVLGRCHKHNSGYDGPWGPSFNQFTNVFYTTLLGDW
FT                   HIKKWNGKKQYEDDETGEFMMLPTDMALKEESYFLKYVKMYAEDQDLFFKDFAKAFSKL
FT                   ISNGIKYPADSKPILFKTLDEQDEE"
FT   CDS_pept        complement(584212..588114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535850"
FT                   /orf_name="CD36_82450"
FT                   /product="Nuclear protein Sth1/Nps1 homologue, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAX42772.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG720361"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192DB32"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL6"
FT                   /transl_table=12
FT                   /translation="MNGTAIANGNGSVGVTPASSQVQLQPDSANLITQSNGTVVPKNKD
FT                   ELNELLGKYYKLLFDSNKLKKEFEKSEDKSEGKFEDVNAQPKFDIESVLAQVNKEHEEY
FT                   IKDETEFMQELFSDDSRKTIKTEEFDNELFEKQVAGLLLLSKDYDLPEKFQKEFTTKSD
FT                   QTKKDDLVNEILEKLTELETDFETRAQSLGIKVPSPRTDKDPLHSSLGTIHAEKIISNK
FT                   ISQRLKELENLPANIGTFGNTDGIDKFKIQALIELKALRLLGKQKLLRHNILVHEAQQV
FT                   KYVDPNLKSLPLALSEKRSFNVRPKIEQRNPQLLAVQLEELKKLEAREAKRKQHIEKVE
FT                   LVVEKSTSRSEAKYIRDHYRSHYLVKQINNFHQTTEKEESKKLERTAKQRLQALRSNDE
FT                   EAYLKLLDKTKDHRITHLLKQTNQFLDSLTEKVRAQQEEASGSSMGTPRHGSPEVTTVD
FT                   NKSDDKAELREKTDYYEVAHRIKEKIEEQPTILVGGKLKEYQMKGLEWMVSLYNNHLNG
FT                   ILADEMGLGKTIQSISLVTYLIEKKHENKFLIIVPLSTITNWTLEFEKWAPSVKVIVYK
FT                   GSPQQRRSLQPDVRYGNFQVLLTTYEYVIRERPMLAKFHYSHMIIDEGHRMKNSQSKLS
FT                   QTLRTYYKTKNRLILTGTPLQNNLPELWALLNFVLPGIFNSVKSFDDWFNTPFANTGAQ
FT                   EKIELTEEESLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCNLSGLQYVLYQQ
FT                   MLKHNALFVGADVGGAKSGIKGLNNKIMQLRKICNHPFVFEEVESVLNSSRLTNDLIWR
FT                   VSGKFELLDRVLPKFKKSGHRVLMFFQMTQIMDIMEDFLRWRDMKYLRLDGSTKADERQ
FT                   DMLKVFNAPDSEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ
FT                   KNEVRILRLITNDSVEEVILERAHQKLDIDGKVIQAGKFDNKSTAEEQEAFLKRLLEAD
FT                   ANGADNEENDSLDDDELNEILARSEEEKMLFTAMDEERKSQQVPYKSRLIEKDELPSVF
FT                   TEDISHHFEKKEIELSKMRDKKRVRYDDGLSEEQWLKAMDDDNDTVEEAIKRKEARIAK
FT                   RKRNKAIREGLLEEDIKDDEVGEEDDEDFEVAAQPRKRQRRARTPLPHIDNDNDDIING
FT                   DNAVAELEEEEEDNDNNEPETDEFTSKCLSVIDEIMALTDETGSRNLCDVFIKFPSRKL
FT                   YPDYYSIIKKPVSITNVKKLLMQDRFASFEDFIAELKQMCDNAKTYNEEGSYIHTDAIV
FT                   IEKLLDEKLANHNQEV"
FT   CDS_pept        589227..589778
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535851"
FT                   /orf_name="CD36_82470"
FT                   /product="Presequence translocated-associated motor
FT                   subunit, mitochondria, putative"
FT                   /protein_id="CAX42773.1"
FT                   /db_xref="HOGENOM:HBG396609"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniParc:UPI000192DB33"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL7"
FT                   /transl_table=12
FT                   /translation="MFSLGVQSRLFTRRTLFSGFRFNSTTSTTSTQPRLTWVDYFQLKK
FT                   QNNRINTIAGVFTGLGGAFITLSYLGNIEIDVEKPIMGFDPLMVMGGAVVLGGLVGFLV
FT                   GPFIGSYVFRLTNRSQLKQFEIKNKEFLYRLRIKRPDPSSQSFSNPIPDYYGEKIYSLK
FT                   DYKQWLRDCNAFRRKSKEFL"
FT   CDS_pept        complement(590099..591289)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230213"
FT                   /gene_name="SAP8"
FT                   /orf_name="CD36_82480"
FT                   /product="Candidapepsin-8, putative "
FT                   /EC_number="3.4.23.24"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42774.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192DB34"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL8"
FT                   /transl_table=12
FT                   /translation="MVSIITFTKNVLVALAFALLAQGLAIPEDIDKRAEKVVSLDFTVT
FT                   RKPFNATAHGQNHQAHPAQKRGTVQTSLINEGPSYAATITVGSNKQQQTVIVDTGSSDL
FT                   WVIDSAAVCQVTYPGQSPTFCKQDGTYKPSSSTTSQNLGKAFSIQYEDGSSSQGTVYKD
FT                   TVGLGGASITNQQFADVTTTSIDQGILGIGLTGDETNPTYDNVPVTLKKQGIINKNAYS
FT                   LYLNSASASSGTIIFGGVDNAKYTGSLTALPITSSNELRVQLSTINIAGTTVSASTTPV
FT                   LDSGTTLTYFSQTIADKLAAAVGAKWSSYYQLYTSSCNLSGNIVFNFAKGVTISVPLSE
FT                   FVLQDGNSCYFGVSRDSATILGDNFLRRAYAVYDLDGNTISLAQVKYTTSSSISTL"
FT   tRNA            592786..592857
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        593297..593485
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575579"
FT                   /orf_name="CD36_82490"
FT                   /product="Protein Ysy6 homologue, putative "
FT                   /protein_id="CAX42775.1"
FT                   /db_xref="HOGENOM:HBG398765"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniParc:UPI000192DB35"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDL9"
FT                   /transl_table=12
FT                   /translation="MALQTPKQRAANAKFEKKNTNQWGKPKKENTKTEYPVSKSWLFVL
FT                   LFLVCGGAILELIRLIF"
FT   CDS_pept        complement(594036..595046)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575580"
FT                   /orf_name="CD36_82500"
FT                   /product="Oxidation resistance protein, putative "
FT                   /protein_id="CAX42776.1"
FT                   /db_xref="HOGENOM:HBG748961"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI000192DB36"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM0"
FT                   /transl_table=12
FT                   /translation="MSFLFRRSTEQPRVNDETDKEVKDEPEDNTKEVEEESSDLGNEKQ
FT                   KEQPKPVKRRGTFFGSLLGNDSKNSSSTSINSSVSSASSSSKLPPLGPLTLTGYKESTH
FT                   HRLLDPELANNIRNLIPARFQLFDNWELVYSLEQHGISLNTLYRNSNPEHQLRLLKRKR
FT                   VEKGFADSIVKNMVVGDTSRPRYSFEPKRSQSYVLVIKDNHKNKFGAYLSENLKPMEHR
FT                   RYYGNGECFLWKCEKYDPSKLDHAVDKKLTQDIRFKAFMYTGINDNIIYSNHDFIAIGS
FT                   SNGQNGLFIDKSLLSGVSYSCDTFGNEILNSSPQDAKFGSFKIKGLEVWRIGTLE"
FT   CDS_pept        complement(595309..595995)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078829"
FT                   /orf_name="CD36_82510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42777.1"
FT                   /db_xref="HOGENOM:HBG736198"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniParc:UPI000192DB37"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM1"
FT                   /transl_table=12
FT                   /translation="MAVKILVINPNSSEKVTKNLEKTITQPENVELFFYTGPPDSPKEI
FT                   TPTTSLQSEKAVLEDFKVNINDRLDYDGYLVCCYSDHPLVHTLGKLTQKPVMGIMQATL
FT                   LFALSQPTKSFILTSTSEWELVLDQSITDFVGANNFPTKKFEKTRGLNVNVTNLADEEQ
FT                   FDQIYKVTKSIFNEYQDVGCVLLGCAGMAGLDRKLGEKFPNVRFIDSVKIGIEQLTTLI
FT                   RLDRQP"
FT   CDS_pept        596202..597617
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230214"
FT                   /orf_name="CD36_82520"
FT                   /product="DNA damage checkpoint protein, putative "
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX42778.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG448661"
FT                   /db_xref="InterPro:IPR007268"
FT                   /db_xref="UniParc:UPI000192DB38"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM2"
FT                   /transl_table=12
FT                   /translation="MVFEAEIGVNKHKLMWSKSIASLSNIAEAITFTITKDSISLSATN
FT                   TSKTSYARIHFKKTFFNKFSVDFNNILPEGYDNGKERKEDPSYSFLINSRHMATLFKSL
FT                   DSGGMKYVSFRINWSRNAPINSRYKLLIEIHTKKLIVKKFQASYTPATKQNLQIASTYK
FT                   DTLSKQQEDNLHDKTRINHIMMDQVIPKQFLEMVPASAEDFKIDIKSERISLCGYTKQI
FT                   IKDRDYLKQPMAVTVTISLEELTDTNLLSLNSDQEPIRKQINFGMRDFKNFLNLANFFT
FT                   TPSSFSERFDEDYITTANNDYFHIFFRNPGDPILFDLQNHQHAEVQFIQITSEDKSELH
FT                   SKEIDANLIRKNLTIEAPIPQKIQNNNTTTTTTPSLTRPMINTVFGKPSKTRKREKDRF
FT                   SNKVQLSQGTMNDDFDDGVTYGLEPERERGNYAETDYSNSSGEESKEPPFKKHAPDQEL
FT                   GPTQLNNKPKSIF"
FT   CDS_pept        598202..600418
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383086"
FT                   /orf_name="CD36_82530"
FT                   /product="Putative zinc metalloproteinase, putative "
FT                   /EC_number="3.4.24.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42779.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396610"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR021917"
FT                   /db_xref="UniParc:UPI000192DB39"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM3"
FT                   /transl_table=12
FT                   /translation="MTILFNYQNDEIVSSPTVIVSGSTSTKLYRGVISFTSNQNKVFPP
FT                   QYFEVNNGNFKAIIHVSPGERNVFQVDISDNGFINNFGFAEYSNGRRPNVVDSGTLTLY
FT                   FNPLPQNKPIHLCLIRGRDSNNTYDMPGYKLQRGEVPTLENAIKKLKVAGRLMQAFTQD
FT                   EMRSAGFSNRSFQFVEETVHDQTIFGYKVNSPTPHQEIKIHVLTSPKTVAELRSPDLAQ
FT                   QNPNAKDSGGLFNHAIDLVKDTPEIFNQRNGTAVQCACMYLDSTWQNNLILTHAALGGG
FT                   TSEVKMAIFGSHGLHSYPQNFPLVTPSFLDATHLTTAEVANDCNECGTSWECLNICLGA
FT                   YLHEIGHSLGCPHQVDGVMLRDYVLLNRSFMTRENECLRTKSQGQIIAENGTWPKICHW
FT                   NRLDLIRFLYHDSFSLPIDNFGKIHSTTWSPDDSYQKDSALNVYPSPSNGSIVTLSSGI
FT                   FLIEVITDDLARYHIEFLPREYGGSGLRPNVLLDFNNLYNELRSRKNDAKDEFSVRILS
FT                   LGGDLNIDNFKEHCSEHSKEVIESDFGLNRGRINGFKSPLLGRTDDLRMEIVGFNIKTI
FT                   YKVRVYHGGALDGMKFYYKSASSSNGGAPKIPKRDYLSKIVHGKFDFSSQRHHDQSPQQ
FT                   LTNISSGEEDRTALVGNETDNYSDFNLNPNEYITFFNFRDGAWMDAVQFGTNQGRLSPF
FT                   FGKDDGGHLSRLDVPGDKFEIVGMYFYLNQWLRGLGIIYTTSKY"
FT   CDS_pept        complement(600407..601120)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575581"
FT                   /orf_name="CD36_82540"
FT                   /product="Uncharacterized protein ygl079w homologue,
FT                   putative"
FT                   /protein_id="CAX42780.1"
FT                   /db_xref="HOGENOM:HBG448677"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="UniParc:UPI000192DB3A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM4"
FT                   /transl_table=12
FT                   /translation="MQDLDTREEGSHTLPEDNTDEIYDADEEANIENDNEYENHPNEMT
FT                   VNSNNSTDSTLSDTEDDYMLSDDEELNRILSRETSNHGLPSSGSMVDHAKFFAEALSHA
FT                   LDSVDIDRSLVLQAQISGKLNNENQKIIEKKELLIEKLKNIQLMYGKNFGLLQDCKESR
FT                   VEKMKKDISFIENRITKLMYGSETKSSIPFFKNKSNMGVEQRFPIEFNQAKDKVLERQI
FT                   DDDDDDNNDATDLIF"
FT   CDS_pept        601312..604605
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575582"
FT                   /orf_name="CD36_82550"
FT                   /product="Delta adaptin-like subunit of the clathrin
FT                   associated protein complex (AP-3), putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAX42781.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG396611"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniParc:UPI000192DBD7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM5"
FT                   /transl_table=12
FT                   /translation="MSSFQLQNSEVLARLKPFGISFEKSLNDLIKGIRAHTKESPESLG
FT                   NFLDVAIQECRNELITTDLETKAMAILKLAYLEMYGFDMSWCNFQILEVMSSSKFQQKR
FT                   IGYLAAIQSFKNEQDLLILATNQFKKDLNSHNHVDIGLALSGVATIVTPSLAKDINDDV
FT                   LMKLNHSKPYIRKKAILAMYKIFLQYPESLRLNFNRVIEKLDDPEIAVVSATVNVICEI
FT                   SKKNPNIFINYLPKFFAILEDTKNNWLIIRILKLFQSLSIVEPRMKKKILPTIVDLMLR
FT                   TQASSLIYECINCIVSGQMLSPDSSKDKETAKLCIDQLRLFFSKNDSNLKFVGLIALFN
FT                   TLKIFPFLMNEMENISGFVLDCLYDRDLIIKRKALEISNYLVNEDNITEVVKIMLMQLV
FT                   PDNNIIDDNLKLEVTLKILQVASQNNYANIPNFRWYVAVLKDVINLTLLPVEGVTNSGL
FT                   IATHIANEISSKIGKEFKNLATKVPSIRSYLLQNVILGLVQDVRLLESSGLILRDLYWI
FT                   LGEYISELKVTDNDDDDDDDDSDSDSDNENAQMMVLDIDKKIEIFNTLINHEIDKKLGL
FT                   TTNVHFPVSAKLINLHFTSVVTVLIQALVKLYNGIATDYINNFATTNGQLPSIKFNELC
FT                   YHLYRLIGFLSNWENHPNYEVQERALSWLEFLKLILEAMTDNNVVDIEKLAEADLKMYK
FT                   DLPIARVEGPESESESDSDSEDEDEEDDEEEEEEEDDSDDDLDSDDDEYENLVSSDEES
FT                   NSKPSELISSIQQEEYNPFAESLESESKDPSESNEVEVDTQQQQQQQDNNGLKQLPMLL
FT                   THVLPSFFTAYTLNPVAKNAQRNVGVPEDLNLNTQINSPEFKLEQFEDDSSDSYDLYLS
FT                   EVDDMEPLIHLSSSDEPQEKRKERLERLKDDPYYLEDVVKTTKKKSKNKKIRSESISPE
FT                   IESENASISNTIGSETDTDINKKQKEKKNKNKKKKMNKLKKEKVLILDEETIVGESDIN
FT                   PIESTNKEKKKPIKKNTFKIDSSNLDNFDLVSNDSEIQIHNDKEYEIDLEALREKLKQT
FT                   NVEPKEKAKKKKKKTKKVPEEEGKSITESNGGESVKPKKVKKKKAVILE"
FT   CDS_pept        complement(604838..605719)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000026375" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575583"
FT                   /orf_name="CD36_82560"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.51"
FT                   /function="1-acylglycerol-3-phosphate O-acyltransferase
FT                   activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42782.1"
FT                   /db_xref="GO:0003841"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG736534"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniParc:UPI000192DBD8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM6"
FT                   /transl_table=12
FT                   /translation="MSTVSSFFSKLKFYLKSGLYGTLIAGCAIYGVLASILLRIVNKAE
FT                   YAQFAVAKACYYLCSLFLGLRINIKNEKYLHNLPAIVIANHQSALDIYVLGKIFQPGYT
FT                   VTSKKSLKYVPFLGWFMALSGTFFLDRSKSASAKKVLDGALTSLKNQGKALFIFPEGTR
FT                   SATEDLNMLPFKKGAFHLAKQAGIPIIPVVVSNTSTIFNSKRKIFNTGEINIEVLPPVS
FT                   TSNWETHEDVTNACNNIRDDMIKTLKKLGNSKIPGSKPREDFYPSESEDTSETDVEIIN
FT                   EQTPLKATAVSD"
FT   CDS_pept        complement(606596..607306)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535852"
FT                   /orf_name="CD36_82570"
FT                   /product="Probable chaperone protein Hsp31 homologue,
FT                   putative"
FT                   /EC_number="3.2.-.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX42783.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI000192DBD9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM7"
FT                   /transl_table=12
FT                   /translation="MVKVLLALTSYNEPFYSDGKKTGVFVVEALHPFEVFRKKGYEIQF
FT                   ASETGTYGWDDHSVVADFLNGEDKEIFDNVNSDFNIALKNLKKASDVNPNDYDIFFGSA
FT                   GHGTLFDYPKAKDLQKIATTVYDKGGVVSAVCHGPAIFENLNDPKTGEPLIKGKKITGF
FT                   TDVGEDILGVTDLMKKDNLLTIKQVAEKEGATYIEPEGPWANFTVTDGKIVTGVNPQSA
FT                   VKTAEDTITAFESK"
FT   CDS_pept        complement(609117..609470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575584"
FT                   /orf_name="CD36_82580"
FT                   /product="Uncharacterized protein ygl080w homologue,
FT                   putative"
FT                   /protein_id="CAX42784.1"
FT                   /db_xref="HOGENOM:HBG627499"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI000192DBDA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM8"
FT                   /transl_table=12
FT                   /translation="MSSFKKFTDFLFSKQSLKYVCTTHFWGPVSNFGIPIAAILDLKKD
FT                   PDLISGPMTGSLILYSLVFMRYSMAVTPKNYLLFGCHFVNELAQLGQGFRWVKHHYESD
FT                   LGSSSNGENTPKK"
FT   CDS_pept        complement(610319..615139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575585"
FT                   /orf_name="CD36_82590"
FT                   /product="Fungal zinc cluster transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42785.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398455"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DBDB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDM9"
FT                   /transl_table=12
FT                   /translation="MSTGLLPISCISCRKRKIKCNRIKPCDQCMKRHVQCEFPEKFRNI
FT                   KIQEDEFKSKPKLELEPGPGPEPEPELKPKPKPEPESEPEPEFEPENTMKLIYDHPRKP
FT                   SDNSSISTSGSGSGSGSGSGSLMSSVPRESTDSTDSMPTSAESATNSDFLEKCSVMRND
FT                   SIDRKSCSSSSITPITIDSLKSSTLSTTGLPTDTGTGTSTGTGNSLIINNNNNNNTSNR
FT                   EISDSDKYNLLKDDYDMMKAANTHLLNSNRLLTRQLEELQQSILNSSGHGGGGSSSSSN
FT                   NNNNITNAINNNYNNIINKTKDCDIGNGNRNESINSNGNFLPTLSRCGDKRGNTSDSYS
FT                   DESPPNKKEKIGVFGHSKSSFPKDSASKNQGIYSNNQFIEDSDSNSSQQKETSSSSIDS
FT                   GSNSSSSSSSSSGGEIGPTFSFQPLSEEQRELFHGRKIHRAKRNRGQGQGQGQRQGVLD
FT                   HQSSNQLSSNKYRLTNRQLKHNWEQDVDNYQDQETMKFNIQIQKSLKKKPLPILPSYLL
FT                   KYDDLDNNINNNSSGSSSSSSISNNNTDSTIYQDVNKLNFEVIIKLVKKFFENNLYYRT
FT                   FISSNHVFNFLNGYNNDNNTDDNDWENDDDLLLIYMILCLSIERLSPQDYVQLNLLPNG
FT                   SLNICTKYRKYLTRQVLYKNFEKLKINLIDESMITIQAYILCSEWLFLQQNYEECWKMM
FT                   FHACSISYSIGLHIMNQYQATTTTTITNNSSGSNEQNKSFKNVVDTTIGESNINNGKKN
FT                   TVKLEGDEMNDEEDLNAQQYRLWYALKYLTSIICSIFGRPNPISVQVGMNNNNGSSSNS
FT                   NSNSTLLDQTDWKLHILLKSESSELLRLSNLMLIENHSIDIPIEKMMLLKSKFDINIKI
FT                   LEDFYKFIEKKSKNNIKNDFIDNDDLKKQTKNKLNDKNDKNDKNDKNDKNDEYDEYDEY
FT                   DEYSLNTKELDILSDTIILHINSIKLIEPFVKKYEIQKNHHDNKFSIQQMNSIDKFLQL
FT                   LNIFIEKFLNVYIQRHLLEKEIIIVNNNNNNNNNNNSNDDDDDDDDFNDNNNKKKNKLN
FT                   QISFSSPPPPPTTTTKKTATTNAAANAAANAATNVAANVAANSAANYGPSKFGRKLKSY
FT                   YPFLNSMLGQGMILIFIFLHHKSKEFVLNDFKTTKLNNNFLQLIEKKLNNLLQFEFRLS
FT                   SKYITTSRMWSSNMIYLIDRVLNLIKMIYEKQQEEEQQQQQQEREKDQTQDQESEDQEG
FT                   EESDKQSFISMKSKSSSEEPSNSTSVQPPPPPPSSSSQPPPPQIPNIEEEFPITTSQGN
FT                   LLYLFNTNPFGDPSQFEYLNGFHLNDPNWLTCSDNISYYLDSLGEDGNKESINDFKQYE
FT                   STTETTNGNLDTSLDPTGTGTGNGTRDAAGMMRTNGSSSSNSVTNPSIATSSVSAPTAS
FT                   NTIDPTNTAPVTTAPATMTTNSSTIPLHPQPKSSSSSSTTTTTNSTIFNQGSGGDVFGL
FT                   NYYNNNNNGNWSSSESPKIQGQGQGQGQSITKIPLNSGTSTLVSLIPNQTKFPNQVSPI
FT                   PPILPPLSQPLSQPLSQPLSQPSQVQPQPSQPSQLLSQQVPNPSNNPNIGYFFPQQILP
FT                   NYNTPSYGNFNIQSMKSTQNDNDGSNQ"
FT   mobile_element  complement(618792..619133)
FT                   /mobile_element_type="retrotransposon:solo LTR, toroa G"
FT   mobile_element  complement(620614..623205)
FT                   /mobile_element_type="retrotransposon:ruru E, Tcd31, LTR"
FT                   /note="LTR, PBS + ORF fragments"
FT   CDS_pept        623586..624410
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575586"
FT                   /orf_name="CD36_82670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42786.1"
FT                   /db_xref="HOGENOM:HBG396614"
FT                   /db_xref="UniParc:UPI000192DBDC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN0"
FT                   /transl_table=12
FT                   /translation="MTKEPYFISNLTSIKPSNNRNYSIVSPDLPSITNTQLKYAPPLNI
FT                   TNDNEPTDTNVDIKARKRSIEPYYNKPIKIGVLPPAILNQFTYHFHDECAIIDDDDDDD
FT                   YEYEYYDDIDEELINYSGSVIAPGNMLDTVSDNYDHNHNQDDQCVLESTNDFKKSMTKI
FT                   KVPPLSVVNDDNSNLSIPNILKLEQYFKYNNEILKTKLLIKSNNPNILINERSRKLSDS
FT                   LLAPNLQQQQQQDLFVNDQYDYCQDNYYYYNGIKGNVRDDYSNNNESYSFLI"
FT   CDS_pept        624960..625769
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230215"
FT                   /orf_name="CD36_82680"
FT                   /product="Zinc finger-containing protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42787.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396615"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniParc:UPI000192DBDD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN1"
FT                   /transl_table=12
FT                   /translation="MDNSFIFDLPTHLPNEIPKEPELTSKIQNNVSVGNETNNQNHSTH
FT                   HNDDDDDDDDKEEENDEHEEKALPKAYTNETIYIQGTNISLQTEEDIAKWIEERKRNWP
FT                   TNKNIELKRQQQQQQKDNDNDNDIIKTDNINKRKNDNESSNTLTKKSKSINICRFYQLN
FT                   KKCKFGNKCKNLHEQQQQQHHQKQSINENPITSTYNELTHYRKFINGIPILIPKLYSNR
FT                   TENTLMNKSSLFKHLVSKDHMTNENEKVIEFIKWLNDHGLINHDVMK"
FT   CDS_pept        complement(625868..627655)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575587"
FT                   /orf_name="CD36_82690"
FT                   /product="Potential delta(6)-or delta(8)-desaturase,
FT                   putative"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with oxidation of a pair of donors resulting in the
FT                   reduction of molecular oxygen to two molecules of water "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42788.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016717"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325617"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniParc:UPI000192DBDE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN2"
FT                   /transl_table=12
FT                   /translation="MDVKTPRSKKIFNRSQIIDLIADGKVIVIYKNNVLNLTSWIKKHP
FT                   GGDKAAYHMIGKDATDEMHAYHCDETVDTFKRFKIGEIEGSRWENLLPPIQGGIYLKGG
FT                   HHHENRHNNNNKETLDNKLDNDNSNSNSNSNSTSDLECLTTTNSCDSIDNNSISEIDIA
FT                   NYKGVGFIPSVKPVVPQNQLVTKTNMEKFFPIINEEMKKKVIRNPKILLTNYDNKLSQE
FT                   DVMSLPSLDYDSQRILRDKYNELHQTIIDYGLYKCNYWDYFREIMKIGSLFLYSLIFLK
FT                   LNQLILSAIFIGMAWHQGTFIAHDAGHIGITHNYQIDNIFGMIIADWFGGLSLGWWKRN
FT                   HNVHHLITNDPIHDPDIQHLPFFAVSVRLFQNIYSTYYDKILPFDKFSQILIPLQKYLY
FT                   YPILCFGRFNLYRLSWTHVIYGQGPRHGKAAWFRYFEFFGLCFFFYWFFYLLVFKSIEG
FT                   NWNKFNYIMISHITTMLVHVQITLSHFPMSTADLGVSESFPSRQVRTTMDVDCPEWLDF
FT                   LHGGLQFQAIHHLFPRLPRHNLRKAQPFVIKFCEEVGLSYSIYGFGEGNEIVISRLADI
FT                   GKQCSIFLDATRHYEGDLY"
FT   CDS_pept        complement(628206..629993)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078830"
FT                   /orf_name="CD36_82700"
FT                   /product="Dolichol kinase, putative "
FT                   /EC_number="2.7.1.108"
FT                   /function="dolichol kinase activity"
FT                   /protein_id="CAX42789.1"
FT                   /db_xref="GO:0004168"
FT                   /db_xref="HOGENOM:HBG396616"
FT                   /db_xref="UniParc:UPI000192DBDF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN3"
FT                   /transl_table=12
FT                   /translation="MAGGRKRKNEVKKPNPIARSTAAIFQDINNLDELEPNPQPKTEIE
FT                   INQESNDEPTGNPEDDIANASFPFNYLYRVQDHLNENMSVVHGVQCLVCLFFIQMVYLD
FT                   RVKIINYSKDEHLPMQIIAVIFFNWVGVFLCTVLGIVKNKNKNKNEGNKMITDFNYIYS
FT                   LLLPALLNILHFNKDWLLVNLSLNYFIIDSMNPIFNLFSCLGFYEVYKDEETTLISTFQ
FT                   FGQYATIFLVFQYILNYINTEEIDDEDNNIIKSRITLKKSEIHLIILLLINILFNPAFT
FT                   NGDVLPMKIFQKLIISFIISSFFTFPIVSFTPGILIILIFGGIFYGFTIFQLTPILNDN
FT                   ALNWLYNYVIKDETRIYILSIWVIMSMTIIPIVFYFANYLKLNTRRKIWHGLMVIALCF
FT                   TSEILFDQIEFTLISLLGTLIVFMVVESVRYNRISYIGEFLHKTLTVFQDAKDLQGPLN
FT                   LSYIYLLVGVTIPIVYDYLINKDTVTIIRYSGLITLGIGDTFASVIGKRFGTFKWKGSN
FT                   KSIQGTIAFIVSVFLCIYGVDYYLTHNNTNYHPIKNWENAFVTILLAGFLEGTCDINDN
FT                   YLIPIFFPISYQLLNKSYK"
FT   CDS_pept        630609..634307
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575588"
FT                   /orf_name="CD36_82710"
FT                   /product="Subunit of the multiprotein Cohesin complex
FT                   required for sister chromatid cohesion in mitotic cells,
FT                   putative"
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAX42790.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG526359"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI000192DBE0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN4"
FT                   /transl_table=12
FT                   /translation="MYIKKIIIQGFKTYKNTTTIDLLSPHCNVVVGRNGSGKSNFFAAI
FT                   RFVLSDAYTHMSREERQGLIHEGSGTVMSAYVEIIFDNADGRFPINKPEISIRRTIGLK
FT                   KDDYSLDGKSATRSDIMNLLESAGFSRSNPYYIVPQGRITSLTNSKNHERLNLLKEVSG
FT                   ANVFENKLKESMKEMNQSNLKRTRIDETLVSIEERLKDLQIESSDLKNFQKLDKLKKIL
FT                   EFNIFDREYNELNESLEELEEKHQSILQESKQDLIELEKREKLCVELQDSINELKISAK
FT                   VLKLEKEQSDLDCDQLLKIIAEKEIKLRELSLNNELSKEQYIHINEQIDNLQLEIHQHK
FT                   QEISHYKPELNKLQQEESNLKQQLLEISSKQRALYSKQNRFSKFINKKDRDSWLNNEIA
FT                   KLKRQIIDKDQEMRHISNEVKTRESSLEELSESIKKLNDSLNDEEHIKTLANLKTTIND
FT                   SKQQITQLVDQRKVLWRDEIRLKSVHDSLTNDLTNATNVVNQTMDRAQAQGIAAVKQIA
FT                   QRLNLSDRVYGTVAELFNVNDKYKTAAEVIAGNSLFHIVVDTDVTAATIMEELIRNKSG
FT                   RVTFVPLNRIDNIEIEYPDSHENQCLPLIKKLKYNEQVYKAIKHIFGKTLVVSELSKGG
FT                   ELSRKYKLSCITLDGDRVDTRGVLSGGYRDYKNSRIDALKIQARKKQELEKTNRELIKV
FT                   TEEIESINSRLNKLNNELQLNVRDLDRLSVSKEPIKIELSQLNNKKFNLDQEISSLKSN
FT                   LHNLQNTKNSIKVNLKQYELELNSEFTQVLTEKEQNELDELSKLAIELESKLDNIVTRS
FT                   SELDTKISGIESEVINNLQPKLNKYRQQQQQQQKQQQQHEQKNFNSKTTNLEYEELQQE
FT                   LESLHIQLDTSQSRNLQIVENLTKINEEINNCEQELIRANNQQIKIIKNIEKFSKQTNN
FT                   LLNQKSIKLQMKDDANQKIRQLGVLPEEAFQSNKYDQYNSNQLLYKLNDINQELTKYSH
FT                   INKKAIEQFNLFNKQKEDLLIRRIDLNNSKSSIENLIINLQQQKNNAIKKSFNQVAKSF
FT                   KQIFEKLVPRGTGNLIMQKKNDNPDSDNNSDDDIDNYSGVAISVSFNSKNDEQQRIEQL
FT                   SGGQKSLCAIALIFAIQNCDPAPFYLFDEIDSNLDTQYRISVAKLIYQLSRNNTNNNDN
FT                   EGRNQGAQFICTTFRPELLQLSGDKFYGVTFSNKVSSVNEINKEEAMSFVEGQQQQQQQ
FT                   LQQQQQV"
FT   CDS_pept        join(635932..635934,636556..636765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575589"
FT                   /orf_name="CD36_82720"
FT                   /product="Uncharacterized protein ydr210w homologue,
FT                   putative"
FT                   /protein_id="CAX42791.1"
FT                   /db_xref="UniParc:UPI000192DC8A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN5"
FT                   /transl_table=12
FT                   /translation="MSYYQQGPPPPQGGYYHQGPPPQQYYQQPQPMYVQQQPQKSGGGC
FT                   CSAFCGTCCAILCCCCAEDCAEAMC"
FT   CDS_pept        638036..639358
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575590"
FT                   /orf_name="CD36_82730"
FT                   /product="Cyclin, putative"
FT                   /protein_id="CAX42792.1"
FT                   /db_xref="HOGENOM:HBG448705"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI000192DC8B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN6"
FT                   /transl_table=12
FT                   /translation="MITTTETTSQIADVNEIPTLKPPRETFVDEPKSLEDVNLEELIYD
FT                   LQNGSKNVNNLHLYHSIFILSKTLQFIIKLQEHPDLYNEFRSQQLNRLGINENDLIGKI
FT                   NENNKSSTLIHPQPLHITKDSEFTNEMSNIRSNTPSLSPPPLKMAKFHKNSIINDNKYY
FT                   DELETSIEARIVDDVEAELDNSIRSPNASSTVNIPSPSNEFESIIDENIDDIKYFSDNN
FT                   NNNNNNNNNNDDDEPPPYIPIEQLINSTTITDQTLNDEQINEIYINKLKLEISQKAEVG
FT                   SNSESQLESLKIFNLLKTPNISIDQFLNRIKTYSSNISIISYLNTTFLLFKLSIYLNKI
FT                   ILNLNNSFRFLIGSLRCSIKIFEDIFQHQSKFNNVVGINNLFDLLKIELKFVYLINFNF
FT                   NSNFNCFIIDQFLKLEFIQLCLFIKSNLPDDYNKIVNKIQS"
FT   tRNA            complement(639542..639629)
FT   tRNA            complement(639640..639712)
FT                   /gene_name="tRNA-Arg (TCT)"
FT   CDS_pept        641500..643005
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074571" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383087"
FT                   /orf_name="CD36_82740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX42793.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG396617"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000192DC8C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN7"
FT                   /transl_table=12
FT                   /translation="MITTRIRPIMNNTSTHTNTKTSTTRLTKMSATTSTIKQSSMSGSS
FT                   KHAILIPSNLNSLLHADKQIKYHFYSLGGDFIRLASYRRFKQLFQVGGGSLVKQFVFDL
FT                   STFLKEELNDTNSLRHHQLKNFLTCNKTILEKEKSMILCDHHFGLKNWLYIIFGYMLQN
FT                   YNEQEINNCLDQLVSMYLEARSNRFSINDIRIIRDEKDQFILSTFEQYLIDVPVRNDLL
FT                   YNDNDNNDGVNYIILNNIKNHKRSNKNDTISTNNNNTNRINLPKLPKIKDKSLLVKSLM
FT                   HKEFYRILLDPNHYFGKEMLNRNYSLDPQDYSLIRKELSILDGLGDLFLAQETSKLIYE
FT                   LICQKNHINIYSSTTYQLLKIMLATNTLMAKLTKAYNLYQGLNDPIINKRVAKEWLPFT
FT                   ILGETPTTTTTNSASSSDDDDWQTNDEIRIYEEEFLGDFFESYMAALLIEQPDVAKSFI
FT                   REIYHRILMVITETLPPDITYQTWTSNILGRNIYRKKSESIQC"
FT   CDS_pept        complement(643264..646626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575591"
FT                   /orf_name="CD36_82750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42794.1"
FT                   /db_xref="HOGENOM:HBG396618"
FT                   /db_xref="InterPro:IPR018844"
FT                   /db_xref="UniParc:UPI000192DC8D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN8"
FT                   /transl_table=12
FT                   /translation="MVKLKLKALLIPKEFEQIDASNIDPRKYVKFLYIVDSTANLESLE
FT                   EKLVTRFSKRYPRERKLRVLAFQNKDLCDLDPDFAVEDVFSESNDELRVLVDNKFRSIT
FT                   YTPDPAISTPINFSQAETIRGGVYSAVEKSDDNTTPKKPKKSPLSSPVSLAPPPPPPET
FT                   KSNRKVPQKKNAVSSSKQRITSGMLEAPPVTPMNNSDEVYFDRLESPIKKPQKAEKTDS
FT                   FIVSSSQDEISSSEEYNESEESDTETVDYEPEGEEEIQPSELLSMFEELDSQENNDLPS
FT                   SRSSNSKSLSINKELQIDMVEGNPAMYLSRGKRRAAREANLVFTASKKAAKAPFSTTKP
FT                   ASTSKITSKPGKVQKPTISTHTKNTLPVVNTNAQSKSVSTPTQNIGIEKKIPVSTSSKP
FT                   INIAGGKSETKTAPTIPQSSNKASSKQPNNPFVSKSTLEDLYDRMKVFGEKVKTLMVNS
FT                   EDGKIIGYEKIPSDFGDGIKVAYDISSEAIDTTLRLTRQKNNQDTSIVEAGEIVLDSEI
FT                   LSSNSGPSLHLVETALPTTSEREVESKANDDKLANNSSDDIVIKPPVKNKVTNSTKAVS
FT                   KDLDSDNDFQEIPSTTAIPNVDSTKPIAKESDSYNDNDDIDIDIKTTGAVFVPVKTNTE
FT                   ASAPLATIVDSSEEERENNKIGIDSVGISRESLNTLATIINNSKKGNGHVLHNSSNSNK
FT                   NSPDIAPSTFAGDYGNEISGNNTPNRLNYNDNEMYIPKSFAANFRANERNSQMLGSLQI
FT                   IHKDDPIDKTPTKNDEPASDHHMLQYMYVGDSGVEDMNTVGRGIDDKLRSYNKSSGPSS
FT                   PFGKTDTSSSFLFAGSNTSANTSIPKPAFGAGDLFAGKTNNGNGTNNNNNNNNNKNVYR
FT                   TGNNHDNSLDSMGGTNTNHTTGSVWNNRNGTGVTSGSVHEKNSSIPSAQQQVKNNINST
FT                   SRATLQKLSSLQNLVNQNKRTRPESESEESDDGDDEDDEDQDEPNRVRKKSKLIASTPI
FT                   PKPTMTPLSGNGNKSRFNLTPWSSKAKPVIPKPIPAPNPNPNPNPNPNPTNDNDNNNND
FT                   DVRNANPSGGVHVINQMKNKLLSSLTDLANKGLPDVKDTKTVTKKPLTIFGDSSDSEGN
FT                   DDDDSDSDSSDSD"
FT   CDS_pept        complement(646965..648338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383088"
FT                   /orf_name="CD36_82760"
FT                   /product="Radiation sensitive protein 28 homologue,
FT                   putative"
FT                   /protein_id="CAX42795.1"
FT                   /db_xref="HOGENOM:HBG396619"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192DC8E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDN9"
FT                   /transl_table=12
FT                   /translation="MVYFSVLLLLSFMETLLLDRSLGRVTPSRFSNIITENLYSEIYQL
FT                   GKHNVFPTNCHDNAAVNSLSLETTDYQYLLSGSNDSSIKLWDLKQQEIVREENEIDANL
FT                   HLHPSTFDNFDYDNPVSTYTNLATIPKRHHHKFGISCIQWWPYDTGMFASSSFDHTVKI
FT                   WDTNELMPVHTFDLSNKVYDIDICAENALIATANDQPFIRLLDLNTTSSAHTLSGHKGK
FT                   TLVVKWHPINSNLLASGGYDGEVKIWDIRRSQSCLTQLDMSRTNDSSYTTKLSKAHSGP
FT                   VNGLVWDPSGSILYSAGNDDKIRVWDMVNVSTPPPINKLINFGPLIRNKHPHTIPLLLN
FT                   PQGETEPQFLLFPSESGDVFIFRTIDGKLENRLARKGSKNTGRTVSMCNGGPSTAKYFC
FT                   GTIDGEIISWGPCLDKPDLSDLQQQDESDDNDNDINEKLLKQFQLDSRRKQFLESIEN"
FT   CDS_pept        648591..649979
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383089"
FT                   /gene_name="SES1"
FT                   /orf_name="CD36_82770"
FT                   /product="Cytosolic seryl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.11"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42796.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI000192DC8F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP0"
FT                   /transl_table=12
FT                   /translation="MLDINAFLVEKGGDPEIIKASQKKRGDSVELVDEIINEYKEWVKL
FT                   RFDLDEHNKKLNSVQKEIGKRFKAKEDAKDLIAEKEKLSNEKKEIIEKEAEADKNLRAK
FT                   VNQVGNIVHESVVDSQDEENNELVRTWTPENYKKPEQIAAATGAPAKLSHHEVLLRLDG
FT                   YDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLSKKGYVPLQAPVMMNKEVMAKTA
FT                   QLSQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRRE
FT                   AGSHGKDAWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIV
FT                   SGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQEKKYVH
FT                   CLNSTLSATERTICCILENYQKEDGLVIPEVLRKYIPGEPEFIPYIKELPKNTTSVKKA
FT                   KGKN"
FT   CDS_pept        650434..650736
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383090"
FT                   /orf_name="CD36_82780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42797.1"
FT                   /db_xref="HOGENOM:HBG396620"
FT                   /db_xref="UniParc:UPI000192DC90"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP1"
FT                   /transl_table=12
FT                   /translation="MESPNANNSGSPPEYISQPPPKYVSRPSSSSSSVSDQESDIHNPP
FT                   QKASNNQLSTCCSDCWCNCFNSCSGTNCTASDKNICGSILVVLCCGTSVGYATNG"
FT   CDS_pept        651404..652180
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17575592"
FT                   /orf_name="CD36_82790"
FT                   /product="NADP(+)-dependent dehydrogenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42798.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192DC91"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP2"
FT                   /transl_table=12
FT                   /translation="MSSITLTSETQIKGKTAIITGGTRHLGGETARELAKLGANLFLHY
FT                   RSDANQAENFKQELTKEFPDLKIEIYGSKLDKAEDLTKLFTTAKSKFPQGIDIAINNVG
FT                   KVLKKPIIEVSEEEFDEMDIANNKSAFFFIKEAGINLNDNGKIVSVVTSLLAAYTDSYG
FT                   LYQGTKSGVEYYSKAASKELHGRGISVNCCAPGPMDTPFLYGQETKESVAFFKTMGLHN
FT                   RLTKVSDIVPIVRFLVTEGGWMTGQTLYASGGFTAH"
FT   CDS_pept        complement(652344..654500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230216"
FT                   /orf_name="CD36_82800"
FT                   /product="Long-chain-fatty-acyl-CoA ligase, putative "
FT                   /EC_number="6.2.1.3"
FT                   /function="long-chain fatty acid-CoA ligase activity "
FT                   /protein_id="CAX42799.1"
FT                   /db_xref="GO:0004467"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI000192DC92"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP3"
FT                   /transl_table=12
FT                   /translation="MVSLFKEDPKHISKTINAHLPVDPRSLAKSVPLPNTEEPGFSPIY
FT                   RNAFSPDELLNMPYPGLDTLYKLFEYAVDVHGPKPALGSRVKNPDGTFGDYVFQDYNTV
FT                   RIRRNNLGSGIFFILQNNPYKTDSEAHKKLKYDPNSEKSFILTIFSHNRPEWALCDLAS
FT                   VAYSITNTALYDTLGPDTSKYILNLTESPIVICSKDKIRGLIDMKNKYPEELSNLITLV
FT                   SMDDLTTEDSVLKNYGHENNITVFDIKQVEKLGEINQLDPIPPTPETEFTITFTSGTTG
FT                   ANPKGVVLTHKNGAAGVTFLYCNFMGKENVRFYSFLPLAHIYERANIQFALSLGSAIGF
FT                   PQGPSPLTLLEDVKALKPDLLALVPRVYTKLEAAIRAQTINNTEKPWLQSIFSTAINAK
FT                   MEAHAKKENEHTNPRFLVYDRILGLLKKKIGFDNVITMTTGSAPIAPETIKFLKAAVNV
FT                   GFAQGYGLSESFAGVMASSKYETESSSCGAISVTTEMKIRDIPEMGYSAHDKEGARGEL
FT                   LLRGPQIFKEYYKNPEETAKAVDEDGWFYTGDVACVDSEGKVKIIDRVKNFFKLAQGEY
FT                   VSPEKIESLYLSQFPYIAQLFVHGDSLQTFLVGVVGLDPTTIGTYIKNRFKDEIVNEAD
FT                   IIEFFKSPRNRKVLLDDMNKSIGKHLQGFEKLHNIDISFEPLTVEKNVITPTMKIRRPI
FT                   AANYFKQEIENMYNEGSLIRNNNL"
FT   CDS_pept        complement(657178..658179)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093859" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078831"
FT                   /orf_name="CD36_82810"
FT                   /product="Sterol biosynthesis regulatory protein, putative "
FT                   /protein_id="CAX42800.1"
FT                   /db_xref="HOGENOM:HBG396622"
FT                   /db_xref="UniParc:UPI000192DC93"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP4"
FT                   /transl_table=12
FT                   /translation="MAELRKIALSNSNLKNMAPSSSSSTPGSSGTSSPQGNGMAKTDSL
FT                   VNLTQPELYGIYRNDSDTSLSKEFEEDSAEIEFKVNSRLNKPTTTATSSSSEAKHFKNE
FT                   ELDKYLPLPLKIVVLTLASFIYNEVTSQISFNHTQSNYPLTIKHLFKISSYIHLDDYLA
FT                   FVGQSKYGHLIDETFALVIQGLVMASFHPILDYYLPKSLSKRLLSSNPNPSSSTSYSTL
FT                   INDLIRSSVAFLGVSYAIRNIEWSSFLQVAIIYSLVSPGLWLLLDGTISGLIGSLVVSI
FT                   GACSVIYYQNYQYLNGVGDVSSVELVAIWLWIGSFVFGGLIVFGKLGRFLFQ"
FT   CDS_pept        659294..662473
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575593"
FT                   /orf_name="CD36_82820"
FT                   /product="Subunit of the RNA polymerase III transcription
FT                   initiation factor complex (TFIIIC), putative "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX42801.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG396623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192DC94"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP5"
FT                   /transl_table=12
FT                   /translation="MKEENKGGRLRRSTRQQLKQQQHEQLVQQQQRAEEEEQQQQQQQQ
FT                   QQLQLKQKKMKQSKQKELDRNQHDTTQQETPEYHDMKEEDFERLMEEMQIDKNDDDSDG
FT                   SSEEYIFSDESEDYDDYDNINNNNDNNNMGGSILSDESEEDDYDEDYNFKDALKGASNF
FT                   RVRNRREKISIKSKSYYKRKMMRADNRELDPEVRSNLSQANEAFVRKDLQVAQQLYLEV
FT                   IKKDPKNFSAYKALGEISKAQEQLNECCNYWLLAANIHPWDTEFWGQVAQLSAELGHID
FT                   QAVYCYGRAITPDITKSCEFILQRAILYQERKQFGKALDGFQKVRQLYPKDSNIIKYLA
FT                   AVYSEQKRLNDAINLYMKVLDSNIHPERESSELYPKFDWAELNILLELHLQNHSWRMGL
FT                   NVLKLASRWIQNRSQETWWDENEDLEFDSRQRFEVISALSSQDQIDLAENKPFDLPIDI
FT                   RFKLGCLRLELQQKDVAVQHFNYLLEEQDVADLHFEAGKLLEEHGHYEDALKFLSRAME
FT                   DAEFTTSLELVQLLAKCYFEVGDYHESKQAYEALLQHDPDNLDLKLSLAENLYYLGDSV
FT                   GAQHLIRQVRQSKPKVPRKNGGTTEEEVEEDEDLNLDTSQSGNIRSLIPNEFKIHGKRK
FT                   LTEQEKEEIENNAKRKVLEKFGRMERLQESIDFGDRIAIGAWLQLASQLIEIFTNVKSF
FT                   FPRDKNRTFNGIVRYRRRKDMGLDEKLARAYNLLEGIVQDENYTRHTLTNKTEYRGLSY
FT                   DQWFDIFAQYAVLISRYENKIDYADEIVDIALAVNVFIQDKRKETILRALKLAFGVRRN
FT                   RVVDSLFVYLRHFLNLNQFSPFIYKLFMCCYGSGIEYWEQFASYNHQKYFLRQLKSYDS
FT                   CYTGKNVSGMAHITTDLSGFELGPHHLDLIYVYGNLLGGNKSYVSSLFYLNRAYKQYNQ
FT                   DPMLCLILGLGHLHRSMQRLSSNRHIQLLQGISYILEYKKLRQLNATIYELQEIEYNLG
FT                   RLFHTLGLFTLAVRHYEKVLTMKDEIANSSNDNYDYDMSWEAAYNLSLIYNIDGNPKLA
FT                   KEIIDKYLTIM"
FT   CDS_pept        662701..663276
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575594"
FT                   /orf_name="CD36_82830"
FT                   /product="Ribonucleases P/MRP subunit, putative "
FT                   /EC_number="3.1.26.5"
FT                   /function="ribonuclease P activity"
FT                   /biological_process="tRNA 5'-leader removal"
FT                   /protein_id="CAX42802.1"
FT                   /db_xref="GO:0001682"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="HOGENOM:HBG396624"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="UniParc:UPI000192DC95"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP6"
FT                   /transl_table=12
FT                   /translation="MVRIKHRYILFEILYPPTADPRITPRDDFTQFSQSESNALLTLHQ
FT                   LSPNVINVKSILNAIRKSLSDYYGDVGAGKAGMLLNVKYFSNRTSTGILRCGRDQSDYI
FT                   IGAMSLIEKLENNYVIIRCLHVSGTIKKCEEYSIERTKQLINVIKNKSKGKVDEYVSQM
FT                   NEISHVEEDEDEEEGEDNDQDDVRISKS"
FT   CDS_pept        complement(663246..664658)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575595"
FT                   /orf_name="CD36_82840"
FT                   /product="N-acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAX42803.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG396625"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI000192DC96"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP7"
FT                   /transl_table=12
FT                   /translation="MIIQPNHRRKPEFNERYYICRTTEKYSTNFSIIVQYNRRVNHNLL
FT                   SNALYSLIRKNSWFVQNFFQVDQRNPATTNGHNFEVRVLEQVKFYDVVKFHKIDTFDET
FT                   VMESLNDHIFSMNNANLPLWRINVFEERRPNGDQFVSVSFDHSNYDGLSGVQFQKDLAR
FT                   ELSIAKDDSFYDVLFDYQHDFENLPATILPAVDNLTDLFDLSMLSISNSILKKCVPFYN
FT                   TICDYIWPSDPSVFYTDKQVTKNLQTKYKFLKLTSNQVGQISRYCRPRGLTITTYFDII
FT                   CVCALQETVFSVVKSPATHTSSLVAINGRRYYSEEIKNFLYGSLVCGAPIILPTIENKL
FT                   ESMQMFHKQMTNDINTKKSFKSTGNLIKHDNVWEFFQNKIGKIGGRFTLTISNLGKISN
FT                   SNGTFKFEQLYFISNTGVVYNFVLNITTLPNGELTAVVAYIPEFENYELNDKPIMDTFM
FT                   EKFYDLLILTSS"
FT   CDS_pept        665361..666899
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575596"
FT                   /orf_name="CD36_82850"
FT                   /product="Thiamine biosynthetic bifunctional enzyme "
FT                   /EC_number="2.7.1.50"
FT                   /function="ATP binding"
FT                   /function="hydroxyethylthiazole kinase activity "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAX42804.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004417"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG326763"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniParc:UPI000192DD46"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP8"
FT                   /transl_table=12
FT                   /translation="MKVDYTLYLVTDSGMVPKSSSFLKQVADSINYGATIVQLREKSLS
FT                   TSEFIKRAEQVHELTQKRGIPLIINDRVDVALAVNAEGVHVGQDDMPAAIARKLIGDDK
FT                   ILGVTCSNVDEVQEVVDQGIADYVGLGTVYKTNTKKDVTNPEGTGPSGIRKMLQVLNKH
FT                   NSKSGAKKIHSVAIGGINDLNVRNVMFQCAIPGEKIDGVAVVSCIMANENAAEGTLLLL
FT                   TLISGSPYWNIPHYDSKYIPDYEAQIKQLTSSRPLIHHITNNVVKNFSANVTLAIGASP
FT                   IMSEFEEEFEELASIYNTALVLNLGTPSKEMMKIFKNAILAHQPRNPIIFDPVGCGASR
FT                   ARLECCKQLLDTGYFAVIKGNVGEILALQKLTSSYIELQDISYMRGVDSVSDLTEEDII
FT                   YIGKQVSTEFKTVLVITGPTNYIIEGPNKVFKVQGGNKLMGSITGSGCALGSTIAAFVT
FT                   SQAKSAYGLPSNFNAAVNAVKLYNKAGAAVSEKTPGKFMASFLDNLYRLTHFDS"
FT   CDS_pept        complement(666929..668356)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078832"
FT                   /orf_name="CD36_82860"
FT                   /product="Neutral amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42805.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG329239"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000192DD47"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDP9"
FT                   /transl_table=12
FT                   /translation="MSDEKVDLDQLEENSLDTEAYLQKEIEDENNHAINYRNCSWQRTA
FT                   GLLFSEYICLAIMSFPWSYSVLGLGLGLIVTVIVSLLCLYTGLIIADYCAAYPHLTDVC
FT                   DIGRHLIGPKWVWYATAVAFLLNNTLIQALHVLVGAKYFNTISDNHTICSIVFSVVSAI
FT                   ICFLISLPRTFSHMSSVGYFSAITMFIAVVLAMAFVGVQSHPYGFKEGTPVHWTAWPAK
FT                   GEKYVNIMSAVLNIVYTFVGQITYPSFISQMKQPKDFKKALIVVTICELITFSLAGSII
FT                   YVYVGNAYITAPAFGSLVGNYKKIAFSFALPTIIFLGALYSNVSSQFLFQKIFSKNSVH
FT                   RNNHTVTGWAVWIGLNGTLWAIAFVIAEVIPFFSDLLSLMSSLFDCFFGFIFWALAFFR
FT                   LKRLYHYKKTGENISLFQLFKSASIFQKFQYGLNVIIFGLGIYILGPGLYATIQSIIWS
FT                   YQASLYGKPFSCVSNAI"
FT   CDS_pept        join(669140..669204,669289..669715)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078833"
FT                   /orf_name="CD36_82870"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42806.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="HOGENOM:HBG286048"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI000192DD48"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ0"
FT                   /transl_table=12
FT                   /translation="MRVVVQKVKSASVTVEEKIVSSIGKGLMVLVGITTTDTEEDIAKL
FT                   SKKLLSLRVFEDLSEPPQTATKWYGKPWAKSIVDIQGEILSVSQFTLYGTVKKGTKPDF
FT                   HRAAKGHHAVELYNKLLEQLRAGLGQDKVKDGEFGAMMDVALVNDGPVTIIWDTQDSSL
FT                   "
FT   CDS_pept        complement(669798..670208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078834"
FT                   /orf_name="CD36_82980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42807.1"
FT                   /db_xref="HOGENOM:HBG396626"
FT                   /db_xref="UniParc:UPI000192DD49"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ1"
FT                   /transl_table=12
FT                   /translation="MQRSWLQLISIVSRNIIDDLKSNILNKPPILLILNPDSFEPPFTN
FT                   GFDEYFNVTSTALLGQYSNSKAANYAIVALSIVLAGLDIVYSIIRLSISTMLMGAFFGS
FT                   LLFFGLWFVVTASRRWKLVVLLFQNNDYNVLY"
FT   CDS_pept        670455..671513
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575597"
FT                   /orf_name="CD36_82970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42808.1"
FT                   /db_xref="HOGENOM:HBG396627"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000192DD4A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ2"
FT                   /transl_table=12
FT                   /translation="MKRQREESESQRKVVKYSQELTLVTLPTDILELIFKDLSRQDTIN
FT                   LSTLDHEHRSVLKPIVFSQIRASWNDMRSEIDGRTSFLKQHRHLVTRLRIVDCDSYGEW
FT                   NMDIFTDLLIDLPRLRHLLINSKFSSNWLKYRQDDNLQQLTLYFDSRAPRESVASTSTS
FT                   TTINRIFSLEHIANFKMLTKLRLWHYHLYWEDVYPVLIVEDVELHNCTWEFPFTLSQFN
FT                   YNSNIKRLVVSYSEGNAFAVSERYREFLQCGNGEDFLSLEELAVTVARGSLNSSVVSRF
FT                   MNASSFPRLRTLRVFARESVYNLSHWFGKLPINTTLRVLDMQVDYEGRDRERALKEAKR
FT                   YFPFLDVRIHRP"
FT   CDS_pept        671647..672300
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575598"
FT                   /orf_name="CD36_82890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42809.1"
FT                   /db_xref="HOGENOM:HBG396628"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniParc:UPI000192DD4B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ3"
FT                   /transl_table=12
FT                   /translation="MYWVLLLLVSICMANTETYLVRVPEYYNIVSHSSPIPRETRFSRQ
FT                   LHRLNTTHTVLLDYPIGTIDDQDMSNTITLTYNTVSQPRSTLLVRVNNYGDNTFTNGDM
FT                   LNIKLCWPATKPYDFDIGHVYMHSNELVESVEDSFDLYVAIRYKFHAFSYDNERFLQQE
FT                   TALSFQLYVNKLPSRILPIPLELYDTIVYLVDITIFIVWNILPCLVKCVLCASG"
FT   CDS_pept        672522..672908
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248406" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575599"
FT                   /orf_name="CD36_82900"
FT                   /product="Uncharacterized protein Igo2 homologue, putative "
FT                   /protein_id="CAX42810.1"
FT                   /db_xref="HOGENOM:HBG396633"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI000192DD4C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ4"
FT                   /transl_table=12
FT                   /translation="MSYSEEDPLSEPTNTQHLDLSKLSPQELRIYKMYGKLPTTQQILS
FT                   SKFQDKKYFDSGDYAMQKQMGGGLKSGIPGGMSMKHPNAERMKEMSVRNSISATNAQVL
FT                   LNGKSGLLNERTAPKDENGDDQTK"
FT   CDS_pept        673398..673901
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575600"
FT                   /orf_name="CD36_82910"
FT                   /product="Autophagy-related protein, putative "
FT                   /protein_id="CAX42811.1"
FT                   /db_xref="HOGENOM:HBG396632"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="UniParc:UPI000192DD4D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ5"
FT                   /transl_table=12
FT                   /translation="MITNQEFNDSIEEFISIILENLKLKGTDFGFSVGNHYVNKWATNK
FT                   MYSFISVSVKRLRIDFTISFDDLYNVPLFNMRLYDNDTFLTSPMTQNTLAVGLSAVDLQ
FT                   NHHLFHQPWLQVHPCETSQTIDDHLKNFPVCKYNSGIQYLCCWFGLYGLPCIFPQFSVR
FT                   PNIY"
FT   CDS_pept        complement(673963..674547)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078835"
FT                   /orf_name="CD36_82920"
FT                   /product="NADH-ubiquinone oxidoreductase subunit, putative "
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42812.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324386"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI000192DD4E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ6"
FT                   /transl_table=12
FT                   /translation="MSGGPVPVWKKYTTRPQGIWEKIRQLLVLVPNRSSGNPLVSLFRQ
FT                   IPPGERIKEAQNYKDPVTIPAGDIKGNPYFKRDYRRNYPQVHTFNQTKISGLLNLGSES
FT                   NPRISIGEKGSKELAVFTNGQDVSLASTLKSVPASVVKGEILGRSGEPIVAPSLNKFKW
FT                   EILPEPVHGMYSEAYPCRIFTEKKARQQSSA"
FT   CDS_pept        complement(675476..677320)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230217"
FT                   /orf_name="CD36_82930"
FT                   /product="Methylenetetrahydrofolate reductase, putative "
FT                   /EC_number="1.5.1.20"
FT                   /function="methylenetetrahydrofolate reductase (NADPH)
FT                   activity"
FT                   /biological_process="methionine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42813.1"
FT                   /db_xref="GO:0004489"
FT                   /db_xref="GO:0006555"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG649727"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniParc:UPI000192DD4F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ7"
FT                   /transl_table=12
FT                   /translation="MKISEKLSQAHRGSKPPPATFSFEFFVPKTSQGVQNLYDRMDRMY
FT                   DLNPIFIDITWNAGGRSSTLTNEMVYTAQSTLGLETCMHLTCTNMKVELIDEALEKAYK
FT                   SGCQNILALRGDPPLDGSESTGDFKYAKDLIKYIHKKYGNHFNIGVAGYPEGHPEEEDE
FT                   QKTLQYLKEKCDAGADFIITQMFYDVENFVSWCSKLRKIGVDIPIIPGIMPISTYAAFI
FT                   RRAKWSEIVIPQHFLDALDPIKDDDFLVRERGTELVSEMCNKLLQSGYVNHLHFYTMNL
FT                   EKATVMILEKLNLIEAIKSHDVVGGSELPWRKSLHPERSKESIRPIFWQHRKYSYISRT
FT                   ATWDEFPNGRWGDSRSPAFGDIDLCASELLRQSPKKAFELWGLPQSLADLSGIIINYLK
FT                   GDLKSLPWSDGPVGDDTRVIVDDLIYLNQHGFFTMNSQPALNAVKSSEKVFGWGPKNGY
FT                   VYQKQYLEFFCHKDVVSKLLDQVEEFNIKGAESSSAFISYYAVDKDGNLSTNCKDDDIN
FT                   AVTWGVFPGEEILQPTIVEKTSFLAWKDEVYRLFTEWAKIASSNLVEADQTQVNEFVRL
FT                   MKKFGDEFVLCNLVNNDFVDGNSTLFDLIKRLNVNDLN"
FT   CDS_pept        complement(677760..682121)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575601"
FT                   /orf_name="CD36_82940"
FT                   /product="Killer toxin-resistance protein, putative "
FT                   /function="UDP-glucose:glycoprotein glucosyltransferase
FT                   activity"
FT                   /biological_process="protein glycosylation"
FT                   /protein_id="CAX42814.1"
FT                   /db_xref="GO:0003980"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="HOGENOM:HBG396631"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="UniParc:UPI000192DD50"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ8"
FT                   /transl_table=12
FT                   /translation="MSVIRYILYAIAVTILLNFVKATENNNFKVELETQWSNIDFLPNF
FT                   IEAIAGFNESLYEQTIENIFGLSDNDEVLEDDASDQEIYSTVANSLRLADEDMDFVNFD
FT                   LVYKKHTPRVAAHYDHYSDVLAKFGDRLKRECAKDSFGNTVETKNGQIQTWLLYNDKIY
FT                   CSANDLFALRTDSSSNSTLLFDRVIGKSKNAPLLILYGNPTEESTKDFLKVLYPEAKAG
FT                   KLKFVWRYIPSATKKLDSIPGFGVTLKMENYDYSYSEANPKYDLSRDFTKINESQELVS
FT                   VNEKHLYELGVKLTSFILSNRYKTAKYDLLNTILTNFPKFIPYIARSPKLLNHEKVKSK
FT                   VLGNEDIGLSQDSYGIYINGSPIHPLELDIYNLGSRIKEELQTVKDLVKLGFDVVQAKL
FT                   LIAKFALLSAVKQTQFRNGNTLMGNNENRFKVYENEFKKGSSEKGGVLFFNNVESDNTF
FT                   KEYTTNREEAYLGVGSYKLKPNQIPLLKENVHDLIFALNFGNKHQLRVFFTLSKVILDS
FT                   GIPQQVGVLPVIGDDPMDEMLAKKFYWIAEKSSTQEALAILYKYFESDGPDEAADLLDK
FT                   VEVPEDFKVDYDHVLNKFSIATASVIFNGVIYDLRAPNWQIAMSKQISQDISLIKTFLR
FT                   QGPIEGKLKDLLYSNAKSERNLRIIPLEPSDIIYKKIDKELINNSIAFKKLDKEQGVSG
FT                   TFWLVSDFARPEMITQLIDLLSLLKRKSIQVRVINTGDADFSEKLETDFKLTTLTNGQI
FT                   DEIIEILEDSNISKAPNDGLRELLVTKQLPAHHSFLLFNSRYFRLDTAFEYEELDQIIE
FT                   FEISQRLNLIPDVIEAYPDEFMSKKVSDFNSMLSGLDNMDWFDLMTSIVTKSFHVDDKR
FT                   FIVDVSRFDFSSLDFSNSIDVKTYKENNPVDVLIILNPMDEYSQRLLSIVSSITQFSFL
FT                   NIRILLQPRVDSKEEIKIHKFYRGVYPHAKPKFDSNGKWIQHYSSQFESIPSDVTYSTE
FT                   LDVPHKWIIVPQMSSIDLNNIYFNNHHSVNIKYSLKNILIEGYARDIRTGKAPDGLIFR
FT                   AFNKNYSTDTSVMTSLDYFQIKAYPSIFNFSTTSNYTLLSASENKYQTNIEELESIEVP
FT                   VFKIDGSTIYPRVKKSDNKKAMPMRRHAEINIFTIAGGQLYEKLTSIMIASVRKHNHRS
FT                   TIKFWILEDFVSPQFKHLMKLISIKYNVEYEFISYKWPNFLRRQKSKERIIWGYKILFL
FT                   DVLFPQDLDKIIFIDADQICRADLTELINMDLEGAPYGFTPMCDSREEMEGYRFWKEGY
FT                   WSDVLKDDLKYHISALFVVDLQKFRSIKAGDRLRAHYQKLSSDPNSLSNLDQDLPNNMQ
FT                   RSIKIFSLPQSWLWCETWCSDKSLKDAKMIDLCNNPLTKENKLDTAKRLIPEWTGYEQE
FT                   IESLVSLVQNDSAKEVSEEIESDVEKEVDHSDKNEEEEEDDDGDDYFHDEL"
FT   CDS_pept        complement(682507..683229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575602"
FT                   /orf_name="CD36_82950"
FT                   /product="Uncharacterized protein yhr134w homologue,
FT                   putative"
FT                   /protein_id="CAX42815.1"
FT                   /db_xref="HOGENOM:HBG396630"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI000192DD51"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ9"
FT                   /transl_table=12
FT                   /translation="MVKEGHGAFPVPKANDPPPPANIKKIGALKRFSNDAYAKSLLYEA
FT                   ARLVAPIIHEQKFKVGKLYEMYPDKAELLGLNVNHGQKIYLRLREHHNDRSFLPMGDIV
FT                   GTLLHELTHNVYSAHDNKFYKFLDKLKSRYDDIHCRGAKTKYLCEENKVGRGVLLSGSL
FT                   VSVREQRLKLLNKPKFANETKVLGSDSKINRPIGSSPRDLRQAILEAAERRLRDSKWCH
FT                   SENAETESVPKEDEYDIT"
FT   mobile_element  683382..683758
FT                   /mobile_element_type="retrotransposon:solo LTR, san E"
FT   CDS_pept        complement(683891..684661)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575603"
FT                   /orf_name="CD36_82960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42816.1"
FT                   /db_xref="HOGENOM:HBG396628"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniParc:UPI000192DD52"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR0"
FT                   /transl_table=12
FT                   /translation="MSVQLFINRTNPDQSGKRRKKKKKNQTISSTRPISPTTPMYWVLL
FT                   LLVSICMANTETYLVRVPEYYNIVSHSSPIPRETRFSRQLHRLNTTHTVLLDYPIGTID
FT                   DQDMSNTITLTYNTVSQPRSTLLVRVNNYGDNTFTNGDMLNIKLCWPATKPYDFDIGHV
FT                   YMHSNELVESVEDSFDLYVAIRYKFHAFSYDNERFLQQETALSFQLYVNKLPSRILPIP
FT                   LELYDTIVYLVDITIFIVWNILPCLVKCVLCASG"
FT   CDS_pept        complement(684679..685737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575604"
FT                   /orf_name="CD36_82970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42817.1"
FT                   /db_xref="HOGENOM:HBG396627"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000192DD4A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ2"
FT                   /transl_table=12
FT                   /translation="MKRQREESESQRKVVKYSQELTLVTLPTDILELIFKDLSRQDTIN
FT                   LSTLDHEHRSVLKPIVFSQIRASWNDMRSEIDGRTSFLKQHRHLVTRLRIVDCDSYGEW
FT                   NMDIFTDLLIDLPRLRHLLINSKFSSNWLKYRQDDNLQQLTLYFDSRAPRESVASTSTS
FT                   TTINRIFSLEHIANFKMLTKLRLWHYHLYWEDVYPVLIVEDVELHNCTWEFPFTLSQFN
FT                   YNSNIKRLVVSYSEGNAFAVSERYREFLQCGNGEDFLSLEELAVTVARGSLNSSVVSRF
FT                   MNASSFPRLRTLRVFARESVYNLSHWFGKLPINTTLRVLDMQVDYEGRDRERALKEAKR
FT                   YFPFLDVRIHRP"
FT   CDS_pept        685989..686399
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383091"
FT                   /orf_name="CD36_82980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42818.1"
FT                   /db_xref="HOGENOM:HBG396626"
FT                   /db_xref="UniParc:UPI000192DD49"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDQ1"
FT                   /transl_table=12
FT                   /translation="MQRSWLQLISIVSRNIIDDLKSNILNKPPILLILNPDSFEPPFTN
FT                   GFDEYFNVTSTALLGQYSNSKAANYAIVALSIVLAGLDIVYSIIRLSISTMLMGAFFGS
FT                   LLFFGLWFVVTASRRWKLVVLLFQNNDYNVLY"
FT   CDS_pept        join(complement(686993..687057),complement(686482..686908))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078836"
FT                   /orf_name="CD36_82990"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42819.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="HOGENOM:HBG286048"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI000192DD53"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR3"
FT                   /transl_table=12
FT                   /translation="MRVVVQKVKSASVTVEEKIVSSIGKGLMVLVGITTTDTEEDIAKL
FT                   SKKLLSLRVFEDLSEPPQTATKWYGKPWAKSIVDIQGEILSVSQFTLYGTVKKGTKPDF
FT                   HRAAKGHHAVELYNKLLEQLRAGLGQDKVKDGEFGAMMDVALVNDGPVTIIWDTQDSPL
FT                   "
FT   CDS_pept        complement(687270..688682)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230218"
FT                   /orf_name="CD36_83010"
FT                   /product="Metalloprotease, putative "
FT                   /EC_number="3.4.17.-"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42820.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396635"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI000192D28A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR4"
FT                   /transl_table=12
FT                   /translation="MDYIKLISLLLIQLVVSYQIQIPFDFYGLFSSKDVSRPHYTTVDH
FT                   QYHPIDLTQYKGKHVIRIDYSDTPDLGKYLMTQSFEDDANIHFTKWGHASNLKTIDIQI
FT                   DETGLLKLHEMFPSMSFKVVVDDLAQKIYETYPQQISQLNEDSVITNELFFKEYRSLES
FT                   IDAWLGLLQATYPDIISVEEIGETFEHRKYKVVHFTVPSSEDNDDHGNRRTVVVSGGIH
FT                   AREWISTSSVLYSIYALIEYYKNVPDSDIWSKLDFIFIPVSNPDGYEYTWTTDRLWRKN
FT                   RQPTIHPKCFGIDIDHSYDYHWTRSSDWACGEEYSGEAPFEAFESQIWTDYLNNTNANH
FT                   KIWGYIDLHSYSQEILYPYAFSCNEQPRDEENLLEVAWGLAKAIRMQSGTLYNVLPACI
FT                   DRDADLMPDLGSGTALDYMYHHRADYAFQLKLRDTGNHGFLLPAKYIEPVGREVVAALK
FT                   YLCNFLVDEQSQ"
FT   CDS_pept        689362..690945
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230219"
FT                   /orf_name="CD36_83020"
FT                   /product="D-lactate dehydrogenase [cytochrome] 2,
FT                   mitochondrial, putative"
FT                   /EC_number="1.1.2.4"
FT                   /function="D-lactate dehydrogenase (cytochrome) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42821.1"
FT                   /db_xref="GO:0004458"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG553036"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniParc:UPI000192D28B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR5"
FT                   /transl_table=12
FT                   /translation="MQRRFVQTASYLIRRNKVACRFNRYNGLPVAFYSTKTVPFTADTY
FT                   SQKVQRDSKYKQLESKDIEFFKSVLPENSIITDKDDLLFFNEDWMRKYRGQSQLVLKPK
FT                   TTEQVASILKYCNDNKLAVVPQGGNTGLVGGSNPIFDEIIISLSSMNKIRSFDPVSGIL
FT                   KVDAGVILETADQYLAEQGYIFPLDLGAKGSCHVGGNVACNAGGLRLLRYGSLHGSVLG
FT                   LEAVLPDGTVYNSMHSLRKDNTGYDLKQLFIGSEGTLGIITGVSILCPSRPQAQNVAFL
FT                   AVSSYEAVQKVFVQARKELQEILSAFEFMDNTSQKLTAKHLGLEHPIESGDFPFYVLIE
FT                   TSGSNKEHDDEKLETFLGNAMEEGLVDDGIIAQDEAQIQSLWSWRESIPEATTIGGGVY
FT                   KYDVSIPLADLYGLVVDVNARLNDAGIASLDDESKPVLAALGYGHIGDGNLHLNVSVRK
FT                   YSPEIETILEPFVYEWIAKKHGSISAEHGLGFQKKNYIGYSKNEVEIKLIKEIKQHYDP
FT                   NGIMNPYKYV"
FT   CDS_pept        complement(691549..695670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575605"
FT                   /orf_name="CD36_83030"
FT                   /product="Repetitive cell surface protein, putative "
FT                   /protein_id="CAX42822.1"
FT                   /db_xref="UniParc:UPI000192D28C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR6"
FT                   /transl_table=12
FT                   /translation="MKLESIAALAGIVSTALAGVYPKNPPPATTYWTTVYAPSTSVVTV
FT                   TSCSKGGCGTQSYATGVTKTKTVHQGVTTEFTTYCPLTTSHEVIKSTYSDTLVVWSTRS
FT                   FSWVWSFSKPPGCGQSTSTIKSTAQTNVPTTATPTATPSIATTCTTGTKTKWWWWVVQT
FT                   TDCSVYSVSSTSSSLITTSQATTTSSIASTTITSAPATPSAVTTCSTGTKTKWWWWVVK
FT                   TTDCSVYTVSSTSSSLISTSQATTTSSIASTTGSTPATTPGTSIKSTPTTAPGTSTKST
FT                   PATTPGTNTKSTPATTPGSSVTTGKTSTDWITSYTTHTAETTTVITVTDCNHRTCTPTV
FT                   VTTGVTVVTVTTTGTVTQYTTFCPLTSTETVVTSTKPTPTTTPKSSTSIASTPATTPTT
FT                   SSKSTPGTSTKSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTSTK
FT                   STPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTST
FT                   KSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGTSTKSTPTTAPGSS
FT                   TSIASTPATTPGSSVTTGKTSTDWITSFTTHTAETTTVITVTDCNHRTCTPTVVTTGVT
FT                   VVTVTTTGTVTQYTTFCPLTSTETIVTSESTPATTPGSSSATTPGTSSATTPGSSSATT
FT                   PGSSSATTPGTSSATTPGSSSATTPGSSSATTPGTSSATTPGSSSASTPGSSSATTPGS
FT                   SSATTPGSSSASTPGTSSATTPGSSSATTPGSSSATTPGSSSATTPGSSSASTPGSSSA
FT                   TTPGSSSASTPGSSSATTQGSSSATTPGSSSATTPGSSSASTPGSSSATTPGSSSASTP
FT                   GSSSATTPGSSSATTPGSSSASTPGSSSATTPGSSSATTPGSSSATTPGTSSATTPESS
FT                   SIESTPATTPTGPATTSVPEQSTVTITGPGFTTVFTLTPGTNTITTPTGPATTSGSTPG
FT                   SSSASTPGSSSATTPGSSSATTPGTSSATTPGSSSASTPGSSSATTPGSSSASTPGSSS
FT                   ATTPGSSSATTPGSSSASTPGSSSASTPGSSSATTQGSSSATTPGSSSATTPGSSSATT
FT                   PGSSSASTPGSSSATTPGSSSATTPGSSSASTPGTSSATTPGSSSATTPESSSSIASTP
FT                   GTTPGSSSAATTPGTSTGSCWTSVSTGGYGDKTTVTICSDVTSGQSVTTPTTISVPSSY
FT                   CTTVPTAGTDETIITSFVTSTAHSTEVITVTSCAETGCETHTTHTGVVVVTVTTTDVAT
FT                   TYTTYCPLTTTKAVYHVAKLANYKRDQTEIVATETNENTSNWPAPTLVPSVGISNNSSS
FT                   GVSTFEGAANSVVPRLGLIAGFFSALLFLF"
FT   CDS_pept        700857..701333
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535853"
FT                   /orf_name="CD36_83040"
FT                   /product="Transport protein particle (TRAPP) complex
FT                   subunit, putative"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="cis-Golgi network"
FT                   /protein_id="CAX42823.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="HOGENOM:HBG396637"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000192D28D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR7"
FT                   /transl_table=12
FT                   /translation="MTIYSFFIFDRHCNCIYNREYTHVASSNDTLSGQINKSNDSNSSK
FT                   LLFGILYSLKTISNKLADDDETEMNELKSFNIGSFKVHFWESLSRFKFVIVTNGEVNQL
FT                   SDVLFELYSNYFIKYVVKNGLMPVEFSADGEYSKINNGKFIEETDNYLQSLSIF"
FT   CDS_pept        702029..703546
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575606"
FT                   /orf_name="CD36_83050"
FT                   /product="Drug resistance protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42824.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D28E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR8"
FT                   /transl_table=12
FT                   /translation="MVISLDPRPKIFTSRYHEIIVVTLICLAQFFTQAGITLSLSTMNI
FT                   ILNSFNTIDSAKQVWFMGSYALTVGTFILISGKLGDLLGLKLIFVIGWIWTTVFSTITG
FT                   LSNYVSVEFFIICRALQGIGFALLLPCGMGILGNIYPNGERKNLVFGCVGANGPSGAFF
FT                   GAFIAALIAQLWWWPWIFWLLSIGGAMLTIISIIYIPPIPHHKFESYSEFFKRIDPLGT
FT                   STGIVGLILFNFVWTQGPVVGWNTAYIIVLLIIAVLSIVAFFIVELFIAEYPLVPKSVF
FT                   NLKIGMVLACISCGWGSFGIWQYYYWNIILNLRKYTAIAGSLTYVPFLVMGIIAAIASS
FT                   IIISHTKPSYIISFATICFMVGCLMLSVTPIQQSYFRLTMGQMFILCWAMDMSFPAASI
FT                   ILSDYLPSHHQGMAGSLVSTVINYSVSLFLGMSSCVETEIKLRTHNVLLSYRSGLYFGI
FT                   GVASLGIFCSLIFIFIQRNDGKGTNALLVDSEEEIIRDSTEDIIEKK"
FT   CDS_pept        703759..705009
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093865" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383092"
FT                   /orf_name="CD36_83060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42825.1"
FT                   /db_xref="HOGENOM:HBG396638"
FT                   /db_xref="UniParc:UPI000192D28F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDR9"
FT                   /transl_table=12
FT                   /translation="MKSLTLLGLLPLTLARTFHIATNQNVACLEIKAPTNISLTKTIGT
FT                   ASGENPPVLIFNYDEKLLLPIPNFDYLVTDGKIDDYFTEQGFTFAKGFIGSSYNDILID
FT                   KLSYDVTSPGTYCIYSPLIDGYEYRVDVDESRIQFDNVVFCVVNIIVNLFYNQFFSRQN
FT                   KVLFKLIGKFELIKAGIFAVSLLLSLRFNIINYTEDIVSAVDDVFTMVFLMGYGTLYSS
FT                   YKDQDLKKIAIVTAFTVTPAITSRFFDLKSDVTNLVINNEYYNVVDGVLGSGKFDGLSV
FT                   VQRIIRDVKIHRFSAAVATLFGVSKIIKFAMYISTIRQTLSKLTPGGTKSGYLYSVILW
FT                   LFVYPFASFAFYPDLVYNYYLVTDYASVLKQFLLESVRDKYIVLMADECHWVLFFLIWF
FT                   IGNKGLTIETISSKKDE"
FT   CDS_pept        705389..707227
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093869" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575607"
FT                   /orf_name="CD36_83070"
FT                   /product="Type II myosin heavy chain, putative "
FT                   /protein_id="CAX42826.1"
FT                   /db_xref="HOGENOM:HBG396639"
FT                   /db_xref="UniParc:UPI000192D290"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS0"
FT                   /transl_table=12
FT                   /translation="MKSSKEQTRSKRPLSEISPNLRRDPSKKRRDSLGFDMASIPSSSI
FT                   KSFPSRIPPPTASKSAAIASVSSTSSSSFSSSSSSVLSSASIPQGILSIQERLRRKAGV
FT                   NDNNGQSSSTLVARSQPGVFRSNELQEEYYSLNELYKQQASSYEKLEIDLGKLKEIYKN
FT                   YYYKIDLINDLINQKQSEFEILEHDIINDVEQEEKLTYSKLHENKIKLDGQFKELEFEM
FT                   LNQLEDAKQFDYKELLTKIDNLKTEKETVMSEYEKAMDKVDCKLTAEKEQFSKDLEDKL
FT                   HPLKKNKQLINDQLINKKDELTKLEIEYNELKDQLAQRNDSIDTIRHEIANIEQEMNNY
FT                   QTTKKELELKVSEAELELHEAIAKDKQEQKEYDNVYSEYSMLHSKIAKHDEHRRILENS
FT                   IMNIQGKFRVYSVGEGHDTCNKRFSKDTPSSFIIDEFQCLVQSTLKGRNVSIINNYLPG
FT                   SQIVIDSYKTIQRQQKYIYQCISIKNSAGNTEVCDLLNSNAQVDTLFQHQQMVIDDFDQ
FT                   FKHIVEKIDSTLSQETAIHIISTDTSKLMIVDCSRIDQDQQEKILEKFKSKSSLGFFEK
FT                   LLTWIYHHCSTLFLYEPKTSQSNSLLKFINSIDSHI"
FT   CDS_pept        complement(707267..708733)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575608"
FT                   /orf_name="CD36_83080"
FT                   /product="Histone acetyltransferase complex component,
FT                   putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX42827.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG396640"
FT                   /db_xref="UniParc:UPI000192D291"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS1"
FT                   /transl_table=12
FT                   /translation="MTSQIADGSSTTTINPLKNGSTALKPPHHAHGMSANSHLTNGSPK
FT                   KVKSYKRLELERLIREFQNKLGKNWEKYHETLSLFLIGKLSRVELISTITPILKGKNLL
FT                   KYHNKLLLLNFANSLKDNSSDLSNEFAGFWNKKAGKVTKSKNNQFERFKSVIMGLPVKE
FT                   RKRIIDISRDSGKKGKIATDIILTRHAILPKIPMIQDKEQQQLQVNNLVQWQQDVLNGI
FT                   NTPIATENYEIPDYDNLSRMVLMIMREHGLTGGLNSGVMEVILLGLESHLKNIIETAID
FT                   VAKYRMNKYTNDNYIPYVKSNGEANNTTGNDDGLPSSKDITLCIEDLHDTLEMYPHLVE
FT                   SSGPKLRLSNVMLENDDMIGDGLDYDLPPINQEYFAKERHTTTSNNASTGATNTSNNTN
FT                   STSGATGGATNSTSKHKTDSTAVSEKTDTNQPLQTPASTPSQAPAPAPAQTQTQVSAPA
FT                   PASTPILRPDAHIGTTDELKWVLHDLVSTM"
FT   CDS_pept        710127..711662
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575609"
FT                   /orf_name="CD36_83090"
FT                   /product="Nitrosoguanidine resistance protein, putative "
FT                   /protein_id="CAX42828.1"
FT                   /db_xref="HOGENOM:HBG396641"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI000192D292"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS2"
FT                   /transl_table=12
FT                   /translation="MSHNDSNSNSNPSSNPISNHMSKPSDIGRSSNDSGSEESIQHFTL
FT                   TQLEPRDNEEDVEMGEPISRQSTFLERVQSRYSFFHENLRAQRKELSMKYLTIYLVMAI
FT                   GCLGVFSIYWGSMYQRETRIKNLKMLVVLEDEEIDGIPPLFGNQLRDLLATPTAKTIGD
FT                   WKIYNTSEFETIASQHNNTVNEEVIRQIHHQHYWASIYVKQNSSYNIYNALANGNQYNV
FT                   SDSVYCYYETGRHLTSVGPYVVASIDSIQTMWLDQNSVMRDLVRIGNITLDNENSVAVA
FT                   TTALAFQIIDMRPSTSGVLVAALQIGLLYLVIVSFFSFNFFVDIHRSVALMVKQRNFLL
FT                   YRVFASIMSYFVISLMFGLVTLAFQVDFAVTFGKSGFLVYWMVTFLTMWSVGLANELAA
FT                   MLILTVYPPMVGFWLIFWVIINITPTFTPIALLPEFYRYGYAMPLHNAFEIYSVIFFNT
FT                   YKGLIGRSIGIIIAWVVFLTLMAPIVVVYFGSTMSKKAAAAAAATAAKKEKSK"
FT   CDS_pept        complement(712243..713763)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575610"
FT                   /orf_name="CD36_83100"
FT                   /product="Mitochondrial protein involved in cell wall
FT                   biogenesis, putative (Protein ecm18 "
FT                   /protein_id="CAX42829.1"
FT                   /db_xref="HOGENOM:HBG396643"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000192D293"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS3"
FT                   /transl_table=12
FT                   /translation="MGVFGRGTASRISIRSIYLRNTTNFVVPENYKPNRSLLKQLPWKA
FT                   GLDIWWKSLSPNRLSDLQKELVEFMLPSHLQENQRIIKEFKKTTIDDKGNYINEVGFKI
FT                   INNEEKPTKHLVFIHGYGASLGCFARNFQIINKFKDNEYNYHVHFLDNLTFGLSSNPKV
FT                   NNGTINYWRIPAPATVKLIDKIPTDSKKLYRKYYKLIEGYQLDPENFEQYTSYFTPILK
FT                   DMEKFYCRAIDNWRKNNGIESIDYLVGHSFGGYWCGSYSVKFPDNVKNLVLVSPVGIER
FT                   HVQAVTNTDPISNRIMAPTLNPTSYNFLSRLPILSKKQLLSWYYKLPHLPRLLPFLGPW
FT                   GVQLYFKMWMGKLYKINKLIDKHGGPQEIFTNSNDLVYGSKKELRLIIEYLYNSITNGS
FT                   NSDIYSRYLLTPATTSKWPLYDKFYETVKQDPGRLKFKVHIMYGQFDFMNSEAGEKLAN
FT                   LLNENKVEARYYEISEGGHNLYIDNPFDTNQKIFEIVVEDATKANNCN"
FT   CDS_pept        714160..717162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078837"
FT                   /orf_name="CD36_83110"
FT                   /product="Protein stb6 homologue, putative "
FT                   /protein_id="CAX42830.1"
FT                   /db_xref="HOGENOM:HBG396665"
FT                   /db_xref="UniParc:UPI000192D336"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS4"
FT                   /transl_table=12
FT                   /translation="MSSPLNSPYSRFNQGLINNSKSSNQLVYGDSSSRNVSVDSNILRA
FT                   NMGSYSNPNDFITYIIPDFDAVRYFQKDFQSLNEFHICEESEASGFEIYLVEQWMNDRN
FT                   ISSVVTTFTGNESSKISVIRFTILKKPAKYYPLRFQEYLNELIQNHSRMKRIEKEKATY
FT                   QHSRTNSNSEMLTLSKLSSTSIPKRENANDYTSEVCFVANLTSLPSNLNLIPVPGGDSR
FT                   RVSTAFMINSNLKKLQCTGRSVSMITSKISDASDDKFRQMYKIQSTKVPIVFAVKELVN
FT                   IVQTCLFYFDLLDAKYCDGLLCTKTEEAISNWWNLIGLPHFSVKPNPANGILPSRTVAA
FT                   IISLILSVRMRIQLVGSSDVPKDPFDFENFMIAIGQFQRQYKLDKTRKLDMETLNKLFT
FT                   VTNARLLPQKNTNYFYSQVSAASDLDPRNFDIISQSGNPKGLNSTPQKRRYGKELKKLT
FT                   NVMKSSVSDRINAASVRDIDDMSNPSKASSGRIRNKIAKLADTVSPLDVETLDLELLVK
FT                   KHLHGKTLIRLFYGTQNSHTFLSVEKSTDMPNKGHRHNLANTHNSHLAFPKRRGRTMVE
FT                   GGSTSQYEFESLRDRIAQTQELLMVNDPSRYSRGLSRMKLGLQSKKNLLANGDKNSMLL
FT                   APGNNYYNSPIQTASLVDSFLQISNDDASGVESVCSNPNSINRKRINSISDFKHPIASF
FT                   KHTLNRRNSFPYLENQHEQNLNTLVIAKNQSSIDCEEIDFLKRKRSVSFSCVEDAVLLG
FT                   KVQNISSMAKFSESFLDSIRVLMKYENLKSYYLEGEKKQNHVTNSQLNKSYQLMNLELI
FT                   KMKNLRNQMDAHQSRIMEGGLEEELNYSVKTLNTTIDRLVYETRIVAKRIDELEQDFKL
FT                   YEMKLNDECKSKLTEIIDKVLHSKKFKEVFTSPEERKQIAYKLTGDENYIELDDEKEST
FT                   IGFLRMIVMFFYGIISSIFRFFHFNRDNMNLERIRQAWVILDPNRSIIKHAYSYIGREP
FT                   SKDSIASAESK"
FT   CDS_pept        complement(717155..717772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078838"
FT                   /orf_name="CD36_83120"
FT                   /product="Plasma membrane t-SNARE, putative "
FT                   /protein_id="CAX42831.1"
FT                   /db_xref="HOGENOM:HBG396664"
FT                   /db_xref="UniParc:UPI000192D337"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS5"
FT                   /transl_table=12
FT                   /translation="MDKSYDDLSAISTLVSSLSQNLNDSEEYITQLQTLSKDLVSKDQY
FT                   EQLSKESGDDLIKSNSVANGDDEMAIIRKLEEERLSLIMDIQREDFISSKLIELIDQNH
FT                   EIIESVKEYLEARESIKEEKAASFKRQLEILVSDVVLPISAQLDANMTELSARMKTVAR
FT                   KLVRIQLRAKENPSLLMSENYLKEFNELVQCFYSLCKEYKTT"
FT   CDS_pept        718035..718931
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575611"
FT                   /orf_name="CD36_83130"
FT                   /product="Protein transport protein sec13 homologue,
FT                   putative"
FT                   /protein_id="CAX42832.1"
FT                   /db_xref="HOGENOM:HBG590901"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D338"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS6"
FT                   /transl_table=12
FT                   /translation="MVTIGNAHDDLIHDAVLDYYGKRLATCSSDKTIKIFDLDGTDNYK
FT                   LVTTLTGHEGPVWQVSWAHPKFGSILASCSYDGKALIWKEQPETQQWSIIAEHTVHQAS
FT                   VNSVSWAPHELGAVLLCTSSDGKVSVVDFNDDGTTSHVVFDAHAIGANSATWAPVSTSS
FT                   KDSATLKQQRRIVSCGSDNLAKIWKYDAANNTYIEEAKLEGHTDWVRDVAWSPSNLIRS
FT                   YIATASQDRTVFIWTQDRDGKWQKQLLTEEKFPDVCWRCSWSLSGNILAVSGGDNKVSL
FT                   WKENLQGKWESAGEVDQ"
FT   CDS_pept        complement(719067..719990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000045183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575612"
FT                   /orf_name="CD36_83140"
FT                   /product="Purine nucleoside phosphorylase, putative "
FT                   /EC_number="2.4.2.1"
FT                   /function="purine-nucleoside phosphorylase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAX42833.1"
FT                   /db_xref="GO:0004731"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG292914"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="UniParc:UPI000192D339"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS7"
FT                   /transl_table=12
FT                   /translation="MAENIPPEEYIKQLNHASDTIKNKIDQFQELAQPRVMIICGSGLG
FT                   GIADVLQAEPKLEIPYSKIPGFKVSTVPGHAGKLVFGLIGKSKVPVMCMVGRLHFYEGY
FT                   SFQETTFPVRVAKLLGISSVVVTNAAGGVNPKFKPGDLMVIEDHINFPGLAGYHPLRGP
FT                   NLSEFGPRFQPLSDAYDYELRKLFITTARDKLGITRSIYEGTYFFAAGPTFESRAEVRM
FT                   IKTMGGDAVGMSTVPEVIVARHSGLRVLALSLITNAGVGDKPPSAFDENPPALDEGMAS
FT                   HAEVLEAADEASKDVQKIIEEVINQL"
FT   CDS_pept        complement(720383..721792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078839"
FT                   /orf_name="CD36_83150"
FT                   /product="Mitochondrial protein, putative "
FT                   /protein_id="CAX42834.1"
FT                   /db_xref="HOGENOM:HBG396663"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniParc:UPI000192D33A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS8"
FT                   /transl_table=12
FT                   /translation="MRFPNVGLAELSKSIIKIRGPDATKFLNGLVTSRLLPNVVKKKQH
FT                   TISESENRHSNLSEIIDVSQNYGLMHEDIYDPDYNITISRDGVNSMILNSKGRVVTDCF
FT                   LYPDPFHNVDGTFQESINEPGYLLEVDKSISQQLMMILKLHKLSAKVDIIPDKKLHSYY
FT                   YYDDTSTFDAWLENIQSKYFKSLDPTAALQNANSFIKDNVFFNQKIAKNILGFAIDNRI
FT                   PNFGIKFISNKPISTTGENDSHNVVIPVESVFSESFSEEFDTTTIDESSVVRRRFQNGL
FT                   FEIQDAPKGSSLLPFECNLDYINGLSLDKGCYVGQELTIRTFNNGVIRKRIFPVQFFQL
FT                   TEYNLSYLQGHPIDLNMLDPVIERMSNIPSSSLGKLEITPLDDSESQQKQASTNESSFA
FT                   SSPFGSSKVVRKRKTSLGKIISVQDNLGLVMFAVSDVEKCQIYKLELPSFEGGTQFIGV
FT                   KVDIPDWWPIS"
FT   CDS_pept        complement(722189..722539)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248816" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535854"
FT                   /orf_name="CD36_83160"
FT                   /product="Glutaredoxin-like protein, putative "
FT                   /protein_id="CAX42835.1"
FT                   /db_xref="HOGENOM:HBG626868"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192D33B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDS9"
FT                   /transl_table=12
FT                   /translation="MLHATMRHTFSTSIPKRFFSYTTINSQIQLTFFTKDNCMLCSNAK
FT                   FILYNALKSSKLKNTPVKLTTIDIMDPENQEAFDKYCYDVPVLHVDRPTQDKPVKFMHY
FT                   FYADKLLEEFTK"
FT   CDS_pept        723402..724403
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17575613"
FT                   /orf_name="CD36_83180"
FT                   /product="Dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42836.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D33C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT0"
FT                   /transl_table=12
FT                   /translation="MSYPTVPWPTFADLRQMLHGFWASKPTYTESQYPDLQDKVVIVTG
FT                   GNTGLGYETVKSLAGSTKARIYVFSRNKEKTLAAIKQIQLEIAEEYNVSNSDIRFIQVD
FT                   LSDLTTIKPAVEEFLKQEQRIDIIIHNAGIMGPPVGSKSKQGYELQWGTNVVGPHLLQR
FT                   LLDPLFIKTSETNPPGFSRIVWVSSTAHLFAPQGGVFWDNVNYENLKLTQTQVRTTLYA
FT                   QSKAGNLIQARTWSRKHNFPNVISSSLCPGYLYTDLIRNLNSFEQCFVKRLIYPRRYGA
FT                   YTELYAAFSPDVKDGAHTIGFGVPSHARTDLTSEAVGDKTWAYLDKETDAYL"
FT   tRNA            complement(724571..724659)
FT   CDS_pept        complement(724785..726608)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535855"
FT                   /orf_name="CD36_83190"
FT                   /product="Low-affinity methionine permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42837.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396662"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D33D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT1"
FT                   /transl_table=12
FT                   /translation="MVSSSFDLELNPNIQRKDNIPQPSSSSNRSSALEINNDNDNNNSN
FT                   NNTSLPSSSDTIEMQALDKSEYSKIPDVLVDDDHSIKTGTDSSSDTSNPYLRPSIELNG
FT                   RISYLQDLEDLPQGRHLGLFSTIILFVSRILGSGIFSITSGIYQDCGQSIALFFAAWVI
FT                   AAIASFGGLYVFLEMGSLVPRSGGAKVFLEFIYPHPKLLATVAFSVYSVMFGFTISNVL
FT                   VFGEYLIHALGLEPSDFKTRFTGLIFLYFAAILHGVSVSHGVRIQNVLGGLKLVLVAVI
FT                   VVAGIYVTAFPQSITGIENQLKWDRVFEVRSSASVSTFASAIIKASFAFSGWNSVHTVA
FT                   NEIKDPVRTLKIAGPVSLTIMAVTYFIANLAYLIVIPSDELANGSTLAGSILFTKIFGQ
FT                   FLGKKLLTLAVSLSAGGNIFVVIYTISRVDQEVFREGYLPFSRFMSSNWPCGAPLRTLL
FT                   LSVAITTTVIVLFPGGDIYSYMVSLEGYPQQLAIALIAIGIFIIRKRYPELHSPIRAGV
FT                   VGTISVFLISVYLLVGPFVSSKSPNPKGLENWPNYGVVAIICILACIGFWYVKFRLLPW
FT                   LGGYELVSEEVQLSDGLPVKKWKKLHSYNSL"
FT   CDS_pept        complement(727944..728132)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        728431..732870
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575614"
FT                   /orf_name="CD36_83200"
FT                   /product="Phospholipid-transporting ATPase, putative
FT                   (Aminophospholipid translocase"
FT                   /EC_number="3.6.3.1"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42839.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG745019"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D33E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT2"
FT                   /transl_table=12
FT                   /translation="MSESKDQSTDSTSSPGLQSRGEPEPPGIKERIHRFFFLKGLADRP
FT                   PYLQEIYDNTPRTVFYNYDLPEYMIDSQGRPITQYPRNKIRTTKYTPITFLPKNLLLQF
FT                   TNVANSYFLLIVILGAFQIFGVPSPGLAAVPLIVIVCITAIKDAVEDYSRAVSDAELNN
FT                   SPIHLLTGVHNPNVLVDQVGPWRKFKKACSRGTAHVFKFIKKCCIFICGNKRIKQEYAR
FT                   EQVQEDNLALHRVSTVVSDYTYRSQEPRYSVSSPRRSMNINRKSIQSSHHRPTVALPNS
FT                   LLNPVLKKENAQNSSSVRANFKNRCWKDVNIGDIIRIRANEEVPADVIIISTSDSEGNC
FT                   YIETKNLDGESNLKTRTALKCGGNNNLKHSDDLSDTKFWVECDAPNANLYSFKGTIHYE
FT                   NFDSNGNLVNEDEKEAITPENVLLRGCTLRNTKWVIGFCIYTGPETKIMLNSGITPTKT
FT                   SRISRELNLSVIINFVLLFVLCFVSGLINGLFYRHDNNSRVFFDFHPYGKTPAINGVIA
FT                   FWVALIIYQSLVPISLYISIEIIKTIQAYFIYADVKMYYDRLDFPCIAKAWNISDDLGQ
FT                   IEYVFSDKTGTLTQNVMEFRKCTINGKSYGLAYTEAQQGLDKRAGVDVIEEANKWKIKI
FT                   ASDKEAMMDDLLKYSNNDQLREENITFVSSQYVRDTFSGDSGDEQKQANERFMFALALC
FT                   HTVMTEENETDPTLRDFKAESPDEAALVSVARDMGIVFKKRLRSSLLLEIYGQEQEFHL
FT                   LDIIPFTSARKRMSCVIKTPENKIILYTKGADSVIFQRLNPSENPNELVRKTALYLEDF
FT                   ANEGLRTLCIASKVLDPQVYENWNRRYREASSSISDDRETLMGQLEEEIEQDLVMLGGT
FT                   AIEDRLQLGVPQSISILSDAGIKLWVLTGDRVETAINIGFSCNLLENDMKLLVVRPESN
FT                   DTEDCEQIDALITKYLQEEFHIDASSPSSVADAIKQARKDHSIPQAKVALVIDGAALSL
FT                   IFQDLKDRPNDTIRVLQDKFLLLGKQCRSVLCCRVSPAQKAQVVKLVKTGLQVMTLAIG
FT                   DGANDVAMIQAANVGVGIAGEEGRQAVMSSDYAIGQFRFLTRLLLVHGRWSYKRLAEMI
FT                   PCFFYKNVVFTLTCFWYGIYNNFDGSYLYEYTYLMFYNLAFTSLPVIVLAVFDQDVSDT
FT                   ISLLVPQLYTSGILGKDWSQYKFVWYMFDGLYQSVISFFFPYLLFYVAFQNPQGMTIDH
FT                   RFYIGVVAACIAVTACDIYVLMQQYRWDWLSVLIDCISILLVYFWTGVWSVNPNYSGEF
FT                   YRAGAQTLGTLGVWCCIFVGIIGCLLPRFTFDFFTSNFRPADVDIIRERVRQGAYDDYP
FT                   LGYDPTDAEDVERHRLLTEIINKDPQLFEKMENEYKEEEHDKETPLERTFKSIKRRTTI
FT                   SRSKKGTAQRLRRDTINDQFQKQIPLDELRQQMIKEGEYTSARYSLDRINTTHEIPGVT
FT                   QADTLLKYHTRNSVALNS"
FT   CDS_pept        733288..736080
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246739" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575615"
FT                   /orf_name="CD36_83210"
FT                   /product="Subunit of mRNA cleavage and polyadenylation
FT                   factor, putative"
FT                   /protein_id="CAX42840.1"
FT                   /db_xref="HOGENOM:HBG396660"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI000192D33F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT3"
FT                   /transl_table=12
FT                   /translation="MFGFSLLTPGDNDHSFKAALLDFDNEFKLIADPFWNGVDVNAAMF
FT                   MEEHLKETNAILLSHSTAEFISGFILLFIKFPNLMSTIPIYSTLPVNQLGRVSTVEYYR
FT                   AMGILGPVDTAILELDEVDNWFDKVNLLKYQQSLNLFDNKVVVTPYNAGHSLGGTFWLI
FT                   TKRIDRVIYAPAWNHSKDSFLNSASFISSSTGNPHLSLLRPTAFITATDMGSVMSHRKR
FT                   TEKFLQLVDATLANGGAAVLPTSLSGRFLELFHLIDEHLKGAPIPVYFLSYSGTKILTY
FT                   ASNLLDWMSKSFTKEWEELSSVPFNPSKVDLLLDPSELLNLSGPKIVFCSGIDLRSGDI
FT                   SAEAFQYLCNDERTTIILTEKTTMSLESSLSSILYTEWDTLAKKRGGGESADGIAVPID
FT                   KNISLKNWTKEIELTGTELTEFQEKVAQKRKEKLLAKVRDQKNQNILSADTVDSEDSSD
FT                   DDEGDEEREKQKSDDASNLLIKQYQSINVANSNVSANEVNPLAIHEAFITDHIKQSLEK
FT                   NLPIDLRITHKLRPRQATFPYFATSHKQKFDDYGEVINIEDYQRHDEVSHSKIIMEGKR
FT                   KFDEKRTTNNRRNKKQNKQQANKLTPQEQVNRKLLQKYLDTLSNPKKRVGLNYGSKKKS
FT                   ETGKLKVRCGLSFVDLSGLVDLRSLGIIVQALKPYNLILLPDYTPLQNLTRVQEFFANQ
FT                   QNEQLQEQTKKSLAQSSRYLSLVSIRDGLSSAMSPYSSGNMNVMVVHDNESVKIGAESE
FT                   SGSIGLNNFEVNLDDSIVKDLKWQKIGDDYKVAKLYGELELQNQFPVTKRIRTVQDYIN
FT                   SNTHFSLRKLDNTTAVKRQETIANQVQDPKIRALITNGPKLAIGNIRLPDLKKRLQKLN
FT                   MTAEFKSEGTLVVNDILAVRKIAYGLVESDESGDIVIDGNVGPLYYKVKECIREMLAYV
FT                   "
FT   CDS_pept        736403..736858
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093876" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383093"
FT                   /orf_name="CD36_83220"
FT                   /product="Optic atrophy 3 family protein, putative "
FT                   /protein_id="CAX42841.1"
FT                   /db_xref="HOGENOM:HBG396659"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniParc:UPI000192D340"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT4"
FT                   /transl_table=12
FT                   /translation="MSGLALKFTSLLVRTIAKPIGNAIKRQAKDHERFRRLCISFAQKM
FT                   HSSEIKLRMSLLGENKIKVKPLNDNKAIEQGATFISEFFIFSVAGSLIFYESYRSRKKA
FT                   TNERDALADDITSLQSEIEKINNKLEDINIKLIDYKVSASSSETAPK"
FT   CDS_pept        complement(737157..737558)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383094"
FT                   /orf_name="CD36_83230"
FT                   /product="Histone H2AZ"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42842.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D341"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT5"
FT                   /transl_table=12
FT                   /translation="MSGKGKVHGGKGKSSEIAKSSTSHSARAGLQFPVGRVKRYLRRNV
FT                   QNKIRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELDNL
FT                   IKATIAYGGVLPHINKALLLKVEKKKGQK"
FT   CDS_pept        complement(737779..739746)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575616"
FT                   /orf_name="CD36_83240"
FT                   /product="Nitrogen permease regulator, putative "
FT                   /protein_id="CAX42843.1"
FT                   /db_xref="HOGENOM:HBG398459"
FT                   /db_xref="InterPro:IPR009348"
FT                   /db_xref="UniParc:UPI000192D3E3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT6"
FT                   /transl_table=12
FT                   /translation="METSDGFIPIVAIFYSVFHPIEGTKIVHQFPENSISTGRFSTSIR
FT                   DGGLFDFDTIKNYVIPKPQLCNRLISLKIDKYKVIGYPVSMESSHYARNSFNFNFCFVF
FT                   RYDMGDVSPYESAIKRMGQMFQVLEEQSFMLSSLDKDNSFFKDKVIKSGKALISSSLSP
FT                   DTAVGEAFDEAGNENHFLPQTGQNGTSISTPGFAKTKKIALSSIESLIQQIYQDLNNYS
FT                   ECCIPLDTSNSVDIKLFPILPPPINIKAYQVPIATVRLNSLVDVNWDPTMIKILPYING
FT                   LNSVKKISELADANYLLTKQCIQHLMHYKCIEVIDIFQFGNVYAPTNHIGEFLKYDGKM
FT                   AEECQAYVVSADFSMDNTSHVNTPIQIHSPHPGNDAHSPTYNYRPSYGTSSVSPYTKYS
FT                   YLSRSPKPPMTIGADVKVPTKTTLFYLYRSLNQGQTVKEWYLQHKKILGNIDIRRFINF
FT                   GVLRGIIYRVYTYPLLNSFTGAIERNDTDQYDQLLRNLKRKKPKRVVSIGHNDNLLKTK
FT                   VNEQTLRTDVKRKVSFAYSQSDKHDLRRFSTNDVILENESSDYDDEDDSSIEEFHGNGH
FT                   IINNRIPISERKARVSSSSYYSDIEEDAIDEEEYRIKANLLKMLKGFQSFDSICTELNK
FT                   SRAEVEQLIESFGAVNIVNS"
FT   CDS_pept        complement(740175..741497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575617"
FT                   /orf_name="CD36_83250"
FT                   /product="Branchpoint-bridging protein, putative "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42844.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG605582"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000192D3E4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT7"
FT                   /transl_table=12
FT                   /translation="MSNRGRQPARPPPSRKRETKWSGKPKRYANFGAQSFDTVITGHLT
FT                   QEQLDAYQRYFRVEEISNFLSVAKQQHKSIVDVLPSAKVDETDHYKRDPSPPPKYDKNG
FT                   NRTNTRERRITEALEKERHELVELAASSIKNYMIPSNYRRPSRTVERLYVPVKDYPDIN
FT                   FVGFLIGPRGNTLKKLQEDSGARLQIRGKGSVKEGKSSDGFGSSQGGTDIQDDLHVLIT
FT                   ADSPLKISKAVKLVNEIIDKLIYSPQGMNFMKRDQLKELAVLNGTLRETKPFDPEAHQK
FT                   KQQQQMDITKIVCKICSNIGHIARDCKQNTGKRPFEDNAENTHETANKKARTDVPPPPP
FT                   PPPPIPPSSNTENSKQVHPPPPPPPPPPPVASASATSVSLNIGQVPPPPPPPPPPPPHV
FT                   RLAFDFSSGTESNSKASSTTENEGSGSSTAPPPPPPSNIPR"
FT   CDS_pept        complement(741673..742347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575618"
FT                   /orf_name="CD36_83260"
FT                   /product="N5-glutamine methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX42845.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG646581"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000192D3E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT8"
FT                   /transl_table=12
FT                   /translation="MQDMLPTPTVKNIDYEEVYEPSEDSFLLLDCFEKEKDYLQSKFKT
FT                   GIPLVTEIGTGSGIVTAFVAKHIVQNGIFLTTDINPHACKTVLQTVKYNNDDGSSICLL
FT                   GSTQMDLTAAIKEQEIDLLIFNPPYVPSSEIPDIPKTKNDPVWLDLALVGGEDGMVITW
FT                   KVLNNLNNILSKSGVAYILFCARNKPENVASVMQSKGWNVEVVINRKAGWEVLSVLKFT
FT                   RI"
FT   CDS_pept        742541..742774
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535856"
FT                   /orf_name="CD36_83270"
FT                   /product="Ubiquitin-like protein with similarity to
FT                   mammalian NEDD8, putative"
FT                   /protein_id="CAX42846.1"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI000192D3E6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDT9"
FT                   /transl_table=12
FT                   /translation="MQIKVKTLTGRDMPLDVEPQDKIIRIKEMMEEKEGISPAQQRLIF
FT                   NGSQLNDDQTVQEAGIQAGASLHLVLTLRGGN"
FT   CDS_pept        complement(742866..744959)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575619"
FT                   /orf_name="CD36_83280"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42847.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG611628"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192D3E7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU0"
FT                   /transl_table=12
FT                   /translation="MNESSTREHQVTSKEILDVAFEKSKSKFTTPRQTIQDTEELQSYQ
FT                   QTKRKEFEQHINKNRLNLGQWTRYAKWEIENNHDFPRARSILERALDVNVQHIPFWIQY
FT                   IQLELSHKNINHARNLMERAINTLPRVNKLWFLYVQTEEMLKNYQMVRVIFERWLDWHP
FT                   DTSAWDAYINFEARYEEKENVREIFKKYVYEFPNAGTWYKWIKYEMENNRDDVKTIRAV
FT                   FESAVDTLLSNKSEDDEVAIIISNWTSWEVSCGESGRANEIFKLLLDNQNNKLEISDKT
FT                   KSSIYTAFVEFEKTFGSKDSIEQSVLLKRRIKYQEEIQNDPYDYDSWWKYMTLLQNSSN
FT                   KSDLENAFKKVTGNVVDDKHKSIKWRRYIMFWIWYAFWEEMTNNDPDSARKIWNDCLKV
FT                   IPHKSFTFAKVWIGYSEFELRNSEDGLAKARKILGRAIGQTSINRPKTKIFKYYIDFEK
FT                   KLGDWNRVRLLYQKWLEISLSTTSSSELVVEKYVEFESSIEEYDRCESILSAACQLSEN
FT                   PEYSSSFNLQRLFEITVEFYKEEMRYDKIRELYRALLEKDPTAHNWISFALFESSIPSP
FT                   EQLEEYLQGNNEEFEATVDESQIENTRKIFEEAMTFFKDKDDKDSRLVIIEAWRDFEEV
FT                   NGSDESLAKVTKRLPVIVRKRRTVGSIEEEYIDYIFPDDETKKLPGKMSKFLANAKKWA
FT                   QEN"
FT   CDS_pept        complement(745387..745671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575620"
FT                   /orf_name="CD36_83290"
FT                   /product="DNA repair protein rad50 homologue, putative "
FT                   /EC_number="3.6.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42848.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG398460"
FT                   /db_xref="InterPro:IPR019342"
FT                   /db_xref="UniParc:UPI000192D3E8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU1"
FT                   /transl_table=12
FT                   /translation="MQPYSRSGGTRRCFYEFQSWMSCVTSADTTSVKQCKPVFEDYEEC
FT                   LHGLKEKEKVRLMLQQLKDNETSKNGVTASELYKASNTIYENLDLIKRE"
FT   tRNA            746399..746492
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        747579..749156
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383095"
FT                   /orf_name="CD36_83310"
FT                   /product="Purine-cytosine permease, putative "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42849.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396658"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI000192D3E9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU2"
FT                   /transl_table=12
FT                   /translation="MAENYDLEQQVTKASKTNFNVEKIVIDKSNDEGDPLTTTIEQPPT
FT                   SDSSLKATNWVDKIGLKINAEIRGIERVPESERHDNSLLSPFLVFLSPNMVISGLSIGS
FT                   LGPVAYNLDMRTSIVIITIFCFLGSIPVGFFSAFGMRFGIRQQILSRYFTGNIMGRIFA
FT                   LFNVISCIGWNAVNVIPCAELLNSVGPLPPWAGCLILVGCTCIFAVFGYKTVHLYEKYS
FT                   WIPNFIVFMIIIAKFSQTHAFNWGERKSGPTEAGNVLSFISAIFGFTVGWIPSSADYTV
FT                   YMPANTNPWKVAFAMTTGLSLPAMFTALLGAAIGTSVNLNGSRFEQAYNKNSTGGLVYE
FT                   ILCGDNNNKGYRFIVVVFALGAIANGIPGSYSLSLAIQCIWSQFARVPRIAWCILGNLV
FT                   ALAFSISAYYKFQDTMSNFLSIIAYNVSIYLSISLTEHFIYRRGFSGYDVTDFNNYKTM
FT                   PVGIAGVVAFCFGICSTVLSMNQTWYQGVIARKIGDNGGDISFEMNIMFAFIGYNLVRP
FT                   FELKYFGR"
FT   mobile_element  750951..752705
FT                   /mobile_element_type="retrotransposon:iota H, Tcd23, LTR"
FT   CDS_pept        751278..752465
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575621"
FT                   /orf_name="CD36_83320"
FT                   /product="Retrotransposon tca3-like polyprotein, putative "
FT                   /protein_id="CAX42850.1"
FT                   /db_xref="UniParc:UPI000192D030"
FT                   /db_xref="UniProtKB/TrEMBL:B9W8T6"
FT                   /transl_table=12
FT                   /translation="MARNQKKQEQESVPETPATTSSAAEQAAGQTIDQGPEAQMFVTAD
FT                   QFAEFRQQVMEMFKQQSETITNQIYKVINETNAAQAEAIAVNRERENVLDEQAKRIVEG
FT                   AQEKFDHVDEHVDAQAEFIQATAQKVDELAAKMEKQRSNPTFGHDNDAPPGQWNVPPTA
FT                   DHAFGPPPSQAYGAPPNEFGFEPYEDEPSPVSPREIAAQIRRVMPTFMVQAFPPSPPEA
FT                   EFIEEVAMLRLHELVVKGKSVDKHNDAKTQKMAYQKMMSAPFGIPANFQKGQWVYRRRK
FT                   KSAKNQYNFDGPFLIEEVRNNNSYIISRNGKREKGTYHHDMLKPAFALEDSPITALSNF
FT                   QKSMQEIEHRVLGKMFDEIKVRVIMLSDIMKNRKPVKIDAVMTHPQFYERERVML"
FT   CDS_pept        complement(753564..754112)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535857"
FT                   /orf_name="CD36_83330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42851.1"
FT                   /db_xref="HOGENOM:HBG396657"
FT                   /db_xref="UniParc:UPI000192D3EA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU4"
FT                   /transl_table=12
FT                   /translation="MAYATTSTTSNNSSYYDDDIFEMNLEDNIPSSYVDYENTNNYTTT
FT                   TTNIPALTSSRSTSIIASGNESSLPPSPLVLPQQMSTSPLQPYYSYTYNSSSSSSSSPY
FT                   STFANEDQDQHDDDQFLYECCICKQKLNNSNNNSHNCTRDLFNGNALNDNDLIIIENNK
FT                   LIQNNYQKWLYNFTPNIPY"
FT   CDS_pept        759144..761618
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575622"
FT                   /orf_name="CD36_83340"
FT                   /product="Nuclear regulatory subunit of serine-threonine
FT                   phosphatase, putative"
FT                   /protein_id="CAX42852.1"
FT                   /db_xref="HOGENOM:HBG396656"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000192D3EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU5"
FT                   /transl_table=12
FT                   /translation="MSDNYRLSLDSLLPIEIIYQILHYAGIENLVQLLPTPACAYHECF
FT                   FIQNNPNIKRAIDNLIVASNITFNNRLVQCSLIHIYLRTRSYLQKHNLRFLPSKQSTLQ
FT                   LLSYCQSQNISIIITISYYVSTFSDLWDFIELLKSQHQTDSLIRYNLELEIIPGFLYNF
FT                   NLNYVFDQIADSIGPLVETIMVYNYSGSFIFKNENFPYLKNLWFEDSNIKFNSNLPSTI
FT                   KLLHLYPNRFGWNNNEPIIIKHQLPYQLEKLNIGNCTIKNQATINNLDNLSSITLYMVK
FT                   DSSTNSSGQYIKQLVTNNLVNKKLNSLKVDFIWDSQRNLLHLPQLLLPNNDNDSDNERK
FT                   FTCEKSMKNLQTLSVTNYIPTGVSNWKNLTSLKISRINNPQIFENCGKFPDSLQNLKLP
FT                   NNNIKDLSVIDRLIDPTNVANTRLKYLSFSDNPIDWNLYIPNFTRFTRLKYFKLSNTQI
FT                   GKNFHKLNYPDSVEELSLEVNQISSIEGIKFPKNLKNLGIGSNWIKKIYRPHLPYTIET
FT                   IHLTENKLTQVDLSCNNQGQKLLIEILYLNFNPLSNFKQIKLPKHLKILNMDNCKFKSI
FT                   SNIEFCSSLVELSFNGCELFRFENVSWSEEEREEEEEEEENDRSQLSSPGLKYLNLSQN
FT                   ELTHLNARFPSTLQVLNLSMNKLSNLTGPLASTLQDLDQLQVLNLSSNQFQKFQIHFNS
FT                   TNLKVLDLSFNSLKSINLTFPKNTITKLQTLNLCSNKLTFVNDIMIGHNKNLTQHENLI
FT                   EIDLTNNKIKSINNNDNGGILQLSHFPQSLKCFFIGHAGQQDRFGYDMAKNVIIDKDSN
FT                   NGLCKTKRIDIP"
FT   CDS_pept        complement(761808..762335)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575623"
FT                   /orf_name="CD36_83350"
FT                   /product="Adrenodoxin homolog, mitochondrial, putative "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /protein_id="CAX42853.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG524254"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="UniParc:UPI000192D3EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU6"
FT                   /transl_table=12
FT                   /translation="MFRLIPRLKPIIPSINRISVSIKPPLPPPTSPSTPQQCHVLRAFH
FT                   TSPISHHGHLKKPNPGEELHITFITKDGKQLTYEVAEGDNILDIAQAHNLDMEGACGGS
FT                   CACSTCHVIVDPEYYDKLEEPDDDENDMLDLAFGLTETSRLGCQVKMTKELDGLRVALP
FT                   AMTRNLQSRDFN"
FT   CDS_pept        join(complement(763392..763485),complement(762714..763279))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575624"
FT                   /orf_name="CD36_83370"
FT                   /product="Vesicle transport V-snare protein, putative "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42854.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG384598"
FT                   /db_xref="InterPro:IPR007705"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000192D3ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU7"
FT                   /transl_table=12
FT                   /translation="MSESFNTYESEFQFAIQEAQTKISQINSVDAEQRKNYLKSIEGAN
FT                   EEAREVLDQMTIEVSNLPSNQRSSYNAKIRNYRTELDNLTVTYNKLLDAQDKVELFGSN
FT                   RYTDGGVGGDTSEQRKQLLSNNSSLERSSQRLHDSQRIAMETENIGSNILNDLRSQREQ
FT                   INGARNTLSQADNYVDRSVQTLKTMGRRLTANKFISYGIIAVLILLIFLVLFSKFS"
FT   CDS_pept        complement(763768..766905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000011547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383096"
FT                   /orf_name="CD36_83380"
FT                   /product="Glucosidase, putative"
FT                   /function="mannosyl-oligosaccharide glucosidase activity "
FT                   /biological_process="oligosaccharide metabolic process "
FT                   /protein_id="CAX42855.1"
FT                   /db_xref="GO:0004573"
FT                   /db_xref="GO:0009311"
FT                   /db_xref="HOGENOM:HBG330830"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI000192D3EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU8"
FT                   /transl_table=12
FT                   /translation="MDGSTPEEKRLKDIKFRQWGSYVGERQWATVREDYSADGDAWSAL
FT                   TFDDSRSRAYRWGEDGLAGVSDRKQFVNVTMALWNGKDPILKEKLFGVTNSQGNHGEDV
FT                   KEQYYYLDNTPTHSYMKYLYKYPQNEYPYKQLVEENQKRSRLEKEFEITDTDMFKNNEY
FT                   FDVVMESAKGDAPDELYFRITAYNRSDKAASLHILPHCTLRNIWSWGADEYQEVKKPHV
FT                   KQIDEYTIEVETEKFGKRYLVFAPSPGFEETDPDVEPQLIFTENETNTKKLYNQENKSK
FT                   YVKDAFHEYVVDGKQEVINPEKQGTKAAAWFTFNDIPAGEYVTIRYKFTNDSSEVDEFE
FT                   LDNIISKRQAEADEFYWHITPYPISDDLRQVQRQGFAGLLWTKQFYYFVHNYWANGDPN
FT                   TIKPPMNRANGRNKEWKHLYTDEILSLPDKWEYPFFAAWDSAFHCIPFAMIDPRFAWMQ
FT                   LDHLVREWYMHPNGQIPAYEWNFSDVNPPVHAWAAYRVFKIERKMYGVESLDYLESIFQ
FT                   KLLINFTWWVNRKDAEGKNVFEGGFLGLDNIGVFNRSEELPTGGSLEQADSTGWMAFYS
FT                   LQMLNIALELAKTRPVYENIASKFFEHFIIIADAMTFRGGDGDDSTKDALWDDKDKFYY
FT                   DAIRYSDHHVESLHVRSLVGLIPLYASLTIEPDLLNRYPSFKKRLNWFLVHQKKMSERN
FT                   IASMETRGVGERMLLSLVSKERLLAILDRMLNEDEFLSEYGIRSLSKYHKDHPYVKEVN
FT                   GEKFTVAYLSGESDSGMFGGNSNWRGPIWFPTNFLLVEALQRFYLYYGPDLKVECPKGS
FT                   GDYLNLAQCAQEIQHRLIRIFLPDEAGDRACNGGVEILNRDPLFKDYVPFYEYFDGDSG
FT                   RGLGASHQTGWTSLVTKWIHDNAASNRVPRTPQTPKNRRRESVFLHASEEANDDDEEEL
FT                   QKYVPKCGPMPGTLARRKSGKSLLNLTVNALDLGDDEGNATTKAAVCGQLNEGKSISEE
FT                   ELERLHKVQSGASIDSNEAAQIDSDLLGQVRAAFKKFRTRTEEDEFEGDEFETRCS"
FT   CDS_pept        complement(767857..769581)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383097"
FT                   /orf_name="CD36_83390"
FT                   /product="Mitochondrial external NADH-ubiquinone
FT                   oxidoreductase, putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42856.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319217"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000192D3EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDU9"
FT                   /transl_table=12
FT                   /translation="MFTRSLVKGSGRIATTRSLVNNSTSWVLKNQFKKYSTSTPPKVTK
FT                   SKSSTIGKIFKYTLYTAVISVIGSVGFIGYKIYEESQPVDQVKQTPLFPNGEKKKTLVI
FT                   LGSGWGAISLLKNLDTTLYNVVIVSPRNYFLFTPLLPSVPTGTVELRSIIEPVRSVTRR
FT                   CPGQVIYLEAEATSINPKTNELTIKQSTTVVSGHSGKDTSSSKSTVAEYTGVEEITTTL
FT                   NYDYLVVGVGAQPSTFGIPGVAENSTFLKEVSDASAIRRKLMDVIEAANILPEDDPERK
FT                   RLLSIVVCGGGPTGVEAAGEIQDYIDQDLKKWVPEVADELKVSLVEALPNVLNTFNKKL
FT                   IEYTKEVFKDTNINLMTNTMIKKVNDKSLIANHKNPDGSTETIEIPYGLLIWATGNAPR
FT                   NFTRDLISKVDEQKNARRGLLVDERLKVDGTDNIFALGDCTFTKYPPTAQVAFQEGEYL
FT                   ANYFDKLHAVESLKYTIANPTPKDNVEKLSRKLARLEKNLPHFIYNYQGSLAYIGSEKA
FT                   VADLVWGDWSNISSGGSFTFLFWRSAYIYMCLSVKNQVLVVLDWAKVYFFGRDCSKE"
FT   CDS_pept        complement(770668..771267)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575625"
FT                   /orf_name="CD36_83400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42857.1"
FT                   /db_xref="HOGENOM:HBG396653"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="UniParc:UPI000192D493"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV0"
FT                   /transl_table=12
FT                   /translation="MTEIHLDQTFQKIPEPIKFVSIEDLNAFPLPKTLESLPPSVFQQF
FT                   LDSKDLLQGYLKQLKAYQEKQQEIIDQLDDLDNILGNVIHKQLIKDYTALVDKINQQIK
FT                   SINIIYQEFLNLETYQYQLLSNNFNQDILKLKFKKLLEKTNQESLNIVKDYHETAESTE
FT                   DDLNNMFENFKESRKLYHSRKEKLYRWEEERVSGFV"
FT   CDS_pept        complement(771487..773412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078840"
FT                   /orf_name="CD36_83410"
FT                   /product="Polyamine transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42858.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D494"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV1"
FT                   /transl_table=12
FT                   /translation="MDSKKTSFESNHKELSASSSNESNEVLEFTVSNYETLQQQQKENG
FT                   NRRNSVRRKSLEAIKKCITGESKYESAETKDYSVHHIYGDLDSDAIEIQRTQTRNIILT
FT                   KLESRVEDNNNTYNDEHEVECQDTISVIPDTNIEISQHGKEFNTIDPELITWNGSDDVE
FT                   DPRNWPINKKVFLLGFVSLYALVAPMSSSMLSPAMTFIAKDFHITSPIIKSMVVSIQIL
FT                   AWAFGPLIIAPLSEHDYIGRKLVLDVSCWMSLFFNLGCAFSQTTAQMMVCRFIGGLFGC
FT                   VPMNVCAGVISDMFDAQSRNAALAGYSLVPLLGPVIAPVISGFIVDHKQWRWTFYVLCI
FT                   FNGFVAITATFLFKETYSPTLLKRKAKKLREQTGNANLHTIYEIADGETKLGKIWICMV
FT                   RPIKLLFTHPMIVGLGSFMAFTYGFMYLMIVTFPEIFGNQYGYSKSVTGLMYIPMGIGF
FT                   IIGVIFWTYMVGNVYERLTRRNNGVAKPEFRLPCLIASSIFIPIGLIWFGWSAQRKLHW
FT                   IMPGIGSAIFAMGLVCVFQTIQNYLIDMNVRYAASSVAAAALFRSLFGFSFPLFANKMY
FT                   SALGYGWANTMCAFIGIFLGVPFPIFCYMYGEKIRHWADKRIEKEQLRRDQKNLEKLKL
FT                   KNDSVV"
FT   CDS_pept        complement(774004..775959)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575626"
FT                   /orf_name="CD36_83420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42859.1"
FT                   /db_xref="HOGENOM:HBG396652"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000192D495"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV2"
FT                   /transl_table=12
FT                   /translation="MKLHLSTYSYKNPNMDVTNLSKSKLILFTMFCATLLFIVTSSRYL
FT                   TGSESFGVVPSEIPKPTVELNEEFSHQITLKLQELASFDKFNSFPLIDKHMKDDIYRSM
FT                   TLETFTDPLPYLENYNEEEYSESNYPICSEKLAFPNEIKSTKQEYLPADLQQFLEILIN
FT                   MKPYYNMIEKAKSYFISDLPEKKKWFRFAGSSIWLPQFKCHYMVSRYLYSPNGVANHAF
FT                   ASFLYIQLFDSDWKELPPNTTLDIPFEQTPTDSIFKFYKSKQRYADFRNSTYPQILPIP
FT                   FDYKLPTETKKYYYGPEDPRILLRTNPLGFDEPLIVFNMKGLKLTKRVMYSYLPFSNTL
FT                   KLLKKRQEPFANIEKNWTPFKSVAQPSRVQTTIHFIYSMIPLEVLACDIDSGLCDILQK
FT                   PAKHDYNYVGGLRGGTQLVSLPLNETIPSEIRTKLPIPKNRQVYIGWARTHLNNCGCGD
FT                   SMYRPNFITLVEDYDEVNDKYYYKIGDISGYFDFAAKIEPWSKQVLDEEGNLYEKAEQC
FT                   EGRNVLIPNSIAYWDVESIQLAGIEYHKQNFQEMFSNGKVPDFSANEIVFNDYMGVTLS
FT                   SADRDVSIVHVKGLLNYILQLPSLIDDSLVVNNEVTFQKKGHDLNVRCAMIASKEYCKS
FT                   YAIKHGVKIDENPDET"
FT   CDS_pept        complement(778624..779433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575627"
FT                   /orf_name="CD36_83450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42860.1"
FT                   /db_xref="HOGENOM:HBG396651"
FT                   /db_xref="UniParc:UPI000192D496"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV3"
FT                   /transl_table=12
FT                   /translation="MISKLIGVTYFKNKLSKHSSKHDDSISNKNNDTSFPTNNSTTLPS
FT                   KRSSICIAHRIKSKRNSSASSSSTTSPTSQSPTSAALTSSSSTRKIVTRSQIRRSNTIS
FT                   TASALRHSLNVSNTNSIPIAIPKKSFSLPNSPSLTSDSTLNEPIDDIPHFYNTTTDTNG
FT                   IGNRYYGTISSTNNLMGRDGLLTLDLTTNNDTNSLFTTATRERLDNDSIVIDEPEQEEY
FT                   NKDSKYTYGYGYEFTSSAAVAAVEGTKIAGLARSISKTKKKNVRFIP"
FT   CDS_pept        782455..783930
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230220"
FT                   /orf_name="CD36_83470"
FT                   /product="Succinate-semialdehyde dehydrogenase, putative "
FT                   /EC_number="1.2.1.16"
FT                   /function="succinate-semialdehyde dehydrogenase [NAD(P)+]
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42861.1"
FT                   /db_xref="GO:0009013"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000192D497"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV4"
FT                   /transl_table=12
FT                   /translation="MAPKLNNPNLFQNKPFINGQWYDSKSTSTFKVYDPATQELIIELP
FT                   DQTPEEIDEAIAITHKAFQTYQRTPVYDRAKWLRRMYELMMENLQDLATLITWENGKCL
FT                   TDALGEIKYAASYFEWFSEECKRNYGHTIQPSNQNNKVITYKQPVGPVGLLCPFNFPSA
FT                   MGARKAAPALAAGCTCILKPDGQTPLSSLALGYLAQQAGFPDGCFNVVLTSVTNTPMCG
FT                   LKFCQSPELKKISFTGSTNVGKLLMQQSSSTLKKLSMELGGNAPIIVFNDCNLDLAVDQ
FT                   SITSKFRSLGQTCVCANRIYVERGVYDEFCDKFVDKVNQFKIGNGFEPGVTHGCLINTK
FT                   AIEKVEDHVQDAVGKGAKLIVKGGRLPQLGENFYSPSVVKDVTQDMKVVKEETFGPLAA
FT                   IIPFDSKEQVLQWCNDTPYGLASYIFSENLNTVWYMSEFLENGMVSVNTGLFTDAALPF
FT                   GGVKESGFGREGSLYGMDDYTVIKSITLGNVYN"
FT   CDS_pept        complement(784114..785676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078841"
FT                   /orf_name="CD36_83480"
FT                   /product="Alanine aminotransferase, mitochondrial, putative"
FT                   /EC_number="2.6.1.2"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="L-alanine:2-oxoglutarate aminotransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAX42862.1"
FT                   /db_xref="GO:0004021"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D498"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV5"
FT                   /transl_table=12
FT                   /translation="MLRVNSRLLITRKSQFMFTSTSLRFLATFKPANPLTTHDINPQTV
FT                   EAKYAVRGKIPIIADELNELIQKQPQSHGLPFNKIINANIGNPQQLEQRPLTWYRQVLS
FT                   LLQYPDLLKNGDPEIVKSLYPQDVIERARSILKHIGSIGAYSHSQGASYFRQSIAEFIT
FT                   KRDGGYVSHANNIFLTSGASTAVSYLLQILSVNENSGFLIPIPQYPLYTATIALNNAKP
FT                   IGYYLDESNHWSTNPQEIRKLIETNQQQGINIKALVVINPGNPTGAILSSQDIIELIDV
FT                   AAEYGIVLIADEVYQENIFKGKFVSFKKILSELVEQDPQTYQHVQLASLHSTSKGVSGE
FT                   CGQRGGYMELVGFKPEVKDVVFKLASINLCSVVSGQALMELMINPPQEGDPSYPLYKSE
FT                   TESIHNDLESRAESLYQAFLQMEDIKCNKPMGAMYIFPTLDFNPAQYHKLYSRAKNSNL
FT                   QIDDIYCIELLENTGICCVPGNGFGQKPDTYHLRTTFLPPGKEWIDKWINFHKSFIKKY
FT                   KDE"
FT   CDS_pept        788350..789159
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535858"
FT                   /orf_name="CD36_83500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42863.1"
FT                   /db_xref="HOGENOM:HBG396650"
FT                   /db_xref="UniParc:UPI000192D499"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV6"
FT                   /transl_table=12
FT                   /translation="MSRHSSRKCSLAIESPINDACNNPLNAFLIYSGDTDINSNNNSNG
FT                   DDGMATPDESMSPLSSSLLLSPMTPPGSRNTTQPSHQHLVKSRRRPSMIKSTSLPELTA
FT                   MSTNTITSPPLSALTTNSSTHAILGNRRISICDLDNFTGEIDYVKQQQHQQQQQQLYGS
FT                   DAANFMYCNLSTSDIVQTPRKFSFHHRPKTAPATMPGNGNETPYNGNHEYGLKQQKESM
FT                   EIEEEETEAVQDPQLPRHYIENLASFQFRNHKRRNSIALKFEEPKIL"
FT   CDS_pept        790802..792964
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383098"
FT                   /gene_name="KRE6"
FT                   /orf_name="CD36_83510"
FT                   /product="Beta-glucan synthesis-associated protein,
FT                   putative"
FT                   /protein_id="CAX42864.1"
FT                   /db_xref="HOGENOM:HBG735630"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000192D49A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV7"
FT                   /transl_table=12
FT                   /translation="MARRNLTKNTNGNGYQETNPFDNQANQNYNNNSTRQSYPGFTDPF
FT                   DSSNRLDDGSFDFENHSSYPSSSTSTSSIVNQYGRPFTVNNGLSSSNGSSGSHLLQGQN
FT                   DYNLSSSPNLQHHQQYLQGAENDKSSSLVNSNINNIKVDVPYDYDRYPKIIGRASSSNS
FT                   LNNTSNNAPYQSDTPSISSNSFSKNPNNTLNSSHNNMFDFSPFGGYPASSFPLNIDEKE
FT                   PDDYLHNPDPVHDVIYEKNRFWNDLKTADRKSFGGILGFLFLIAAAVAVFVVVPALTYS
FT                   GVTTHSPPEEYEILTHYSYPSLSAIRTSLIDPDTPQDAMTMKAKDGTNWSLVFSDEFNI
FT                   MGRTFYEGDDQFWTAPDLHYDATKDLEWYDPDAATTSNGTLNLQMDAFKNHNLFYRSGM
FT                   VQSWNKLCFTQGKIVISARLANKGTVSGLWPGIWTMGNLGRPGYLASTEGIWPYSYDSC
FT                   DSGITPNQSSPDGISYLPGQRLNKCTCPGESHPNRGVGRGAPEIDVIEAEISTDVTGKK
FT                   ENLGVASQSLQLAPMDIWYYPDIDYLEIYNTSVTTMNTYTGGPFQQALSGTTTLNKTWY
FT                   ELGGDGVHNFQTYGYEYLNDKEKGYLRWFVGDDPTLTVYPQALHPNGNIGWRPLSKEPM
FT                   SIVMNLGVSNNWAYIDWPSLSFPSTFRIDYVRLYQPPNQINVGCDPADFPTSDYIEEHI
FT                   NVYQNVNLTSFEDGGYSFPKHSLIGC"
FT   CDS_pept        complement(793367..795490)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575628"
FT                   /orf_name="CD36_83520"
FT                   /product="Nuclear control of ATPase protein, putative "
FT                   /protein_id="CAX42865.1"
FT                   /db_xref="HOGENOM:HBG396649"
FT                   /db_xref="InterPro:IPR013946"
FT                   /db_xref="UniParc:UPI000192D49B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV8"
FT                   /transl_table=12
FT                   /translation="MDLISLGLTPRKSKKILQIINNNRVSRDIKHEFDQLNSYTKAFLV
FT                   NQLSIEGSQQEKQENQGHQFNGEVNDNVLQVFQELYFLLDVENFKFNHVYTDIDLNKLK
FT                   LIYMKLASIGGNESLNNNTKTILEIIERYIILTTTLSLTNSLIYKTLILKNQQVYWQAL
FT                   NNSSTINKLIYFMQTSPIKLYNFGCDIFVKTKRILFHSDNNNNNNNGNGLYQLSSQSGG
FT                   KEEDNIISRYLLVIKNVCKLAFNGLITSIRQQSPPSISFILLSNDRTRTKHKHKQRTLS
FT                   IKWYLHSIKSVIKFPINLVVKEAKSKLRKIDDEIAINIGNIDKLIKTNPKDYLEALSVI
FT                   LQLDSTQDQLISQNLNAAAYQKKKNMILQAMEHVVKFDKKSYDITSSPGFLTRYWIIIA
FT                   LIIFYGPSQTKKVYANRQEIIYWINYNGIEPVVGFFKNWVIKPVYDMLDILRNTSSDSQ
FT                   LSITSKDSLNSEFDSLNSMIYQFAQDNHIDVTESQITNDVKNGDLKIIMSTYENEIKSP
FT                   IKYLITGSLLRLILIQIQKGKVDGAMAINGIDKLLKSQQLLFAMVSISPSILILYQMYR
FT                   ILANSGKSNGSGAGSIIINGKQLNIVCLKCLNNIENLLILLQLQEKKPQQEDEQNKRSM
FT                   NGVGNNRHQEFYEGELLIEIINLFVFSSYLIPIDLKDDWINDLNELNNKQFDISTKLDL
FT                   IRKIWNMYGAYFR"
FT   CDS_pept        complement(795803..796558)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575629"
FT                   /orf_name="CD36_83530"
FT                   /product="Proteasome subunit, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAX42866.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000192D49C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDV9"
FT                   /transl_table=12
FT                   /translation="MSRRYDSRTTIFSPEGRLYQVEYAQEAISNAGTAIGILSSEGVVL
FT                   ACEKKVTSKLLDDDGSAEKLYIINDQMICAVAGMTADASILVNNARIQAQQYLKMYDEE
FT                   IPCEMLINRVCDVKQGYTQHGGLRPFGVSFLYAGYDDRYQFQLFTSNPSGNYSGWKATS
FT                   IGANNSAAQTLLKKDYKDDLTLKDACELAIKVLSKTMDASNINSEKLEFATLSLGKDNK
FT                   VLHKIWNDKDIDILIKASGVLNEKNSDDE"
FT   CDS_pept        796937..797404
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575630"
FT                   /orf_name="CD36_83540"
FT                   /product="Uncharacterized protein ypr153w homologue,
FT                   putative"
FT                   /protein_id="CAX42867.1"
FT                   /db_xref="HOGENOM:HBG326704"
FT                   /db_xref="UniParc:UPI000192D49D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW0"
FT                   /transl_table=12
FT                   /translation="MTIFISSTNVPLGYIVPQFPSLFWPVGSTRPSYLNSYLYYSWDIW
FT                   RFTVFWSLLLSGSFYLIVGIIASMSSFTNKFRHNLKFGKRDMLACVFIVVFYVFAGLLK
FT                   GFIGGAIIGVIIAAIYQAGSLTMSTWIPLTWAMIQVLYDIVSSYSTSQIIL"
FT   CDS_pept        797786..799309
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230221"
FT                   /orf_name="CD36_83550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42868.1"
FT                   /db_xref="HOGENOM:HBG396647"
FT                   /db_xref="UniParc:UPI000192D49E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW1"
FT                   /transl_table=12
FT                   /translation="MTDAFDIDYLFINQLAFTFNKYISLPSSGIPRSSIINTAKQCLNY
FT                   MKRYEIIHPIAEILVDYLSKEASLESNFSTQWIESTRSLNGLYLEQVKAEIKQTLETSM
FT                   QSLSSNEAEALFGKIKRAIAITIVQTNYDTGLSLLNNYVAVVDISTQPKTKEQLASNGY
FT                   IEFLFYQYVLHIFSSIWFPLYYNELHGYNLSQRQFSGTYEIKANIISNFFKTLEQIYFK
FT                   AINYYHKNELLFGQYDKETHYLWAIKFFNLCLLFKQFKLSEFHDQFIEFFLIEKDPLSF
FT                   LIGNMKILSSSLLVMFGITTIFLKPFNELTLMKLDKDDALIDLFTEVPESLEFQLYNSI
FT                   MIPLAKCEFKQVIVQLQNKKFDAELVAQLEYNLPVHFKNASGTNGSSLINYMASIIDYK
FT                   NFFVILTSSRKVSRLQMIELMGHDTTDDRSATELTNALIGIIVALGLHKYGIYYDAENQ
FT                   MFVNDEMIKDSNADDVAKLQENINELKNELRAESLATKMTGLLLDKYYR"
FT   CDS_pept        complement(799361..800563)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078842"
FT                   /orf_name="CD36_83560"
FT                   /product="Ubiquitin-like-specific protease, putative "
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42869.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG396646"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI000192D49F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW2"
FT                   /transl_table=12
FT                   /translation="MLILLWLIVPDLINQFFFLLVGFVSFRLSSIVTAPEHTDVEFLKI
FT                   LIENMASVIYDEHKGYCITNEPTNKVNDNEGMINNGLQALPWNLYLPEETDDSSSAPDN
FT                   TPTPPPKPLTKQEKREAKQLKKINASRRRKLKREQELDNKEETKFPDFKPYLAKQELKS
FT                   LFGSIVKRTCQDPKTDTKILQYRSIALYKSDLEHILPGEWLNDNNISLIYELVVQLFIK
FT                   HGRKFSNQIQLLYPSLIQLLMHFPDDVESLLPVDELKSSKLIFLPINFIDEMDANLEDA
FT                   NNGDHWSLGVLSLLDNTLYIYDSMQIDDDEISEIQLKKLVQKLQSCKTIVHGKLKVRYL
FT                   KCDQQQNFDDCGVYVIMITCYLINQLLHQDEMSLDISRVKFNPLDARLYIMKLISRLIK
FT                   E"
FT   CDS_pept        800755..802233
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000008762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575631"
FT                   /orf_name="CD36_83570"
FT                   /product="Uncharacterized peptidase, putative "
FT                   /EC_number="3.4.-.-"
FT                   /function="aminopeptidase activity"
FT                   /function="manganese ion binding"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42870.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG545079"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="UniParc:UPI000192D54A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW3"
FT                   /transl_table=12
FT                   /translation="MKSQFALTLRRFISTRSRLFTTYTTGQPTYETRPHIITQPGDLTP
FT                   GISAMEYYQRRLKLSTHLPSKSLAIIIGNTTQFSSGSVFYDFQQDNDLYYLTGWLEPDS
FT                   IVVIEKRGDNGADDVVLHMLVPPKNPRKELWEGPKSGLEGAYNIFNADMVEDISQAPSY
FT                   LKQLIKQNDYIYWDKKFSSKQNDGLRQFFNFSSNNHHSQDINGIIENSKKSIQKLSPII
FT                   AKLRAIKSEAEIGVMKRSCEISSTAINRAMATVGSDEPIDSENTLARYLEYQFVKGGCE
FT                   KQAYIPVVASGSNALCLHYTRNDDLIKRNELVFIDAGGKLGGYCADISRAWPNSTKGFS
FT                   DAQRDIYEVVLATNKKCITLCSESLGYSFHDIHEVSVNTLKHELKNLPGFGDVTVSDIS
FT                   RIYYPHYVGHNVGLDLHDIPSVSNRSPLKQNQVITIEPGLYIPHDGPKHYRGIGLRIED
FT                   NVVVGKTHRDILNLTSSCKKEVSDVEALVRGCLT"
FT   CDS_pept        complement(802418..803689)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575632"
FT                   /orf_name="CD36_83580"
FT                   /product="Alpha-ketoglutarate-dependent sulfonate
FT                   dioxygenase, putative"
FT                   /EC_number="1.14.11.-"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42871.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000192D54B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW4"
FT                   /transl_table=12
FT                   /translation="MAPTAVTQEPKDVQETIKRLAGLKVIGHSKNSKGIITGYDPEWAD
FT                   KLPETTKQRYAKYGVDISKGYPYIPVNEKVPKFVDEVFAIRNEEYPYIERGKNADPEKK
FT                   SLFDAAEDVIHLTPYIGTEIVGLQLSELTDKQKDELALLIAERVVVFFKDQDLSPQKQL
FT                   ELGHYWGQVEVHPQASRIGEEFDGISVIWQEQQRDRWDLNLTFKQSKKGNSQWHSDLVH
FT                   EKQTAGITHLHLDAIPGIGGETLWSSTYGAYDKLSPALQKFLDGKTAIYRSAHQYLDRK
FT                   DPLKGPKYVEREHPIVRTHPVTGWKYLFVNRSMTVRIVGLLPEESDLILNYLYSVIETN
FT                   RDIQVRWSWQKELGSVKNNKKEEPKQYRGVSALWDNRISNHSVVHSEESIVGRHGTRVT
FT                   SLADTGYYDPNSKSQRESLGLSLD"
FT   CDS_pept        join(complement(805123..805163),complement(804262..805012))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575633"
FT                   /orf_name="CD36_83590"
FT                   /product="Glutathione S-transferase, putative "
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="CAX42872.1"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192D54C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW5"
FT                   /transl_table=12
FT                   /translation="MESKGCEDRFILHWLDDSRTHRILWLLEILQLDYEVKIYLRHPET
FT                   WRGPLQLFDVHQLGKAPILEIFFGDGRPPIKITESGFIIQYLLRVYDKENILNPISQEQ
FT                   QLEVDYYLHYAEGSLQHIQMALLINSVAKHVAPFATKAVVKLITKAINNGYYKHEWYLN
FT                   FQYLEDRLAQNGTGFFVGNKLTGADVILSFPVYENVFDNPGGVREICGEKRDLRKVYPH
FT                   LAKWSRMIKNNPTYKRVTEMMNEEVEDLIAKNPRFDYGKEK"
FT   CDS_pept        806364..807215
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575634"
FT                   /orf_name="CD36_83720"
FT                   /product="Subunit of the prohibitin complex, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42873.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG680510"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniParc:UPI000192D54D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW6"
FT                   /transl_table=12
FT                   /translation="MSQRIADFVSKIALPAGITIALAQSALYDVPGGKRAVIFDRLKGV
FT                   KQGVVGEGTHFLVPWLQKAVIFDVRVEPRVITTTTGSKDLQNVSLTLRVLSRPEVRKLP
FT                   TIYQTLGLDYGERVLPAIGNEILKSIVAQFDAAELITQREVVSARIRQELSRRAAEFNI
FT                   ELEDVSITHMTFGREFTKAVEKKQIAQQDAERSKFLVERAEQEKKAAIIRAEGEAESAD
FT                   VVSKALAKAGDGLLMIRRLEASKDIASTLANSPNITYLPNGGAGGGDSDGSKNSLLLNI
FT                   GR"
FT   CDS_pept        join(complement(808066..808094),complement(807271..807991))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575635"
FT                   /orf_name="CD36_83610"
FT                   /product="Glutathione S-transferase, putative "
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="CAX42874.1"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192D54E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW7"
FT                   /transl_table=12
FT                   /translation="MSDTKIIVHWLNYSRSQRVLWLLEELNIPFELKVYLRNKQFRAPK
FT                   ELENVHSLGKSPVIEVVDTKTGESEVIAETGHIFNYILSNYDTTNILTPTDSKFQSQVD
FT                   YFLHYTEGTLQPKLVALMVHGVAKKRAPFGTKFLMGLLVGGIDDAFYIPDLKKNLNYLE
FT                   DIIHKQHEKGSKYFVGDKLSGADIILEFPVITNIFQNKRGAQQFGAGDVEKTYPHLNQW
FT                   AEDMQREPKYIKAQELVAKHETVKPNI"
FT   mobile_element  complement(808384..808586)
FT                   /mobile_element_type="retrotransposon:solo LTR, kappa G"
FT   CDS_pept        join(809113..809412,809412..810659)
FT                   /pseudo
FT                   /gene_family="HOG000093872" [ FAMILY / ALN / TREE ]
FT   CDS_pept        811781..813361
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383099"
FT                   /orf_name="CD36_83640"
FT                   /product="Allantoate permease, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42876.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192D54F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW8"
FT                   /transl_table=12
FT                   /translation="MSEKKELENQNTNIEPIISFTKEDIQDKEPHVLTTIISPSGKEIA
FT                   ITNDVDQAMKLALEHKGETIELDKAQADKLLRKIDLYLLPIMCLLYCFQFMDKLTTSYA
FT                   SVLGLRKELNMQGDMYSWTATAFYLGYLVFEFPASMLLQRFPVAKTVSVFIILWGMILA
FT                   LHSVPQYPGFIALRTILGMLESSVTPAFTIITSQWYRKEEQFLRTSWWFASNGIGTIVG
FT                   SAIAYGLYQNDGNYSLPAWKLVFVVTGCLTIFLGFVIMAHIPDTPAGAWFLTDEEKLMV
FT                   VERIRTNQQGFGNTHFKKHQFIEALTDHRTWLFFLFALSNNIPNGGLTSFGTILLNEDF
FT                   GYTPSKSLLMQMPQGTVEIVGCVLFAWLCKFLPSRMLMGVIATSITVLAECLLAFCKGN
FT                   SARLAGFYLYLLGPLGFICCLSCVSSNVAGHTKKVTTNAMYLIAYCVGNLIGPQTFIST
FT                   QAPNYTGAKVAIVVCGFVSLFTLIAIYISYHIENKKRNSRPQVDMSHIENYEFADLTDK
FT                   ENPNFRYSI"
FT   mobile_element  complement(813476..813891)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon R"
FT   CDS_pept        814005..815405
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535859"
FT                   /orf_name="CD36_83650"
FT                   /product="Pre-rRNA-processing endonuclease, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="endonuclease activity"
FT                   /protein_id="CAX42877.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="HOGENOM:HBG379306"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="UniParc:UPI000192D550"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW9"
FT                   /transl_table=12
FT                   /translation="MSDTKNIESLILDAGPLITQPATTLQQYAVAYYTTPGVHSELKDE
FT                   YSRQQLAIWGDSLKIKQPKQEYIDRVVKFAKLTGDYSVLSVNDLHIIALAYELECLNNG
FT                   EENLRSFPGEVLKSQQVENENGTSKLSSIIGDDDGFVVATKRRGGRRQREKAELRKKGL
FT                   LPTFSPKPKGDPETEEPDELSNVRASNETSETDSGKESDVQEQKKQEEPAPGSKTAEVD
FT                   EITEEYNEDDDDGEWITPENLQEEILKDKNEQVQESNTTGPLIKVALATGDFACQNVAM
FT                   QIGIKLLNAMSGKQITRVRNYMYRCHACFRLTPMSKDGRPKHFCPKCGGNTLLRCAVSI
FT                   DNETGKITPHLKQNFQWIRRGERYSLPSPLSKNQKKLQGNGGYQHNKENRHKSLQTPLI
FT                   LNEDQKEYQQALKNDEWERKQQEKMLQDWIGGGSADNFVSPFGDTVRNSGVKVGRGRYA
FT                   NSSKKKRK"
FT   CDS_pept        815693..817600
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575636"
FT                   /orf_name="CD36_83660"
FT                   /product="Protein involved in regulation of
FT                   phosphatidylinositol 4,5-bisphosphate concentration,
FT                   putative"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX42878.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG396666"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000192D551"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX0"
FT                   /transl_table=12
FT                   /translation="MSGNGAANAAALAAFNNIGKKKKEPVTKSNGLDNSTNHLGAIGSN
FT                   SNQSKQQLQQPLRIPLPPHPTKKQSTKFSQLKRLNTAPVTGSLQPALQIVSPSISPTRP
FT                   SAPASALDTESDYFSLSPHTFPTKNELAKSPQTPQDMLRNVRQSIELKAIPNNAPAKRL
FT                   SADYSPQEMLKNLRHSIHSRTKTSPMLTTGDRAGQTMLAEMRDRLENTRRIASSSVASL
FT                   SLSPNVDFHKSTSDVSNSSHHYDFDTVSTDSFASFNSSINERHLPHGISIDVTNHDSNE
FT                   DELDDREREEEEDQELVDAGESRSIDDKVTVSNRLRRKPPPGEDFQMSLNDKSRETISS
FT                   GSYSLNPDEIYSFADPDSYENLISEVGAGDTTKLFPQFPDANHYHQHSSKFRKKHQRVK
FT                   PINGIYYHDMDSSNNSDTEESSSNLPSRSTTPLLGQPQQQVHFRSTMRKSNTKKDKKSK
FT                   FNELKPWKNHNELNYLTDQEKKRYEGIWASNKGNYMNQVVIKLHGVNYETRKDPKNDVE
FT                   MEHSRTAALLSAAAVEESNYNGNNSLHNLDSVEINQLICGPVVKRIWKRSRLPNDILEK
FT                   IWNLIDFRRDGTLNKNEFLVGMWLVDQCLYGRKLPKKVDNVVWDSLGGIGVNVTVKKKK
FT                   "
FT   CDS_pept        818042..820066
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078843"
FT                   /orf_name="CD36_83670"
FT                   /product="Histone deacetylase complex subunit, putative "
FT                   /protein_id="CAX42879.1"
FT                   /db_xref="HOGENOM:HBG396667"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniParc:UPI000192D552"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX1"
FT                   /transl_table=12
FT                   /translation="MNLLDMLSKDPPSSLYNPEPEVNIQNNAISFNSNGISNGISISES
FT                   QDTSTINNDSNSNNNNNNNSSSSTPNIIYLPTLLTELQKSLVEMTLHLFSSELLNTVRS
FT                   KRLRTSIDNLLDSSNTIEESDKNTNENKISLCFEQLSMICNHPSLLIDHFIPKKMLLSE
FT                   TIERQLNLSGKLEILNRIIDTLIEEKPSKGYRIIVVANNVKELELVEGIVLGKTLYYIN
FT                   SANAKLFEDRRFIPDLKDKSSNKIFINLLTTQQLYNNYVSDKDGESYDLIFSFDPNLDA
FT                   QTPSIEIFQLENNNQCPILVPIPVFTLEHIGLQLPQPRQIDFTDSIDTALNKWRVKCIN
FT                   TLVVNFFNLDEMSKEFFTENYGLNMKEFWNLMHNDRQSLSKLIQTYNDQLVLSFSDDKL
FT                   IKKLNSFYNRYGSGGFDQISDANCHLFKSKLAEAVYQKFMDIDKEIEEIELNLNGKREF
FT                   ETARQLHYDDDEDFVASTYKRFKRLNDDASVSDRKLARVDTDLTKQKHKLIALNNKLEY
FT                   LMDISDDELTDDELNDDEETSQTRTLESLQQKVEKLKQEFNRINEECDATREKYQSSSS
FT                   VALQLSQKLIRLKQQNEKIDRKISGPGMAQLPELIEKDALLSYELKLKHLEKKNEFMQQ
FT                   FFSSKIESLYQERQQLLENSGSGANNRQNNRASRAATPL"
FT   CDS_pept        820880..822649
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575637"
FT                   /orf_name="CD36_83680"
FT                   /product="Sphingosine-1-phosphate lyase, putative "
FT                   /EC_number="4.1.2.27"
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="sphinganine-1-phosphate aldolase activity "
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAX42880.1"
FT                   /db_xref="GO:0008117"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG657947"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D553"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX2"
FT                   /transl_table=12
FT                   /translation="MIEFNSITIPRNFTEFQLTALQIYFQLKILFLTAYCTQGSFDFNG
FT                   AICLARDVFFGYFVYIQLLKLYRVLRGYGIIESIRKLYRYVSSTVSSQIFLLPFIKSKI
FT                   DKELQSTIVKVEEEIMKNDPQLLQFPALPEEGIEAANVSLELDKLQNLKHSDWINGRVS
FT                   GAVYHGGENLLSLQVEAYKKYSVANQLHPDVFPGVRKMEAEVVHMVLDIFNAPSDGCGS
FT                   TTSGGTESLLLAGLSAREYGKKYRGITEPEVIAPVTIHAGIEKACFYFGMKLHKVELDP
FT                   VTFQVDVKKVERLINSNTVLICGSAPNYPHGIIDDIESLSKVAVKYHIPLHVDACLGSF
FT                   IVSFLEKSKVHGDRKLPVFDFRLPGVTSISCDTHKYGFAPKGSSIIMYRSPKLRECQYY
FT                   IASDWTGGMYGSPTLAGSRPGALVVGCWATLINIGKQGYTKFCYDIVSAAMKVKRAIEN
FT                   DPILSKHLQIIGDPIGSVISFQLAPQQLGNLSIYEISDLLTKKGWHFATLQNPSALHFA
FT                   FTRLTVPVVDELIADLVDATKEAAAIAEEHKKNGVTKPPGDTAALYGIAGSVHTAGLAD
FT                   RLIVAFLDTLYKI"
FT   CDS_pept        823169..824173
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575638"
FT                   /orf_name="CD36_83690"
FT                   /product="Vacuolar integral membrane protein ydr352w
FT                   homologue, putative"
FT                   /protein_id="CAX42881.1"
FT                   /db_xref="HOGENOM:HBG396669"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000192D554"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX3"
FT                   /transl_table=12
FT                   /translation="MPCSISFISTTFSTTSCISWMFAQLPQILENYRNKSAEGISPSFL
FT                   ILWFMGDFLSFTSCLINIDIVLDFQLYLSVFFLCNDVTLCFQYYYYNSVYPRLQQQQQQ
FT                   QSSSSYVSLNTERSDYSKLTMTNNEDRDISIYQAQDIQQIKHANSNQSTSEDCINSTPS
FT                   SYNSINDNGNGNIIKKSIVGAILNTSHAAALPITTETFCKRDTDGNSTSSVGLYLAWGC
FT                   TLVYCLSRCPQLYKNYKRKSVNGISPLLFASALMGNLTYTLSILTSCEFAFGSNRQGFI
FT                   LKELPYILGSAGTIVFDIAYFYQKYLYRNNGGNTTAMTLESWSDIETRRTNDN"
FT   CDS_pept        complement(825359..825661)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        826047..826985
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575639"
FT                   /orf_name="CD36_83700"
FT                   /product="Vacuolar Fe2+/Mn2+ transporter, putative "
FT                   /protein_id="CAX42883.1"
FT                   /db_xref="HOGENOM:HBG748253"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniParc:UPI000192D555"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX4"
FT                   /transl_table=12
FT                   /translation="MSLVAIKNGISKLVSKKDASDAELERVERLIDSNQIPYGSTDSND
FT                   ERAQQIAREEAIIQAAASISAASSSENKEGEGVDSITAFFNTFDPRVMSDIIIGLSDGL
FT                   TVPFALTAGLSSLGDSKLVITGGMAELVSGAISMGLGGYLAAKSESEYYFSQVKKEKLE
FT                   FFKKPEAINQDAAEIMFELGASEQTIISFLKDLDAKPKNLIDFVIRYGKGLEEPAAGRE
FT                   LTSALTIGASYFLGGFVPLLPYFFTKEVGTGLIISVVAMLVVLMLFGYFKCSISMGEGC
FT                   PNHKKFAAGFEMVVVGSIAAGAAWGLVFLIE"
FT   CDS_pept        join(828117..828145,828220..828940)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575640"
FT                   /orf_name="CD36_83710"
FT                   /product="Glutathione S-transferase, putative "
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="CAX42884.1"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192D556"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX5"
FT                   /transl_table=12
FT                   /translation="MSDTKIIVHWLNYSRSQRVLWLLEELNIPFELKVYLRNKQFRAPK
FT                   ELENVHPLGKSPVIEVVDTKTGESEVIAETGHIFNYILSNYDTTNILTPTDRKLQNQVN
FT                   YFLHYAEGTLQPNLVALLVHGFAKQQAPFGTKFLMGLLVNGIDSMFYIPELKKNLNYLE
FT                   DIIHKQHEKGSKYFVGDKLSGADIILEFPVITNIFQNKRGAQQFGAGDVEKTYPHLNQW
FT                   AEDMQREPKYIKAQELVAKHETVKPNI"
FT   CDS_pept        complement(828996..829847)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230222"
FT                   /orf_name="CD36_83720"
FT                   /product="Subunit of the prohibitin complex, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42885.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG680510"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniParc:UPI000192D54D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDW6"
FT                   /transl_table=12
FT                   /translation="MSQRIADFVSKIALPAGITIALAQSALYDVPGGKRAVIFDRLKGV
FT                   KQGVVGEGTHFLVPWLQKAVIFDVRVEPRVITTTTGSKDLQNVSLTLRVLSRPEVRKLP
FT                   TIYQTLGLDYGERVLPAIGNEILKSIVAQFDAAELITQREVVSARIRQELSRRAAEFNI
FT                   ELEDVSITHMTFGREFTKAVEKKQIAQQDAERSKFLVERAEQEKKAAIIRAEGEAESAD
FT                   VVSKALAKAGDGLLMIRRLEASKDIASTLANSPNITYLPNGGAGGGDSDGSKNSLLLNI
FT                   GR"
FT   CDS_pept        830467..830796
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575641"
FT                   /orf_name="CD36_83730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42886.1"
FT                   /db_xref="HOGENOM:HBG396671"
FT                   /db_xref="UniParc:UPI000192D557"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX7"
FT                   /transl_table=12
FT                   /translation="MIANSTNISNRMFRSQRIIILSILAAFLMLLGITSLSGHHQVVVN
FT                   SVKSMSNKASDSISDFYNKVDPSLPSDEKELKEEGIADAERLAELADEKSKEIKEEDNT
FT                   RAQQK"
FT   CDS_pept        complement(830877..832988)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093891" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576639"
FT                   /orf_name="CD36_83740"
FT                   /product="Subunit of the origin recognition complex,
FT                   putative"
FT                   /protein_id="CAX42887.1"
FT                   /db_xref="HOGENOM:HBG396672"
FT                   /db_xref="InterPro:IPR010748"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniParc:UPI000192D601"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX8"
FT                   /transl_table=12
FT                   /translation="MRKQNINKQDIQITNSIQHLPMMQRKRSSPEDELSNSSDSESETP
FT                   QLENDDDLKTHYYITPKTTSTESSFENVYCKVTSQTKRPHSDTTPFLSLFDGNESRENV
FT                   SRRFELYNQVWANQLDKIQLILNNANDELFKDLIQFINLENLQQLAVGYVQLTTNTANN
FT                   LRILQEFYQYIQRKSDYDYKLITLNSKHFTYNIKATLREVVKQFHETCEPVEEMYRLNY
FT                   DLDAIDDWFNEERLNNSRLVLILEDTNLINNQLLNQLLKILQSYVGKWPLKIIMGLSCE
FT                   TVSSWINGNLTNELRIGIQGYKFKSNDNKSLGYIILNNLFLTPELTPENPLLINSTLST
FT                   IILNRFENSNNSIDALIAEIKLCYMIYFYRSPLSILIAEENPQPQKLYADGLRKLSSFK
FT                   KYIELKLHQGDHSVKNLLNNDESVIKLFNEAGVNFRKFKLAVMNAINVIYQLHPNKPKQ
FT                   KFELYKLLINHKLLNSKYLYESVKNLSKLPDSVLGKVVIGLTDNCTEILDGITDNHLIK
FT                   LIKDLGELSDLKGISEKLQNYFDNSILTTPLEYMVFHEVFSMDGGTIQEKFTKPPLFEE
FT                   NYENLMINLLRPNLRATLERGLDNCDTYLANPLITNEVEQPLIPPTLTHLFKLYKEAPT
FT                   TINLYDFYQAFKSTLGQKELSLQLPANEDWDKLTYAWFVQNCHELMLMGILQQKPKGDF
FT                   LEKAIWKGI"
FT   CDS_pept        834942..836663
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230456"
FT                   /orf_name="CD36_83750"
FT                   /product="Diacylglycerol o-acyltransferase, putative "
FT                   /EC_number="2.3.1.20"
FT                   /function="diacylglycerol O-acyltransferase activity "
FT                   /protein_id="CAX42888.1"
FT                   /db_xref="GO:0004144"
FT                   /db_xref="HOGENOM:HBG561030"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI000192D602"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDX9"
FT                   /transl_table=12
FT                   /translation="MTETADLKSEHTEKVTGLSTSKEVPESTLTQRKQSSAPATPSSKR
FT                   STTSKKKRAFINVAPLNTPLSHRLETLGVVWHCISIPFFICLFFFMISLGLFGWIVIVL
FT                   PYFIWWYGFDLHTPTNGKVAYRYRNSMKNFIIWDWFVRYFPIKVYKSVELEPTFKEVLV
FT                   EETESSEDDDEQDLVSERSRTLVDKVFKFFGLKKRLNDTSSGKSETYKTVSTGPRYIFG
FT                   YHPHGVISMGGVGLFATNSLRNEPYTPFLKFLKPFFHDSTKGERLFPGLGNIFLLTITT
FT                   QFAIPFYRDYLMGLGVTSASAKNIRSLINNGDNSVCIVVGGAEESLLNNMVAKHARVGY
FT                   GYKENQDINGSDTEDDEPEQQQQQQNGNVEVKKKSTKEVDNKTSSQPPKREVKLILNKR
FT                   KGFVKLAIELGNVALVPTFAFGEADVYRLVQPSPTSMMYKFQKWMKGIFSFTIPLFSAR
FT                   GVFIYDYGLLPFRNPINICVGKPIYIPAGALQEYKQQHPEEFTEEETKPPMKKSGSFTD
FT                   IFKINDETPKISTIKTKIPPALLDKYHKLYVDELRNVYEENKHKFGYGDVEFSIVE"
FT   CDS_pept        complement(836805..837671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576640"
FT                   /orf_name="CD36_83760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42889.1"
FT                   /db_xref="HOGENOM:HBG396673"
FT                   /db_xref="UniParc:UPI000192D603"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY0"
FT                   /transl_table=12
FT                   /translation="MLCNQALIRNTPRLVRCLSRSATGAPILTSKKDILDQQKTKPSTS
FT                   EVKPVSHRLKSASKKKQEKMKNTSKYLPLSALPHFPNPEDVRMKRPRGIDLQIPKEYLK
FT                   SSVVKPSKESDKETRELDDKIESFSQREADHQTLIAISKEIGKYLEPELNRMYSTEEHP
FT                   MRKSLSGMSKINPTLDIIEDSYLWEILPPKKSFGIPPYQRSDPLGFKEWERKLVEKEVK
FT                   KQLEDEAYKEEYGKMMAEVSDADSFIMSKRGARKRINRKLLKNYKKLEKDAKLPEKYKL
FT                   VIEVIKL"
FT   CDS_pept        838096..839130
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536096"
FT                   /orf_name="CD36_83770"
FT                   /product="Methylthioadenosine phosphorylase, putative "
FT                   /function="transferase activity, transferring pentosyl
FT                   groups"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAX42890.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016763"
FT                   /db_xref="HOGENOM:HBG286690"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="UniParc:UPI000192D604"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY1"
FT                   /transl_table=12
FT                   /translation="MVKLVFKGNNLSKLIKMSVHREKIDLAKLPHHYDGPVTLAVIGGT
FT                   GLYDLPNLHPVARLTISTPWGFPSGSITISKTDSGFPVAFLARHGAHHDLLPSDVPSRA
FT                   NIAALKKLGVKAIVAFSAVGSLQQEIKPRDFVLPTQIIDRTKGIRPSTFFEKGFVAHAM
FT                   FGEPFDLELNKLISDAIPSKGFLEGFDTDAAPVLHTKENTNNGEDLTIICMEGPQFSTR
FT                   AESKLYRSWGGSVINMSVLPEAKLAREAEIAYQMICMSTDYDSWNESEEPVTVETVVGN
FT                   LKANSANACKLAAKLIDEFAAKGGEIGKDLQGSMKYAVSTSPHGVKKELLEKMHYLFPG
FT                   YWEV"
FT   CDS_pept        841045..842775
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230457"
FT                   /orf_name="CD36_83780"
FT                   /product="Peptide transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42891.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG323814"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI000192D605"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY2"
FT                   /transl_table=12
FT                   /translation="MSTEEKHSQTDVINNSTQVSNSVEKSSRDDEYAGDNLGSDIQIED
FT                   DGREPTDHEMETLRHVSESIPMSCWLVAVVELAERFSYYGLSAPFQNYMQFTPDHSPKG
FT                   MLGLKQQGATALSYFFQFWCYVTPILGGWISDTYWGKYKTIFVFCVIYIVGIFLLFITS
FT                   IPSITSKSTATGGYIAAIIIIGLGTGGVKSNVSPLIADQIPKKKPYIKVTKKGERVIVD
FT                   PNITVQNVFMFFYLMINIGSLSVIATTEMESHIGFWSSYLLTFCFFFIAIAALIIGRNK
FT                   YIKVPVGDKIVNKTFKCVWVGIMNGFNFDAAKPSVKPEKSYPWDDHFVDEVKRTISACK
FT                   VFVWYPIYWVQYNGMMNMFVSSAAGMSRDIPNDFLTVFDSVAIIVFIPIFERFLYPLVR
FT                   HFTPFKPITKIFWGFMFGSGAMVYAAVLQHYIYKAGPCYDHPLDCPNGNNINIGLQTPA
FT                   YVLIAISEILASITGLEYAYTKAPVQMKSLVMAMFLLTNAVGAAIGIALSSVSVDPKMV
FT                   WTYSGLAVSCFIAGCLFLTLFRHYNKKEDEWNNLEYETNIDETGLMPVSSLTPSRKSIA
FT                   "
FT   CDS_pept        843290..845392
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576641"
FT                   /orf_name="CD36_83790"
FT                   /product="Serine/threonine-protein kinase Rad53 homologue,
FT                   putative"
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42892.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396675"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI000192D606"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY3"
FT                   /transl_table=12
FT                   /translation="MELTQRTQTQTQPTQQSPTTQTQTQSKEDQNRICQLICSTGQFGN
FT                   YDLNINDKTVVQGKMTWYFGRDPNSDLQVASSSRISNKHFQIWFNFNDKSLWIKDTSTN
FT                   GTHLNNSRLVKGSNYLLNQGDEIAVGIGRDEDVVRFVVVFGDKYNPAKLPDSTNTVKDE
FT                   GIYKDFIVKNETIGQGAFATVKKAIERSTGESYAVKIINRRKALNTGGGSAMAGVDREL
FT                   SILERLNHPNIVALKAFYEDMDNYYIVMELVPGGDLMDFVAANGAIGEDATQVITKQIL
FT                   EGIAYVHNLGISHRDLKPDNILIMQDDPILVKITDFGLAKFSDNSTFMKTFCGTLAYVA
FT                   PEVITGKYGSSQMESQQKDNYSSLVDIWSLGCLVYVLLTSHLPFNGKNQQQMFAKIKRG
FT                   EFHEAPLNSYDISEDGRDFLQCCLQVNPKLRMTAAEALKHKWLQDLYEEDSVKSLSLSQ
FT                   SQSQQSRKIDNGIHIESLSKIDEDVMLRPLDSERNRKSSKQQDFKVPKRVIPLSQHPAT
FT                   PLPMSQPKKRPYQIDPRTNKKVDLEELSASKKVKMSDSVVGEEYLKLEPVAKSLFQETI
FT                   NISKSPFSFGRNDTCDCEINDDRLSKLHCVVAKENDSIWLLDKSTNSCLVNNTNVGKGN
FT                   KVLLRGGETLHLFFDPLSSQHIGFKVVVVNQPSAEHVSQVEVLKQTLEEMNIIPPLISG
FT                   SSSINS"
FT   CDS_pept        complement(845471..846670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093893" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230458"
FT                   /orf_name="CD36_83800"
FT                   /product="Pentamidine resistance factor, mitochondrial,
FT                   putative"
FT                   /protein_id="CAX42893.1"
FT                   /db_xref="HOGENOM:HBG396676"
FT                   /db_xref="UniParc:UPI000192D607"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY4"
FT                   /transl_table=12
FT                   /translation="MNRSSQFYRLPSKKSVFLSELSKSPRLSSIWQSVDSKCMNATKTL
FT                   PIVIQTKQEVFNQVVQSNPEKQGVSLKIKQLIAYGKTIINFYKLGIKNVWQNQTILKKL
FT                   KQDFYLTSVTPSGQETKIKIPSFRKLTEEMSQRIYMDKVESETLEKMTKGDIKRSNNVK
FT                   THSIFNLTREQFQLYKRTPNDYYKIPLFALMCLIFEEFTPILCYMIPEITPSTCILPNI
FT                   LPRVWNPQAIGKMKSLNRKLDENSMIEISLKTSYNLDIEHVRLLSQSLRLVSRYIPPRF
FT                   YPDEYLRDKLQDYYNYIVIDNFYLSGLNGDGNMWNLNDQELVLACLERNLIQNIVYDTK
FT                   LFNQISDPIQKRMFQDKYMGKLRVKLFQYLVDFENFNIGYVAVNHVIPREEEVNVITWR
FT                   "
FT   CDS_pept        846821..847897
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079104"
FT                   /orf_name="CD36_83810"
FT                   /product="Serine/threonine-protein phosphatase 2A
FT                   activator, putative"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /protein_id="CAX42894.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI000192D608"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY5"
FT                   /transl_table=12
FT                   /translation="MSYITPTKRIYTSEDLSKWVGSPTYNTVLDFIVELQTSVTGKSND
FT                   SSNEASSIIDKLSKLLSKVDSLITLHPAHDSVSRFGKVEFRDFYKDLSAKAEEYISEIT
FT                   PMAIQETSTYFVESWGNSTRIDYGSGHELNFICFLLCLKELGQITASDYEGLILRVFTQ
FT                   YISIMRKLQKEYWLEPAGSHGVWGLDDYHFLPFLFGAAQLSTHPHMKPKSIHNDELVEM
FT                   YSTKYMYFECIDFINKIKTIPNHQGKLSLRWHSPMLDDISAAKNWDKIREGMVKMYKVE
FT                   VLGKLPIMQHFMFGTLLKCPEGIPEHTDENGHGDKVEDHCGHAHVNTWGDCCGIKIPSG
FT                   IAASESLKHERKGNIPFD"
FT   CDS_pept        complement(847903..849372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576642"
FT                   /orf_name="CD36_83820"
FT                   /product="Subunit of cleavage factor I (CFI), putative "
FT                   /protein_id="CAX42895.1"
FT                   /db_xref="HOGENOM:HBG396677"
FT                   /db_xref="InterPro:IPR010655"
FT                   /db_xref="UniParc:UPI000192D609"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY6"
FT                   /transl_table=12
FT                   /translation="MSIPGFGSTEKVNYAVSSITLTIPQNYEWRIEVPFNRLLKFKVLT
FT                   GIVEINGTELANNIEIQLSGTKAYLYSPIADSVIEYVLVENKDDLSLASTSDDGFVEYL
FT                   SDESNMDSILNLHMYFESKRQYTKDYNFSSSIDQQQSGPKVLIIGSKYSGKTTMSKILA
FT                   AYANKMNNTPVLVNLQPRDGVFALPGSLTATPISDSFDVESCNGYGLTTTSGTLTHNPK
FT                   QPIVKNFGMADFNDNVDFYKLLIEKLGITVLSRFDQDLNIKNSGAIIDTPALTSKNFDI
FT                   IECIVSNFLIDNIVVIGNERLAIDLTKKFAHKSTQLNIIKLSKSSGCVEVEDRFIRLQQ
FT                   EQTIKEYFNGNFKTRLSPFKTDIELSGLRIYKNVLTKDLLSQMAFLPGGDDFEKDEPDL
FT                   EEDAEEKQLEKYYQAIEEPNSSNLENSIVAITHLPNNDKKLGKDLLNTSVLGYIHVSKF
FT                   DDQKKHLKVLLPFPGVFPKNILISTNIGYNE"
FT   CDS_pept        complement(849588..850301)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576643"
FT                   /orf_name="CD36_83830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42896.1"
FT                   /db_xref="HOGENOM:HBG396678"
FT                   /db_xref="UniParc:UPI000192D60A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY7"
FT                   /transl_table=12
FT                   /translation="MSSSTDTPSLFVTPQTPPRQQQRRRSNPGAISTPVASSVLLTPST
FT                   TTKKPTRTPVSQKRKQGIQLSPQANKFPFTPITPQKSPCKTRKNLDLFTSNEKFGVLLP
FT                   SPSTIGSGRCHNSFTQAPPPLFDLKKVNEFKVPRTPAKQIIDDSRAKESENEDDWEVMD
FT                   IDEVAKIPREKLKNPFIDTYEPPSPLTHEKNNEGSINYDTHMELINNKTGKKRVVKLTK
FT                   NQMKIKPKRLSFDNI"
FT   CDS_pept        851141..851668
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079105"
FT                   /orf_name="CD36_83840"
FT                   /product="Uncharacterized protein yer134c homologue,
FT                   putative"
FT                   /protein_id="CAX42897.1"
FT                   /db_xref="HOGENOM:HBG595032"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D60B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY8"
FT                   /transl_table=12
FT                   /translation="MTLARYPKAVVFDLDYTLWPCWCDTHIVTPLKSVSPTTVADRYDF
FT                   QLSFYKDVESIIRELVENNVKIIAASRTGTPHVAKQLLSMLHIHGRPAIRYFHSLQWGT
FT                   GSKTKHIKKAAKNLKMTTELTDGEFILFDDELRNRDVESINCHFAHVPDESVGLTRHIF
FT                   VQGLTQWNKRNL"
FT   CDS_pept        complement(851982..853631)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079106"
FT                   /gene_name="SAP9"
FT                   /orf_name="CD36_83850"
FT                   /product="Aspartyl protease, putative "
FT                   /EC_number="3.4.23.24"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42898.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192D60C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDY9"
FT                   /transl_table=12
FT                   /translation="MRLNSVALLSLVATALATTAPFKIDFEVRRGSSKDDLSPDDDSNP
FT                   RFVKRDGSLDMTLTNKQTFYMATLKIGSNEDENRVLVDTGSSDLWVMSHDLKCVSAPSS
FT                   KRHERSFGHGTGVKLNERELLQKRKNLYQPSKTIETDEEKDSSDKIHNKIFGFGSVYST
FT                   IYITEGPGAYSTFSPFVGTEGGSNGSGGSNTCTSYGSFNTENSDTFKENNTYPFQIQYA
FT                   DDTSAIGIWGYDDVVISNVTVKDLSFAIANETSSDVGVLGIGLPGLEVTSQYGHTYQNL
FT                   PLKLKADGIIAKSLYSLYLNSADAKAGSILFGAIDHAKYQGDLVTVKMMRTYSQISYPV
FT                   RIQVPVSKIDVEGSSGSTTNILASTTGAVLDTGSTLSYVFSDTLESLGKALNGQYSRSV
FT                   GAYIVNCNLADSSKTVDIEFGGNKTIKVPVSDLVLQAGRSTCILGVMLQSSSSSYMLFG
FT                   DNILRSAYIVYNLDDYEVSLAQVSYTDKESIEVIGASGITNSSGTGTTSSSGSRTSGSS
FT                   TSTSTRHSAGSIIAKPMYELLLSLLVAYCVLV"
FT   CDS_pept        complement(855092..856123)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576644"
FT                   /orf_name="CD36_83860"
FT                   /product="Vacuolar protein sorting protein, putative "
FT                   /biological_process="vacuolar transport"
FT                   /cellular_component="retromer complex"
FT                   /protein_id="CAX42899.1"
FT                   /db_xref="GO:0007034"
FT                   /db_xref="GO:0030904"
FT                   /db_xref="HOGENOM:HBG525567"
FT                   /db_xref="InterPro:IPR005377"
FT                   /db_xref="UniParc:UPI000192D60D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ0"
FT                   /transl_table=12
FT                   /translation="MSIFFKAPLDIEIRLDNEDTRKHVDVKTPQGRVEKLPIYKDGESV
FT                   KGVVTLRTKEGRKLEHLGVRVQLLGSIETNTDGISSSEFLTLATELAAPAQLSHPESYP
FT                   FEFKNVEKQYESYRGKNVRLRYYIKVTVLRKSSSEIIREKELWVYQYATAIPKQATTGN
FT                   SNSTADSKLGSKKTNEEAASGAATSSSNDGTNKGSTIAKRNESHSVKMDVGIENCLHIE
FT                   FEYSRSRFSLKDAIIGKIYFLLVRLKIKHMELSLIRRETVGAPPNQVTDSETVVRFEIM
FT                   DGAPVKGETIPIRLFLNGFDLVPTYRDVNKKFSTRTYLSLVLIDEDARRYFKQSEIILY
FT                   RDQ"
FT   CDS_pept        856895..860893
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248821" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576645"
FT                   /gene_name="CDC25"
FT                   /orf_name="CD36_83870"
FT                   /product="Cell division control protein 25 "
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="cell division"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42900.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG398462"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniParc:UPI000192D6B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ1"
FT                   /transl_table=12
FT                   /translation="MSSTNYITDEVAPDMISPHDHRPSKDEPLKHLDTVIALYDFPGTQ
FT                   SSHLPLNLGDTIHVLSKSATGWWDGVVMGNNGELQRGWFPHNYVRSVNYVQPVLKKLKD
FT                   NKDLDSITAANTAANVVMPSLTNLIQKSLQESERNSPANSTRKNSVVSFASSETSMPSD
FT                   SKYTQQQTNTNQNSLEYQSISLPSTRDHSTVDMQPSSQQPSISHTLTGFGTGDDEIIPM
FT                   EVGEAERLMEEYRFKYNKTVTWIPRTSTKGDIIFYCEQLDVYCESLPLILFDAEAPSPN
FT                   LEYSGSEVIMDPTPISVQGSQSMENILDTREGSTAGSFDSTKRDSNVSMSTQSSGSSYH
FT                   RFSRPFFSMDNLFYKHSSDIGTWNELKEQCNYILDLMLKAIKDQNRQLFSTHFSRLNKL
FT                   VVALCAAVRLNQEDYVDTKYESSTRRKLKRVCASFAQIYINGILHLSVLHYSLDGFNEG
FT                   RLFGYDMSKLNRSSSNSAFQSPASSLSTIRQGSDDSTRFAQKLSQDKNNEGNSDINYIN
FT                   QLVYEIDNLRENVDSIVKIFLKLSTNKKIRNSDYDSSDASDDEGEDRFDILPQVYPRFL
FT                   VDEFNGGNWCNPFFSTKNTVLNVSGDDLKNRYHTKIIIDHSAYESLSQYVDKIVDACEN
FT                   ILEALDPKVQTTFYYNEMLRSERNTQILRLTYKSLYHCSAMVDLIESFDFTVFCSVKRH
FT                   MANAIDAEDESFENPSVWGDHYDSNLSFDYPVVLEFFRLKQELHDLVAKIIMATQSLTL
FT                   EDPEVFKGLKEEDPLFYNREISKIPKEKAALLLSSILKEQLTFKDGGAISLNPDTLLSG
FT                   YLVEITKTTKAVLLITQQLIEERETIINYATRVMQDNFDVQLLLVERNNTSSSEKTDEN
FT                   SYYVGGHKKSNDVPWYLEGDDEYELLLDVKGNIKGGSKEALVSHLTHHLLLDSNFNSVF
FT                   LLMFSSMMSLGELISLLIARFNIEPPEGLSYEEYNLWVSKKRNPIRLRVMNIMKLLLEK
FT                   HWSQSYYNETVLRRWLAFAQSSQVQTYSMGSLLVNYLEKLLRGEIIYVERDPVIPNTKP
FT                   PAPLTKGSSLSKKPRIMDIDYVELARQLTLREFKLYCKITKFACLAKVWGKKSGLSESI
FT                   DSITQFIKASNQLTNFVGYMILRKADPKKRVQIIRYFIQVADKCRQYNNFSSMTAIISA
FT                   LYSSPIHRLKKTWEYMNSDALSNLKNMNKLMNSSRNFNEYRDVLKFIGSEPCVPFFGVY
FT                   LSDLTFVYHGNPDYLYNRTRQVNFAKRTKTSEIVSGIDRFKTMGYNFQEVPEIQKFLDA
FT                   WFEKCPTIDEQYQLSLNLEPREQQAGTSNSITTANTTTIKSFKPFSLK"
FT   CDS_pept        complement(861156..861548)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536097"
FT                   /orf_name="CD36_83880"
FT                   /product="Histone H2B.1, putative "
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42901.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D6B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ2"
FT                   /transl_table=12
FT                   /translation="MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKTRKETYSSYI
FT                   YKVLKQTHPDTGISQKAMSIMNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRL
FT                   ILPGELAKHAVSEGTRAVTKYSSASS"
FT   CDS_pept        862064..862462
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576646"
FT                   /orf_name="CD36_83890"
FT                   /product="Histone H2A.1, putative "
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42902.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D6B6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ3"
FT                   /transl_table=12
FT                   /translation="MSGGKGKAGTSEKASTSRSAKAGLTFPVGRVHRLLRKGNYAQRIG
FT                   SGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGDVTIA
FT                   QGGVLPNIHQNLLPKKSGKGGVNASQEL"
FT   mobile_element  complement(863086..869685)
FT                   /mobile_element_type="retrotransposon:epsilon Q, Tcd25,
FT                   LTR"
FT   CDS_pept        join(complement(865384..866841),complement(864696..865397),
FT                   complement(864162..864593),complement(863537..863626))
FT                   /pseudo
FT                   /gene_family="HOG000213059" [ FAMILY / ALN / TREE ]
FT   mobile_element  complement(863635..864150)
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon M"
FT   CDS_pept        complement(867068..869104)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536098"
FT                   /orf_name="CD36_83910"
FT                   /product="Retrotransposon protein, putative "
FT                   /protein_id="CAX42904.1"
FT                   /db_xref="HOGENOM:HBG398463"
FT                   /db_xref="UniParc:UPI000192D6B7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ4"
FT                   /transl_table=12
FT                   /translation="MSNNSESNASNDAQGENNPLSPINPITTLGQDNPTTVQDDDPTMV
FT                   GNTLNLTQTDQQVNELLSQRLPKMMADQFGPMVNEQLHPMMDKLFEAHLPKYISTIENH
FT                   VKAMYFDTATTRIIDTLKPFIQETVNQAVRPRFPGSFSEPANVLSNKNNISASPPPTQT
FT                   NNPGSQPNADLENPTNEALDHPESVAADTIPIQSPQDVGASANHQQDSNGTESVNSTMP
FT                   HPPSSVPSIDTTNPLKSPTHINSPNPSHQSTYSMVNSMNTHVTSQPSTDQFVNNSPPFG
FT                   SGKFFEVRKRISAIDAECQDLKVKITDINIIEKKLPYIYNPSLSKESLFIERLDLIESI
FT                   PDIERTKEEKESLKKSNHKEYPTTTSIKTTHDTLLYVKELLFYKAKYSIPDKLLKGAFV
FT                   LACNNPKDNDLKRACDLAIIPHNTNPNFNGINYGIIIDLLYDTEPAIVAESVLDSVNNY
FT                   LQNEKNAIMLVAQIDFAITSNINNITPSIWYQIYCSLWNKQKPLMTNLTKTIDNPKVSA
FT                   TLESIQFYKSSAITSNPEFQKIDFHEVWKIVSEQLRHIAKYHSDTTSSSTPQSNNQKAT
FT                   NSNDKNPNTKGKSPCTCCGKRNHSAQACFTLKQLIKNEKVKFSDNIFYKMDGTTPYELS
FT                   PSEYLLKKYRTDFPAPPKSNTENKPKESTSNDSNSNARPHSTV"
FT   CDS_pept        869803..870633
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576647"
FT                   /orf_name="CD36_83920"
FT                   /product="Transcription initiation factor TFIID subunit,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42905.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG396681"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D6B8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ5"
FT                   /transl_table=12
FT                   /translation="MLSAPEQDTTNSPGTEGPHTENVVEDEYQDDEYVSLDEEDEELIW
FT                   RVFFQKLEKHNNKNNNDGSDSDESEESDGSSEEEEESEDEDLDDDEFSDLSDIDDPALV
FT                   ATYKALMSEKVNKDLGEEEQRRLLISNFTDDQMERFEAYRRMTVNKPGVKKICNGIVGH
FT                   TIPQIIAVVMAGVSKSFLGEIISKAFEIQERNSKGRLLMDIETKKKQKREIISSLQRGE
FT                   EIEVDERSLKFEGDEIHPLQPEHIREAWRLYQLENSVFSGSRKRKMGDDGPFYT"
FT   mobile_element  complement(870858..871100)
FT                   /mobile_element_type="retrotransposon:solo LTR, iota M"
FT                   /note="partial"
FT   mobile_element  875627..876088
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon P"
FT   CDS_pept        complement(876429..877928)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576648"
FT                   /orf_name="CD36_83930"
FT                   /product="Nitrosoguanidine resistance protein, putative "
FT                   /protein_id="CAX42906.1"
FT                   /db_xref="HOGENOM:HBG396641"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI000192D6B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ6"
FT                   /transl_table=12
FT                   /translation="MNTKMLESEENSQDETYLGPQQQQQQQYYHHKYLSSSELEPSPPA
FT                   RNMVGKVNKGLSLFSKKFQTERKKIALKYFLNYLIMGIGVLGIFSIYWGSFYRINGRIK
FT                   NLKMLVVIEDDSIINGLNPVFGDNLKEILQTPEAKTRGNWKIYNSTEFAQIALKSNRTA
FT                   EEEIMHQIHHQEYWASLHVLPNASYNYFNALSHGDTNYDIVKNTVHSIYETGRDFNGMT
FT                   QFVIPSISNVENVWLSKQSTMAFDIVGNLTINSTEKLKLLAQPIKFEIVDPVPWNDPIL
FT                   IGPFHDLLIYMTILTLLQFEFFSPVHKAVSKLGIRKRHYMIYRFTASILSFLVLSLFCC
FT                   LVTLAFQVDLTVTYGKAGFVVYWMIAFMTMWALGSVNEIMAMLLIIVYPPLVQFWLLFW
FT                   IIANITPTFTPMAVLPKFFRYGYALPIHNSYEATKTVFFGTYKGQLGRNFGILAAWFAV
FT                   LSFIFPFVVYYFITTTNRNFEQQVCAAVNEKKELETEEHHH"
FT   CDS_pept        complement(878546..880498)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230459"
FT                   /orf_name="CD36_83940"
FT                   /product="General amino-acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42907.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D6BA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ7"
FT                   /transl_table=12
FT                   /translation="MSNFEKIQSLQMISTDNANPGRRPTLSSTISSFDADRSSYNSATS
FT                   TSSTESTSSSPYPRSYHPRDLLNNFINSFKEFDYSTLPPVYNNITDQESQLQLNPANPN
FT                   FDYSRFTQLERDALITASSPLSKRLKTRHLTWISLGASIGSGLLISSGSSLAHAGPLGL
FT                   LIVWIFVGSVIFATMSSLAELATAFPVSGSFTTYVTLFVDKSISFAIAWNYALQWLVTF
FT                   PLQLVAASLAIEYWTIKIHPAIFVTIFYVCIVFINLFGVYGYAEIEMVVSIIKVIAVIG
FT                   FNILAIIIVTGGVPGQPYIGAKNWQEPQGGLFNTIEPFKQMCYIVSNVAFAYGGVELFG
FT                   LAAVETASPKKSINQARKQIFYRLMVFYILSIVMIGFAVSYKTPELQDSGAFGTDINAS
FT                   PFVIAIKQAKIKALPSIMNGAVILTVLSVGNASVYASTRVLCAIGALQQGPKFLSFIDR
FT                   SGRPLGCLIVQFAFGLLAYLICIPGKNVPAQIFDWLLSLSGLSALFTYISINVCQLRFN
FT                   CTLKHRARIPKDELLYVSPLWCSWYGIFAIIAILALQFWAALFPPGAGKADVESFFKIY
FT                   LGGPILFLCWLGHKLYSYWYLNVPFIKFWLTVDEIDIDTGRRQIDLETVKQEIAEEKIV
FT                   MDSKPWWYRLYKTFC"
FT   CDS_pept        complement(882447..885110)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576649"
FT                   /orf_name="CD36_83950"
FT                   /product="Carnitine acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAX42908.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG396684"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniParc:UPI000192D6BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ8"
FT                   /transl_table=12
FT                   /translation="MTQDQYFTFENEASLPKLPVPSLVSTTQQLLASLKPLLPQNEYAT
FT                   VVDEATEFVGNDIINLIQKHLVAISENENYNNYLNFVNDDKTPSIYGEIRGDILPRNPY
FT                   LVLEEDPYSKTINPPNQAQRAANLVNSSLKFAITLRNETLKPDVTPKNGNPLTMKCYMD
FT                   LFGTTREPEQDDHGFDIRIKKYQHINDSRHILIISNNQFYTLEVLTEFDENEYQETNSK
FT                   HKIWFNDSELSKILQQIIDESNKVDAVNSIRNSIGSITTQTLKYWKFARLELEQSNSEN
FT                   LKLIDDALFVLILDSNTPVTDGEKTQVISHGTSVLSSDNVQVGTCTSRWYDKLQIVVTK
FT                   NSVAGIVWESMTMDSTAILRFISDIYTDSVLKMAKNINGSEYTLFDPNITFASMGKDGD
FT                   GVTKPEPRLIEFNKTKALQHVIHLSETRLADLLDQHEYMTHTIKLDSYLTNKFNLSVDS
FT                   IMQICFQIAYYSLYGRIVNTLEPITTRKFRDARTELVAVQNQSLANLVKLYITNASTSE
FT                   KFEVFKKCCTLHKTQYHDAMMGKGFERHLMTIVQVVKKPKVIARLNQINTHLPPIPEDL
FT                   CQDGINLPLLLNPSIDKLSSPELLVSNCGNPALRLFGITPAIDQGFGIGYIIHRDKVLI
FT                   TVCSKHRQTARYLDTFHRVVHDIKIRLRASSNFLLSISDSEQRKNELQRLRIEHELSNV
FT                   SLDVPTMKHPIPLTIGKSEISIDNIALETARTGHNKRSEEKALQNNANDDDDDDDDDDE
FT                   DDSKFELMGGYGYFDFGELELRSDEVSRNESYLNSQVHSNLSSAMSSRRHSFTNLHKIA
FT                   SRSHDSSLPQQLQQQQQQKYDIKEKQSLSERIRDKLSHSQDTLSSVQSVLEEDVQKNEP
FT                   TKKSSIGRSLDMSKLS"
FT   CDS_pept        complement(886094..889390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576650"
FT                   /orf_name="CD36_83960"
FT                   /product="Zinc cluster transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42909.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG448728"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D6BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WDZ9"
FT                   /transl_table=12
FT                   /translation="MSKKNRKADEKTVSSNFKLISTSTGVRVSQACDRCRIKKIKCDGQ
FT                   SPCRNCQKVSVECKTSDRLSRKSFPKGFTSFLEAKVKELEDENRELREKLGDNSSASNH
FT                   NALSFEAVENKHSISTADTSNITTVNTTPTPSTIPTTTTTSNDKVLFQTNNQSVPINNP
FT                   IDQIFNLDDKGIIIGNDNLNFESQFNHLLINLNLPFLKITNSHNYLLDDPDSYLYHPSY
FT                   TKSNKFHNRDLDLIYNPLTGTNTETGLRNELPTDVYDLFIKLINNFKKIFKSKREMDNQ
FT                   IVLFFLHYNIFIPIFDYNEFMESYNAFHTMYPFIFTYDDSSINGFNLSNSNDYQIVNNY
FT                   LMTIIQIYAMISINNPTLNLNLLLNHTDPHYSINRDKSIIKSLYDFLPYFNGFHISIGQ
FT                   LQTYLLFLYYSLLTNNKEKSLILSSLVNAFIGILGINLNSKNLFFNDLALKQQQRRNRV
FT                   KIFWVFKILLKCFNLKFGFKPSLNTTVINPVTIDRYFQLTPEKLSSLLDDNDDLFNTLL
FT                   KPSIEFLNLMNIIIPSSFSPNYYQYLKQDRKKKDKDKDKDKDKDKDKDKDRDYHHPHHH
FT                   HQHHTTPHRLDLILNEDDGEGNDGNLNYNYHQFLIIDKNLSAWRQSLQNKKTQLTSLME
FT                   LGLPNLINIVENDLYFDMNCDALSREGLINYYSTGLPDIHTASHLIKLQLNFHYILIRS
FT                   TNYLNFIVDRELTFEYYKEISLLSMEVLQFFLLIFEHVSKAEEKINEPKVSSNSIVMES
FT                   LGLDVDEDGFVINDFSVKRRKVDSHNKATNPLKKLVKEIPISPFNTMLNGLSLCIINLK
FT                   KSIILQMLYLLICQMKFIKRPQGWEKMDETFDLLNRTVDLFIRLFINYKPGASKKIHED
FT                   KLFKKLVNDELKDDILRHHQYGSDDDEEEEDEDDYNGARKRSPAYYKSIDWDDEDLDED
FT                   LKYLKILKFVKYKSNDSLQKLHKKQKLDNYTNSNSNGNGNGNGIPQPTSVTHHHHLHLH
FT                   SQPQTENATATETEIAAPQLPIQHPSSVSPPPPTSLSIPPAIMTDAVNLSNDSKSNLPL
FT                   PQYYNPYQPIPPIFGNEDKDRGAAHDLMNLRRGSSQGKLYPPPSSQSPQY"
FT   CDS_pept        complement(890938..893361)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383333"
FT                   /orf_name="CD36_83970"
FT                   /product="Peroxisomal matrix protein, putative "
FT                   /protein_id="CAX42910.1"
FT                   /db_xref="HOGENOM:HBG396685"
FT                   /db_xref="UniParc:UPI000192D770"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE00"
FT                   /transl_table=12
FT                   /translation="MSNLYQSLGPQGRALLLQNGPGIPGGTPDTNLSPQELDFLVNELR
FT                   NPKPDTTTNKVLGYLYNYIPYIRHEHNLRLVIASFLNCPVCFGGDSDFEDNYLIVEVFK
FT                   LIIDKKLKISMPVISIKEFYTLILKELQNFQRYNPIMNSWKILPIITGILLSNGLRDQL
FT                   YTEVNFIEYKWFFANLDKEIYQLFNNALPYSLSQSLDNNINYLSLMSLALVFKNSQRHY
FT                   KNSSDTVVHTKNISSVFMIQKLTEMIFLDRNVSMLVYRKFFQLNPHNENSESIISNEIM
FT                   SKPVVKHLNKISFLLEHYFSTLDFTQLNDQAISESLIIMTNFNKQLNHETNDHSVFNNF
FT                   NNTPESGTNNNPLVQNFRFIMKNLLFSQIIIFQGVLSRFLTANSRLLTNKTFFWFSQRN
FT                   YYGNRVDNNKNIEYQYRDISLQIMTNLYYINFILLSIGQGGFDNYNFVYYLTIELALTT
FT                   GIRFEKLTLYLMSNYQEVNMYPDVLNSNYIDTSKILFVLGVWENYFQQLNRLSHQRSQD
FT                   IFNKEIYNIVINLVDAKKYTNNDLLEASHSVLLFYFANNSKVNLNDVMRYIELVLEQFP
FT                   QRISATQLSIAIETIGKKILSNPITYNDREKTVFINSAEKFFIFLLNKYSRIEPGVPIK
FT                   VKSITLVASTEESNVSFTSAQPVNEIEAHATLNTLEQEGKLANDIIDENKAKAPSKKVI
FT                   KKYLPDLVGKANSDNHPFEFFDNRLTPETAREATIVSLINLVPYFPLSVFISWLNQVWD
FT                   LIVRSDSKEQQFLFNMLWKVISESLDINRGDLAIRWWYEEKQFTDKHQKFAGKF"
FT   CDS_pept        join(893873..893912,894159..894286,894374..895072)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536099"
FT                   /orf_name="CD36_83980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42911.1"
FT                   /db_xref="HOGENOM:HBG396686"
FT                   /db_xref="UniParc:UPI000192D771"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE01"
FT                   /transl_table=12
FT                   /translation="MFCIVEIIVIILSIYKSGTNSWYHYPQRTDLSITFVYNGVQADQI
FT                   DVTVHWKGSNLDNFNLFNTNKCKTTVLCRQPCIGVKQVNDNGIIFKRFQISLINEVTNN
FT                   FDMCCTMFKLFNFQIKIKDNINEIKNKKSYDNIQVSNPQTVPPIQTTSDSQIYSLMQSQ
FT                   PCVSQVPVQITSQNMASCFSSFQTQPSQPHVQIIEPSVYPLYTQSGHFIQQGNIPETTN
FT                   NIVSTDLKINATTQTLPEKSQSVFLDDINELKKITNSSLRSAIRTSLKSKDFLALIDRL
FT                   DKIITDI"
FT   tRNA            895409..895481
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        complement(895913..896884)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383334"
FT                   /orf_name="CD36_83990"
FT                   /product="Coproporphyrinogen III oxidase, putative "
FT                   /EC_number="1.3.3.3"
FT                   /function="coproporphyrinogen oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="CAX42912.1"
FT                   /db_xref="GO:0004109"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG631180"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="UniParc:UPI000192D772"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE02"
FT                   /transl_table=12
FT                   /translation="MVTAEQIHDKSFPIRERMEALVRLKQQQITDAIAELDTVKFHTDT
FT                   WLKGDNGGGGQSMVLQNGTTFEKGGVNISIVHGKLPPQAVERMRADHSNLKGSSKDGSV
FT                   NFFACGLSLVIHPINPHAPTTHANYRYFETSDPETNETQTWWFGGGADLTPSYLYEEDA
FT                   KWFHQQHKDALDKFDPELYPKYKKWCDEYFFIKHRGESRGIGGIFFDDFDSKPADEILK
FT                   IVESCFDAFIPAYAPIVAKRKDTPYTPEQRNWQQIRRGRYVEFNLVLDRGTQFGLQTPG
FT                   SRVESILMSLPATASWVYDHHPEPGSEEDKLLQVLKNPIEWV"
FT   CDS_pept        complement(898429..902970)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383335"
FT                   /gene_name="CDR1"
FT                   /orf_name="CD36_84000"
FT                   /product="Drug resistance protein 1 "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42913.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000192D773"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE03"
FT                   /transl_table=12
FT                   /translation="MVNLPSPKVTESGGDQATTTRASSEYQGFDHNEIRQLAKILTNDN
FT                   DDSTKSSLIRQLSHMSNVPGINPCDSNNLPPQLNPNCDQFDSKLWIKNLKKLYESDPEY
FT                   WQHSKLGVVYTNLRVYGIANDVDYQPTVTNLLWKLGGEAFRKYFRKNDKTQYFDILKPM
FT                   DAIMKPGELTVVLGRPGAGCSTLLKTIAVNTYGFHVAKESKISYDGLTAHDIEKHFRGE
FT                   VIYSAETEVHIPHMTVGDTLEFASRLRTPQNRGVNIDRETYAKHMADAYMATYGISHTR
FT                   NTKVGNDIVRGVSGGERKRVSIAEVSLSGAKIQCWDNSTRGLDSATALEFIRALRTSAK
FT                   ILDCTPVVAIYQCSQDAYDLFDNVSVLYKGYQIYYGKTTMAKDFFVRMGYKCQPRQTTA
FT                   DFLTSLTNPAERQTLPEFEDKVPRTPQEFESYWKQSPEYAELMKKIDGYFLDCENLNTK
FT                   EIFHQAHVAKQSNHIPPSSPYRVSFFMQIKYLVGRDFKQLKGNPSLAIFRVCAQIIMGL
FT                   ILSSVFYNLPSTTESFYYRGAALFYSVLFNAFSSLLEVMTMYETRPVVEKHRKFALYCP
FT                   SADALASIISELPIKLASSVSFNLVFYFMVNLRRDPGRFFFYWLMNIWATLVMSHFFRT
FT                   IGAVTTSLAGAMTPSTILLLAMVIYTGFVIPKPSMLGWARWITYINPVGYIFESIMVNE
FT                   FYDRQFECSQYIPSGLGYENVDSKNKVCTAVGSVPGEPFVDGTNYLKYAYEYYNSHKWR
FT                   NLGIAIAFAIVFLGVYIWLTEYNKGAMQKGEIVLFLKSGLKKHKRQSQKAGGATTGSIE
FT                   DIETGQFSNDKLVYPSDIEEEEDGDIATDKRLDLSGNRNQQEIFFWKDLTYQIRIKKED
FT                   RIILDHVDGWVVPGQITALMGATGAGKTTLLNCLSGRLTVGVVTEGARLVNGHSLDSSF
FT                   PRSIGYVQQQDLHLPTSTVREAFRFSAYLRQPNYVSKQEKDEYVEYIIDLLDMKTYADA
FT                   VVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSICKLMRKLADHG
FT                   QAILCTIHQPSALIMAEFDRLLFLQRGGQTVYFGELGQNCQTMIDYFERNGADPCPKEA
FT                   NPAEWMLEVVGAAPGSHAKQDYFEVWRNSSEYKAVKDEISRMETELSKLSPLSSSSNGR
FT                   DEKESRLTYACPLWKQYLLVTWRTIVEDWRTPGYIYSKLFLVVSSSLFNGFSFFKADKT
FT                   IQGLQNQMFAIFMSFIPFNTLMQQMLPYYVKQRDLFEVRESPARTFSWFAFIAAQITSE
FT                   IPFQIVLGTIAYFCWYYPVGLYMNAEPTNQVVSRGVLTWLLQVSFYVYVSTMGHLCNSF
FT                   LELPDAAANLANLLFSLCLMFCGVLAGPNQLPRFWIFMYRCNPFTYLIQAILSTGLANT
FT                   RVVCAEHEYVVIEPPAGQTCQEYMSAFITIYGGYLLSANDTKPGVSCSYCTMDETNTFL
FT                   KSVNALFSERWRNYGIFNAFIVINVVLAIFLYWLARVPKGNRESRIKHKKKE"
FT   CDS_pept        join(904668..904724,904835..905188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536100"
FT                   /orf_name="CD36_84010"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein "
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="CAX42914.1"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG626321"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="UniParc:UPI000192D774"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE04"
FT                   /transl_table=12
FT                   /translation="MSFFRDLLESVVPTAYAEEPVEDVEVEQPEDAPEEEVSEETVEDD
FT                   DEDEDEDEDDEDEDEEETVDPLDALREECTKTAACKPFDHHFHECIERVTKEQEEPDYE
FT                   HKHYKEDCIEEFFHLQHCVNDCVAPRLFNRLK"
FT   CDS_pept        906542..907375
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536101"
FT                   /orf_name="CD36_84020"
FT                   /product="Nucleolar single-stranded nucleic acid-binding
FT                   protein, putative"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX42915.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG396689"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D775"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE05"
FT                   /transl_table=12
FT                   /translation="MSTTEETKVTKPVIEDRIYVGNVDFKATEDELKELFQDLKVTEVE
FT                   IPFKENTRGDKVFKRHLGFAFVQFENKDDADKAIATYNGQKFQRRNIFIKKAVPPPTEE
FT                   EKKERVEAFKAKREEIKKEKEQKKAEAKKKREEAAATASANGESTDYTPAIPDGTPSKD
FT                   TIFITNLDYKVNVKTLNNLFKDLKPKWIHVPSRRVPYNRRGRGGKFRKPFNKGIAFVKF
FT                   SNEETQKQAVAEFNGKEVNGREIIVDIAIDSRIPKEGSAEDVDDSDNDEEKSDGN"
FT   mobile_element  complement(908427..908553)
FT                   /mobile_element_type="retrotransposon:solo LTR, koppa D"
FT                   /note="truncated"
FT   CDS_pept        complement(908753..911308)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576651"
FT                   /orf_name="CD36_84050"
FT                   /product="Transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX42916.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG396691"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000192D776"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE06"
FT                   /transl_table=12
FT                   /translation="MSDTQIYSATYSNVPVFEFVTSEGPIMRRKKDSWINATHILKIAK
FT                   FPKAKRTRILEKDVQTGIHEKVQGGYGKYQGTYVPLDLGAAIAKNFGVYDVLKPIFEFQ
FT                   YIEGQTEVPPPAPKHNHASALNVAKRQASLLKKQKEKQVQSTLSDTSFGSVSVPPSTVP
FT                   KKRGRPKRATLSATPSLQHSDTTPINKSLIDFNSNDNSAKNSFINGIPSLTRNDTEQDA
FT                   LQIMTNNMNLRQEDLASVETDDDEEYHNGSRGDGFQNSSFTTKRRKYPGGITNGNGLES
FT                   QADLLTSKELFGVSRTSFEKRANQQHNQYSPLQPYHQPSISLSQENQIYSDYFQSLLTY
FT                   FLDDNNKIRSSIPDSLLSPPLPLSKIHINQAIDNDGNTIFHWACSMGNLNMVEFLLKTF
FT                   THSLNPDVRNNNGETPLMFMVKFNNSFQLQNFPLILELLKESIFLVDSNNKTVLHHIVD
FT                   TDSKHKREKFAQYYIESLLEKTVDEHHEQGESNGHQVEDYSSREELITKFINHQDSDGN
FT                   TAFHIAAHNLNKKCIKIFINYHRFINFGLRNLVSCTVEDYLASHNYVLRLDPVEHDQNN
FT                   ILDNNSDVDEDIMEDYTNENQSFETQLHNSKMAINLQNTTANILTEKMTQLAYAIDSEL
FT                   SEKDEAILTYFKVLSQINQIKLESQRKILSFFKLDHLIEELEQDRDNSQQSTDDDPASR
FT                   HNNDLYLDFKRDHILQEEIYRLMNDLTYQELHQRDELDKVEHSYRMTKERLHEKVLDAA
FT                   SFAIEQNHQQSNVHEQLELAKELQEEIIKRKKLMDEIFKLTKNVPLPENPNSKTIINRH
FT                   STTDKLYKYCKLISLSCGIPMDEIETSIDAVEESLVKNK"
FT   CDS_pept        complement(911868..912830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230460"
FT                   /orf_name="CD36_84060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42917.1"
FT                   /db_xref="HOGENOM:HBG396692"
FT                   /db_xref="UniParc:UPI000192D777"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE07"
FT                   /transl_table=12
FT                   /translation="MPYTIGDRRITLDSNLLESDKQLLITHPKIFKYCLNNAVFRYIIN
FT                   LKNLVHLYSDIITIYATLLRKIPHYDDVTLMTNKSKLNLLKLEHDFNDIFGQYTTMLEY
FT                   KKFKSSWEDISYEGDIVPSALLIIDVASQAFGTVYKSLSCIELFFKHYDNLKKLLIPSL
FT                   VVRTKSVLDSFAKLEQFLKLSFPVDKMARGEIITFDESTFENMRRVEKVTSGIERESII
FT                   LETVFLTFDGSLKQYTSILLGKAILKRDVAPRDCEIISRRGICYQAAEHVVTIPLSEDS
FT                   PNKSKSAMEYLSKYIAYIGVSLLILISVVFYRLFKVLFG"
FT   CDS_pept        913341..914387
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536102"
FT                   /orf_name="CD36_84070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42918.1"
FT                   /db_xref="HOGENOM:HBG396693"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="UniParc:UPI000192D778"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE08"
FT                   /transl_table=12
FT                   /translation="MGVFSIFSSKESFDPNVFEKELTSITENINSNKQQISKLQSRSKY
FT                   LRRSLSRYLFIIYLCIFGYCYATIPSSTIGKNRVQWFIRGQTKQNLLVLIGYPLFSVLT
FT                   LRAVSYIFQFFINNKQSYLKSLQNKHKEKIEELKKITNFNKTNELINKYGNEKQPPVSL
FT                   QKQESEPFSNQKQSDHLRNRGNKPGNLRDQAMKELNLPEDKQLPSSQKGQSPSTKQAPV
FT                   PTIPQPPAQRTIQDRLLDILIGSDNSESVENRYALICFHCFAHNGLAPPHTEDPADVKF
FT                   QCWKCGAMNGKGMLFEQPDMKFDSSKNSSSELINLDVKENAENKAHESLDQPATTNKEN
FT                   EESTKELQ"
FT   CDS_pept        complement(914438..914974)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536103"
FT                   /orf_name="CD36_84080"
FT                   /product="Nascent polypeptide-associated complex subunit,
FT                   putative"
FT                   /protein_id="CAX42919.1"
FT                   /db_xref="HOGENOM:HBG628290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniParc:UPI000192D779"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE09"
FT                   /transl_table=12
FT                   /translation="MSIEEIPQGADVNVIPKNEKKARELIKKLNLKQIKGISRVTFKQR
FT                   GNLIYAIDSPDVYRSAAGTYVVFGEAKVDDMNQRIAEAQAQQAQQEALQKAAADAGKTE
FT                   DKSPEAITADLEKASLADKKAEEEEEDEGEVDETGLDPKDIEIVVEQTQVSRAKAVKAL
FT                   RNHDGDMVNAIMDLS"
FT   CDS_pept        complement(915052..915414)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383336"
FT                   /orf_name="CD36_84090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42920.1"
FT                   /db_xref="UniParc:UPI000192D77A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE10"
FT                   /transl_table=12
FT                   /translation="MTRLQRITVKQKFHVISHFEGTRVISLINQVGFSGSFEESKRDVT
FT                   YRNDPMKYVDREKKKRRGKTEKKNLIIRWRIYSIDVFRFPGKHVVVEKQKKKNMKNFLR
FT                   VFSTLFLLRRTASIFH"
FT   ncRNA           915251..915562
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="U3"
FT                   /db_xref="Rfam:RF00012"
FT   CDS_pept        916508..918088
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576652"
FT                   /orf_name="CD36_84100"
FT                   /product="Allantoate permease, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42921.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192D77B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE11"
FT                   /transl_table=12
FT                   /translation="MKSEKDSEIQGINIEPIISFSKEDLQLDKSHVLTTVISPSGKEVA
FT                   ITNDVDQVMKFVLDHQNKKVVLDEATDKKLLRKIDMYMLPVMCLLYCFQFMDKSSTSYA
FT                   SILGLREDLNMVGDMYSWTATAFYLGYLAFEFPASMLLQRFPVAKTVSVFIIVWGIILC
FT                   LHSVPQYPGFIALRTILGMLESSVTPAFTIITSQWYKKEEQFLRTSWWFAFNGIGTILG
FT                   SAIAYGLYQNDGNYSLPTWKLVFIVTGCLTIFLGFVVMIHIPDTPTQAWFLTDEEKLLV
FT                   VERIRTNQQGFGNTHFKRNQFIEALTDYRSWLLVIYALSSNIPNGGLTNFSGILLYEDF
FT                   QYSESKSLLMQMPQGAVEIVGCVLLAWCSRFISSRLLMTVFTTSLTIMSECLLAFCPEK
FT                   NGRLVGLYLPMLDPLGFICCLSCVSSNFAGHTKKITTNAMYLIAYCTGNLIGPQTFVSS
FT                   QAPQYIGAKVGMIAGSSVALLSLLSLYFSYVWENKKRDAMPMVDMSHIENYEFADLTDK
FT                   ENPNFRYSK"
FT   CDS_pept        919159..919560
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230461"
FT                   /orf_name="CD36_84110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42922.1"
FT                   /db_xref="HOGENOM:HBG396694"
FT                   /db_xref="UniParc:UPI000192D77C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE12"
FT                   /transl_table=12
FT                   /translation="MITTSLKRSRSLLNKVLPIDIEGDKHSSPSVVTRSSPLLNHDSEF
FT                   LHVSRNPALKNSNKKTSKSPTRQGSNKNSKKSNGHKKRRNSSHHKERTEKSELSQSTRG
FT                   SDILNQRSKLDWILIVAIGTLIILIYILN"
FT   CDS_pept        920154..920969
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576653"
FT                   /gene_name="KRE9"
FT                   /orf_name="CD36_84120"
FT                   /product="Cell wall synthesis protein, putative "
FT                   /biological_process="cell wall biogenesis"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAX42923.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0042546"
FT                   /db_xref="HOGENOM:HBG396695"
FT                   /db_xref="InterPro:IPR008659"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI000192D77D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE13"
FT                   /transl_table=12
FT                   /translation="MRQFQIILISLVVSIIRSVVADVDITSPKSGDSYSGSSGSASIKI
FT                   AWDDSDDSDSPKSLANAKGYTISLCAGPTSDGKIQCLDPLVKNEAVSDKSKTVSIKQNS
FT                   VPNGYYYFQVYVTFNNGGSTIHYSPRFKLTGMSGPTATLDVTETGAVPEDQASGFDTAT
FT                   TADSKSFTVPYTLQTGKTRYAPMQMQPGTKVTATTWSMKFPTSTVTYYSTKAGTPNVAS
FT                   TITPGWSYTAESAVNYASVAPYPTYWYPASERVSKATISAATKRRRWLD"
FT   CDS_pept        922267..923532
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576654"
FT                   /orf_name="CD36_84150"
FT                   /product="Arginase, putative"
FT                   /EC_number="3.5.3.1"
FT                   /function="arginase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAX42924.1"
FT                   /db_xref="GO:0004053"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG391953"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniParc:UPI000192D843"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE14"
FT                   /transl_table=12
FT                   /translation="MKFHIFALLACVSSQAIFKSPSLLDQLYGELHGRTNTAPNLQIQA
FT                   DDPNQMTVQKVLSMRSKLKLPDKDDTSDIAVDQNMFGGILTYAHFNHFNCFISNENNEF
FT                   DKHSTLDQQTTRNIDVAIVGAPFDTGTSYRPGARFGPESIRSNARRLGSAWKSTKKRFN
FT                   YPVDPYDETTHNYSIIDCGDVAMTPFDNRIALNQLYRGHRSISKHQGNVNQHPKIITLG
FT                   GDHTITIMAIKNVYEQLGRKIRVFHFDSHIDTWDPKKLGGGITDYMSLNHGTFLHYATE
FT                   LGYIETKGNYHIGIRAPYIDANYDKQHDADCGFHIIQANDIDKIGVQGIIDELTKDPDI
FT                   PTYISVDIDVLDPAYAPGTGTMEVGGFTTRELLAILDGLKNKVNVIGGDVVEVSPPYDT
FT                   NSEITSLAATSVVDSLLKLMIV"
FT   CDS_pept        924390..924908
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230462"
FT                   /orf_name="CD36_84160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42925.1"
FT                   /db_xref="HOGENOM:HBG396696"
FT                   /db_xref="UniParc:UPI000192D844"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE15"
FT                   /transl_table=12
FT                   /translation="MTYQTGRKCSLGIEEPIDISSKNVPLNAFLIYTTSRTLPDHNSTD
FT                   SWNEYYDSLSMTNNTQVMTGCTDNVKSTNNVPRCVSGVESKVATSEMETLHRCRFSVCD
FT                   LNNLENYLYQSEKESNSAVIEQIEAHNSTGMNTCCNSIIDINAQCNHMKNHRRRKSIAL
FT                   KFKKPQTLL"
FT   CDS_pept        complement(925152..926780)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000262757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576655"
FT                   /orf_name="CD36_84170"
FT                   /product="Uridine kinase, putative "
FT                   /EC_number="2.7.1.48"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /function="uridine kinase activity"
FT                   /protein_id="CAX42926.1"
FT                   /db_xref="GO:0004849"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI000192D845"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE16"
FT                   /transl_table=12
FT                   /translation="MPLHPKSRRRSSRISPLPDEDSLSFINSSVENLDQSPFESIDDLV
FT                   EDVNKYELKSTNDQQQQQQQQQQQLQHKSSFTSTPKASYIPPWTEPYIIGIAGNSGSGK
FT                   TSISQKIIQDINQPWTVLLSFDNFYQPLTSEESKLAFANNYDFDCPDSLDFELLVETIG
FT                   NLKKGGKTTIPVYSFTSHNRTSKTNTIYGANVIIVEGLYALYDQRLLDMMDLKIYVDTD
FT                   LDICLARRLTRDILYRGRDLSGAMQQWERFVKPNAVKFINPTVQNADLVIPRGLDNSIA
FT                   INLMIKHIKNQLTLKSRNHLQRLKKLGVDIKFDIDKFNIKLLQNTNQVKGINSILFNNS
FT                   TSRNDFIFYFNRMCGLLIELAQEYMTNYTNVDIDTGKGVYHGKKLLQNQYNAINIIRSG
FT                   DCFMTSIKKSFPEISIGKLLIQSDSTTGEPQLHFERLPHKLSDKIMLFDSQIISGAGAI
FT                   MAIQVLLDHHVKEQDIILITYLSTEIGIRRIVNVFPKVKIVVGKLSSVEDSNSNNKVWY
FT                   NNEGFLDSHWHFRNRFIDSLYFGTE"
FT   CDS_pept        927082..929682
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079107"
FT                   /orf_name="CD36_84180"
FT                   /product="Pre-mRNA-splicing factor ATP-dependent RNA
FT                   helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX42927.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D846"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE17"
FT                   /transl_table=12
FT                   /translation="MDTQTGRGVRRRRQELLDVDDDNDINNKEESVQVTQQEFPNTNST
FT                   TESTKPTTPPLPPQQTHYKRSKSKYYQFKQELEELEIQEDLSPNQQSRLDYLINKLNNW
FT                   NKNKNNHNQNEYYNLPSLQQSKNELLHQRQQQKQQQQQRQQSFQPSRMNWEDEQFKRAD
FT                   QLILQNDDKIYINDDKEYEFVFDQSQFVNYDEKEEEELPGDEEDEEGDRNNNSASINAK
FT                   YDEVRKSLPVYSYREEFLKIINENQTLIVVGETGSGKTTQLPQYLYEAGYSQNNRIIAC
FT                   TQPRRVAATSVAKRVADEMQVKLGEQVGYNIRFDDNCKDGITMIKYVTDGMLLREFLQD
FT                   PTLEKYSVIMIDEAHERTLSTEILLSLLKDIIMTTTRKNDLKIIIASATINAEKFSKFF
FT                   NNAPILNIPGRRFPVKIHYTKQPEANYIQAAITTIFQIHMTQPLPGDILVFLTGQDEIE
FT                   TMEEILHDSIVKLGDQINPMMVCSIYANLPQELQQKIFQQTPTNTRKIVLATNIAETSI
FT                   TIDGISYVIDPGYVKQNVYNPITGMESLVVVPCSRASADQRAGRAGRVGPGKCFRLFTK
FT                   WSFYNELDLNQQPEIQRVNLTSVILLLLSLGINDLLGFEFMDPPSKQAIIKALNLLYAL
FT                   GALNSQGKLTKIGKKMSEFPLDPIFTKCILTSDKFDNTKQIISIIAMLNESSNLFYRPK
FT                   DKKELADKRKQEFNDSQGDQFMLLNIWQQWVDSGYSVQWCQDYFIQYKTMKRIKNIYEQ
FT                   LIRLSRKIGIEVNNHQHPKESNNNDNCTLLTECLISGFFNNIVKLSPMGDCYQKLTNGK
FT                   NGNNNTPCYIHPSSCLYKLKPKPKYLLYYELVLTSKEYMRNCIILDEKLIKQYL"
FT   CDS_pept        complement(931183..931257)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        932636..933748
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093899" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576656"
FT                   /orf_name="CD36_84190"
FT                   /product="Cell wall integrity factor, putative "
FT                   /protein_id="CAX42929.1"
FT                   /db_xref="HOGENOM:HBG396698"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI000192D847"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE18"
FT                   /transl_table=12
FT                   /translation="MVKLHFFTIAVSIFYANSLLVLAADFFAPASNIGCYSSISGGDSK
FT                   GDYNFQSSGYCVTNECPNSPYVAVKGGECICLNSLPQSSSKVNSNQCNQPCPGYSSDKC
FT                   GGSNVYNIYKGLASSSSSASSNSGSYASSTSSGSGSSSSGSPSSSESSSVTGSSNNSDD
FT                   SDQSTATVVSTMSNSDGNVIYKTITQEASPTTSSGSSSHASTTSSSSPSSSSTSSSHPS
FT                   DSTDGKNNGKSEKKSSSSVGAIVGGVVGGIGGLILLVAGGFFYMRYRNNNNDEDEEEEF
FT                   YNDKPLKRSNGSKIGSRRSPNDLEMPMANPFQHPADDLVRNNSVQKNGFVDPRLNPIMM
FT                   GRRRLSEGSLVDEADYSRKVLQVANPDDTK"
FT   CDS_pept        join(934861..934878,935180..936472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093900" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576657"
FT                   /orf_name="CD36_84200"
FT                   /product="Metal homeostatis protein, putative "
FT                   /protein_id="CAX42930.1"
FT                   /db_xref="HOGENOM:HBG448425"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniParc:UPI000192D848"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE19"
FT                   /transl_table=12
FT                   /translation="MRSHERLSTSSEDTNKKSSNSDINSNNKNILDSFISEEAISPPST
FT                   TQHHHRQDYTDTTPTATATTTTTMETTSNSTPIIPSLDEDNRLSSSPESMPIESSSSPS
FT                   TTTTAPATSSRSEQRDLDDLESQTPPRLTTNQRIQRVLHHFFPVRQTYERLNNGLTTGR
FT                   MQTNNGRFIGQGTDGVFRNLMAKPDTEEMRQQQELNPPSYEEAAADASPEYWESTMISP
FT                   MYEDEVFVQGLPVGNIANFVWNALVSVAFQFVGFILCYLLHTSHAAKQGSRAGLGINLI
FT                   MYGWNLVPQNFGHPDKLPKKYQPENPNDFDINKSTKISGKIDGYNSGIFIQNSIDNTKD
FT                   GNAGDWLGGSGSAPYVAYGLIAFGLFIILKSLVDYYRVKQLERAILNPPSNMPVNTNSI
FT                   TGVVDEIDEENRHREQHQEQHQQQQQQEEEELYSHQH"
FT   CDS_pept        join(complement(937626..937640),complement(936682..937551))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576658"
FT                   /orf_name="CD36_84210"
FT                   /product="Tricarboxylate transport protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX42931.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D849"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE20"
FT                   /transl_table=12
FT                   /translation="MSKDKKQVDPFKSFIAGGTAGAVEGVITYPFEFAKTRLQLISKSS
FT                   TASRNPLVLIYNVGKTQGISSLYVGCPAFVVGNTLKASIRFLGFDSIKNLLSDKNGKLS
FT                   GPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSIKPKYQNGVISGSFKLVRDMGFK
FT                   GIYAGVVPVSLRQAANQAVRLGSYNAMKTMIQQASGQKPNEPLSGVTTFSVGALAGIIT
FT                   VYTTMPIDTVKTRMQALGADKLYSSTLNCFVKIFKEEGLLTFWKGATPRLGRLVLSGGI
FT                   VFLCYEKIMILLN"
FT   CDS_pept        complement(939396..941630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230463"
FT                   /orf_name="CD36_84230"
FT                   /product="Subunit of the SWI/SNF chromatin remodelling
FT                   complex, putative"
FT                   /biological_process="chromatin remodeling"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="CAX42932.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="HOGENOM:HBG396699"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniParc:UPI000192D84A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE21"
FT                   /transl_table=12
FT                   /translation="MSFNQQPQNFSSSSGMNTNTSQQQQHQQRGGNLPALTPQMLQSLT
FT                   PQQFQLFRSNPQFQEVMNQYMQKQQLLQQQQQQQQSMQGTTGGIIGGIAQQPPQSMQLS
FT                   REQFLKQQQMMLNQQQQQQQQQQQQQQQGSPHIMNGIPNQPQANPQYRQQVVANQIPPN
FT                   MVNVPGSQTIINQPIHGGNIPINKVPARRMSSIPGVAGGQNPPVGVPGGAGPPMAGVPG
FT                   ATPLVPGQGPVRSAGGVLATGVPNSGSGPSTGVLNGAQGDAGLNSNLPPGVTPDILNKI
FT                   PMKPMQNIKEWSEKLKQEGKDVPLDLKVYEDLIRKDTEFVGKLNKQLHDNKTIMENIGK
FT                   DIKSYNQIKQLRMNSIALSNKGQYNNSIWGEGYQGYGNGITNASTKLFIPNRDLTDRII
FT                   NERVMKNKNKPKHYVPIRLEFDQERDQFKLRDTFLWDLNEEIIKVEDFAAQLLEDYKFI
FT                   SKVHYETILSSIKEQIADYSKKPSKTMGELRIPIKIDITINNTQLTDQFEWDILNSQEG
FT                   DAEEFSSYMCDELCLPGEFCTAIAHSIREQSQMYYKALNMVGYGFDGSPVHEDEIRNHL
FT                   LPPLRLVSSDSGIVDDFFSILRNPSSVPDFSPTLGKLTQLEVERLDKEMERESRRKRRH
FT                   NYNEDQQQGSGRGFTSRRIAAHAGRGNTIPDLSDIPKTFRTPAPSSILPGAVDLGVPEV
FT                   YEYNEVLINKTQVRNPDYRPPTPIRVENELVEYNHDPLGGTFMVTIKLPV"
FT   CDS_pept        complement(941887..946482)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383337"
FT                   /orf_name="CD36_84240"
FT                   /product="DNA polymerase alpha catalytic subunit A,
FT                   putative"
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleoside binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42933.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0001882"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG561737"
FT                   /db_xref="InterPro:IPR004578"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015088"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI000192D84B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE22"
FT                   /transl_table=12
FT                   /translation="MRVLFFFFGFSRQSHIFSNQYCSIHLKEEKKKPKQRKLELKSILF
FT                   SFNSSPSHYIKRFLTMSSRSARRKTLQQLKEARRTGRNVNVIESDTDDYNEIYDEVDED
FT                   TYRQHKRNQLMNDDFIVDDNGEGYVDNGADDWDDASRPNYYSDEENESMGSRKRRKKED
FT                   KTSKVAKTSQIRNFFKPMSGISDSKKKLETNIDDILNDFGDDLDRKKHIPKAFSHSTNK
FT                   EVNNNKINKKKLKNTFNFSTSTKKTDITTPKLDAFNASSDYTMDIDTFEDQPSSPFKLK
FT                   SEVTPEADTGKENIDPEPTKNILEDPPELPKNQEKANVNDDDSDDDIVYSRKPRAAVVK
FT                   KNQVDTVSAVKANQLPSSPTSKPVYTKFSNHTEKVSEDNIKDTSDSFKMFWFDYAEVEN
FT                   SLLLFGKIMTKEGKLVSGVVKVDGICRELFFLPREYRIVDDEEDKTKKLAAIDVLEEIQ
FT                   PLLLANYKLEELRAKPEVKKYAFELADIPKEAEYLKVLLPFNNETNRNIMPANIEGSTF
FT                   RHVFGTNANMFESFVMQRNIMGPCWLEIRGGDFDAMQNVSHCQVEVVVNRPSQISTIDK
FT                   DAPASPNLTVTAISMQTVLNPKSNKQEVVSVSLATYFELPQDAPISEDIKPDDVFTLAR
FT                   PVGAVSFPPRLQQLADKGGFQLRTCPSEKVLLNALAAKIKTLDPDVFIGHRLENISLDV
FT                   LVHRMNDNNVVTWSALGRRNRKKWPYMINKSNSSYNNSLLIRDVFQGRLLCDIANEMGQ
FT                   SLTMKCQSWDLHEMYDVVCHKKHAPVEINYQNLKYAEDAHLFLMALKENELNVKQTAEI
FT                   AFATQILSLSKQLTNIAGNAWSHTLSGTRAGRNEYILLHEFKRNNYIVPDKEDKTHKNT
FT                   SYQQEARVENAEEDATTATSNKKPKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEF
FT                   NICFTTVNRDRFNVTHDENKDMPVLPERDTESGVLPRLLNTLVSRRREVKKLLKDPKNT
FT                   PFQKAQYDIKQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMDTRQLAESS
FT                   SLRVVYGDTDSVMIDTGANSYKEAIKIGEQFKAQVNERYRLLEIDIDNVFKRLLLHAKK
FT                   KYAAMNASINKATNEETATLEVKGLDMRRREYCQLSKDISTFVLTKILSDSDPETALLE
FT                   VYDYLDEMKTKVQNNEIPIDKYKINTKLSKDPKSYPNGKTMPQVQVALRLREEGKVIKA
FT                   GSVITYVITAARDDGDSSTVAERARAIQELLSKKDPNLKPDANYYLEKQIFAPVERLLE
FT                   RIEGIDMVRVATSLGIDTKRYILRVKNSEGGGANGEILPIESNISDEERFRATSYLVLH
FT                   CKCGTSFRFGGIMAAETYKVTFNGVCCSQCNYTFPAIKLTSQLESMIRKHIALYYAGWL
FT                   VCDDPACGIVTRQISVYGKRCIGNSGRAMDCKGVMRYRYNDKQLYNQLLYFQSIFDVEK
FT                   TKRGQLRPLVDALEESKDKQLPKLPSGQVEALAEQNRELFGVCQEVIQKYLGECGRRYV
FT                   NMGSIFDFMNN"
FT   CDS_pept        complement(946750..947640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383338"
FT                   /orf_name="CD36_84250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42934.1"
FT                   /db_xref="HOGENOM:HBG448426"
FT                   /db_xref="UniParc:UPI000192D84C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE23"
FT                   /transl_table=12
FT                   /translation="MKFLTLLTIVELIFVSGVDSTPAAPPQPGLRIGENDRKQIDELVH
FT                   QLEILNAENSNLVNDFTEDYQLISRDLDFEDLSARSDLPILDTVFRLVNNSGVAIIATD
FT                   FLLTREPLLDTAIDTLVRAIDEQWVNLTTIFIALDQSNLLLDTLMHAIKDPDVLPGLLR
FT                   ITKEVINQSGFRIFNVRETKDIASYSQEASASMDVFKRENSLLVLLFTSLKDSGLVVAL
FT                   SKHILTTPELAPGAAHFVWRILKLRPSTLYKIFDALKRSNLIWNLLREIINVPAILSNF
FT                   STIVTQTITQKLNLQ"
FT   CDS_pept        948142..949002
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576659"
FT                   /orf_name="CD36_84260"
FT                   /product="Syntaxin, putative"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42935.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG396700"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000192D84D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE24"
FT                   /transl_table=12
FT                   /translation="MSFANIDLEAQKEPLLKSKDNDTNYTSPDELDTIIGKTSRQLSVF
FT                   GNLISQFETQRKQIGTRRDTQELRNTIDELTSKIQEMDKAISALITNLSNLINSKNGSA
FT                   TNASISNRHIVIEERLSHQYDELSKAFNKSTKIYQEKKRTTPLLTRTSQATEEQTKPED
FT                   TLTTSQQEQEQEQEQVDQDFIDQTELQYHILLTEERNREIEQVTEGIMEVNSIFKDLSQ
FT                   LVHQQGEQVNTIEDNILQLHGNTQQASNELNKANEYQKKKGKWSCILLVALCIFLLVIV
FT                   LIVVS"
FT   CDS_pept        join(complement(949585..949597),complement(949142..949521))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093903" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536104"
FT                   /orf_name="CD36_84270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42936.1"
FT                   /db_xref="HOGENOM:HBG448427"
FT                   /db_xref="UniParc:UPI000192D84E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE25"
FT                   /transl_table=12
FT                   /translation="MTPFIPLSVKVALGLGTLVGATIAVINNKEAIYETAEAFFSRGAE
FT                   YCREKLEEAKIANETNFADHYQDEELKDVSAARSTGSNLRDESDYEDISTPETSDFSEI
FT                   DTDFQDDDDISDGKEQSDDFDTASLD"
FT   CDS_pept        950447..951628
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246767" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576660"
FT                   /orf_name="CD36_84280"
FT                   /product="N-acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAX42937.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG396702"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI000192D903"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE26"
FT                   /transl_table=12
FT                   /translation="MTVNNSIVYSRPLSVSENFFRCRTASGNYRNFVVTATYNQGLKKN
FT                   LHILVKALRKTLLEYPILATTVQFDKTVNAFANVPLKSIKLNDILFFESDKEWLTEGVI
FT                   NENFIRYCNETQFNLYQENVLFKLILVGDFHLSAIFEHTIGDGLVANYFHEVLLKNLAE
FT                   CELMENTLFEDQFGPLVFENIELKDEILNFEKDRIYIKNSLPPPIDPFLEDIDLDYSFG
FT                   DPYFQDKVIPEGFPNKWRGRFDTVDTHDISFKLINFSRQETKEILSKCKEHKVGITSYI
FT                   EVVNALTFQPVFGDNSFTTHRTAMTLRRHYTPDLAEYPYKKILSDPEYKIFGTSAHMGF
FT                   VQNFPPIKAFSWDLVKKVNLDLSKAVRNKRALNQMKPWKDAGDLLDEKKYGVL"
FT   CDS_pept        complement(952111..953004)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI17576661"
FT                   /orf_name="CD36_84290"
FT                   /product="NADPH-dependent 1-acyldihydroxyacetone phosphate
FT                   reductase, putative"
FT                   /EC_number="1.1.1.101"
FT                   /function="acylglycerone-phosphate reductase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42938.1"
FT                   /db_xref="GO:0000140"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192D904"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE27"
FT                   /transl_table=12
FT                   /translation="MSQQKFALITGASSGIGYALAKEFSLRGYKVIGCSPKSVLHLQKP
FT                   LEDEYGLISIACDITNLEDIKRVKELVIKETGGYLDILYNNAGIAIGQPAIEIPEDKLN
FT                   WIFQVNVIGHINMTKHFAPMVIKSKGSIIFTSSVAARVPLSWVSAYSATKAAIDAYAKT
FT                   LHGEMEPFGVKVHSVITGGVQTQIGAEENNIEEMKTQFADSPFNVDGIIESGMASQRMA
FT                   VDLGIPPQKYAKNMVGQITKKSSKFNLYGGSNSYILHILGLFYPFWLVEYIMQFTFKQL
FT                   KPFALIRKKYAGKKNR"
FT   CDS_pept        953729..956035
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576662"
FT                   /orf_name="CD36_84300"
FT                   /product="Voltage-gated chloride channel, putative "
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42939.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG735070"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI000192D905"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE28"
FT                   /transl_table=12
FT                   /translation="MTTYQPVEQSLLEDDLDLTLSSDLVRSRSTGSWINQDNIREVQRF
FT                   NDFRTIDWVEDELDAQKKRVLKARHITSRGNNLKDKIISQVQNWVVLGIMGCSIGLIAG
FT                   SLNIITSFLSNIRTGHCKRNFYLSESFCCWGEESDHCDNWVKWTSFEFINYIFYVLISL
FT                   LFAYSAAKLVKFYAPSAAGSGISEIKCIVSGFVMDGFLGWPTLFIKSLGLPLAIGSGLS
FT                   VGKEGPSVHYAVCVGNSIAKLITKYRKSASRAREFLTATAAAGVAVAFGSPMGGVLFSV
FT                   EEISTVFQLNTIWKSYFCALIAVTTLAALNPFRTGQMVLFEVTYDTNWHYFEIPVYIIL
FT                   GIFGGLYGIIVSKFNIRVVAFRKKHLGNFAVREVLILTLFTASFSYFNQFLRLDMTETM
FT                   QILFHECDKNFHHPICDSSNKKAGIIVSLLFATFARMLLTIVTYGCKVPAGIFVPSMAA
FT                   GATFGRALGIIVDLVYANHKDSFVFRNCPKDGKCIIPGTYAFLGAAAGLCGITDLTVTV
FT                   VIIMFELTGALRYIIPTMIVVAITKSINDKWGKGGIADQMIKFNGLPLIDSKEVFTFGT
FT                   SVESAMSTVMVSLSTDLNDSITLKQLQTTLFKTRYRGFPIIKSSKDPKIIGYVSRHDLE
FT                   CILKKHANVNEDILCNFNEAESGEVDKVDFDGVINKSPLTVNFNTSLEYVLDIFAKLGA
FT                   RYLLVEKEGCLVGIITRKDVLRYEYTVHEHNRDNIQQAKHDAFDEKVWEFINVIGTSAK
FT                   KNIGKLLHNDPNRYL"
FT   CDS_pept        complement(956074..959436)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576663"
FT                   /orf_name="CD36_84310"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /protein_id="CAX42940.1"
FT                   /db_xref="HOGENOM:HBG448428"
FT                   /db_xref="InterPro:IPR018849"
FT                   /db_xref="UniParc:UPI000192D906"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE29"
FT                   /transl_table=12
FT                   /translation="MGKSLVTAEAVTKLLRSKDTSITEIVHTANSLLNDELDIYLPGKE
FT                   VFVLNLLCDRLNDKSNGKFGTWKFNKDVWSLLLSVWSKLNHQKVDRQRVIQKLKTIEII
FT                   FIVLQHSNDNEVFSKLFEFLGILFQESYIIADENSAIQLLKCFVEHMDVLQSNESIVTW
FT                   TELVRDIYIRACSKISLEGSKKFYSKFFEDCCFPLVDYLAISECSSVSPIFKELLIQGV
FT                   FNSDSTKFYQSSLERDLKKKEVKEESLIYLYTLTVQLLSAKHMTICEGVYSIMASKSPD
FT                   LAEKLLSILASSKKTISQSFIESIYKVEIADKPFKQLNWDMVKHIFAIDSELAINKSGF
FT                   LFKTYKSEFQLDDKVVPVAEVIVDGFARNRELSDFFIKVWPKAIKRDEVWESDEFIYIV
FT                   SQHVKTFSGKQLIAVIESSFNVDKGSQRAIFTAITKGLTNSSVNLVDAVKPTLLDQDSY
FT                   FNAIENFWSIRYYLLCLYGADFTIAKQNLKQNIDLYYHFTIFRLLELQVVKDYSKSDQK
FT                   YFIACIEGEKEMIPQVFKRWLVIFNKFFDTDSLIKLISIGYSDIEFGDVFFEQPKLTTS
FT                   LLKFIAENLQARMDLIASIPIVCFNKSFKKELLNGLFTLFTSNPTKETLENMHYLLGQP
FT                   TYSSVLETKFDNLLKLLTVGTDESKLIAYNVIKIVWRNNVQQIKNEENHKYVNDAISKL
FT                   NSYLDSKPQQIISTELEAILIILTNTKEEGLSENMEAELNELNDKFTNYCIETLNDCKT
FT                   EDLTTIKWLLQTLVMLPSKSSTFENVISCVKRLDSKILKDASIQSTLFQLICKTTDLNH
FT                   KSLVYVLSLFVSLQPGLNTELYDVLKLLFQKLSKHSQLYFEVFDFFTGSIGTVPVEFSL
FT                   SFAQIASIFLSTVPKDTSANRYNSKCFTFYVNALQSENECVTMQILTSLKDLLTNQSWV
FT                   FKQNLLEITLVIVKIGSQRINSFTNQEKIYILSTQIVSHILLYHRFKIATRHHLILNVM
FT                   SSLLECLADGNSKLSSNAEAASAYARLLSNLCEPSERVGDKMSHLTTSASYFKKLLRKY
FT                   LSVLLSNYIYFNLKYTFTRAVNDAIMPGIYSVFAVLSQNELRVVNASLDYGGKAFYKTL
FT                   YNDYKDHGKWKDQ"
FT   CDS_pept        complement(959758..960138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000055226" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576664"
FT                   /orf_name="CD36_84320"
FT                   /product="Ribonucleoprotein-associated protein, putative "
FT                   /function="nucleic acid binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX42941.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI000004DD84"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE30"
FT                   /transl_table=12
FT                   /translation="MSAPNPKAFPLADSALTQQILDVVQQSQNLRQLKKGANEATKTLN
FT                   RGISEFIIMAADTEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVIAASVTS
FT                   NDASSIKNQIYGIKDKIETLLI"
FT   CDS_pept        join(960616..960629,960943..961411)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576665"
FT                   /orf_name="CD36_84330"
FT                   /product="Vacuolar ATP synthase proteolipid subunit,
FT                   putative"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrolase activity"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="CAX42942.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI00001381F0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE31"
FT                   /transl_table=12
FT                   /translation="MSDLCPVYAPFFGSIGCAAAIVFTCFGASYGTAKSGVGICATSVT
FT                   RPDLLVKNVVPVVMAGIIAIYGLVVSVLVSDSLSQKQALYTGFIQLGAGLSVGLSGLAA
FT                   GFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRASQDVTC"
FT   CDS_pept        complement(961680..964001)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576666"
FT                   /orf_name="CD36_84340"
FT                   /product="Nucleoporin, putative"
FT                   /protein_id="CAX42943.1"
FT                   /db_xref="HOGENOM:HBG396703"
FT                   /db_xref="InterPro:IPR011502"
FT                   /db_xref="UniParc:UPI000192D907"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE32"
FT                   /transl_table=12
FT                   /translation="MPEYTNFESKFDDIDMLEIPDDDDGENSNENSISSETEGISDSSD
FT                   SSKNSYDQSSPVAIFKSDKEYIDLSDWLNTQKTLEFKFEAQKYRKGTEKARPFDEKYIS
FT                   YINNIFKTIEKLTEDDITRFDLEEDDSPIGLVMDSTGSRAKHVQKFQKIDEAFKQIIDY
FT                   LQNLVNSISREEQESYDFQCLQHVLYILECFEANNFYFDIQQKPELIIKWVNTFDPKPD
FT                   PELLNDVMVNTPQPYLHPQFWNTCISQLLTRGLFTQIHEVIEHSQYHELKEKCPELHAV
FT                   IGDMDTLLSNYTSYSSKGQFTAWKLLACEFRDSLSSVRNESITETNYKLIIDQIYDLAC
FT                   IFTGLPKTISSYCDTWYEVYLALSLYQIRDSNEVYVDYFKTAVSEKPPSDIFHDENEDI
FT                   DGLTEACFLNILENNYLKVLETLHELDPPTTAYLAELMELRLLLRGYYFDVTVTSSASF
FT                   EDLLNRRTVSEYFLTRHAYDCLNIHELVPVGIGLLLNNVVCTSNNATSTNRKVIAAFLP
FT                   NYICNTNDDLEWALTICANLNLVSTARQLYYQAGLKSLKDGYIYEALNNFVNCYDPTLL
FT                   SGENHSEGMKKVHYIVWDLIFSNCLVRNRPIDDDLINNIVDKKVNTNIKMHPVIQQCLA
FT                   PYAVLKEFYVTLPQRDIKLSSKLSKLIHLLKFNYLPKKFVPLLLAQFIPFLIDPNTTFQ
FT                   LPDLVIIIELLDNYESDRNEKELTEGADLYLYSINNIGSGADENDWRKLLGKDNLPKDV
FT                   DSFTRMLRNQIAAKVGKVFI"
FT   CDS_pept        complement(964146..967472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093904" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230464"
FT                   /orf_name="CD36_84350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42944.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG396704"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI000192D908"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE33"
FT                   /transl_table=12
FT                   /translation="MFVLSKISDQDALNQSVVIYPLNNTACVVALTASGQKLILYKVKY
FT                   NDLVYLESINLDGKVLAIAKIRIGNQEAVVYLDDQFQIGILFIDNEFCTTIKILAKLST
FT                   TGQSMIIDMHICMVADPSENTRFIAFHIFRDVVHVFHFNNISSVDAILGKDHKTSRTRR
FT                   KKRRSDLGKWWSLESISVARISVKQIAILEKPTNTMAILYKDVNSNFFVRCLSVKGVDS
FT                   LHAKQPIIEFEQDLPCLIIPFQAGGYIVLSTFSVFYFPDDQIQYITISSEINDISIIQS
FT                   HSKLHCVKELIKSGNGICEENYVSFEVIDKTRFLVIAESGRSYLLFTDMEISSKTTMII
FT                   NQMTMISLGEVTIPYYNGLSHISGDLFFQSSQFSRSVLFSVLPEKPHIHIRAYIESSPP
FT                   VLDIKDRGKQDEELYTCQGSWEGSELRKYGGVQHFPELLNTKSIDMKIKKLTIMSSMVM
FT                   VYNANGDSVALEAQNLMPKITYPKIDSDVLAYHEEADFQYSITRSSLSVDGKPMVNEPF
FT                   IYFSVVPEINIVVAVSDTKRIYVLQKNNVFDFKSEVLEEITSIDAIHVGDGTILILATD
FT                   WNGRYQIWKVVNKKVKSLFYGELQDNTFVLDSVIIQSGKNGITVFMSTKKGSLHQLIFA
FT                   LTEKGIDKVNSTEQYVSDVPCILRKFKDNVLVFNSKHLTALKKDELSGFFVKKRIYVPD
FT                   PDIADVCFVTEDVILIGYRNGRIDQVRIILPQPIVSHQSLFSNKLYLKCLPVPLAKYLV
FT                   GVVLDNSTDSVNTQLHLVDTDTFELLSTYEFDDPPGVQVVDICLIQEPQTINNHMDGLF
FT                   VCLTLSTEFPLYVFGIEESKLVCLNRGTISGMDSLTDIKLNSISSFDQEKQIYLCSGNI
FT                   VTLIHLNIDDKFQWTFVPRSAVHSPAFVVSQWSYENMVYLADAIHGAFSSNVDELEKHS
FT                   AMKLIKVDTDSMGNQMTAITALRSQDNRYVIIGDALGNVNIIQTDPNDPSIRSVFKFNI
FT                   GDQINCISALGRQKSWGAQICAIGTVSGGLFILNKTDLNGCCESLVEFAANNYLELLEC
FT                   DEESKNKDDKSQCNEIISDTVIERVLNHFIANPIEFSQTYNNLYLNRHRLQSVHFECNS
FT                   I"
FT   CDS_pept        968127..970811
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079108"
FT                   /orf_name="CD36_84360"
FT                   /product="E3 ubiquitin-protein ligase, putative "
FT                   /EC_number="6.3.2.-"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42945.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG398466"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI000192D909"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE34"
FT                   /transl_table=12
FT                   /translation="MSQQYSSKKSKVTPNPKHNWNFKDLLTIPTINSAKSKKAVITPNA
FT                   TEFDTTGVQANVSKSLSGTSENTQSQNVSKCYCCGTVLTFPNKAKKFRCSVCHTTMLLG
FT                   TSQNTNGPDIPLVSYKHVKTLADECFNNVNDSKGKSKSLHEIFEPLSNYLYQAFKTFKI
FT                   LNNSFKLRPHSKRPHHSTSNIYYTGVRDVINLLTKLPTKKPLHSALKGASEQLKRIDVY
FT                   LEDSGPLAYSWVLILFEIPILSRSLVSDNPKLKLMSDVPEIKMLSYDILKRCLGILSCI
FT                   DSAKTLGYFSSWLSKLDSADFIRRIDLINLYITFQLKKYFYLANNPQIKLNLSPSEDGY
FT                   VDNSEAEYFQSLYLKSHIESNSDISSPCSLNLPMSQFSSNPFPLKTNGKKQTKETKVKV
FT                   HQYGNDWHIRSALTVLSIAYKANKLRNDPVPVSVFYNSLVDYVNIRLDFDSWQSNRRAK
FT                   LKGNKSMQPELWAIIDYIHGTSVNKNLYDDALFYICQYPFLISLGAKISVLEYEARRQM
FT                   ERKAEEAFINSLDKRVIIDVYFRIRVRRDHIVQDSLQYIKTNSDNLKKSLRVQFVNEPG
FT                   VDAGGLKKEWFLLLTKEIFHPQSGMFHNVDDSNFLWFNIIPVENPDMYYLFGAILGLAI
FT                   YNSTILDLQFPIALYKILLKRGLDREDYRKLYPVSFKNLINLKTMTNKEILDLDLTFEV
FT                   SYSDMFGKHHTTELIANGANTQVTKLNLEEYIDKYTGFFMKDGIEKQVDAFITGFNNVI
FT                   GGNALSLFSPEEIQLLLCGSDDHRIDVDVLKSVTKYIGWRSSEDAVDSKIITWFWDNMN
FT                   KMSNKERKKLLIFITGSDRVPATGIQNLPFKISLLNNGHDSHRLPIAHTCFNELALYNY
FT                   STKEKFVEKLNKAVNESAGFGIK"
FT   CDS_pept        join(971121..971169,971347..971939)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000255193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536105"
FT                   /orf_name="CD36_84370"
FT                   /product="Ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit, mitochondrial, putative"
FT                   /EC_number="1.10.2.2"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42946.1"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG668715"
FT                   /db_xref="InterPro:IPR004192"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000192D90A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE35"
FT                   /transl_table=12
FT                   /translation="MSSLAFRTLRNGLGLKSSVRALSTTTTTLSNYQQPDYSSYLNNKS
FT                   GQGSRNFTYFMVGSMGLLSAAGAKSTVEAFLSSFAASADVLAMAKVEVKLGAIPEGKNV
FT                   IIKWQGKPVFIRHRTADEIEEANQVNIKSLRDPQNDSDRVKKPEWLVMLGICTHLGCVP
FT                   IGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPEYDFTDDETLLVG"
FT   CDS_pept        join(complement(973514..973929),complement(972230..973439))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576667"
FT                   /orf_name="CD36_84380"
FT                   /product="Uncharacterized protein yel023c homologue,
FT                   putative"
FT                   /protein_id="CAX42947.1"
FT                   /db_xref="HOGENOM:HBG396705"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniParc:UPI000192D9C5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE36"
FT                   /transl_table=12
FT                   /translation="MSLSEEPKIIYNGKNYPNQHNSSKVIQKTNHSKSIVLCFDGTENE
FT                   FGPKPFTNVLKLFQMLERNNSSQICYYQPGIGSTFNADINNVFEKNFTSTVLSKITNRA
FT                   DSLVAFTLEKHVMAAYGFLTSVYKTNDKIYLFGFSRGSFTARIIAGMIELVGLVNYGLE
FT                   DMTPLAWRIYTSWEYAGQPVQLENKTSTMAKEFKKSFSRGDVKVHFMGLWDSINSVGIL
FT                   WDRMFPYTIKTTNVDHIRHAVSIDERRSKYKQQLFSPIESSDTGSKGSSTYSSPISYGM
FT                   FASVRSLIDLLKRFVERFNRQRSRSLPIVNDLIEVYFPGNHGDVGGGWEASQNGQVLSS
FT                   VSLRWMLGHAIKHGVKFQRQSISQWSSNNSPTSSFLSSNHDILALSSKSPDSRFGIILP
FT                   ESPIKLSVGRGEEPLLYVVLWWILEFIPFLRIKENQEEGYWKRAFVPNLGKHREIPSTA
FT                   LLHWSVFYRLHYAADYNPKNLHNLSLGEKFIESLMQFKIFKFSEIYSYSENLTVKKIKN
FT                   NWTPGFWKKVPDELSEYLEKDPSL"
FT   CDS_pept        complement(974126..974965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205347" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576668"
FT                   /orf_name="CD36_84390"
FT                   /product="Uncharacterized protein ymr244w homologue,
FT                   putative"
FT                   /protein_id="CAX42948.1"
FT                   /db_xref="HOGENOM:HBG398646"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniParc:UPI000192D9C6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE37"
FT                   /transl_table=12
FT                   /translation="MYFLSFVISSLVASVVGNPIKKCTFPRNEDITSVGVNGWAMSPDE
FT                   PCTPGKFCPFACPPGKLMNQWDPEAVSYTFPKSMNGGLYCNEDGTTSKPFIGRSLCIDG
FT                   VGTVSVVNKASDVVAFCQTVLPGNEAMLIPTEIGDGNEQVLAVPGPGYWAGTAAHYYVN
FT                   TPGVSTKDACVWGTSEKAIGNWSPYVAGMNQDSNGNTFVTIGYNPKYIDDFSGKIPDFG
FT                   IRIVCDNPDECNGLDCEIDPRQGFNKATGPSSGNSLGADYCIVTAKNHAQARIEIFQ"
FT   CDS_pept        975827..978820
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230465"
FT                   /orf_name="CD36_84400"
FT                   /product="WD repeat protein ybl104c homologue, putative "
FT                   /protein_id="CAX42949.1"
FT                   /db_xref="HOGENOM:HBG396708"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000192D9C7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE38"
FT                   /transl_table=12
FT                   /translation="MTGTITRALNWDNVYEQQFIAVTPMGDEVLLYQTNHEDPGIESNS
FT                   MLQLYSRSGFENIQCSSYSDINKGIVGVGSINGNISIFDIYSPNSSILNLRPKQNRPCN
FT                   SVSFGNQNLVVAGFDKGRQDNSLQIWNIETYSSSGSNGSNLKRPLATYLPNEAILSTVF
FT                   YPDQNSNIICGSYKFLREIDLRLDQPVFQMATKCTLGLQIDYFQNHLFQSFSEDGSLAI
FT                   WDRRKLTSTKHRSTGTNNVITETPLLQFTKLLSDASSRKVQHPCVRYSTVRRGEFASVF
FT                   NGDLIRRWQTDIVPENNDLQDTFKAKDSSTLQRLKQQAVQLYNPKEESVFVSLVLDTKT
FT                   DYEKVVSFDYSPDIASHTSTNFVCMRQSGTVFRMPVVESIEALDFNPINEFSIAGPEGT
FT                   VTNFLNKQFLEINQSTNAKEPGPRDKNSSSLAKLGDLTLNSNLKNRNTESATTSTVDDE
FT                   SLAQSNIAEDKRYSYDNVFEEDIPLNKFWDSSDIVGNDICVTIRKRAQMGYSVDCDKNV
FT                   SILEELDVADSTLFLKNTWKWLALAKKSLDKKTMISEGIDLGYQGVLGIWKGIEELNKQ
FT                   KCTMTDELISDNWLSQAVKVIVSSKNKKISGITIPHDSERKAQRKLCLIVCGWYFTESE
FT                   FEEKLQLLISLGYYEKAAGWAVFHGDVPKAISILSHAKTERLRLIATAVAGYLAYKNSH
FT                   VNSPWKDQCRKMALELDDPYLRAIFAFIADDDWWDVLDESSLSLRERLGIALCFLSDKD
FT                   LGVYLNRIADTVVNRGELEGLILTGITPRGIDLLQSYVDRTTDVQTASLIASFACPRYF
FT                   VDARVTHWTDCYRNMLNSWGFFGVRAKFDVARTKLSKTFGGQTTIRAAPKQVYLQCNRC
FT                   NKNISKVKSNPGNNQVLLKQQFNKFNSLNKFNDIINACPHCGAPLPRCSICLLSLGSEL
FT                   PLEPSDKIEIANNQSSNIVPRIENKFNSWFSFCLTCNHGSHAYHAEEWFSKHYVCPVPD
FT                   CNCRCNSK"
FT   CDS_pept        979477..982815
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576669"
FT                   /gene_name="PKC1"
FT                   /orf_name="CD36_84410"
FT                   /product="Protein kinase C, putative "
FT                   /EC_number="2.7.11.13"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="protein kinase C activity"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42950.1"
FT                   /db_xref="GO:0004697"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG396709"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI000192D9C8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE39"
FT                   /transl_table=12
FT                   /translation="MSTSQPLQQNPEQVVNDIRQKIEKERKIIQGFNDVKRNTNNPEVI
FT                   QKCKSKIIESQSMIDYYQETMNKLTRQMQRLNTNSSSRTASRSSVVSEYKPSYSNFDLI
FT                   KYECPSLGNKIQFMLQYLEFKLQVENKYSEANRKLSHLYLMDGDKSSSNAAEGGRAESD
FT                   QRIQLLEKALKKYQKFSINDHEFDHDYEIMDSTKHSRKLLTGRLTVSITCIRDVDHIAT
FT                   ALSKKRETVVVIKVDDLEKARTKPSKNDNWNEEMVIDVDKSHEIELAVMDKQNGIYVPV
FT                   AVNWFSLFDLAEEIRKKKVAKDQGSSGWLPAANLPQTSGSGIGTGTGSSMTGGASYGAT
FT                   SPLPAHNDLGPSVSPSNDAKENKVSVSTWLSLEPGGQMLINLNFEKSITNGKQFRGPLG
FT                   RHGAIRQKKEEIFEKHGHQFVQKQFYNIMSCALCGEFLRYTGYQCQDCKFLCHKKCYQK
FT                   VVTKCISKSGSDYDAAQLNHRIPHRFEPITNHGTKCCCHCGYILPWGKKNVRKCTECGV
FT                   MCHAQCTHLVPDFCGMSLQMANEILATIESTKVSPKKAQQHHRNHSHAKPLPPKPPIES
FT                   KPSMDSEETLHNEPSYKSLRPASVIHQDTSFVSKLPTTVQNKYQEPVELPPHQQNQVLP
FT                   SSRRREHGSADLSFEAGYGQQQHQYHRDHHHQDQHQNVPQIVVEDHQHYNSLDTADVEM
FT                   EESKDNFDNFDYNNKYTENEILTDVQQEQVRSPFADQIQGVPDATHVKQQNQQVQQVKQ
FT                   VQQQELGHQRTHSSGKSGKSKRRKRKFGLDDFQFLAVLGKGNFGKVMLAESRHTLKLCA
FT                   IKVLKKDFIVENDEAESVKSEKRVFLTANKEMHPFLLNLHCCFQTENRIYFVMEYISGG
FT                   DLMWHIQKNRFTAKRAKFYACEVLLGLKYFHDNGIVYRDLKLDNILLTTKGHIKIGDYG
FT                   LCKENMWHKSTTSTFCGTPEFMAPEIVAGKSYDRSVDWWAFGVLLFQMLLCQSPFKGDD
FT                   EDDIFNAIENDEVKYPINLSRQTVLVLQALLTKDPSQRLGSGPRDAEEIMEHPYFHDVN
FT                   FDDVLNCRIPAPYIPEVQSEHDYSNFDKEFTSETPRLTPVETVLTSEMQEQFRGFSHIS
FT                   DNATI"
FT   CDS_pept        complement(982972..983919)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536106"
FT                   /orf_name="CD36_84420"
FT                   /product="Ras-like protein, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42951.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396710"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI000192D9C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE40"
FT                   /transl_table=12
FT                   /translation="MSLLLDSLHALTKNYDVCVIGSAHVGKSTLILHYIYHHFDESLYD
FT                   LDAVYTKRIITPETNGKFREITIFESDFHIDMYTITRERHVLNANTIVLVYAIDDYQSF
FT                   TALEDYYERINQLRPSIPISVIASKLDLDTTNREVSYYEGAEFAKRIGAVSFNECTREN
FT                   VMGVNQAFESIANVAVKIQLSKDNPIDKIESKGGNDQNSNITTTPATTQSQSSNHSQRS
FT                   SQESIVISNLTQHDNFSHRVNSNKKQSDIEENTPLATLTRQSTTLTSDLNSFTHIPQKP
FT                   STSFRQRKARLNQSSGPSTNPNQTHAEKKCCIIS"
FT   CDS_pept        987635..989281
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576670"
FT                   /orf_name="CD36_84430"
FT                   /product="Bud site selection protein rax1 homologue,
FT                   putative"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAX42952.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG324603"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI000192D9CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE41"
FT                   /transl_table=12
FT                   /translation="MYNEKYASDFPNSHYLSNLNNLNGTNQSIHLNRLPTLGEILANKS
FT                   KSPVDLFTFYQFMKDVEGKIDYLDFWFDLINHLNLCKHYVKGLRDSIIRQSSTFHQQQQ
FT                   QQQQQQGHQIISSSQPQPQQQDLSYESPAAAAGFRHSMAISEKSNRKSLSSSILLDLII
FT                   NDNILEENDSHRLSAFLRGDINLDNLDPKLKDLIEQYNAEAESNSKHSSRVDSVARSSP
FT                   SYVSNPIMSSVPIASPQQPYLHQDRKTSSHSLLVHDEDDENNHSYYENQLDIGRADKAV
FT                   SASKYISLQSENKDVFGKEQENERYQHPTNPFADTSAINTQKKRASAINPSLLEKLIKD
FT                   SPASNGTHSFITRENLRESSHQLLLKYFVEDSEKNLNLPSNLNSQIIKAIEVDGRDDPD
FT                   VFNYVKNFVFNKLENEHLPKFLDFMATRNINHSNFWRIILGFFFLFIGFWVSFIMVFLN
FT                   YRKGLRPVIIIPYFLAFYFLISSIYLIDPVMAWMGISETFSKSNGRSIMKIREKFIYRF
FT                   IVKRSLWVLFLVLIFTAIFTVLFSLVPGHRL"
FT   CDS_pept        join(complement(990826..990828),complement(989793..990401))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576671"
FT                   /orf_name="CD36_84440"
FT                   /product="Ribosomal protein of the large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42953.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG748852"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="UniParc:UPI000192D9CB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE42"
FT                   /transl_table=12
FT                   /translation="MVYIKNTNNVSFFRANLRTQKRLAASVIGVGMRKVWLDPNETTEI
FT                   ANANSRSAIRKLYKNGTIVKKPETVHSRSRARALKESKRAGRHMGYGKRKGTKDARMSS
FT                   QVLWMRRLRVLRKLLAKYRDAGKIDKHLYHNLYKAAKGNTFKHKRSLVEHIIAAKAEAL
FT                   REKALKEEAEARRVRNRAARERRQHRLAEKKEALFAEATN"
FT   CDS_pept        991378..991680
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576672"
FT                   /orf_name="CD36_84450"
FT                   /product="Uncharacterized protein ybl028c homologue,
FT                   putative"
FT                   /protein_id="CAX42954.1"
FT                   /db_xref="HOGENOM:HBG396711"
FT                   /db_xref="InterPro:IPR019434"
FT                   /db_xref="UniParc:UPI000192D9CC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE43"
FT                   /transl_table=12
FT                   /translation="MAKSLRSKSKLQAKSIKRKGEFSKYDEGRSKRIANRLAEETKKQE
FT                   EAKKQQEQTQTGTETMDIEDDKDKKVSTSGWRDSRSQAYKQRKLKNKNKKKTLKF"
FT   CDS_pept        complement(992001..993707)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383339"
FT                   /orf_name="CD36_84460"
FT                   /product="Phosphoribosylaminoimidazole carboxylase,
FT                   putative"
FT                   /EC_number="4.1.1.21"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAX42955.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG516369"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="UniParc:UPI000192D9CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE44"
FT                   /transl_table=12
FT                   /translation="MDSKTIGILGGGQLGRMIVEAAHRLNIKTVILDAAKSPAKQINAL
FT                   DDHVDGSFTNYESIVKLAEKADVLTVEIEHVDVDALIKVQKKFPDVEIYPLPETIRLIQ
FT                   DKYLQKNHLVSHGVAVTESVAVENNTIDDLLNIGEKFGYPYMLKSRTLAYDGRGNFVVK
FT                   NKSYCEKALEFLKDRPLYAEKWCPFTKELAVMVVRSLEGEAFAYPTVETIHENNICHLV
FT                   YAPARIPDTLAKKASILAKNAVKSFPGCGIFGVEMFLLENNELLINEIAPRPHNSGHYT
FT                   IDACVTSQFEAHVRAVSGLPMPKGFTEFSTSITNAIMLNVLGDKESPNKELEICRRALE
FT                   TPHASVYLYGKTTRPERKMGHINIVTSSMQDAESRLSYILGDTTEIPKSLTVDKESPLV
FT                   GIIMGSDSDLPVMAVGARILKQFGVPFELTIVSAHRTPHRMSEYAIEAPKRGLKCIIAG
FT                   AGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPVATVAINNSTNAA
FT                   LLAIRILGAYDSKWLTEMNQYMLNMETEVLGKAETLEEIGYEDYLTDKLKK"
FT   CDS_pept        complement(998177..1000363)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576673"
FT                   /orf_name="CD36_84480"
FT                   /product="TEA/ATTS transcription factor involved in
FT                   regulation of hypha-specific genes, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42956.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG396712"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI000192D9CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE45"
FT                   /transl_table=12
FT                   /translation="MMSQATPSATPVRNANGQKKGKKLPLIVDVAIGNNGKQLYQVHES
FT                   SKMVRKEMPRSTNFALNDDISDEGFFISQRNEERTPIRKTLGTLSPSSLNQKRIRDDVY
FT                   DQGDDNSNDIDCQNIVYEQQQQPQHQPNMYENSNVGVVSHDPAAAAGHYGNTPIQHIPT
FT                   GAYSRVQDNDIWSDDVEEAFEEVLRLIPKSGLNKIKIAGRSCGRNELISDYIFAKTGKF
FT                   RTRKQVSSHIQVIKNLGQKLDIIQLINDGPIFNSHEEQVESTRKFEDVFSKINLNKSLG
FT                   FSDSMKRKSDSLPMHLPATKRIRRKHSGNPLNKIKFSNFFMSVNDQYGMNPIVLTIQQN
FT                   GNDVKSLKLKDNANISSRFPGLSDFKTCPHIPIIHNMVKILLPQLPESYNIDNGFSSSY
FT                   ALKYEEPENASPTHASIISTSKTYSLFTCVYSYGNEIVKFDEDGIQLNQDREFIPGFWK
FT                   FFFGTFGDQSDDGGFSTAFKGVTIKQILYESSPNSVKKEQDASKVNKSKVKLVLLWEFA
FT                   KVSECKDALTTTTKLVLPPRASNPNSNTTQEVFEYSQPALNSIGGTPTDTTSPIMDLNN
FT                   SNLSGAATTIPGIRDTTHSASMPDINELPSSGKPQMKLQKTFQSMQHLQPHQMWQQQQQ
FT                   QQSQLYGGYNSSIASQQLNTSLTSPYAQHGMPVPQQPLAAFAPSAGVSYTHNSLHPSAN
FT                   MDLMMLSSVNGNSTIGHDYQFGNMGYTGGFTSEF"
FT   CDS_pept        complement(1006414..1008693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576674"
FT                   /orf_name="CD36_84500"
FT                   /product="Histone acetyltransferase complex subunit,
FT                   putative"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42957.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG396714"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000192D9CF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE46"
FT                   /transl_table=12
FT                   /translation="MNSVSTNSYDFSLKPREETDFKEIYPDLDESCQLPVFVVERNTSS
FT                   EETTNSRHAVNLSELKAPMYRRVPQLSLTPTNLRFSKQLSEYGFQNPSKLTSKSNPDTY
FT                   IRPFQLNTSLKETTASIEKFIEKKKNLVEYDMDEQDYLFLRDRNSQPENVIKITPEVFE
FT                   IMMTSLENQWFALELKMNSITTNGGNGSNDPGSNHKLLTIGHNNARYGNDDGIVPGSIY
FT                   DQKCAVCNDSDCDNANAIVFCDGCDIAVHQECYGVAFIPEGQWLCRKCMINKNRTTECV
FT                   FCPSTTGAFKQLDNSLWSHVICGLWINELYFANPIYMEPIEGMEGIPKSRWKLSCYICK
FT                   QRVGACIQCCNRNCFQAYHVTCAKRAGLYMNMTQGIKGAISNKLTLKSFCEKHSPAEFD
FT                   ETKVLEGIRRTRLYFRDTKLLNEENARLSKDRETANKLNIFKWNTEANTPIAPKLFSDV
FT                   LVKILYQLKVENQISLPEESTNEVLHLKVLPNRSKMEIDQDLRSIADEVCRYWCLKRKS
FT                   KRGASLIRKNNNLISTSSILYDSNSLESNDVSEPKKKIDFAESLVNDIDRLISMGEMLT
FT                   EEQEVNHEINSVNFDVVDSVYFPLKQLIEVTIMGLNNKFDSNETLQTYKPKSDNVISLN
FT                   SISLKNSQYGYQSIDQLEQDVENLREYIYKDNKPSSAVYKKMKNWIAGFRKELPSLRLF
FT                   EMEIMNDANNGKLLSFPYVKSAGTNTDLELIDYRVVLEENDLSEIDDDEIESDQNREDL
FT                   QKFLQV"
FT   CDS_pept        complement(1008871..1010118)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576675"
FT                   /orf_name="CD36_84510"
FT                   /product="Calcium/calmodulin-dependent protein kinase II,
FT                   putative"
FT                   /EC_number="2.7.11.17"
FT                   /function="ATP binding"
FT                   /function="calmodulin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42958.1"
FT                   /db_xref="GO:0004683"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000192DA87"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE47"
FT                   /transl_table=12
FT                   /translation="MTKTSKFTPWDEDTGDTTTTANNTSYILSKKPLGDGSYSVVFECK
FT                   NTSTGRHYAAKKYNKRLMYGFENMLKNEFKVLNRISLSHSHLLSLIDYFETEESFYLVT
FT                   DLARGGDLWNKIADEGKLNEQTTRTITKQLVESVDFLHKHQILHHDIKAENVFFQSKHQ
FT                   DSILLGDFGLAKILQPQEKFHEISGTLSYMAPEMLDRKIGYDFPVDVWAIGVCVYFMLC
FT                   GYMPFDCDDDDETKDAIRNCKYLFEPSEYWVDISSEAKDFILACLRVDPQKRFTPSQLL
FT                   QHSFLKTNLAKPTITISSPLKRSFSNLSALQRDQIKNILQKAGGLSAPALSHSSSINER
FT                   LERGRFDSLNKDATLHGAICPSPECVSIFSSPANSTSVSRDGSAINMFEESLKWDGSQK
FT                   KALPLNTLRHEASFVL"
FT   CDS_pept        1010775..1013897
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207540" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576676"
FT                   /orf_name="CD36_84520"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42959.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396715"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DA88"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE48"
FT                   /transl_table=12
FT                   /translation="MSTGLNLSSLKDKIFNKLSLQKDNQNKTKQKPKKTDSNDKEIKND
FT                   KKKQTIPAKTNVQKSKDIDEILRREALALGATDEDLKLVEGIESDDDKSEQEFDDDSQL
FT                   DKTFSADLSKFMKGIGLGEGEAMVVSEDEEEEVPELVEEEEEEEEEEEEEEEEEEEEQE
FT                   VVVEETKIDNKKSKQEPDKVTDLSSVSSSKLIVPNRTDWFNIVEVPTETPEKLDRFARE
FT                   RLLERAQKTIEKDNKTYLEEFASNTSQKKFLSQILSDGTLNDKISALTLLIQEAPLHNL
FT                   KALDTLLAYCDKKSRTAALQSIVALKDLLINSLLPDRKLFAFDKQPLRKDDSDIQLAIY
FT                   YFEDHLKKVYFKLIQILEKLSHDPIVHVRMTVVNHIFDLLGAKPEQEVNLLKLGVNKLG
FT                   DIDNKVSAKASYLILQLEQAHPAMKQIITDAVIDVIFQSNNDDHAKYYGITTLNQTILT
FT                   RKEHELANSLVKTYFALFEKVLVESDGYNKDTKEDKSIGDSKKGRKNNRKNFKKGKKGG
FT                   KSVKVEEKTEQELVEEKNAKFFSALLTGLNRAFPFSKLPNEIFQNHLNTLFKITHSSNF
FT                   NTSIQALVLINHIVTEQKLNSDRYYRTLYESLLDPRLANSSKQGIYLNLLFKSLKNDVG
FT                   NIPRVLAFVKRMLQICSHWLNVGAIAGMLYLMMQLSNTIPEVSDLLVEFASRPEEPTEK
FT                   DAPEAEKSKDENKDIEYDPRKRDPKFANANRSSLWEIHQFLNHYHPTIAIYASSFLDGT
FT                   EQVKPDLGLYTLSHFLDRFVYKNAKQKPQTKGSSIMQPLGGAHTGSLLVRSTNLVDTTV
FT                   PVNTENWLSKKIEDIKPDEKFFHQYFSTKVNKLKTKKDDKRTKEAREGDNEDEDDNDMD
FT                   DDEVWKALVKSRPEVEDASEDDFSDFDENDFADMDSEEDGDENEKEVNKEEEEEDIEGE
FT                   FSDAELEAELEDGDDDDELDQDDFDDEEKAMFAINDEDEFEDDEIELKMLGDDDDEEEE
FT                   ESEEEEQQQKRKRSRESDSHSKKKSKKQRVKDLPIFASAEDYAEYLDSDNE"
FT   CDS_pept        complement(1014045..1016051)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576677"
FT                   /orf_name="CD36_84530"
FT                   /product="Urea active transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42960.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniParc:UPI000192DA89"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE49"
FT                   /transl_table=12
FT                   /translation="MSDSAVHLLDQAAGYGVLVGVGALFAGGMILTTFLLQKYLHENAN
FT                   STETFAVANRSVGTFLSASAVYSSWSWSTEFLLVSSMTYNYGIQAGYYYGAGLGIQIAV
FT                   MSVIGIHAKKKIPTAHTSLEAIELRYGKSAHLLYLTLSLICNICSCSAMILACASGISI
FT                   IAGNLHIVASTMLIPFGVLLYTVVGGLKATFLTDFVHSSILLIILCYLNTSVLTSEQVG
FT                   GLNGLYEKLLKVSATKHIEGNYDGSILTGKSQGAAIFGLILTAGNFGLSIMDSSFWQKT
FT                   FSARPRSTVPSYLITAFLICSNVWPLSAIIGGSSHFLETDPSFPTYPRKMNQYEVDSGF
FT                   VLPYVLKATIGNGGVGALLLIFYLAVTSTVSAQMVSVSSIVTFDIYKRYFKPDAQNKSM
FT                   IKVSHITCIVFGFGIAGFSIMLHYVGINMTWYTYFYPILICPGVIPIILTVTWNRQTFW
FT                   AAFISPLAGFAAGLAVWLSTAYHFYGEVTIASTGGQLPALYSSLTALLLPGVLSIIISL
FT                   IKPEKFDWDQLKKADLLVKSDDSTQEDLSSETEREKTEKNDQVEVNVDSDRNSSLEQQE
FT                   HPTKLTEKELDFWIKIATGAAIFILLITWLIWPMSVYRDWIFTPTYFKGYVTVGLIWLY
FT                   VTLIVIGVIPFYTGRHSMAKVFKGVYNDYIKKK"
FT   CDS_pept        complement(1017182..1018501)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576678"
FT                   /orf_name="CD36_84540"
FT                   /product="Zinc finger protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42961.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396716"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DA8A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE50"
FT                   /transl_table=12
FT                   /translation="MLILSIGLINHTSNKSLYTISPNKGKRYEPFTTTSLDSFKFHVVR
FT                   FLHRLIYGTQRYQELFPPIQKIKDINNVKQQRIFPVNCAADDLDLGFGESDQIELFNHS
FT                   SKDAYGHHNLIQLIDFFDSPQAHSSSPADEFFKSNKISEQIDIFDMIGRQPPPLHHQQL
FT                   NIETPYFEDFATPLVLPQHEVSSDDVESYFSRSVSTVSSIEPLDDEFVPPPHPPRAHPS
FT                   RKRKHESISPPIPTSSSSSSTAQLIPSCSSSVASSSDLSVSPTTKRKYTKRRYTKKKQP
FT                   VFPNQDEPIVITTTTKTNNIDVKKVTTTKNGTIENRFDCPSCDASFKVKGYLTRHLKKH
FT                   STNKAFECPFFDNHGVYGSKCHPTGGFSRRDTFKVHLRALHFIYPAGVKANQRSSFSGR
FT                   CAGCFQFFDSNSEWLENHIEAGKCTGTVTYKQNVSNLLLD"
FT   CDS_pept        join(1022022..1022300,1023242..1023655)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576679"
FT                   /orf_name="CD36_84550"
FT                   /product="RNA-binding RNA annealing protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX42962.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG396717"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DA8B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE51"
FT                   /transl_table=12
FT                   /translation="MSASLDKSLDDIISSNKKTFKSKRPGAKFGAKGGNRVGKKIGGTN
FT                   NKKPIAKFNRPAAAAAAAVAAVPTIDLSYATKVNVSGLPKDLKHDNIKEFFQSQIGGVQ
FT                   TVALTYNEKGQFKGFATIIFKSSKFATAAVDKYNGASIDGGAAKLRLELIIDTSKKPLA
FT                   ARIAPNAKAITAAKTAGGKKIAAAKNALNKKKAGPGNKNNNNKQKKPKQKKKTIEELDQ
FT                   EMADYFEN"
FT   CDS_pept        1024716..1026605
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576680"
FT                   /orf_name="CD36_84560"
FT                   /product="Spindle pole body interacting protein, putative "
FT                   /protein_id="CAX42963.1"
FT                   /db_xref="HOGENOM:HBG396719"
FT                   /db_xref="InterPro:IPR013925"
FT                   /db_xref="UniParc:UPI000192DA8C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE52"
FT                   /transl_table=12
FT                   /translation="MPNIEYIVTAEFHIDKGPSIVHQFPNQLPGMDNLYFLPELMLPDQ
FT                   IHKRNEDYTLFLLHRNTTNGEFQYLFNKSTCEDNPYYLYTIVDNRKNDEFKRGASIKSL
FT                   SIITKLSYFKNFKPLLLICLDLYFKNNDVKYLQELYRVINEKKFEISPGYSVSIIKKLL
FT                   ITSILDLPINDKIYYDESFRNKLLGIGKDDFINEDLFIRKDLSFNSVIKFNKMNIPIKI
FT                   PMLTLPDTIGDYLNPTDLNFKPSLINILQAKLISTNLNNELTIYGLQTPPIIILINAIL
FT                   TGKKIIFLSYEHSSGYIIDHILLTLKIITGGGILSGILTNYNVFPMIDVSKIDLLEECE
FT                   SFIAGTINPFFKQNDRLWDLMYDLDNNEFILSSQLPNDDIEFKNSIISEDAKFLSNLQL
FT                   SLFNYNDDLTTIQLIFRRHINEIIRILLSSKNFNSNLAPTSQDLILLLDGIGYYWASDT
FT                   NKLLEISCYQLISKKFHFLLYNGKLIYNLLLPNLSNELNLMIDLHYHLQSLNNPLSNSR
FT                   INEREIWFNILKFLISGKSLEIFLLITYLIPPNSSSSLQSSSVHGGNLTIFDKNKGIEL
FT                   LLLNLFNQDDQVKSNVIMILQELQDNFLCSWCLDKFLKSNLIYELAFSDLINE"
FT   CDS_pept        complement(1026856..1027266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576681"
FT                   /orf_name="CD36_84570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42964.1"
FT                   /db_xref="HOGENOM:HBG396720"
FT                   /db_xref="UniParc:UPI000192DA8D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE53"
FT                   /transl_table=12
FT                   /translation="MLNIAKSTESRNTLLRKLGIFGSIAIGLFIIGKKHIAYQKKHRHE
FT                   LESDSSTLSSRHQDEEFGYISSRPGFPLTNPNLDYTSPDRKSKYVGSGDSFSTRRPGDR
FT                   LSMWNMIKMRWFSDEIEESKYYTPSRNDKLDK"
FT   CDS_pept        1028917..1030035
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159426" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576682"
FT                   /orf_name="CD36_84580"
FT                   /product="Peroxisomal membrane protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42965.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192DA8E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE54"
FT                   /transl_table=12
FT                   /translation="MSNQEIAHAVSGAVGGALALGITYPLITLSTIAQTAAKKKEAEEA
FT                   SEITENTQKSQPTVSLTTLEKIVYAIQNNAAYIAAKEILKEKGPLGLYSGLESALYGIT
FT                   LTNFIYYYFYELTSNVFLKSNGKKRNGLSTFQSIITGAIAGAFTCVGSNPFWVANTRMM
FT                   TEKKKGKSVAANANSGGGGGDAQSKEEDNDNNSSNSTFKALVNIVEQDGVGALFAGVLP
FT                   ALVLVINPIIQYTIFEQIKNIIIAKNGPKSFTAIKAFFIGAFGKLIATSLTYPYITLKS
FT                   RMHIKRKKLNADNQQDEEKQLSMIQEIRKIVKEEGLEGLYAGLAVKLTQSIATAAFLFY
FT                   FKEELFSGSVKLIEILRMFSFKKSIKSPVVKV"
FT   CDS_pept        1033533..1036829
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230466"
FT                   /orf_name="CD36_84590"
FT                   /product="Fungal zinc cluster transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42966.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396721"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DA8F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE55"
FT                   /transl_table=12
FT                   /translation="MFISHMSAPPSIPTITTPGASSTNTRRVARRACLSCREKKIKCNG
FT                   EPMTTITAADGTNKVIPEKTRTCSNCRFLDIPCVFVQSNRGGKRKKRSTEHQLSDSETT
FT                   TTTTAGTHSNQLNKQQQQLPPIKKTKSTPLIHNLERGVVIPPINKQQEKNQNGHHEEEL
FT                   ASTERVSSYILDGNNRTKLASPVLTHSTFDTQKEESHRFNTNLRRSSGTITGFSLPPPQ
FT                   ELLGRRSVSYSPGPSSIKNQLPHLTPSSTATSSVQSPPPPPPLPRGMGIQFHEGNQQPG
FT                   IFPPPPHHLHHQYYGYPPPPPPPPLHHHHHHPPPHHPGFGLPPPPPPPHFNQSPPSASP
FT                   SSEYKHRHPKHFDKGHRHHPHPHPHPSHHHHHHHHHHPRHFQQTNGQNDVKSKHTEENS
FT                   QNSRTSSPQWLDNTSISSSDSSRSVSSPQSQHNDKSQYSSNKSSTQMSSSTNSVTQTLD
FT                   KLPKMVSTQQNNNTTSSSKISQNSPFTESELAKYDLPPWEVLNKAINYYYIYNQPSHQI
FT                   FPAKTILLENLALNTDSSIIHAIIATTCLIISKYDPANDIVADELYWINKMHKFWDNLN
FT                   DLGILCCYKLLVKCTSIRFNIKKMNDINIKLWEMINNNQYVDIFKQKRFDFQESRIIPT
FT                   FGTKRQNYERELTLKIIWSFYINNIILLRFNQGRPYYKLSSIMNGFKFDYDRDQYSNNI
FT                   LLPMSDIDYLSLKSAGNRTNWNQLYEQTYIPTDATSLILSSKSFEKSLSKLSNKDITIK
FT                   NLISKDEFHIDLSNKLKTRYYEILPDEKLVVINISYWFSNIILRLSELIQYNYILCDIM
FT                   VFKMCKYDMKSDLSRNSHDDQDDSKVIGSTQGDSSTTGEKLQGVNGNTFRRNEHYKSAL
FT                   QHLLISDETQSIEGLTSKLKNLNKKDWTILIEMIKSTNDYVDLIKLIPSSEYTDYSIII
FT                   GPTTFDDNYNNENETTKRFRNTINNCSEWWNKQELKSSVQQSWAKLPIYILSFTSGVLS
FT                   IIYSLAVLTKYLRFKKCSGSGDLIVEFVETNENKTIEGCNINNPQHQKHMVDVCEIFTE
FT                   SHILSQLFVLCEYVKFKLSYSDEDLTAFSIQRLNNLNQHLDEILQQNFPK"
FT   CDS_pept        1037399..1038535
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536107"
FT                   /orf_name="CD36_84610"
FT                   /product="Uncharacterized protein ydl237w, putative "
FT                   /protein_id="CAX42967.1"
FT                   /db_xref="HOGENOM:HBG396722"
FT                   /db_xref="UniParc:UPI000192DA90"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE56"
FT                   /transl_table=12
FT                   /translation="MINVFKPIVHRDLVPTAYYNNEILQYNGVSPTDTPILPFNQTIED
FT                   LNRDVYAKPLHSHNDYWRKYPLFSALSAGAISVESDIWYFPQTYKLTRTITPSTNNNNH
FT                   QGNKYDSSINETLIFKNDEIYVGHSQEFLKPINTLFNLYLNPLFQFLQFVNPIYEIIDN
FT                   NINPENSQSEQNLFTQSQSEKNSVFYNNPGQPLYLWFDFKTDANATYDVLKPLLKPFID
FT                   NGYLAYYNTSDDKYYSGPLILTITGNLPIEKVTNEKIRYLFLDGPLDKFTIDNNNTNID
FT                   ELKKWSKLSRVASGSLEKILGSESYSTSTKTNFNEQQKSQLKQVLDLAHEYGLKTRIWG
FT                   DITWPWNVLDSHLKSLFELGSDLLNVDDLERASELFSQ"
FT   CDS_pept        complement(1038619..1039581)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576683"
FT                   /orf_name="CD36_84620"
FT                   /product="Mitochondrial ornithine carrier protein, putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX42968.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192DA91"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE57"
FT                   /transl_table=12
FT                   /translation="MDQEISLPNAPDHETLHPLKEITFGAISGMVGKVVEFPLDTIKVR
FT                   LQSASGNGNNSSITTLQMIKSTYHNEGIFNGFYKGLKAPMIGACLENAILFSSYNFGST
FT                   VIANHLNKSNDKRRYTTETLPFMGKIIAGGFAGFMASFVLTPVELVKCQLQVSNLSQDK
FT                   SHHTYRTIIKSTVRDRGIIGLWKGLNSTIVREVIGTAIWFGTYEYINDYYKQAKDPWVS
FT                   NKDVQLLIAGAMAGVTFNFSMFPVDTIKSNIQTHDLLNKHRNSTSVVKQIGFWQTTRSI
FT                   ISKPGGLLNLYNGLGITMVRCIPANALIFYTYELLKSNF"
FT   CDS_pept        join(complement(1040887..1040899),
FT                   complement(1040106..1040521))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576684"
FT                   /orf_name="CD36_84630"
FT                   /product="Ribosomal protein of the small subunit, putative "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAX42969.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG307515"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniParc:UPI000192DA92"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE58"
FT                   /transl_table=12
FT                   /translation="MVDATAPKKRTFKQFSFKGVDLKDLVEMPTEEFTKLCGARVRRRF
FT                   SRGLDSKPMGLIKKLRAARAATEPNERPAVVKTHLRNMIVVPEMIGSVVGVYNGKVFNT
FT                   VEIKPEMVGHYLGEFSITYTPVRHGRAGNASSKFMPLR"
FT   CDS_pept        1041352..1041687
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079109"
FT                   /gene_name="RPP2B"
FT                   /orf_name="CD36_84640"
FT                   /product="60s acidic ribosomal protein, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42970.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG744999"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="InterPro:IPR001859"
FT                   /db_xref="UniParc:UPI000192DA93"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE59"
FT                   /transl_table=12
FT                   /translation="MKYLAAYLLLVQGGNATPSASDISAVLETVGVEAEESRLQALLKD
FT                   LEGKDLQELIAEGNTKLASVPTGGAAAGGASGSAGAASGAAAEAEEEKEEEAKEESDDD
FT                   MGFGLFD"
FT   CDS_pept        complement(1041818..1042855)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576685"
FT                   /orf_name="CD36_84650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42971.1"
FT                   /db_xref="HOGENOM:HBG448659"
FT                   /db_xref="UniParc:UPI000192DB3B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE60"
FT                   /transl_table=12
FT                   /translation="MLITLSKMNHSYTYTKNFIQDQVNILNESYKINSQIRSILSEQEE
FT                   ITESELQTILNLLNNEIKECNNELFPSQINNQIVSQILKLEKQKLKIVNSQLLKINSFI
FT                   EPITLPDFDNLTNQDQNKKLAELTAQIKELPNSKYLFVSSTDTTDIQDEYDLDDDDNDP
FT                   VHDEQVENNETDEANTNIVQDDQEEAISSEQMKKEFIEEIANEVNVSNVQPDQELIDKY
FT                   DKLRTDLINISDRLKYKSGKLEYLSGLHQTLSEIVGVRSTVSNSQHPESNQIYDSDEEV
FT                   NTPNDHETNLLSGPDNTRTSIQSELNRFRMLVEKISYKVNTKNLTADNLREKLQEINQN
FT                   PGRTT"
FT   CDS_pept        1043078..1044181
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093908" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576686"
FT                   /orf_name="CD36_84660"
FT                   /product="Nucleoporin, putative"
FT                   /protein_id="CAX42972.1"
FT                   /db_xref="HOGENOM:HBG396723"
FT                   /db_xref="UniParc:UPI000192DB3C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE61"
FT                   /transl_table=12
FT                   /translation="MFGGNSSAFGTTGLGNKASSGNAFANQSNPFATSSTNSGFGGFGA
FT                   FKKSETNTNASSQQSGFGGFGTKSNTPSQSSAFGSTGFGNTTNTSSAFGNSGFGNAGLA
FT                   KSTPASNSGFGSSGFGSKGNSAGSTFGSSGFGTSEFSQTNTSNSNSSPFGQMGNTTKPS
FT                   PFGTTTSQPSPFGSTTTQPSNNKPSPFGQTSSSPSPFGSSATATTTATNTLSAFGSSSN
FT                   NNSNPFGGQSSTSSPFGQSQTSASIFGANNQTQSAFGTASTQNANSGFGSGNSTSSTIA
FT                   NTNQNSSTTNTANPFGSTSETTPTFSFISAQPKPQPEITGNIDIDIKDSTPDNDDSLPA
FT                   SILQAFNADMFTLGQIPDGPPPPELCR"
FT   CDS_pept        1044329..1045207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079110"
FT                   /orf_name="CD36_84670"
FT                   /product="Mediator sterol homeostasis, putative "
FT                   /protein_id="CAX42973.1"
FT                   /db_xref="HOGENOM:HBG676993"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniParc:UPI000192DB3D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE62"
FT                   /transl_table=12
FT                   /translation="MICIECGYPNIDCLYSKYKSDYIKLSVCPECNKIADKYIEYDSVI
FT                   LFLDILLLKRQAYKHLAYNLTEMEMISSIHSNINSNFKFLQTYGKLMKLIFMILSFEVY
FT                   LTWANEEKLLIHSQLINLIFSQSVIYQYLFFIIKSSLENLILNLSLQLILRFGYKWGQS
FT                   TPKINGNVSDEEFFGYKTSVLLVTTMVSGSIRLFPILMFIWPYDNISITKPLINLIAFI
FT                   NIVEALRVVTSLGYIKLILSLAFSIVIKNIVSKSLLVLIVNLFLDFNFTEVNHNEMYQL
FT                   YSQFQTYIHWI"
FT   CDS_pept        complement(1045204..1047774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079111"
FT                   /orf_name="CD36_84680"
FT                   /product="Uncharacterized membrane protein ylr241w
FT                   homologue, putative"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42974.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG395921"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI000192DB3E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE63"
FT                   /transl_table=12
FT                   /translation="MIDNIINNLQIILQQNDDNATSPHDDVIYRPHSTRVARYQVIIAS
FT                   TLGLIALLLFSILRLKYPKIYVANFNHLNFSLHSTSRRNLPKLPSNSLFGWIPTVYKIT
FT                   EQEILEHAGLDAVVFLEFFKMCIRIISICLVFAIVIISPIRYKFTGRVDQDYPDDDDET
FT                   KIIKRIVLAGISITSKNRDGEQYQQFLWLYTIFTYVFTFVTVYFLFKQTNRIISMRQKY
FT                   LGSQNSVTDRTVKISGIPGSLRDEVALARHIDRLNIGEVDSVLIVKEWQNLNKLFKRRR
FT                   KIIRKLEESWVEYFEKNGITNKSDLVSLHPQVGESYRFSNRYTDDGEEESPEDWASQRS
FT                   SLTQVSIIGQESESVEGDSSDTLNRLLNDESRTRPSLRKGWFGLFGPKVDSINYYTDKL
FT                   EVIDKEITRARTREYPATSTAFLTMKTVAEAQMLAQAVLDPKVNHLITSLAPAPHDIRW
FT                   DNLSLTRQDRNTRILTVTIFIGIMSLLLVYPVRFMASFLNTKSISKIWPSLGKAIKAHK
FT                   WAETLITGLLPTYLFTILNLVIPFFYVWISEKQGYLSHSDEELSSVSKNFFYIFVNLFL
FT                   VFTTFGTASFVDTTKIAFDLARSLRDLSMFYVDLIILQGLGIFPFKLLLVGNLLRFLVN
FT                   SLFRCKTPRDYLNLYKPPVFNFGLQLPQPILIFIITLVYSVMSSKILTAGLLYFIIGYF
FT                   VSKYQLLYACVHPPHSTGKVWPIIFRRIILGLFLFQITMVGTLALQDAITCASFLAPLP
FT                   FLTLYFWWSFHKQYIPLSTFIALRAIENNDNINPTDLEQIIENNYNKTLDERRELNTKY
FT                   EYTNLVNDLDGPMIALDGEDVLIVNRDGTTVRKPPQNFSSEWDY"
FT   CDS_pept        complement(1048348..1049769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093909" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230467"
FT                   /orf_name="CD36_84690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42975.1"
FT                   /db_xref="HOGENOM:HBG396724"
FT                   /db_xref="UniParc:UPI000192DB3F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE64"
FT                   /transl_table=12
FT                   /translation="MNEEIDHTQTLSSATGSASFNKRSNFQFTYDSETNLLFLIHKYKE
FT                   DIFTRGNIIKTWEKVLQEFNERCNSNIVQSRTINHRFQMLKKNLENRLKHNNQLLDQVV
FT                   LNENEKLLVDILEYMYKNNHTEVNPYSLGGSSNNSDVAINTQIDNSYVHQNATTTQIEN
FT                   PLALADMSQISPNSYEYKLNRDRAQYLMSQGFDNSIQHQFQNNMDFPNGIRQHQLVPSS
FT                   GTPSLGTNKDIVAGYVPSLEHSELINPSNQISHAEETMLQPHPNNQASSHIIYKSPDIN
FT                   MTASVPQNEQHNVQHPSRHSNSSTSAGTSASTSQPQQQLNHESKQHFGNNISPNIQYDN
FT                   NPNTRTSDFAYRQDQNQNHEHQQQYQTQSQQDNTTESLLKRLIVSQSQVAHSINALRED
FT                   LQSFKSETNQKFDRLISDYSLQQDNSMNKKLDSLIRILRSQNLKNDDNSSSPTDEDMTN
FT                   EHDSSYGAEQATSTD"
FT   CDS_pept        complement(1052469..1054361)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079112"
FT                   /orf_name="CD36_84700"
FT                   /product="DNA topoisomerase III, putative "
FT                   /EC_number="5.99.1.2"
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAX42976.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG525547"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="UniParc:UPI000192DB40"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE65"
FT                   /transl_table=12
FT                   /translation="MKILCVAEKPSIAKAVANILGGGRTSLRDSSEKFIKNYDFTFTFK
FT                   PEDGPCQVTMTSVVGHITNLEFESAFAWGKCVPGRLFDADILTVITKKAVHENIAKEAR
FT                   NADKLMIWTDCDREGEYIGFEIMNAAKKYNRNLELNNIWRAKFSHLERNHIIRAAKNPV
FT                   NLDMSAVAAVSCRMEVDFRVGTSFTRLLTDQLRQKGIIDGTQVASYGTCQFPTLGFVVD
FT                   RYKRVKNFIPEPFWHIEVETRKENKKTVFNWVRGHFFDKLYVVMLYEQCCKSGEYGIIS
FT                   KIESKRKPNFRPFPLTTVELQKDCARFFKMSAKAALEAAEKLYNQGFLSYPRTETDRFA
FT                   KETDFRSLLEVHKQDSRWGSYTTELLSQGYQVPRSGSHDDKAHPPIHPIKYVSLDTLKS
FT                   INEKKVYEYVVRRFIACCSKDAVGMQTVATLKWGDEFFTANGLMVLEKNYLDVYIYKKW
FT                   ESSKQLPKFTEGERIKLASGVLKEGKTSPPNHMTEPELIALMDANGIGTDATIAEHIHK
FT                   IENRGYIAKSKKGKNEFIVPSLLGMGLIDGLDKMEFEDISLSKPFLRKSLERSLEEIAT
FT                   GSRSKVDVLNTTISVYLDAFGVCSHQILVLCNECRRVLRGNSSNNNNNNSNNNT"
FT   CDS_pept        1055061..1056905
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093910" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576687"
FT                   /orf_name="CD36_84710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42977.1"
FT                   /db_xref="HOGENOM:HBG396726"
FT                   /db_xref="UniParc:UPI000192DB41"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE66"
FT                   /transl_table=12
FT                   /translation="MASFTNGFESINLASTVSGAYQEEDTPIKRLHSIPASTSEDEDEL
FT                   DPEEFISNKVHKPATKDSHVSYNEYSEKNRSDEPLSNLHDTHKPHLTTTTTLIDSTKEN
FT                   ESLYNTMDSLMIKSINFPAAIYQSDDKNSQSPIEYLSNRIKLLTQELYEDSIKYGKFLK
FT                   SGNNHIYQLRSKLLQTFNQLSESYYSLNELYHKDMSYAETLHGSFKKWDQQQNKVLSKV
FT                   KSIKSDTNKHGAKLFTLLDEVNDVDDEIKLLETKLQQLRSKKELLNKEIEDTSSVLESR
FT                   TAKYVDMFKDLENKGKSAIIDFLVSNGAPEKEIDTIVRFLPVDITISSNYSSKKEPDKQ
FT                   VHTAKESVPQPESTSNPPAIPNNIGMQPFIVPEVEPDSKTPDLQSMNHDHGPTPFEKGY
FT                   AMGTQNSATLKNKMNHIMNKLLHSLPTTAPSNIPKIPAMSHIKVDDLSNTISKKLDLDP
FT                   IMIFLEHKVAALHDLAVQSSQNAALFHEFGRIWEDVTKLMNIQEEKLESILNDYSNPKV
FT                   VTRVLISTLDQLKTILSSLNNNPITNASSKNEVLTSLVTSEYNAVEEAVKLVSTDLVTI
FT                   GEANSSGGQPPLIPTSSKPTSQVYPVNTNDIKSATKIE"
FT   CDS_pept        complement(1057008..1063037)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576688"
FT                   /orf_name="CD36_84720"
FT                   /product="Helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="endonuclease activity"
FT                   /function="helicase activity"
FT                   /protein_id="CAX42978.1"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG396727"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="UniParc:UPI000192DB42"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE67"
FT                   /transl_table=12
FT                   /translation="MSHTVTPQSGVETDKPPEHDSLVRLITQSLSEPGNSPTHETAIKH
FT                   TIEYLRKYKNNPHWFCNRYMYSIACYSLILFSFPNNAVLEELKPDIAKSLSKCTSCLRA
FT                   FAIAKTQLRSGFITNKKTPIANVNQFINAITSWEATLVQPCLNLVYNNLETIEKVQAQL
FT                   HLCRDWFMVNPDLLRHYKDNKEKFAHIVRVLRAKDELPTSPALLAGLVYLLFEGSGEEK
FT                   LWAFEWMKHLSQQKIIYNKRSLEEPVVKEFSIHLYRIQDSKYFNDGTAIKFWEIVYNIL
FT                   DFMDDEAFILRVNTPKDIRAMSEHTNLKLYSAISVLCNSLMSNLTAPLPVLLKVFTKLL
FT                   NRLGSKLYSHTMPLTPIALLSGILGNPEYSKQLILSASEKSSLNDFSFQDFISWIFLFI
FT                   ESLNGSQRQNACMKIGPYLLRQGKGYTSSTNDLRSQRVTNLRELGVKIFAGIFPATVVE
FT                   MNPKDPKLSVEIMSFRDVRAALEYEAGAILSCAMNSPPCADAMDLVCRCLKYDVLILVK
FT                   NSYLLSKGEIPNMFDTFPFFWSAILKSKLYTNIGLVKVVIQCLRLMPMAINFNEIKYNQ
FT                   ANKDLASAKTQHNKGMEAICDLQNQIFSSFSLCDPENIKQIINDLDCAESVWGCIFTPL
FT                   ISQAALDFMNEVYNASGRLETFQECFSNNLKSSLVSININLANLTNLACYEPTPKAIRI
FT                   VMDIIKALADPVDSSLLSSTTNCESEIISFWKNCWKFLIMVFQETFVWAGQFHLDELLE
FT                   FARDTLDLSHLLLDSFRFIVDTIKEQTNKDISYEFFESFMNAFQHIIVWLKLGDLSLLN
FT                   SCVALVIKGFDLASEENFKVQDQFVEQLWKYSKKVKGYNNKLSESQRMMLMTKARELNE
FT                   VLVETMEGKESEQKYAQARAKVEPKLQPIDDEIQELRPEEFAKRTNKRQQTLEGFVSFT
FT                   NKAPVAPAPKEVKGTQNLNSIRQKLQQSRSSISGPPKSHINPAPPRPAGFNSKKSPPSA
FT                   PSVAIGRPLHALKKKTAADSESSSEDESDTDLTDLFVEGKAKKIAKITEVDMNLKTIDR
FT                   NNLQKRRKQIDEAKMAKERMRLRLNVNLKPLYLSVLRWNYNSKSDFPSKDKSIYQEIKD
FT                   TYKDVKEYVQVTEPLLMLECWSAMQSAKLTVDEKPFELLIGSRTSVDGFFDVFASMEKA
FT                   VLQDRRIGDSDLVVLALKNESLQHEAEIRRYIKAEDTMTCLAKVQDTKYTNSDYCDVIL
FT                   RVYPSGPMMGALTPKSVVTGMKVMQMITIEREFSSLKGLQYYDLADSIISATPNKPIEI
FT                   EEEDAEKMRKIYHVNDSQARAIMGTFKSEGFSLIQGPPGTGKTKTILGIVGYSLSQEKN
FT                   KKVIDISESGSSPAPSDKAKILICAPSNAAVDELVLRLRDGVRNSSGEHMPLKVVRLGR
FT                   SDAINSSVRDLTLEELVDKELQTKQTEVVIDPNIRLEHTKCINERDELRKRLATESLED
FT                   KDITELEEKIRAINKKRSELAKKLDEQREKASIANRTKEINRRNIQARILSEAQVLCST
FT                   LSGSAHDLVANLSVQFDQVIIDEACQCLELSAIIPLRYGCRKCIMVGDPNQLPPTVLSQ
FT                   AAASYNYEQSLFVRMQKNHPDSVYMLDVQYRMHPMISKFPSSEFYNSKLKDGDNMLELN
FT                   TRPWHKDPPLTPYRFFDILGKHEKNELTRSLFNTDEAMVALQLTDKLMQIIPQDKFSGN
FT                   VGIISPYKEQIRKIKEVFVRKYGKPILDEIDFNTVDGFQGQEKEIIIMSCVRASATGNV
FT                   GFLSDVRRMNVALTRAKTTLWILGNKESLSRNEVWRKLLTDADERKCVTQAYPGFLNSS
FT                   NPVLKRKEASVFIPPQEKYAKKQKVSNESERNVQKIRNSMTMPAYRVTNAGVLPSKTKP
FT                   PNGNKNFNYQTKNSQPTNNAPKPYINQPKPQDDSKNVPTRSGTISKPVAASTPTPTSSG
FT                   TLKPNKPADAERSTSKEFPTTPQNKSLQITVNSSIASVKSTDKTKKPTKSTMPSSSGVV
FT                   KPPSNLFIPRKRPFAKK"
FT   CDS_pept        complement(1063374..1065527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079113"
FT                   /orf_name="CD36_84730"
FT                   /product="Fungal zinc cluster transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42979.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396728"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI000192DB43"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE68"
FT                   /transl_table=12
FT                   /translation="MEEKKKIIRRSRNGCHNCKRSKIKCDENKPICSYCFKTNAICDYS
FT                   LKLTWGGRPYKDINKRKQLSLVKKEAQATVNDFPIETSTSLNIPISNNSNSKGDTGLTF
FT                   ILHEFNTDSIKSPQSPSESVSSHIDPPAPHRNAKRKIAEIDGIVDPEIKRKDSHMALTD
FT                   IFPELNSGMENLTNALADFGGQQFQLQNSDIFSTYISNPQKYMGVTRYGSDSESSATSF
FT                   LNNYSEDISRIEKYLPNDQSNLIGDTFPMRSVYSSINGSPTSEDIWDSIPPSLTPLPTL
FT                   LLNVPFYRNLMHFWVTVASQNLVPAPSSIYKDNPYKILLTQMAMEYPAILNTLLAFSAK
FT                   LRSSLIGADDTPDIVIDQLLSRSCTELLQLLKDESKATSDEALATALLLSCYEVFNSKD
FT                   FSRHRAHNIGARQIIKARSNTPHKRGPEAGTEGDMTFFLMRWFVYTDVIGALSSTTDSH
FT                   DYLLTSNDLSTYEPLESLTMLHEIDKMEDETQYPKKTIDYLMGFNIKFLPHFTKITMLV
FT                   RETNAHLGKAKASAANLPLSIVYKALEVKEALIETQRKDEKSILQSHEKIIELNSGKGQ
FT                   PSSAKDLPEETVTLIKENDILRFTNKIFCDAGLIHLYRRVLLVPRESNLVQDLANGIGE
FT                   LAKLHIESRSPADICCIFCLFTAGCEVLRPEMQQFFEQRFQNLGQMGNINARKGLQIMK
FT                   RCWETNEDWITAAEKIGVDLTLL"
FT   CDS_pept        complement(1066219..1067256)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536108"
FT                   /orf_name="CD36_84740"
FT                   /product="COPii-coated vesicle-associated protein, putative"
FT                   /protein_id="CAX42980.1"
FT                   /db_xref="HOGENOM:HBG396729"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniParc:UPI000192DBE1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE69"
FT                   /transl_table=12
FT                   /translation="MDSFAQKVKTFDAFPKVDPHHQVRSQRGGLSTLVTYFCGLLILWI
FT                   EIGGYIGGYVDRQFTVDDQIRSDLTINIDMIVAMPCQFIHTNVEDITHDTYLAGETLNF
FT                   EGIHFFVPDSFKINNPNDFHETPDLDEVMQESLRAEFRSEGARVNEGAPACHIFGSIPV
FT                   NQVRGDFRITGKGFGYRDRSHVPFESLNFSHVIQEFSFGEFYPYLNNPLDATGKITEER
FT                   LQTYMYYAKVVPTLYEQLGLEIDTNQYSLTENQHVIKVDQSTHRPDGIPGIYFLYDFEP
FT                   IKLVIREKRIPFFQFIAKLATIGGGLLIAAGYLFRLYEKLLFIFYGQKAVQQNREQKPG
FT                   GLLDI"
FT   CDS_pept        1067559..1069010
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230468"
FT                   /orf_name="CD36_84750"
FT                   /product="Translation termination inhibitor protein Itt1
FT                   homologue, putative"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42981.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396730"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000192DBE2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE70"
FT                   /transl_table=12
FT                   /translation="MNSGDETTTDDFAEFSDDLRAQELQSCRYIYPDCEIDLSSLSGTV
FT                   NIKVKSDKDITIHLLEKTSEGTRHIATSTISNLSPIVLSFQLNSDYPFEAPPEIKVACA
FT                   WIATSKIDMLTNSLYNIWKEYKDQVLFNLIDHLQDQVQNHLDELIPTPLDIFDMEEYYN
FT                   LVDFNIQAEIEEFNLQTYTCDICQKARSGVNCTKFDECGHVFCNNCLAEYFESCIESGD
FT                   IDKVHCPDFECTKKYLDKKKKFMELETWMYNDKKVKDMLNQVLIPSTPLTMLTKILSNP
FT                   SLVDRYYSLFKKNQYEWIGNLLPNRLVKCPRIGCEEVIFREDIDEKLVVCPKCKYAFCN
FT                   DCRKSYHARFKLCSKIDESGKYSGIPIEDLETYPLLPPDSYDKKTMNAKYGRKRIARAI
FT                   EEYQMDQLFQQMLRERKTVVQCPGCSVATEKSEGCNKMKCSLCKTDFCFNCGSKIENNH
FT                   DHFVDPSSPCYKLLFFGMPGTEDIY"
FT   CDS_pept        complement(1069052..1070818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576689"
FT                   /orf_name="CD36_84760"
FT                   /product="Peroxisomal membrane protein Pex28p homologue,
FT                   putative"
FT                   /protein_id="CAX42982.1"
FT                   /db_xref="HOGENOM:HBG396731"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI000192DBE3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE71"
FT                   /transl_table=12
FT                   /translation="MDSTDQSSDSLQQSPSISSSISSNSYKDFAIDVLNKAVVKGNSIA
FT                   ESNPGSKRAIAISTASTIVEMSLEKYSSSNLSSRRSGRSGSIELTDEQISQIESVPTSA
FT                   DDDGDGNKRKSGHFADRMIEKLLKSVLPQDIPEREIFEKRLNDPERNKRPGLSLGVLTS
FT                   NVKQMAGKMTNFFALQYEVLYIIAWKKPTKTISALVLYTAVCLWPHLVLAYPLIFVLFS
FT                   VLIPGYVHRHPQRNPELIKVKKRGQSLLSFLFETPETSIVEDLINEEYLRESDEMASST
FT                   YSISEETSEVTVSSSMPLDSESPKKDDVAKHRKSQIALLINLRDFQNLTTDILKGINNA
FT                   EKFYYETGGFKDERLSTFIFYGVLLSTFGILFVGKYVPWRLIFIQGGWTGAILCHPNCK
FT                   KFLVEASKARKARAAIEKAKKEEESVPEIIIKDANDTITQFDRNDIIVDDSPETRIVEI
FT                   YELQIKSILKHSWAFYRYSTTIYDKNNKARIAGKRPPGVDHLSKVYPPNDWKFDFGLVN
FT                   KWNLDTEPNEFIRERSLNPNLFIVKNNESQGWIYDNMEGVVHSDIVYEFRRRRLYRECY
FT                   RYGRPHKQPSKY"
FT   CDS_pept        join(complement(1072523..1072540),
FT                   complement(1071270..1072055))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383340"
FT                   /gene_name="RAY38"
FT                   /orf_name="CD36_84780"
FT                   /product="Ray38p homologue, putative "
FT                   /function="DNA binding"
FT                   /protein_id="CAX42983.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG396732"
FT                   /db_xref="InterPro:IPR019084"
FT                   /db_xref="UniParc:UPI000192DBE4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE72"
FT                   /transl_table=12
FT                   /translation="MSFQNKNLYDLLGNDVEEDAASSAPIREVVKKNTSSKKSDSAPSS
FT                   ADPAKAKKKKQPTGNEAALKNKNFNKDVAPPQSTATKHSKKPFDRHSRTGKTDSKKKLQ
FT                   QGWGQSDKRELEGEVEGTEDAEAELEAEAEENDESANATPKKSLQEYLAELELSKQELE
FT                   GSKKLRQANEGAEEKWTSEEKIEKEQEVFFASTHSKKVKSKAQKEKVFLDIDASFGDEQ
FT                   PQNTRGGFRGGKRGGARGGARGGAKRGGRGGAAKPEVNDKNFPSL"
FT   CDS_pept        complement(1072864..1078392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576690"
FT                   /orf_name="CD36_84790"
FT                   /product="Protein transport protein Sec7 homologue,
FT                   putative"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42984.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG355338"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DBE5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE73"
FT                   /transl_table=12
FT                   /translation="MSEQEEEASKPHEIETSLESIEKNGQNENTNTDNTSNGNKNPDDS
FT                   SDPITEVELHQPDNEVQETTNIEDVKEDTVPTLDGNNSPKNTESDKSNTDTDNTSNANT
FT                   KGTPKINNSPEAIPDTVVTPAEDVSVQSTPTANHIRQSSILSISSNATVDNAQIFKKTF
FT                   DAILTSKEVKKDESFKNLIQTALDSLNDPESKNPQIIFNALKACCDTSSTNLKSKAIDL
FT                   FAKLFDYAQFDDYLEQVKLTDDSVSVISACFEGEGTDPELEMQVVRALMHSILLMPCHG
FT                   ASLLQAVRQIYNVFIFSLTARNQAVAQGILTQVIGTIFQRVEESVKNKSKRNSTPRLIS
FT                   SSSDDNLEIEASGETEDQEKLTLKRLENLSDVINDNDRLNEANFATETDEDLAVKDAFL
FT                   VFRAMCKLSIKSLDSATIDMKSHSVRSKLLSLHIVHTILKDHIDIFLSRDVIILSSNTN
FT                   EHVRMVNAVRQYINLALSKNAASALAPVFELSLEIFWLIISNLRAEFKREIPVFWDEIY
FT                   FPVAEMKTSSAHQKRYLLSIIERLCNDSRCIIEFYLNYDCDSNMPNICEKLIDYLTKLS
FT                   LQRVEVTPQQKYAYRENRRNGISVYDINKISNLTSKTMSSRPPEPEIYSQFPLEYALKM
FT                   TSIGCAVAFLRSLYSWAQRGLTNANSKSFTIDNNDNNKSLLSLRNRSDSTNTSISASRN
FT                   HSFVNGDSLTESDNPQQFENQKQRKKAYLEGVRQFNQKAKKGLRYFIDNGFITSDDPND
FT                   IAKFLLTTDGLDKATIGEYLGEGDEKNIAIMHAFVDEMEFEKTGFVDAMRRFLQSFRLP
FT                   GEAQKIDRFMLKFAERYVLGNPDVFTNADAAYILAYSVIMLNTDLHSPQIKNRMTIDSF
FT                   IMNNSGIDDGKDLPREFLEKIYDEILNDEIKLQSEQHAALLAGDLSVPASGQSIGFFGG
FT                   RDVTREAYIHASKEMSTKTEKLMRNLGKKSKSDDSEGIFYAASNVLHVKSIFDTLWMSV
FT                   LAALTPPFKEYDEEDVSRTCLEGIKLSIRIACMFGLDYAKTSFISALVQFQNLHNYEEM
FT                   KQKNIDSIYIMLDLAVSEGDHLGRDAWVQILTSISQLERLQLIAQGVDQDSIPDVTIAK
FT                   LVTRNSLETSRTSSSFFRSFSSSQTPAQTAASKFHNQQLSPEAASLLTKTELEVAIDKV
FT                   FTNSANLSGESIVQFVRALSEVAQEEIDSSGQSTNPRTYSLQKVVDICYYNMSRIRLEW
FT                   SQLWAAMGETFNAVGCHTNPAISFFALDSLRQLSMRFLEIEELAHFKFQKEFLKPFEYV
FT                   ILHNDSLEVKDMVLECINNMILARADKIKSGWKTIFGVCTAAAKENKESIVMKAYKMAN
FT                   WINKEYVEEVRLQDSFSDLVVCFTVMAKNEKFQRISLLSLDVLSRLIHEIAQYTVLNTG
FT                   EDNKPIVPDIEKNEHLVKLWFPVLYGFHDIIMTGEELEVRSRALTNLFDVLMKYGQYFD
FT                   FEFWKIICENLLFPIFHVLSNHWEIGLDDINDQLSVWLSTTLIQALKSMMTLFTHYFDA
FT                   LNSFLDGYLELIISCICQENDTIARIGRECLISLLIDNAQNFNYEHWGKVSDALSNLFE
FT                   LTTAKELFTSDPLRNRTAKDGEGGSSDIGGEEVEHRESKNPIIDDAEERLKKSKDKSSI
FT                   VVKSVLQLLLIQSLSELFESDDFYENVPYHYLLKMAKLLFKSYNFAKKFNDDYDLRVRL
FT                   WNAGVIERLPNLLKQESSSAAVFINITFRMYCDDDKTSPANKQSLLDYLVPLCNTIVER
FT                   YSDLDETNQQRNISTWKPVIVEIYEGYVELDDDDFVKHCPVLYHLTLKLFTKSMSSELR
FT                   LAIKAFLTRVGEEFVSISDNVKEKNRK"
FT   CDS_pept        complement(1078760..1084423)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383341"
FT                   /orf_name="CD36_84800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42985.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325769"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI000192DBE6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE74"
FT                   /transl_table=12
FT                   /translation="MKPEIEQELSHTLLTELLAYQFASPVRWIETQDVFLKQHNTERII
FT                   EIGPSPTLSGMANRTIKAKYESYDAALSLQRQVLCYSKDAKEIYYKPDPADLAPKETPK
FT                   KEENATPAPAAAAAAATAAAPTPAAAPTPAPVSAGPVESIPDEPVKASLLIHVLVAQKL
FT                   KKPLDAVPMTKAIKDLVNGKSTVQNEILGDLGKEFGSTPEKPEDTPLEELAEQFQDSFS
FT                   GQLGKTSTSLISRLMSSKMPGGFSITTARKYLESRFGLGAGRQDSVLLMALTNEPANRL
FT                   AAEADAKAFFDGIAQKYASSAGISLSSGSASGAGAANGGGAVVDSAALDALTAENKKLA
FT                   KQQLEVLARYLQVDLNKGAKSFIKEKEASAVLQKELDLWEAEHGEFYAKGIQPTFSALK
FT                   SRTYDSYWNWARQDVLSMYFDIIFGKLTSVDRETINQCIQIMNRANPTLIKFMQYHIDH
FT                   CPEYKGETYKLAKRLGQQLIDNCKQVLSEDPVYKDVSRITGPKTKVSAKGNIEYEETQK
FT                   DSVRKFEQYVYEMAQGGAMTKVSQPTIQEDLARVYKAISKQASKDSKLELQRVYEDLLK
FT                   VVESSKEIETEQLTKDILQAATVPTTPTEEVEDPCTPSSDDEIASLPDKTSIIQPVSST
FT                   IPSQTIPFLHIQKKTKDGWEYNKKLSSLYLDGLESAAINGLTFRDKYVLVTGAGAGSIG
FT                   AEILQGLISGGAKVVVTTSRFSKKVTEYYQNMYARYGAAGSTLIVVPFNQGSKQDVDAL
FT                   VQYIYDEPKKGGLGWDLDAIIPFAAIPENGNGLDNIDSKSEFAHRIMLTNLLRLLGAVK
FT                   SRKATDTRPAQCILPLSPNHGTFGFDGLYSESKISLETLFNRWYSEDWGSKLTICGAVI
FT                   GWTRGTGLMSANNIIAEGIEKLGVRTFSQKEMAFNILGLLTPEIVQLCQEEPVMADLNG
FT                   GLQFIENLKDFTSKLRTDLLETADIRRAVSIESAIEQKVVNGDNVDANYSKVMVEPRAN
FT                   LKFDFPTLKSYDEIKQIAPELEGMLDLENVVVVTGFAEVGPWGNSRTRWEMEAYGEFSL
FT                   EGAIEMAWIMGFIKYHNGNLKGKPYSGWVDAKTQTPIDEKDIKSKYEEEILEHSGIRLI
FT                   EPELFNGYDPKKKQMIQEVVVQHDLEPFECSKETAEQYKHEHGEKCEIFEIEESGEYTV
FT                   RILKGATLYVPKALRFDRLVAGQIPTGWDARTYGIPEDTISQVDPITLYVLVATVEALL
FT                   SAGITDPYEFYKYVHVSEVGNCSGSGMGGVSALRGMFKDRFADRPVQNDILQESFINTM
FT                   SAWVNMLLLSSSGPIKTPVGACATAVESVDIGIETILSGKAKVVLVGGYDDFQEEGSYE
FT                   FANMNATSNSIEEFKHGRTPKEMSRPTTTTRNGFMEAQGSGIQVIMTADLALKMGVPIH
FT                   AVLAMTATATDKIGRSVPAPGKGILTTAREHHGNLKYPSPLLNIKYRKRQLNKRLEQIK
FT                   SWEETELSYLQEEAELAKEEFGDEFSMHEFLKERTEEVYRESKRQVSDAKKQWGNSFYK
FT                   SDPRIAPLRGSLAAFNLTIDDLGVASFHGTSTVANDKNESATINNMMKHLGRSEGNPVF
FT                   GVFQKYLTGHPKGAAGAWMLNGAIQILETGLVPGNRNADNVDKLLEEYEYVLYPSRSIQ
FT                   TDGIKAVSVTSFGFGQKGAQAVVVHPDYLFAVLDRSTYEEYASKVSARNKKTYRYMHNA
FT                   ITRNTMFVAKDKAPYSDELEQPVYLDPLARVEESKKKLVFSDKTIQSNQSYVGEVAQKT
FT                   AKALSTLNKSSKGVGVDVELLSAINLDNETFIERNFTGNEIEYCANTAHPQASFTGTWS
FT                   AKEAVFKALGVESKGAGASLIDIEITRDINGAPKVVLHGEAKKAATKAGVKNVSISISH
FT                   DDFQATAVALSEF"
FT   CDS_pept        complement(1085380..1086861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576691"
FT                   /orf_name="CD36_84810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42986.1"
FT                   /db_xref="HOGENOM:HBG396733"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000192DBE7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE75"
FT                   /transl_table=12
FT                   /translation="MRCILFFFFFKFFKSIGSEVYRKTEDILSELQLHSCLLRNPFLFG
FT                   NYKKVYNLVEMSSKSQSCIYPKRYKKTKKNMLFELPPEIMEIVLDNLHQRELLQISQIN
FT                   KYFRHLTLLRQYSVISIDSSPKLFQRDTKSLNDFQELRGVYQVDSCSIRAVNISSVYCL
FT                   KLFFKTLIENPQYGGYIKILHVENLPDIPDLHMVEFLHKALPLMNRLKVFRWNHSHPIS
FT                   MQLLQYNWELTAVSGNILCDNINMNEYPLLNEAVLTITDFHLPLRRLTIKNVDLSKISV
FT                   NTKLLKSLSIENCSNEKDFLIKLDAPHLEELSLSIEDQPFVAKMFSQLHLKSLKLSIPE
FT                   QCEMLKVSHILNFLNKDISRLEISNQPDNLSYKILPKFNNLDYLHLSVLEKDIYKLLSS
FT                   LTKKLRFLSLNVLEATERRNCLIASEFWECSMIDENQLKYMDFTLEYHRKLDRLNWLRF
FT                   QGNDTTYIFECNESEPIIFRDGFYHYFDRIVNTLI"
FT   tRNA            complement(1087060..1087144)
FT   tRNA            complement(1087168..1087254)
FT   CDS_pept        1089548..1090867
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576692"
FT                   /orf_name="CD36_84830"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42987.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396734"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DBE8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE76"
FT                   /transl_table=12
FT                   /translation="MFNTKIFENTGSSGSTTAMNIPVQSEPSNTGNAQPQPIDITFNHR
FT                   PSVFNNSRFRRESVAHSQGMGGISWGSVTIGSWLKDEVMMASGGNNNFLNPHYHPTQSH
FT                   NNQSSHSSYSQQQQQQQQNLINPRRGSFRTSNHPNLSPHLQTSYLPELEADYCKDYSCC
FT                   GELLPTLHDLLRHYEEAHISASPPPDQNHFVLNNSRNRNNYNNAHNVMETVSTTDVFLN
FT                   NNHNNHHTPTMHPSATTNNYNGNNSFGNQQAHQVLQQHDNQQQQQQQQQQSQHSQNQLH
FT                   HNSDNYQHQSQSTSRQPGQQFGQSNSHFGSQQQSPSSGSQGDGTPMQTDEDDMYIDDPA
FT                   RHLYVMENEENKPFKCPVIGCDKTYKNQNGLKYHRQHGHQGQNLRENPDGTISIIDPDS
FT                   NCPYLDNAALEKDKPYRCEVCGKRYKNLNGLKYHRGHTTH"
FT   CDS_pept        join(1091807..1092737,1092824..1093425)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536109"
FT                   /orf_name="CD36_84840"
FT                   /product="Activator of meiotic anaphase promoting complex
FT                   (APC/C), putative"
FT                   /protein_id="CAX42988.1"
FT                   /db_xref="HOGENOM:HBG396735"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000192DC97"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE77"
FT                   /transl_table=12
FT                   /translation="MAISRSLITETSNRFIPSSLSTSVYKTRHKNELQISYQSHENLDN
FT                   NNQRANLSIRDDSLFTHSTSSTSSNTHFQSSSSSISSSSPTKRVTVGSTNPSDLHQKIV
FT                   AEALNFVSSSKVLKFDNRSKSKKIQNRIDAKLVESLTTAEREVSIDAGKSRLIPSIKTI
FT                   IATDILQAPGLRNDYYSNLVSWSFKTNRVAVGLGSKIYLWGVDNNVTQINHSNEDLVTA
FT                   VSCSKEYWILVATAGGKIILMDQQSNSVVSEYTNSEGKCIFCFAWFDNSNMFIAGDDFG
FT                   EVYIFKIHKLFNVQIELVKVFKCHQQQICGLALNGKNDEIAVGANDNCCTIWNIKDFSA
FT                   PVLKFVLPHNAAIKALCYCPWTVSLLATGGGSKDRKIRFWHTSSGTLLNEYYTDGQITS
FT                   LIWSRFRKEIVATFGFGGTSKSNLLCVYTYPQMQPILEVNAACNLRILSATLSPDYCSV
FT                   CVATNDSTIRIYQLWEGSLEILPSATQRIMGAFGSDIIELLEGISKTGDVIR"
FT   CDS_pept        1093829..1094671
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576693"
FT                   /orf_name="CD36_84850"
FT                   /product="SH3 domain-containing protein, putative "
FT                   /protein_id="CAX42989.1"
FT                   /db_xref="HOGENOM:HBG396736"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000192DC98"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE78"
FT                   /transl_table=12
FT                   /translation="MSAALVNRSLTTIRTELEFLKDSDVITEGLYEKLLQSLPTKYQKD
FT                   SAPWDVDRIAGGSTGPGRVENKSATDVLADDFSKTNISVPPPAYPPAQPPRSAAPKPVG
FT                   YCIATYDYKAQQAGDLDLSKGDKLAVVEHLSEDWWKGYKSDASPEKTGVFPSNYVKIIS
FT                   QLEFEADERKAAPPAQTPSYDQNGYSAYGPPATYQPQQLQQQPSYGGYAQYPPPSTNYY
FT                   PPQQYQQPQQPQQVVEQQPEQHHSSGSEHVKKFGSKLGNAAIFGAGASIGSNIVNSIF"
FT   CDS_pept        1096243..1100745
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576694"
FT                   /gene_name="CDR2"
FT                   /orf_name="CD36_84860"
FT                   /product="Drug resistance protein 2 "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42990.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000192DC99"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE79"
FT                   /transl_table=12
FT                   /translation="MSTTSNTSLSQQLDEKPWVDVSDDSSVQEYQGFDATASHNIQDLA
FT                   RKLTHDSTKGDHHAANNLARYLSHMSDIPGVSPFNGNINHEQLDPDSENFNAKYWVKNL
FT                   KKLFDSDSEYYKPSKLGVAYRNLRAFGVANDSDYQPTVTNALWKFTTEAINKLKKPDDS
FT                   KYFDILKSMDAIMRPGELTVVLGRPGAGCSTLLKTISANTYGFNIGKESHITYDGLTPK
FT                   DIESNYRGDVIYSAETDYHFPHLSVGDTLEFAARLRTPQNRGEGIDRETYAKHMANVYM
FT                   ATYGLSHTRNTKVGNDFVRGVSGGERKRVSIAEASLSGANIQCWDNATRGLDSATALEF
FT                   IRALKTSAVILDTTPLIAIYQCSQDAYDLFDNVVVLYEGHQIFFGRASKAKEYFEKMGW
FT                   KCPQRQTTADFLTSLTNPAEREPLPGYEDKVPRTAQEFEVYWKNSPEYAALVGEIDNHL
FT                   IECEKSNTKSYYHETHVAKQSNNTRPSSPYTVSFFMQVRYVMARNFLRMKGDPSIPLVS
FT                   ILTQLVMGLILASVFFNLRKSTDTFYFRGGALFFSVLFNAFSSLLEILSLYEARPIVEK
FT                   HRKYALYRPSADALASIISELPVKLLMTMSFNIVYYFMVNLRRTPGNFFFYWLMCALCT
FT                   LVMSHLFRSIGAVTTTIATAMSISTVFLLAMIIYAGFVLPIPYILGWSKWIRYINPVTY
FT                   IFESLMVNEFHGREFKCGQYIPSGPGYESLSVENKVCTTVGSTPGSTVVQGTEYIKLAY
FT                   QFYSSHKWRNFGITVAFAVFFLGVYVALTEFNKGAMQKGEIVLFLRGSLKKHKRKTAAS
FT                   NKGDIEAGPVSGKLDYQDEAEAVSNEKFTEKGSTGSVDFPENREIFFWKDLTYQVKIKK
FT                   EDRVILDHVDGWVKPGQITALMGASGAGKTTLLNCLSERVTTGVITDGERLVNGHALDS
FT                   SFQRSIGYVQQQDVHLETTTVREALQFSAYLRQSKKISKKEKDDYVDYVIDLLEMTDYA
FT                   DALVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSICKLMRKLAD
FT                   HGQAILCTIHQPSALIMAEFDRLLFLQKGGRTAYFGELGENCQTMINYFEKYGADPCPE
FT                   EANPAEWMLQVVGAAPGSHSKQDYFEVWRNSSEYQAVKDEISRMEVELSKLPRDNDPEA
FT                   LLKYAAPLWKQYLLVSWRTIVQDWRSPGYIYSKIFLVVSSSLFIGFSFFKSKNNLQGLQ
FT                   SQMLAVFMFFIPFTTFIDQMLPYFVKHRAVYEVREAPSRTFSWFAFIAGQITSEIPFQI
FT                   VVGTISYFCWYYPVGLYANAEPTDSVNSRGVLMWMLLTAFYVYTSTMGQLAISFNELID
FT                   NAASLATTLFTLCLMFCGVLAGPDVIPGFWIFMYRCNPFTYLIQAILSTGLANAKVTCA
FT                   PRELVTLKPPMGETCSSFIGPYTKAAGGYFSTNSDGTCSVCRIDSTNQFLESINAMFSQ
FT                   RWRNFGIFVAFIAINIILTIFFYWLAKVPKGNREKKLKK"
FT   CDS_pept        1101059..1103557
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576695"
FT                   /orf_name="CD36_84870"
FT                   /product="Nucleolar complex protein, putative "
FT                   /protein_id="CAX42991.1"
FT                   /db_xref="HOGENOM:HBG737435"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniParc:UPI000192DC9A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE80"
FT                   /transl_table=12
FT                   /translation="MAGSQLKQLKAALKDKGLIGQTNVSQKKKQKKKNSQSTNNNKSFN
FT                   RDEKLQQLKEIRDQFNKFDQKINRSKHDISIIHQGKFVKVGSKQHNSSAIKNGNIQRQM
FT                   KMQYDLEKFQHGKTGGILDKRFGENDSHLTKEEKMLARFTKERQSAASSKKRSVFSLAS
FT                   DDEQDESEEDEDDDGGFMLTHGGNTLSLDDEETINYVDEDSLQPPKKKSKNEVMKEIIA
FT                   KSKFYKQQRQKEFAKTQDQIDELDEDFGDVMDDLRNVQSQISKNNTKDGGSGGSTNGGF
FT                   STKTPEQIEYDNKVRELTYDRRAVPAERTKTDEEIRKEHEDKMKKLEADRLKRMEGFID
FT                   DDRETQGDDLDNDFWAGSDNDSDGNEADGFTIKNSDHHESDSEKEEQDQNQDESHKREV
FT                   KSQKITNVIMPFTIEEFIQEMSNVDPIKQPEYVKRICETYKPSLAEGNKEKMSNFVGVL
FT                   FEYILHVANQYQDFEPFVKILRKLAESSTSKTATNYNESLVQRVREHIKHIQSRIDKQL
FT                   TPGDLVFFAIIAYLFSSSDHYHIVITPSLILMNQILSNIIYHPKTVTDIAHGVYLIDVL
FT                   LMYQRFAKRFDPEIINFIEHALFMMIPEIDKMNTSKLLSISPTAGNITLQFAMNKSEKI
FT                   CSLEESTLSIKQLYDEENLNKSCLISKLIQLMDKCVTLWKEKSSLIEILESFISILKHI
FT                   TKYNAIVTGPILTKFTRLYANLVKDRKPLTLQHHKAIAIATYAPKFEENFNPDKKSYDI
FT                   NRERQELNKVKHELKKEKKAALKDIRQENKFIAREQISEKKRMYEDYHKKMANIVNSIQ
FT                   SEEGAEKNQYERERKQRKRR"
FT   CDS_pept        complement(1104783..1105295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230469"
FT                   /orf_name="CD36_84880"
FT                   /product="Non-classical export protein, putative "
FT                   /protein_id="CAX42992.1"
FT                   /db_xref="HOGENOM:HBG331474"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000192DC9B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE81"
FT                   /transl_table=12
FT                   /translation="MLAIGDVILRAFNFVFLVIALGLTGSLAATTITQHNPQVNFAVFA
FT                   AAFGLLTSSIYGVFAYFIAAFAWPVVLFLFDFLNFVFTFAAATAIAAGIRAHSCSNEDY
FT                   VFDNNITQGSSARCRKAQASTAFLYFSTFIFIASAIFSAISLSKGGLFGHSSRPAPRTG
FT                   VPTMSQV"
FT   CDS_pept        complement(1107567..1108310)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576696"
FT                   /orf_name="CD36_84890"
FT                   /product="Proteasome regulatory subunit, putative "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAX42993.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG595165"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000192DC9C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE82"
FT                   /transl_table=12
FT                   /translation="MGDVKQGNKFAIHDAIKEGNTLLAKKLIDAQPTNQLYISDDDERT
FT                   PLHWAVSFNNSDLVQYILSKTPNDLDIDEYVDGSGWTPLHIAASLGNSTIFNQLMRRAT
FT                   TTTTNNNTSEPELDVNLQTNSGTTCLHLAISKNNYDIVKELIETYKANCRIKDKKGYTP
FT                   LHRAASIGSIPIIKLLVDKGKININAQDNDGWTSLHHALAEGHGDVAVLLVKLGADPNI
FT                   VNNDGETPVKVAVDDKVAKYFTENI"
FT   CDS_pept        complement(1108644..1110896)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576697"
FT                   /orf_name="CD36_84900"
FT                   /product="Glucose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42994.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192DC9D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE83"
FT                   /transl_table=12
FT                   /translation="MKNLSVFPFLTRIMYDASVEDEYYRQMRQKSSSISAFKVGLVAAM
FT                   GGFLYGYDTGLINDLLEMEYVYTHFPSNNKSFTSHERSILVAILSLGTFIGALIAPLAS
FT                   DRYGRRFSIMMSSGLIFTIGNILQIASASIALMCVGRFVSGVSVGILSAIVPLYQAEVS
FT                   PKWSRGSVVFTYQWSITAGLLVSSAVCQGTRKINNSGSYRIPIGLQFLWAFILFFGMYF
FT                   LPESPRYYVQKENLQSALDSLCKLRKLPPDDDDLIEELVDIKANYDYELSYGKTTVLDC
FT                   FKSGGGRHKQGLRMLTGIGVQFFQQCSGINFIFYYGVNFFSSTGIDNYYIMSFITYLVN
FT                   VIFTVPGIMMIDVVGRRPLLFWGGVGMAVCNFIIAIAGVSVKNNEINGILCVSFACVFI
FT                   VFFASTWGGCTWALCSDIYGISIRQKAVALTAATNWLVNFIFAYITPYLIDTGQHTAAI
FT                   GSKIFFIWGSFNACGAIFVFFTVYETKGLKLEEVDYMYVHCANARVSTKFISTKIDFAH
FT                   LDENYDPIPMTQLPDSTSSNEMYHDKGSDEYSSPQQQQQQNRSQQPLYNGDDQNNLTII
FT                   PYDNSSTISSVNSIEERRDSIPSTNGLSFTSSSQSHPHSNSQSQSHSQSATYRSKSHNS
FT                   TISNDYQSYLESIQREYSQHYQNSSAMIKQLSRNSRNNGSDQEENHEPIQKQETINVPL
FT                   NINNINQINNIPTTVIATPFFDHPPSDSDSSDEDEEGEEQQEEEEDGKSSDIGNVK"
FT   CDS_pept        1111955..1113094
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383342"
FT                   /orf_name="CD36_84910"
FT                   /product="Undecaprenyl pyrophosphate synthetase, putative "
FT                   /EC_number="2.5.1.31"
FT                   /function="di-trans,poly-cis-decaprenylcistransferase
FT                   activity"
FT                   /protein_id="CAX42995.1"
FT                   /db_xref="GO:0008834"
FT                   /db_xref="HOGENOM:HBG396737"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI000192DC9E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE84"
FT                   /transl_table=12
FT                   /translation="MSCKKKKYVSTLLSIEIIKFIKTFPPTAANMNVTSPKISENVRLR
FT                   NNGNTQLKNITREMNNNDNESNEDSETKAPPNSYRIYNIFTIILALFRSMIKTTSKTTN
FT                   SVLQMSMFYINHFILLSLFFMIAIYKNFQYLYRRVYLKYLAVTYYPSKSPQVIREDINK
FT                   LEKIPKIVSCILDLQDDEDENGGKDGLINSISELTAWSMSAGLTKLIIYEFTGALIENS
FT                   GCIVDLRKYITKTLVLYFGTEAIPTFSIRVPHKNLIIYSDNHIEGNTVDLEIDLISRID
FT                   GKPTLVELTKTMSELAVNRELSIRDITIDLIDEELHELVGPEPDLLISFAPSLNLEDYP
FT                   PWHIRLSEIYWEPDNKDVNYAVFLRGLQQFSNCKINIGK"
FT   CDS_pept        1114061..1114606
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576698"
FT                   /orf_name="CD36_84920"
FT                   /product="ADP-ribosylation factor, putative "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42996.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000042C261"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE85"
FT                   /transl_table=12
FT                   /translation="MGLSFSKLFANLFGNKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRYYFQNTQGIIFVVDSNDRDRIAEAR
FT                   EELQQMLNEDELRDALLLVFANKQDLPNAMNAAEITEKLGLHSIRQRPWYIQATCATTG
FT                   DGLYEGLEWLSTNLKNSS"
FT   CDS_pept        join(1115737..1115739,1116187..1116546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230470"
FT                   /orf_name="CD36_84940"
FT                   /product="Ribosomal protein of the large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42997.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG323932"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniParc:UPI000192DC9F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE86"
FT                   /transl_table=12
FT                   /translation="MAGVKTFELRTKSKEQLESQLVELKQELATLKVQKLQRPSLPRIH
FT                   TVRKNIARVLTVINLNQRENVRAFYAGKKYIPKDLRAKKTRALRRKLTKFEASKETEKA
FT                   RKQRIAFPQRKFAIKA"
FT   CDS_pept        complement(1116763..1119981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576699"
FT                   /orf_name="CD36_84950"
FT                   /product="Ubiquitin conjugation factor, putative "
FT                   /function="ubiquitin-ubiquitin ligase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="CAX42998.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0034450"
FT                   /db_xref="HOGENOM:HBG398467"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniParc:UPI000192DCA0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE87"
FT                   /transl_table=12
FT                   /translation="MSSADDVRAKRLAKLASSANTNSNRQQSPTVETSTTNVATTNVAS
FT                   KDNNSETEKTTTAPKPISEPPTKPTVSDRTPVDQTLPKEDQISSWIRLELEYIFHATTV
FT                   KSSDNSKGLIFLPDLAYNVNDTNVKLNEDHIESIFMEILTELGVPKQYKTPMEYLYTVY
FT                   HIAFKTKRTLPVKSTFYEDKMAILNRIISLVTAYGNMSFQMPDMFVNNDLRKSLDLFID
FT                   RFGDLSSFLSDIIQVSIEEESLSELMSLFFTYLSTRLYQANLNERKYLNYISVFQFLVS
FT                   IKPVAAIFSQIDGFQPPDKTKALDYEHRTLLGPLLRISPLLDNMASFYFGQETSTMTPL
FT                   QIDNLYGSMQTEYKVVIDHLFTIIDKLIRGSTKTREDLLQWLGSLINLSHLRRGSHADF
FT                   RKLPSDGIMYNISVILIRLSLPFLDYPTFSKIDKIDVDYFLKSDLIDIKEESRVNSTIE
FT                   ESNEYYAKRKQETSSDNLTPPNFISDCFNLTLAYLHYGVGGIFVKHDRLKRQLDQMEQR
FT                   LEAIESESSMPNPMMQQLMRRELPGLKNAIINMRASRHVIKAIFSDRNHQLEIFDFVVG
FT                   ATTFITRLIDPQHKYPQVKLSIPIFKISSVSQLDDHDFLKTKTPEPWKYYPEFILEGII
FT                   NYCKFSTKFIGCPLVSNEDKLNVFVEFSTILLRCPELIGNPHMKANLVELLFMGALPMQ
FT                   NGSPGFISNIFNGNQLVMDNLLYSLLDFYVMVEKTGASSQFYDKFNSRYYISVILEELW
FT                   QNPRYRSQLTDYSKNNVDFFIRFIARMLNDTTYLLDETFNLLNSIHDYQQEIKKRESGG
FT                   EENESMGTNEELANHLEEDELRVKSYMGLSNKTMELFKLFTKEVPRGFVLPEIVDRLAG
FT                   MLDYNLSILVGPRCSNLKVAEPEKYQFEPKKILSDLCEIYVNLSAQPEFVTAVARDGRS
FT                   FNVVYFQKAEKILTTRTFIKNEIINGLIEFANRAEKARLDEETEELELGEIPDEFLDPL
FT                   MFTLMEDPVILPSSRISIDRSTIKAHLLSDATDPFNRVPLKLEDVIDDVELKQKIQDFK
FT                   QEKKNLQKQNSNVDQEEEDVVMKE"
FT   CDS_pept        1120904..1122139
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079114"
FT                   /orf_name="CD36_84960"
FT                   /product="R3H single-stranded nucleic acid binding protein,
FT                   putative"
FT                   /protein_id="CAX42999.1"
FT                   /db_xref="HOGENOM:HBG626850"
FT                   /db_xref="UniParc:UPI000192DD54"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE88"
FT                   /transl_table=12
FT                   /translation="MPNQNSTVPAQGSDKTHTAIPSSLLTALSKQQDKLYILHLEKDLI
FT                   KFIKNSVLGNIKQPEYIIQAQYLKNSYYRLLSHQLCQYYNLQHWNNTFNEIIVTPIPDF
FT                   DYQQFIKAIESSDNNQGDFIKIASVAHKYKSENATTSATTNADAQEQLNKSAPIKKLMV
FT                   RKIINKPPMSDPASGQTPGTPESEVSDLTKELDESKLISEDTGSSTPISESSENTTNNI
FT                   ESQRASKEALYMKLREEIFENNNEEEEEEEEEEEDDDDDDNEYGTIDPQENNNRGYKTH
FT                   NNFNKGRNHGNYSGYKTTPYQQQQLQPHPPMYNTIPIPVPYQFNPNSQGPPIPGMVYSP
FT                   YYQPMMYGYPPNYTGANNNNVVPTPKYDKETERRILNNPYIILPDDTKNGKSNNYSNKH
FT                   TKHKKQFANTNT"
FT   CDS_pept        1122795..1123406
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536110"
FT                   /orf_name="CD36_84970"
FT                   /product="Rho GDP-dissociation inhibitor, putative "
FT                   /function="Rho GDP-dissociation inhibitor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX43000.1"
FT                   /db_xref="GO:0005094"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG329264"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000192DD55"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE89"
FT                   /transl_table=12
FT                   /translation="MSKPNIDDDLVPEKVEGYTVGEKKTIDEYKNLDAEDESLAKWKAS
FT                   LGLTADTKPYPVKPGDNRKVVVTELALEFPEQPDLQPIRINLEDSDGNTIVDKEIKFNI
FT                   KEKSIYQLVVKFRVQHEIITGLKYLHSVKRGGIRVEKVEEPLGSYAPNTIDKPFYERKF
FT                   AEVEAPSGMIARGTYSAISKFIDDDDNVHLTVPWSFSITK"
FT   CDS_pept        complement(1123811..1126390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536111"
FT                   /orf_name="CD36_84980"
FT                   /product="ATP-dependent DNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX43001.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG396739"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI000192DD56"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE90"
FT                   /transl_table=12
FT                   /translation="MSMSNQVLGKILESLNANQRKAVTAPFNGRLQIIAGPGTGKTKVL
FT                   ISRVAYLLIAENIRPDNLIVTTFTKRAANEMIERLTKLVEGTDVNIDKLIIGTFHSICY
FT                   RIIRKYGKLIDLEDYTIADERDKSQILKTVLTNLSGEEVVTLNSFSEVALQKLRSHKAN
FT                   ENYYGLDLAVISKKISSLKSNGISHDSYSVNTKRNLALAFLYNKYQASLADLKKLDFDD
FT                   CLLECHKLVKNFPVLNYIKHVLVDEFQDTNEIQLQLMYHFAKGNINGDPKYQNNVTIVG
FT                   DPDQGIYAFRDAQSINFEKMSNHYKSMKLSLHKISLNENYRSTSGILNISETLMNQQKG
FT                   RTPKLLKSQLDFSIKPVYSCLKSAQEEAKWIVYQISHLLSLPNSAVQGKDIAVLYRAAY
FT                   QSRALEDELVKKGLPYKMIRGRAFWDRQEVIAIMDYLKVCSDENEQAAVIRTLNYPKRG
FT                   LGPKTVESLGKIIEKQANQGKSVHQCLLAMTKKSGEPKIKLTIKQLQSVEEYYSMVTKV
FT                   KSKLDEMKNCPDEDISNHAKELFDLIYEKSKLKQEFENDEDSSKRLNVEEVGNLLVQFK
FT                   PKDEILPDYIDGSGDVEEEESVDDRNFLARFIESVGLYETNDEVENNKSDSNGNDKAKE
FT                   EKSCISLSTIHGSKGLEWPVVFVQGLSEGLLPAGFSMRNSFNDNDENLNEERRCFYVAV
FT                   TRTKVLLYISSYTESQSKAFYRQALDQESRFIEPLKKSLAHSQLAFSEEKNLRALYELL
FT                   SKPFPTENLDWTQFYETYKKSFRRFASGEPMVFSVGTEDKPAKSMNNFGFSSAQSLMND
FT                   FSNVQSIKNSTHNKNNNVGPIISNSKNVKRAPPYIPERRLKKPKKIM"
FT   CDS_pept        1126645..1128492
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079115"
FT                   /orf_name="CD36_84990"
FT                   /product="Uncharacterized protein yhr151c homologue,
FT                   putative"
FT                   /protein_id="CAX43002.1"
FT                   /db_xref="HOGENOM:HBG396740"
FT                   /db_xref="UniParc:UPI000192DD57"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE91"
FT                   /transl_table=12
FT                   /translation="MIGLLFVFSVLLSFSVGYIFPFSTSNGPTVNDTLQHAIRSQRDVS
FT                   KPIPIDRVEFSGVSLSSFFESEGYSSDSLSNLYGLLKENIAGVMIDLYWNEFTSKWQLC
FT                   PAPFPNNITYTSSNRVVDVSWNNRTYKCDPNLSTDDIMSILNNFIRDTNTDVEANFMHV
FT                   MYNLKSIHYKKSNQTINLENAYKEKNSNFNVGMDTLNDTVSLLSSYIFTPLLLEQYQSS
FT                   SSKNANSSSSIRYIDSLNETQAIQKFYNQSTILMPSLQTTLLTQYKRLMVHVISNDMAE
FT                   SSRSYQISFSDKETIFFNNVFPAMIGHTNNASADDFCYELTHAYNGTDVNIMEFNRVSL
FT                   NSTLRLIIDNDKTPFTTDSLSKYVRCGYCPVFNSTQYSSQKVTEGNSSIISQEFTSNLF
FT                   WSWAPGQPSGPDNCTNCTRPVTNYTSKYSEASNGGSDEEEHSNNIAYKCVALTENGWEV
FT                   SNCYEKYLFACQNKLSRNEWKLDNYTKRNYFDLDDDDCPEGYFFSLPRSNIEMLSLMTT
FT                   VKQENVSYPIWIDLNDITVENCFVSGGPYAQCPYQETVTTDKFVRMIAPSFVVAMVVLV
FT                   LIFLEKVFRKTPIQTNRKRYWKKAIQEYYAKNDYEGVPS"
FT   CDS_pept        1128710..1129621
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230471"
FT                   /orf_name="CD36_85000"
FT                   /product="Subunit of the prohibitin complex, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX43003.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG680510"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniParc:UPI000192DD58"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE92"
FT                   /transl_table=12
FT                   /translation="MNDQNWKNLSNELRRRAEQARSSSNMKSPKSPLGIFGGIGGLLLL
FT                   GGATMFIQNALFNVDGGQRAILYSRLDGVQSKIYPEGTHFVIPWFQRPIIYDVRAKPKE
FT                   LASLTGTKDLQMVNITCRVLYKPDIWQLPTIYRTLGLKYEEKVLPSIVNEVLKSVVAQF
FT                   NASQLITQREKVSRLVRENLVRRASKFNILLDDVSITYMTFSPEFSQAVEAKQIAQQDA
FT                   QRAAFIVDKAIQEKQQLVVKAQGEAKSAELIGEAIKKSKDYVELKRLDTAREIANILAA
FT                   SPNRIILDNDTLLLNTVTDNRK"
FT   CDS_pept        complement(1129718..1132582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230472"
FT                   /orf_name="CD36_85010"
FT                   /product="Autophagy-related protein, putative "
FT                   /protein_id="CAX43004.1"
FT                   /db_xref="HOGENOM:HBG447720"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniParc:UPI000192DD59"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE93"
FT                   /transl_table=12
FT                   /translation="MSSSSYNPYKDNINDRLINNSTDSFQDNYQGIPNNNDTFLSRIFG
FT                   LNSIYNQLQDNYQYYDPEFDSSLNQQLQKSIQEEDDADAEDESLLPQSQQQVAAVDMAM
FT                   QDKSTKQKSKSSSLLNSDSDSDLSSSEDSYVRPNIPKIPSTPIETDKQGSSSKIKFSIP
FT                   QRAKNLVGKFQPHHEPTLPVYQTPQQFRRNLPQQQQQQQQQRASATGNNNYQRTRNNNR
FT                   KFIIPPKERALYLWANITNMDEFLSDVYYYYRGKGLLNIVLSRGFDLIILIFILIFTVF
FT                   LKWGIDYSIFFDNLHQEESKHITLNDMIIPNYFATIPLSIKFILFGFSIYILLRSVQLY
FT                   LDYNYKLKELKNFYHYLLDVTDDELMTISWKTIVEKLMLLKDYNILTSTATKSNNFSDN
FT                   HYVNDLSSKVRLNAHDIANRIMRRENYMIALINKDILDLSVLFMNEKSLLTKTLEWNLK
FT                   LCIDNFIYNQQGQINGKILKEYNRNQLARELTSRFKLAAIINLILSPFIVIYFVLLYFF
FT                   RYFNEYKSNPASILGLRQYTPYAEWKLREYNELSHLFNKRLIMSMGPANTYIDQFPKGF
FT                   LVVNLMRLINFISGSILAVLVIMGILLEDENHSFWSFEITDGRSALFYISIFGTIWAIT
FT                   ASSATGTTHESTISTTSQSSNSNSNSNAASTFVYDPEASLRYVAQFTHYLPSSWNKKLH
FT                   TIQVKNEFCQLYCLKIIIIINEILSSVLTPFILWFKISHNSGNIIDFYREYSIHVDGLG
FT                   YVCYFAMFNFEEKDKNMMNDLNKSKKRTRKKLRMNKHGKKTIINPIQSQKINNNNNEIE
FT                   MTKISKSDSEKSSDDDNDNESTYGTDEELDYLSYKKDDKMIKSYMYFLESYGGSKQQQP
FT                   QQQQQQNQTVNGLRNRNPIQPIDPTIMTGNYYDQQSLNSSIYNINYKFDDSGLLQDETL
FT                   NSSSRKKGGVFGMLNQFYKQDINR"
FT   CDS_pept        1134990..1135871
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17576700"
FT                   /orf_name="CD36_85020"
FT                   /product="Zinc-finger transcription factor, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX43005.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DD5A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE94"
FT                   /transl_table=12
FT                   /translation="MSLPMSPVSPINTSTPSSTTKTKTTTPPSPPSSIEHSSHPLTSSI
FT                   SNNSIASDSSLDSDTSATSTTTNYGTKTPSGNARIFNCKLCQRAFTREEHLTRHTLSTH
FT                   NKLKPFTCGICSRPFSRRDLLLRHAKNLHQGSEVAVSRIRKSYKHCNKDNDSKNSSDSN
FT                   SISNKTTKYGKKQEVEEDEEEEVKSDTSSGADDEDSNSSNGGGSNYHAISNGNKRFVNN
FT                   NPQLKRNMTNGSASSTTNTTINTTIPISTNNNTTSISKSSSSHIRQRPLNVEDYDTPEK
FT                   KRLKMSVNMLVS"
FT   CDS_pept        1137268..1138599
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230473"
FT                   /orf_name="CD36_85030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX43006.1"
FT                   /db_xref="HOGENOM:HBG396741"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniParc:UPI000192DD5B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE95"
FT                   /transl_table=12
FT                   /translation="MKPLFTYQIPDSPYWYIVITDTSHHFYFNNQDKSSYWQLSDIQNH
FT                   YKNGIDIQQQLIKSINFDELAILFAKSRGAQFEIIYDKAEEIQGDVDQQQNEQKQAVEE
FT                   EEEEEIVVENIPSKVNTRKQEEKEQPKVKQTNSIIQGYLSSDEEEEEEDNKETDQEQEA
FT                   SQSIHIDELTSQALAQHQKSTGIESDEDGDNDNGSLDLSLSEPENPETDTSSAEQDFIN
FT                   LLNQFVRRISIYESWDLVEEELLQEFTTYPEFYAISSKSERQKVFQKWCTQQEQQKSSQ
FT                   PDIEEGGVFPTVKLNYLIFLQDFKQEIKQSFYQSFYNSHYQQLNGFNLSSSIKETIFRN
FT                   YKLMLNDFTEFAKKYKKLNVGDNRNLKVMKLNEFLQNKLHGDINNTVNSGSFIVDSKLS
FT                   NLENWINLLNQYDIPTNIAENEINFLVGDEKRLNSYIDQLRTTK"
FT   CDS_pept        1138655..1139977
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383343"
FT                   /orf_name="CD36_85040"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase,
FT                   putative"
FT                   /EC_number="2.3.1.41"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX43007.1"
FT                   /db_xref="GO:0004315"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG757733"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI000192DD5C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WE96"
FT                   /transl_table=12
FT                   /translation="MTRVVVTGMGMISPLGVGLSHNWKQLIANKSGLISTTTLADYESA
FT                   GWDKIPSKVIGKVPHGSISEGNWQVGDHLPANEARRMATFSHYALASTQEALTDAQLLT
FT                   NNNTLNMDTYKIGVAVGSGIGSFEDIYNNSIAYNASGYKKVQPLFIPKLLNNMAAGNIS
FT                   IKYQTKGPLHSVSTACATGLQAIGDGFNFLKMGYAQAMICGGTESSIHPLALAGFARAR
FT                   SVVTDSEFNSNPTKASRPFDKSRNGFVLSEGCGILVLETLSHALERGVTPDQIYGEILG
FT                   YGVSGDAYHITAPHEDGTGAYSAMNQAIERSGIDPEQVDYVNAHATSTVIGDRAENNAM
FT                   MRLFNPQKTKVSSTKSSIGHLLGAAGAVESIFTLNAIKTGQVPATLNIDNVGQHEGDDQ
FT                   SQFKFDYVANKSISMDVNYAICNSFGFGGVNSSLCFAKYHN"
FT   CDS_pept        1140555..1141766
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383344"
FT                   /orf_name="CD36_85050"
FT                   /product="Zinc-binding dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX43008.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396743"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192DD5D"
FT