(data stored in ACNUC8465 zone)

HOGENOMDNA: CANDC_4

ID   CANDC_4; SV 1; linear; genomic DNA; GRV; FUN; 1641709 BP.
XX
AC   FM992691_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
DE   chromosome 4, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; mitosporic Saccharomycetales; Candida.
XX
RN   [1]
RX   PUBMED; 19745113.
RA   Jackson A.P., Gamble J.A., Yeomans T., Moran G.P., Saunders D., Harris
RA   D., Aslett M., Barrell J.F., Butler G., Citiulo F., Coleman D.C., de
RA   Groot P.W.J., Goodwin T.J., Quail M.A., McQuillan J., Munro C.A., Pain
RA   A., Poulter R.T., Rajandream M.A., Renauld H., Spiering M.J., Tivey A.,
RA   Gow N.A.R., Barrell B., Sullivan D.J., Berriman M.
RT   "Comparative genomics of the fungal pathogens Candida dubliniensis and
RT   Candida albicans.";
RL   Genome Res. 19:2231-2244(2009).
XX
CC   This Genome Reviews entry was created from entry FM992691.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641709
FT                   /organism="Candida dubliniensis"
FT                   /strain="CD36 = CBS 7987 = NCPF 3949 = NRRL Y-17841"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 4"
FT                   /db_xref="taxon:573826"
FT   CDS_pept        join(complement(6608..6694),complement(6088..6624),
FT                   complement(5496..6080),complement(5190..5336))
FT                   /pseudo
FT                   /gene_family="HOG000094271" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(8411..10039)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   mobile_element  complement(8433..10036)
FT                   /mobile_element_type="LINE:4A, Zorro1-like"
FT                   /note="partial ORF1 (subtelomeric)"
FT   CDS_pept        11961..14417
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579774"
FT                   /gene_name="CNH1"
FT                   /orf_name="CD36_40100"
FT                   /product="Na+/H+ antiporter, putative "
FT                   /function="sodium:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41897.1"
FT                   /db_xref="GO:0015385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397235"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniParc:UPI000192D6CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF78"
FT                   /transl_table=12
FT                   /translation="MAWSQLELEPPHIAYACVGIFSTLFSLVSLFVKERLYIGEATVAS
FT                   IAGLILGPHCLNWFDPVSWGNSDYITLEICRIVLCIQIVAVAVELPKKYMMKHWLSVTI
FT                   FLLPVMTCGWLIVGLFIWCLIPHFSFNDGLLVSACVTATDPVLAAAVVGKGKFAERVPG
FT                   HLRNLLSAESGCNDGMAFPFIFLSLNLIIHSGHAGEIVKDWFLLTILWECIFGCLLGTV
FT                   IGYVLRKLVAFAEKQNLIDRESFLAIFVFIAFISAGVGSMLGVDDLLVSFAAGTAFGWN
FT                   GAFAKKTEESHVSTVIDLLLNLSFFVYFGAIIPWPQFNNAELGLNVWRLVVLAFVIIFL
FT                   RRIPAVVALKPITPDVKTWREALFCGHFGPIGVGAIFASILARKDLEAHYTTEETPLHH
FT                   LPSKDFPHYQLLATIWPIVCFIVITSIIVHGSSVAVLTLGKRLNRMAITMSFTTDQEGG
FT                   GGGWMQRLQKLDRTTSSFSLHRVDTMAPQELQPETSGIKVCPAGGAKRKKKHGRIKSLS
FT                   RVATKDDEKRAPPEAQFLQLGSRTSEHETSTKESSSDNNLAVPNKTSGLSEYGEKQPTK
FT                   AEKAPVPTVAYQDGDQVIIEDQYGEVMETLKLTRKPKPESSSIHSMESLERHLTQYSTG
FT                   SSAGESDDENGLSPIHQKLSRTLSRRSYYKKDDPNKRKVYAHRVDDLIVIENEDGDIIR
FT                   RYKVNKHAPATRPRSSSIMGMMKSMVGIRPVESAPPEISVTDLEHGTQHKILLPDEENT
FT                   PAAAQKLEDKIANMLQEDHHHHPDHISEESDDDDDEEETEVEKKRRLQALGYLPSTRRD
FT                   REDEEE"
FT   CDS_pept        14490..15326
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579775"
FT                   /orf_name="CD36_40110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41898.1"
FT                   /db_xref="HOGENOM:HBG448378"
FT                   /db_xref="UniParc:UPI000192D6CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF79"
FT                   /transl_table=12
FT                   /translation="METNYSLALKQFINKNFAASFRLASELFHKCFTEYSGHSISLTLL
FT                   TKIINLYLVEVGVCLKDGLLNQVQANTAVNSITSNEVINQIHAVFGDEIPCEILYNYHL
FT                   MHITNSKLLINDNYWDQLRNDYHHAINDKYKQKFIELVVFEILPRYDKYKEAEQLITNP
FT                   NDLQRLRKIQEKQKLAEEVERSQKKTPPKEQPTLKYKSIKEIQNAYNLEEAKKPTLPES
FT                   RLLYIYNLVKNYLRDNYLVVLVLIILGLGARKYLNRANLREKIVDTIKMAFKFSYI"
FT   CDS_pept        15338..15991
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579776"
FT                   /orf_name="CD36_40120"
FT                   /product="Cation transport regulator-like protein, putative"
FT                   /protein_id="CAX41899.1"
FT                   /db_xref="HOGENOM:HBG522249"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI000192D6CF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF80"
FT                   /transl_table=12
FT                   /translation="MTHPQGMWIIGYGSLIFKPPPHVSLKVTGYLKGFIRRFWQSSIDH
FT                   RGTPEYPGRVVTLLSLDDLHSNNKFHDEWVSPEDLRVYGVAYYIEPQHVEEVKQYLDIR
FT                   EQNGYTSHKVAFYVSDKSVSMFTDKEGDYIESNIYIGKVDNEAFVGPESLEETAHVIRK
FT                   AVGPSGLNIDYLTNLVHSIKDFGIRDHYLENLYTLASSSPDNSTSPIPKPAPPY"
FT   CDS_pept        complement(15933..18338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231267"
FT                   /orf_name="CD36_40130"
FT                   /product="Uncharacterized protein Tre1 homologue, putative "
FT                   /function="receptor activity"
FT                   /protein_id="CAX41900.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="HOGENOM:HBG397234"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="UniParc:UPI000192D6D0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF81"
FT                   /transl_table=12
FT                   /translation="MATMTSSSHSGYQRLDNAASSSTTMPMYPPDYNDLHIEQFEIEDP
FT                   QTPASGILDRAHKFASNFNTRILRPVTRIIDPIYEGYKYFQMQYERSILKLGNPLVVKR
FT                   LLYVSFVMVIVFGITKYSDNDSISGASVGAFTRGRFYDIEKVGESITHFIDPKEMKEHL
FT                   EYFSSIPHITGTKGDLALAKYVQSFFKNNGLHHVELTELESFTNYPDKANTYLRLKDSS
FT                   FEAALFEQHNEGMEFLAFNPNSLNTDKPIEGGYVYVNYGESGDYKKVIEGGVEVKDKIV
FT                   LVKYGGKTPEPNKVYIAEQHHAKAVVFITEKYTVSGQEVDDVIQRENVGLTRMSPGDIL
FT                   TPGWSSENMYVTRLAWDKSETTPKIPSIPVSWKDGEALLRKLSGGIDFDGYKSGDGKSP
FT                   ALQLSINNIDRPMHQVWNVAGSIEGREQNEKGVIIGAARDSGCYGTLGSNTGTVALLEM
FT                   VKIFTSMQRKYSWTPSRSIFFVSFDATEYNLAGAAEWIENRREALRKEGYVYIDLSDLV
FT                   AGDKLSINANPFLHEVISNCLQKVKTGDGPEDTLYHLAKKQNGDRVVMRNDFLETKNYV
FT                   PFINYVNIPSMEVKFTGERYPHNSCFDSFDNFETSGVDPKMAKHAQMVELLSRIVLEFA
FT                   ESPLIPYNFRDFTRSLEMLEQDLERYAEQNGQPVLHFDGLKRALNSLKSVSESYQEWAR
FT                   EWKQFIHESGGMEPTIHTMSRWRWNDNMVEFNGQFLTREIQRKRAGYKNILFGVPFIAP
FT                   TTRDEFDWNSFPFVRHYISQNDYGSAQNEINKVASVLESAALNYRDLS"
FT   CDS_pept        complement(18405..19637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000042598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384100"
FT                   /orf_name="CD36_40140"
FT                   /product="1,4-butanediol diacrylate esterase, putative "
FT                   /protein_id="CAX41901.1"
FT                   /db_xref="HOGENOM:HBG734622"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI000192D6D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF82"
FT                   /transl_table=12
FT                   /translation="MFTSKLADTLDGVLTDITTFNGDSTPQLVAPGCTLGVTDRDSTVY
FT                   LNSKGVKNIEDPQPVTNNDSYAFFSCTKSMTVMGALILYEQGKLQLDVPVARYFPEIAN
FT                   IGVLEPGAVDKYSGKLLKPLTTPQTPITAKHLITHTAGFSYGFISPDYFALITKGERID
FT                   AINPPMEFFHKKTPLIHEPGTDWAYGHNIDWLGFVLERISGQKLGEFLAKYVFEPIGMS
FT                   SCTFHKKEASDLVRLHFRKSDETLVLLKKSPISLDPILDLGGQGCFGSVGDYLKFIRVW
FT                   LNYGVSPDSGKRILNESTVKFAIRNHLPEDFEFDFIGLSHNVLDEDERKNDGWTLTGNA
FT                   YGSNDLPTGRPKGANYWSGVANLHFWIDFDNGIGGFYAVQVLPFMDEYNIESYARFESE
FT                   VYKDLRSQSKL"
FT   CDS_pept        join(19839..19952,20003..21316)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579777"
FT                   /orf_name="CD36_40150"
FT                   /product="1,3-beta-glucanosyltransferase, putative "
FT                   /function="cation binding"
FT                   /function="transferase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41902.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192D6D2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF83"
FT                   /transl_table=12
FT                   /translation="MLQYTILIFLIFIEYCTANIHPIIIHGHYFIDSITKEPFYIKGID
FT                   YQPGGSSAVSETTDPLSDPAKCARDIILFQELGVNTIRIYSINAHLNHDKCMTMLAKAG
FT                   IYLFLDVNSPLPHHHLNRYEPWNSYNLYYFENVFKVVEQFSHYNNTLGFIAGNEIVNDP
FT                   ISASVAAPYVKAVVREIKSYIEYNAPRTIPVGYSAADDLNYRMPLAQYLECGDDNPKES
FT                   VDFYGVNSYQWCGDQTFYSSGYNILVNDYKHFTKPMFFSEYGCNEVLPRNFDEVPVLYT
FT                   NDMIDVFSGGLVYEFTQEPNNYGLVKILSNGDVKVLRDFIQLKNKFDTLPELDYNYIIQ
FT                   SMKENANNIQTKLKNFKTSIPKCELSYPNLDISKGVPPSIAQTLIETGVDARRGEYVSL
FT                   SNDDITTKYQFFQESGEKLNIVNRIETLADEEAPLENRQEPVEAPPELPPPTTNPFVDF
FT                   IHKVLDPFKTFCANLFN"
FT   CDS_pept        complement(21313..22665)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384101"
FT                   /orf_name="CD36_40160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41903.1"
FT                   /db_xref="HOGENOM:HBG397232"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000192D6D3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF84"
FT                   /transl_table=12
FT                   /translation="MLKYQLIGKKGRFFSKKKVHEYPLKHLHSLPLEILLEVFRHFVDD
FT                   YQTLRSVALCCKKFNHIVNKHLLYNSIVFRNPKKFYQFATIHLLADISNKINFLNTIEF
FT                   INPQIKDSENTKLNIAGSYAVESKVRAMDQLNYTEFILSLSNLFTHAFGLKCVIFSEIS
FT                   PSFGFPMEYKSSSSNIFKRRTPKTKNRRLRKLVLKTQSGWSIPFRNTHLSLIAEYFDVV
FT                   DELCLVNFIIDNPITLKDLRINKLHFESCIYPFKKGTKRECPIFANVSELELSKIANST
FT                   ELSLIDLVKVKNEVLHYLTLDIGSNIFYSNSEFKFGKYNPFFQLLCSGIGGYSRLDTLK
FT                   LTNFELFDYLRHDDVHKDVDSWIEPPTDNFETFMEYTSQIAHLIIVLRKFPSRVKTCVK
FT                   CGFKEQQSDKNIESLTYDEWKIFLSPLELNPKNTLQIFRHDYRLLYTKSRY"
FT   CDS_pept        complement(22892..24559)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079898"
FT                   /orf_name="CD36_40170"
FT                   /product="Ferric reductase transmembrane component,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41904.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397230"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000192D788"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF85"
FT                   /transl_table=12
FT                   /translation="MAIPFDQQFFVEKERNNKYEWLIFILTFIVLAGHGILFYWIPRYL
FT                   RVNNKRNNIYFRLLKVWDVWTSCVRVRGDIYFQPSLVLLAIVFIGLNVGFCFAEINDLD
FT                   YQSRFYIISKRLSKVAVGNLPILLFSVMKNDLLTSITGLQHDRLEFIHKWLSRLMWVMI
FT                   TIHMGMAIYYWLNLNFKIMIIIPPQIFGFIAYGSFSILNWASLRFIRQFAYDFFLVQHR
FT                   VFAFMMLFFTFIHNQGNRAVVLISVHGLVIDRVVSKVFAHIHAKKSPTKGRCTFRIIDD
FT                   STISVEIPVSEAEYVSKSWYTRFLPKYKTWKAGQHVYLNVGKIKFFQYHPFTIASLAES
FT                   GKMRLLVRVQRGFTRKLMRHLEQVDHDEVTIKAMFHGPYGARYQPLITFDTCLFFAAGS
FT                   GGAFTFPVCLDLLNQIDRRNQDGDVLFRPKSQFIKFVWVIKKQDNIEWFEDLLKQFAGR
FT                   CAVDIYITQESKEELPLERKNSVIELTKSLTNDYNILYGRPQVQEIIKQHSQQLSSNQS
FT                   MAVTSCGSPSFTNSIKHHCQSARRMKGSPEVYCYTESF"
FT   CDS_pept        24924..25583
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579778"
FT                   /orf_name="CD36_40180"
FT                   /product="Glycosyl-phosphatidylinositol protein, putative "
FT                   /protein_id="CAX41905.1"
FT                   /db_xref="HOGENOM:HBG397070"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniParc:UPI000192D789"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF86"
FT                   /transl_table=12
FT                   /translation="MHFIFYLILLVSAADYGNFGTYPKVPKTASINGFADPIYDLLPNC
FT                   AKECVKFSTSNTPCPYWDTGCFCVMPQWAGLVGQCVAQKCKGEDVASARFLATSLCSVV
FT                   GANTWMMPASISSMLSTAAGDAKEVTTIEGKTAKSWVTAPGSAAGSSVSETGAASETGS
FT                   SESAKSTTSDASSSSSSTASSSATTSSSPSSSANFAVLQTGGIGSVILGFMMYFLV"
FT   CDS_pept        26916..27635
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536883"
FT                   /orf_name="CD36_40190"
FT                   /product="Glycosyl-phosphatidylinositol protein "
FT                   /protein_id="CAX41906.1"
FT                   /db_xref="HOGENOM:HBG397070"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="InterPro:IPR014005"
FT                   /db_xref="UniParc:UPI000192D78A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF87"
FT                   /transl_table=12
FT                   /translation="MLSLSLLSIISIALAADITAIPEGDNPYTVFPSVAKTASINGFAD
FT                   RIYDQLPECAKECVKQSTSNTPCPYWDTGCLCVMPQFGGAVGNCVAKNCKGKDVGSVES
FT                   LATSLCSAAGVWEPYWMIPSSVSDALAKAGEAAAETTAETTTAETTAESTTAQETTAQE
FT                   TTAAETSKAAESSAPAETSKAEETSKAAETTKAEESSVAQSSSATGVASVSVETANAGN
FT                   MPAVAIGGVIAAVAALI"
FT   CDS_pept        complement(28091..29533)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579779"
FT                   /orf_name="CD36_40490"
FT                   /product="Ammonium transporter, putative "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41907.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI000192D78B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF88"
FT                   /transl_table=12
FT                   /translation="MSGNFTETGTGGDVFKVDLNEQFDRADMVWIGTASVLVWIMIPGV
FT                   GLLYSGISRKKHALSLMWAALMAACVAAFQWFWWGYSLVFAHNGSVFLGTLQNFCLKDV
FT                   LGAPSIVKTVPDILFCLYQGMFAAVTAILMAGAGCERARLGPMMVFLFIWLTIVYCPIA
FT                   YWTWGGNGWLVNLGALDFAGGGPVHENSGFAALAYSLWLGKRHDPVAKGKVPKYKPHSV
FT                   SSIVMGTIFLWFGWYGFNGGSTGNSSMRSWYACVNTNLAAATGGLTWMFVDWFRTGGKW
FT                   STVGLCMGAIAGLVGITPAAGYVPVYTSIIFGIVPAIICNFAVDIKDLLQIDDGMDVWA
FT                   LHGVGGFVGNFMTGLFAADYVAMIDGTEIDGGWINHHWKQLGYQLAGSCAVAAWSFTVT
FT                   SIILLAMDRIPFLRIRLHEDEEMLGTDLAQIGEYAYYADEDPETNPYVLEPIRSTNISQ
FT                   PLPHIDGVADGSSNNESGEAKN"
FT   CDS_pept        complement(29808..32315)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000243914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231268"
FT                   /gene_name="HIS4"
FT                   /orf_name="CD36_40210"
FT                   /product="Putative uncharacterized protein "
FT                   /function="NAD or NADH binding"
FT                   /function="histidinol dehydrogenase activity"
FT                   /function="phosphoribosyl-AMP cyclohydrolase activity "
FT                   /function="phosphoribosyl-ATP diphosphatase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="histidine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41908.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004399"
FT                   /db_xref="GO:0004635"
FT                   /db_xref="GO:0004636"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG329596"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016298"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniParc:UPI000192D78C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF89"
FT                   /transl_table=12
FT                   /translation="MTFPVLPVISSPEDRESINEFSLVGQVIFPIESVSIKKHFIHQFP
FT                   HDVDIFVNAIDNASIDQIVELLNVGIKQVFVNETQYREAIEAGLPSARFVVSVDVPSAE
FT                   LVASEASFVVTKPFPEGNLKEYNANENRVLYIKSDFTQDEAIELAKNYIPVIPSSKLSV
FT                   KREEKNKISISAVFVSTLTTDRPDGLYTTLITTPSPSYTALGIVYSSKDSIVAAIEEKV
FT                   GVYQSRKRRDELWYKGKTSGATQKLVKLSKDCDSDVIQFMVEPRTGYGFCHRETKFTCF
FT                   GDDMADSPARGLPKLDSTLQDRLENAPEGSYTKRLFDDEKLLIAKLKEELDELIEAKSK
FT                   EEIAWECADLVYFAMVWCIKHGVRLADVEKNLDVKSLKVSRRKGDAKPKYQEPTTNSSY
FT                   KLEIVSIDDAAAVERAMTRPVQKTADIMKLVLPIIEKVKSDGDKALIELTSKFDGVKLD
FT                   TPVLQAPFPAESMDISEEMKAAIDLSMQNIEKFHAAQLPKEKVMTVETCPGVFCSRFAK
FT                   PIENVGLYVPGGTAVLPSTAMMLGVPAKVAGCKNIIIASPPSRATGKLTPEVVYVAHKL
FT                   GAKCIVMAGGAQAVTAMAYGTESVLKCDKILGPGNQFVTAAKMYVQNDTQALCSIDMPA
FT                   GPSEVLVIADCNADADFVASDLLSQAEHGVDSQVILIGVGLSDEKLNEFQNAVEKQAQV
FT                   LPRKEIVAKCLAHSYILLAKTYQEAFDLSNQYAPEHLILQIDDAPSYVPDMIENAGSVF
FT                   VGALSPESCGDYSSGTNHTLPTYGYARQYSGVNTATFQKFITSQEVTEDGLKNIGKAVM
FT                   ELARVEGLEAHRRAVEIRMDRIT"
FT   CDS_pept        complement(32492..34285)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079899"
FT                   /orf_name="CD36_40220"
FT                   /product="Peroxisomal targeting signal receptor, putative "
FT                   /function="binding"
FT                   /function="receptor activity"
FT                   /protein_id="CAX41909.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG505494"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192D78D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF90"
FT                   /transl_table=12
FT                   /translation="MSFVGGGSECSVNGNAVAQFNKHAQQDRSLQQQVANQHGNLAQNQ
FT                   GFKKDNLMNVRDRANLDQFMNNGAPQNSFQFQPMRHELNAIQNQPNPIHQQQNNWSQDF
FT                   VAQSPSAQIATPIAKTGSPVNAQWANEFSQVSSTTQPQQHNQRPGQFGPRLGGYRPMMG
FT                   MSMAYQSQPQQQQQHAQTQNQEQQVDWENQFKEIEELTNKAEEVEEIQREQSPEIVVDD
FT                   KYQATFQEVWDSLNSEAFENDFINQQYEDFKRTQKDGYPADMNQWEKDFAKYASTRAHF
FT                   GDYQFEDKQSNQFLDLPKDQDPYEIGLQLMENGAKLSEAALAFEAAIQRNENHVDAWLK
FT                   LGEVQTQNEKEIAGISALEKCLELHPENSEALMNLAISYINEGYDNAAFATLERWISTK
FT                   YPQIVEKARQENPTITDEDRFSLNKRVTELFLKAAQLSPNQASMDADVQMGLGVLFYAN
FT                   EEFDKTIDCFKAALSIRPDDAILWNRLGASLANSNRSEEAVDAYFKALQLKPTFVRARY
FT                   NLGVSCINIGCYKEAAEHLLSGLSMHQVEGVDTVSTLNHNQSTSLTETLKRAFIAMERR
FT                   DLLELVKPNMDLNQFRGEFSF"
FT   CDS_pept        complement(34546..35856)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579780"
FT                   /orf_name="CD36_40230"
FT                   /product="Ornithine aminotransferase, putative "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="CAX41910.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D78E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF91"
FT                   /transl_table=12
FT                   /translation="MSSTPDFKVSSETAREYETKYSAHNYHPLPVVFSKAEGAHVWDPE
FT                   GKEYLDFLSAYSAVNQGHCHPKIVAALVDQASKLTLCSRAFSSDVFGVYAKYITEYFNY
FT                   EMVLPMNTGAEAVETGLKLARKWGYDKKGIPSGEAIILSAVNNFHGRTLGVISMSTDPD
FT                   ATTNFGPYLKGVGPQIPGEPEGTLLRYGVIEDVEKAFANAGDKIAAILLEPIQGEAGIV
FT                   VPPEDYLPRVQELCKKHNVLLICDEIQTGIARTGKMLCYEHSKGVKPDIVLLGKAISGG
FT                   VMPVSAVLSSKEVMLTLEPGSHGSTYGGNPLACRVAIAALDVVRDENLVERAQKLGTLL
FT                   REKLEELQKESNGMISEVRGKGLLSAIVIDESKTNGRTAWDLCLLMKNHGVLAKPTHDN
FT                   IIRLAPPLVISEEDLLKGVDSIRKSLKELPNVAKTEH"
FT   CDS_pept        36204..36611
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579781"
FT                   /orf_name="CD36_40240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41911.1"
FT                   /db_xref="HOGENOM:HBG397228"
FT                   /db_xref="InterPro:IPR013900"
FT                   /db_xref="UniParc:UPI000192D78F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF92"
FT                   /transl_table=12
FT                   /translation="MMQPRVKRHMQNAIQPVENINEDAASLPSVAMRIRKAVSEGYKLP
FT                   GDNTQQFGGSFQRVPLPSGLTAPPDLVNGESTRTVSNLEEWDSYYKIQNAPLQTLSEGN
FT                   NYLKRKFEDDHDLDLSQYQAKYGDLKFNEEF"
FT   CDS_pept        36896..38425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579782"
FT                   /orf_name="CD36_40250"
FT                   /product="Extracellular matrix protein, putative "
FT                   /protein_id="CAX41912.1"
FT                   /db_xref="HOGENOM:HBG398508"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI000192D790"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF93"
FT                   /transl_table=12
FT                   /translation="MLLWRNLVYNIALPFKNLNKEDRIIQLCRLFTCVLAIVCCLVCIV
FT                   APRVTNTTYAARINCAHLDVANGLYESLRNSVTQVFSPAIFNDQMSGTGNSLTNSEIRL
FT                   ITEYAETQVAGSPQYCISSLWTWCYGNYETYTVVDKHGKVLTKKKNEVLTCTDKSSYVF
FT                   DYINQLESIGLEIILAYAYQSSTFATTSYEKLVSSRNAKFQFAFNGIIFTCCAQFVILL
FT                   CIFVIYSNRGSSRDLSKIPALVLHVVTLISLASSLSIIIGSAMITNLFIITRNEIKSKL
FT                   GDFGVTFHMGSKWFSFLSLSAVFATLSSVSWVFPMWCANPSISLTDRDDEASFYEVPTR
FT                   RNNMEEFSRQADFQTRRFKSSEHNGGHGRTKIGNIFHNPRHAVHQDDHHEEEMRKLGES
FT                   LSKKSSVRRTKSLGARKAELEEQGILLDNFAFKEDYPTIQEETYDGYSSRSVSRSASDK
FT                   VTRKVSDKRQRHLIKSPFDEEDKMDGISPRNSYLEDDELQLLDNQMFNLKK"
FT   CDS_pept        38493..39410
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579783"
FT                   /orf_name="CD36_40260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41913.1"
FT                   /db_xref="HOGENOM:HBG397227"
FT                   /db_xref="UniParc:UPI000192D791"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF94"
FT                   /transl_table=12
FT                   /translation="MNKEEIYIIRPTRSKLLIVWSVIEVGFTSLLFATSFFFLFANSKV
FT                   IQRGPPAFQLRIQSDSIFAKNTFQLIQQGLKFATYLSNDLNIYINETIPETYLQQIDSN
FT                   YDNSLYSFNIFGFCRLTQFNKILNCYNGQGINIAACFLQDIGTQLGNLTNQSDPSNVSA
FT                   KLVSFYYNLVDQICSDTQKEMCILQTYNTMSRIVQYLAFSSLVCLAITTVTALFEMVCY
FT                   CIFARSLIRVFFIVKVVCMLGFVFTMCIVYCLIMVMRNFLTDLITQFQIGTLEFPTIKW
FT                   ITWCVLTLMCLIIVVKRYLIYQSI"
FT   CDS_pept        complement(39407..40729)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231269"
FT                   /gene_name="MET15"
FT                   /orf_name="CD36_40270"
FT                   /product="O-acetylhomoserine o-acetylserine sulphydrylase,
FT                   putative"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAX41914.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D792"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF95"
FT                   /transl_table=12
FT                   /translation="MPSHFDTLQLHAGQPVEKPHQPRAPPIYATTSYVFNDSKHGAQLF
FT                   GLETPGYIYSRIMNPTNDVFEQRIAALEGGIGALATSSGQSAQFLAIAGLAHAGDNIIS
FT                   TSYLYGGTYNQFKVAFKRLGIETKFVNGDAAEDFAKLIDDKTKAIYLETIGNPKYNVPD
FT                   FEKITKLAHEHGIPVVVDNTFGAGGFLVNPIAHGADIVVHSATKWIGGHGTTIAGVIVD
FT                   SGNFPWTEYPEKYPQFSKPSEGYHGLVLSDALGKAAYIGHLRIELLRDLGPALNPFGSF
FT                   LLLQGLETLSLRVERQSENALKLAQWLEKNPNVESVSYLGLPSHESHELSKKYLNNDAK
FT                   YFGGALAFTVKDISNSSTDPFNEASPKLVDNLEVASNLANVGDSKTLVIAPWFTTHQQL
FT                   SDEEKLASGVTKGLIRVSIGTEFIDDIINDFEQAFKKVYNN"
FT   CDS_pept        41388..42083
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079900"
FT                   /orf_name="CD36_40280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41915.1"
FT                   /db_xref="HOGENOM:HBG397226"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniParc:UPI000192D793"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF96"
FT                   /transl_table=12
FT                   /translation="MPKQYQCNGITTRGVRCKIKCNSPNSYCRHHENQANVHHNNNNHK
FT                   TQSNDTGYIYMYTMTNFLFPPKHWTFKVKNLPDASKKTDWVDFNSRKSHYILIKIGRTT
FT                   KTPESRIQQWQEKCQHPLTNVGPPNKHLIKKRRELVERLACMSIGDSAYTRWKNGGFYC
FT                   RNLNLVESTIHNELWKKYGKGQVYCPTCVADECRSEAKFKIHMEWFLIPKEDIEKVYHL
FT                   INTVCMKIG"
FT   CDS_pept        join(complement(43330..43552),complement(42185..43263))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579784"
FT                   /orf_name="CD36_40290"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41916.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D794"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF97"
FT                   /transl_table=12
FT                   /translation="MSHEGQEELLDYSDSEEIAVSTTTQASGEGQSNDKESDKKGSYVG
FT                   IHATGFRDFLLKPELLRAIGDCGFEHPSEVQQVCIPQSILGTDVLCQAKSGLGKTAVFV
FT                   LSTLQQLDPVPGEISTLVICHTRELAYQIRNEYARFSKYMPDVKTDVFYGGTPIKRDIE
FT                   KLKNKDTCPHIVVATPGRLHALVEEKAIRLNNVKSFVIDECDKVLESIDMRRDVQDIFR
FT                   ATPHQKQVMMFSATLSQDIRPVCKKFMQNPLEIYVDDEAKLTLHGLQQYYIKLDEKEKN
FT                   RKLSDLLDSLEFNQVIIFVKSTRRANELNKLLCACNFPSIAVHSGLPQEERIERYRSFK
FT                   EFNKRICVSTDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGLAVSFVSS
FT                   KEDEEVLEKIQSRFDVKITEFPEEGVDPSTYMNT"
FT   CDS_pept        43828..44208
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579785"
FT                   /orf_name="CD36_40300"
FT                   /product="mRNA export receptor, putative "
FT                   /function="receptor activity"
FT                   /protein_id="CAX41917.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="UniParc:UPI000192D795"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF98"
FT                   /transl_table=12
FT                   /translation="MFRIGTRVPRILPYRQFTTTPTLRFFDKGPTAEEQAQALAKVSKV
FT                   VAENPELYKLMVEFKQLLEKKGFETGAKPSMTQMFKLLADKDIREQGAKFKHFLETTDT
FT                   GLTQNEIATVSGAFLFKNKDIK"
FT   CDS_pept        complement(44220..45044)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000230247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579786"
FT                   /orf_name="CD36_40310"
FT                   /product="Pyrroline-5-carboxylate reductase, putative "
FT                   /function="binding"
FT                   /function="pyrroline-5-carboxylate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="CAX41918.1"
FT                   /db_xref="GO:0004735"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG726602"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D796"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF99"
FT                   /transl_table=12
FT                   /translation="MKDYTITVLGCGVMGTAVTSAILKSKFDPYPKKIIACTIPSQEQS
FT                   LKETFANQPLVHVSAGVENNNKAVTEADVIILGCKPYMYESIYEEVKQSLTGKQLLISL
FT                   LAGTTIKELSIFTPYVAKVMTNTPARFGCGTAAIAFAPEVSEESQELVMKLIDTVGMTV
FT                   KIPEKNMDIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVASVAAAKVMEGTARMVLE
FT                   TGEHPAALKSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAKK"
FT   CDS_pept        45723..47906
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579787"
FT                   /orf_name="CD36_40320"
FT                   /product="JmjC domain-containing histone demethylase,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41919.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397223"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000192D85B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA0"
FT                   /transl_table=12
FT                   /translation="MSFDKSLLTPCPVLTPTDKEFRDPVGYLSSEKVSKLGATHGILKI
FT                   IPPPNWKPSFHINPDFKFHVRKQVLSDLGITTRSRDFFRENINRFLKMRRKRQLKLYFE
FT                   VHGTKVYYYDLYREVENLGGTMDQDKWQKLGVWFGVEASALEREYDSTIKYYATYLHTN
FT                   CSYDFPESDSEDEYDSCLVCGQHDHPSETLLCDNCDNPYHMKCLNPPLESVPATSWYCD
FT                   KCLIGTGEYGFDEDVDVKYTIPEFYKMCQDFDAKFIRDYSQNKPLSVDDIERKFWSFVD
FT                   EEKSDLEVKYGADIHNLRPGEISGFPMADTPSLDTSDPTIQYYINHPWNLNKLAFSSGS
FT                   LLNFINSSISGMTIPWIYIGSLLSTFCWHVEDHYTLSANYCHFGATKKWYGIPSSFADK
FT                   FEQLMRESAPDLFKRQPDLLHQLVTLMSPIKLVEHGIPCVYADQNPNEFVITYPRVYHA
FT                   GFNCGFNFNEAVNFAIDEWLEFGEKSVYDYRPIKKENVFNHYQLLENILSRFNEKHDVS
FT                   IDLVKRSLQSFEKFVSRLEELSVHLKDKATVEYKSSVGDNEEDDLCDSCKTHIGFQYFV
FT                   LEPEYSKQLLTPDASPQEVESKSDNAEEASKVANSQASHDLARLNEPKAMVDQFNSLIE
FT                   KAKKDVSKDESSKVRRSKRILSLKEKEALQQPTKRTKKNTKKVRSKPPINEPKLCTECV
FT                   CAMKSKSIHGTLVLRKSLSTLKELIEETKMNLV"
FT   CDS_pept        join(48279..48397,48819..50214)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079901"
FT                   /orf_name="CD36_40330"
FT                   /product="ATP synthase subunit beta, mitochondrial,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAX41920.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI000192D85C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA1"
FT                   /transl_table=12
FT                   /translation="MVLPRLFNATSRAAFRAVKRDVLFNSRTLATAAAAHGKVRAVIGA
FT                   VVDVQFDEGNLPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTEGLVRGTEVND
FT                   TGAPISVPVGRGTLGRIINVVGEPIDDRGPIECKEKKPIHAEPPSFVEQSTAAEILETG
FT                   IKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGND
FT                   LYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFI
FT                   DNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPA
FT                   DDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVATG
FT                   VQQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIQRFLSQPFAVAEVFTGIPGRLV
FT                   RLQDTVKSFKDVLEGKYDHLPENAFYMVGGIEDVVAKADKLAAESN"
FT   CDS_pept        join(50492..50509,50580..51899)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000257874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384102"
FT                   /orf_name="CD36_40340"
FT                   /product="CAAX prenyl protease, putative "
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41921.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG435738"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniParc:UPI000192D85D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA2"
FT                   /transl_table=12
FT                   /translation="MISLAESFAFLDSPSINWKTIIIGFTVGQYVFETYLDLRQYRVLQ
FT                   SKTAPKSIEKEVSQETFDKSQEYSRAKAQFSFFSSTFSLLQNLAILKYDLLPKTWTLAG
FT                   TIMKGCAAILPKAMSGVITQSLFFVFTTQILTTLIGLPLSYYKNFVLEERFGFNKQTIG
FT                   LWVSDMLKGIGISIVLGSPVIAGFLKIIEYFDDKFIFYLMGFILVVNLIAMTIVPTLIM
FT                   PLFNKFTPLEDGELKTAIEKLASEQKFPLTKLFVIDGSKRSSHSNAYFTGLPWSKQIVL
FT                   FDTLIEHNSTEETVAVLAHEIGHWKLNHLPKMITMMQGHLFLIFSLYSAFIHNKSLYTS
FT                   FGFIKQQPILIGFMLFNDIFQPVECLLTFVQNLISRKHEYEADKYASDCGYSEELSRSL
FT                   IKLSNENLSSMNADWLFSSYHYSHPILPERLSALGYVSKVKVKKDE"
FT   CDS_pept        join(complement(53007..53643),complement(52937..52940),
FT                   complement(52098..52761))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536884"
FT                   /orf_name="CD36_40350"
FT                   /product="Choline monooxygenase, putative "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="monooxygenase activity"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41922.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG332077"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000192D85E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA3"
FT                   /transl_table=12
FT                   /translation="MAPPTLTQSVPAAPPLDTPKMLVGEHTLPASWWTSESIFELEKRA
FT                   IFHKSWMFCTHSSRFAKAGDYYAFNLTGINFFIIKSKIDGQLKAFHNVCRHRAYPIVRK
FT                   DQGSSTVLGCKYHGWSYNSDGILRRAPHFDNVEGFVKEENSLFPINTHVTPQGLVFVNF
FT                   SSDPIPFDDWFSGLTSEMNEFDFSDYEYHMSYELDGKFNWKTLMDGYQECLHCPTTHPG
FT                   LNTAFKMETYKVVPKNRYCRHFAKIVRQEKKVEKQDSSSWFGFKKETKEVKETKSNPGG
FT                   EFDGLWVYLFPSNGINCYSPAWYSIRVLPITAKRTILQYDIYTKKGLEEDEKKEFVDFL
FT                   QQVELEDFDLCELTQKNLNERIYSTGYLHPEKERGVLYYQGVVRDMVKEHFALEQAADQ
FT                   SIDPASVGTNPKNGEVEELEGICKSLECGKETVDW"
FT   CDS_pept        complement(54087..57056)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536885"
FT                   /orf_name="CD36_40360"
FT                   /product="Subunit of the SWI/SNF chromatin remodeling
FT                   complex, putative"
FT                   /function="DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41923.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG397222"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="UniParc:UPI000192D85F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA4"
FT                   /transl_table=12
FT                   /translation="MSDWLNENAFADSNSNDDFLNSIFDQNQGEQQAPQAPQVSQVSTS
FT                   MTNPPVQSQSASSTSRIPQAHTPMYQQSPVIAHNIPQNSPQNMPSQMAQPQQQIPPPSQ
FT                   QATAQMLPQQQLKQQQQQQQQQQQKQEQLYRMKQQIYQQKMLKKQQENMSRQPSPMNSV
FT                   GQTPQQNTPINQNAKAPQNNSKLQSMQMELFFSVLYEFLQRSGIAIPQSLAINGKRVNL
FT                   FILYILSQRLGGYRVMKAFLLMSPEQQHMQQQNPWALMAEKMGFHDEGEDPMTKERIDR
FT                   ELCNCYSNFILPYEEYYATPEGNKDIEASKHRFQQQIVQKYSSNVPTPVPNQQSPMVSS
FT                   APTPHQQRKLSRTSNSVNNSPNVSSPFQNTPRQVPAPAPAPVQSSSMPPPTPVTATVKS
FT                   QITKADAHILKNYTPFKKIVETHGPYNIKELSQLSTEIEVTKPVYLFAPELGVINLQAL
FT                   TMSIKSNSGIQSSEVVNALNTLLVATSDVNYAFQIKDIMELLDALSSLGKDVLNRIVGA
FT                   NTEDDCVNSDVTKLSANGRIDDIFNRYVKGQGEDISYVVNSLTGEVVSEDEDIEELFSV
FT                   CEGGDAESPIEKLNESLDISEFHLDDYLTALKNFKLENKHHFSKLQTRSAVDDQILLID
FT                   ELITITMILRNISFAEYNKEPMAGNRLFKDLLFSIVKNVALSNEKFVFSRKRLCLLKDC
FT                   LLMLDNISLYTHLHTLEEAFLSFVLVASFGPKIEDQYKIPRCNIETHSYFAFGLDAFTK
FT                   LMVREPYNRSLIQAVLNGTLNASMTGYSVSLQDQEYTRKLIKAYNKDYKSASLLSQAFQ
FT                   MYMSILPFDANTFELSKFIFMRSPTISQMLFGAKLLIDMVPVDDLNTHHNRLSLYWLLE
FT                   NRELLLGNFARIVVALATETGKFPRESPEHKILSSVLCKALVVINSLVNNAVLAKEIGD
FT                   SRHTDLMESLTDCLAFPRIIPDTILTLDTFLAPTIDTNLGKEVVRLLRYLKDLKACEGI
FT                   "
FT   CDS_pept        complement(57268..58275)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384103"
FT                   /orf_name="CD36_40370"
FT                   /product="Alpha-1,6-mannosyltransferase, putative "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41924.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG397221"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="UniParc:UPI000192D860"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA5"
FT                   /transl_table=12
FT                   /translation="MSELPTDLEDTYSKTFKPNRKNAFEFSSVADFITKYKKIVLFIVT
FT                   FVCLSLFTNVPYIPHFKQAPPKVVIILAANEGGGVLKWKSPQEWSVERSSIANKKNYAK
FT                   VHGYGLTIKDMTIKKRYSHEWRESWEKVDILKQTMRQFPDTEWFWWLDLHTYIMEPQIS
FT                   LEKHFLNNLNNATYRTLDTFNPLNLPTDLPYVDYNQPIDMIITQDCGGFNLGSFLIRRS
FT                   EWSEMLLDIWWDPAMYEQMHMQWEHKEQDALETLYSTQAWIRERIAFLPLRQINAFPPG
FT                   ACSDQADDPQYFFQNHDFVVNMAGCEWGRDCWGEMEHYKALSKKLHKRWWKFWE"
FT   CDS_pept        join(complement(59421..59460),complement(58479..59347))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079902"
FT                   /orf_name="CD36_40380"
FT                   /product="Peroxisome assembly protein, putative "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAX41925.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG717253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D861"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA6"
FT                   /transl_table=12
FT                   /translation="MNKQLPFADAATIVRAHQKDAYFESSYRTQLQELFQFLKGQRFVN
FT                   AYPQEITVLAKAVYLSLTTLLGARTLGEEYVDLIYVNRTGNRLPRLLPRLGFIFSYALV
FT                   PYIISKIVKKLKNKEDDWVSEALSNYYKVLDTILNLHVALFYFKGEFYSLSKRLFGLRY
FT                   AFGHHKEPEKMQGRNYSLLGGIIVLQFIVKTLVGMKSKEQKQTEDIIDDAKIRSINQLS
FT                   QLSENYSAEYIIDLSDEKQLPYLPEPSRSCMLCLSPMVNPSAANCGHLFCWDCIVDWIR
FT                   EHPECPLCRQQCLEQHLLPLK"
FT   CDS_pept        complement(59879..60160)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579788"
FT                   /orf_name="CD36_40390"
FT                   /product="ATP synthase E chain, mitochondrial, putative "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="CAX41926.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG328835"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniParc:UPI000192D862"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA7"
FT                   /transl_table=12
FT                   /translation="MSTFNVLRYSLLGAGIVYGAYTRYSVDSAFKAEQAAKKWRQEEKL
FT                   IQQAKAEYAKLHTPKKDTSSASTSGSINWEDPNLDLGKALESLIQKLD"
FT   CDS_pept        60453..61505
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231270"
FT                   /orf_name="CD36_40400"
FT                   /product="Mitochondrial protein phosphatase type 2C,
FT                   putative"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="CAX41927.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG397219"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="UniParc:UPI000192D863"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA8"
FT                   /transl_table=12
FT                   /translation="MSMLLSILSKKNGVSLGSNFIKTSARSFASSSRSYWGGYGKGSTK
FT                   DYSTAASPSATASAASMNYDSALTSVSHYNIAVAFQPKNREESNLFKKKQPSPSLQSPS
FT                   GEDNLFVSNEKAGCIAVGVADGVGGWSEAGYDSSAISRELCASLRRQFESGAASNPKQL
FT                   LSLAFKEILSSPQVEIGGTTACLGVLTSDLKLHVANLGDSWCGLFRDSKLINETNFQTH
FT                   NFNTPFQLAKIPEEIVRQAKLQGRRYIIDSPEAADEYTWDLKSGDVVMFATDGVTDNVI
FT                   PQDIELFLKDHEESNQLDEVANRFVKEVVKVSKDSNFPSAFAQELSRLTGQKYLGGKED
FT                   DITVVLIKVK"
FT   CDS_pept        61617..62954
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536886"
FT                   /orf_name="CD36_40410"
FT                   /product="Vacuolar segregation protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41928.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397218"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI000192D864"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFA9"
FT                   /transl_table=12
FT                   /translation="MQINSTPPRKINRISFSDQGFSIGDSEYNAPGSPIKRSHWKQQSS
FT                   ANQCTLCDTTLSVKNGIVNCRKCGELFCNEHTHYKVRLRNPDKGEATPQYDSSGVWCRC
FT                   CETCFFNKQKSTEINSVDLTEQFKQNRSAKVEAHQLHRTRIQRNFIKLTDSLMNNSSVD
FT                   DIANWSPNTKNCSICFVEFNLFIRRHHCRLCGSVVCDDPNGTRKGCSINVPLVKLVEKL
FT                   PQLNYANEYEDIDENIRFRCCITCKNSLLFDWKRSIDSDNKVLVMYEGMLLQRQQIEKL
FT                   MPQYEQSVGHNNDSSKLRNKLVHILKELETLVIQFRNEFFTRDNERIVIRTGFESYEKV
FT                   ITNIYQGIAVFLQDNLLKYKQITDKYKQQTEIPRTPSPPRLTKKEIREMREQLMVMNEQ
FT                   KFLVENLIKDYTKARRFDELDSLIANKNELTETIARLENELGEFGF"
FT   CDS_pept        complement(63017..64252)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231271"
FT                   /orf_name="CD36_40420"
FT                   /product="Transporter protein, putative "
FT                   /protein_id="CAX41929.1"
FT                   /db_xref="HOGENOM:HBG332024"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="UniParc:UPI000192D865"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB0"
FT                   /transl_table=12
FT                   /translation="MSLETFRESKTYKWTSKVISFLIGQWFFIFLGVFIALAHSYPEFA
FT                   KQGGTIRAEYSIGYGAVAVIFLISGLSMSTKQLLVNVANWRAHFTVLSMSFLITSAIIF
FT                   GIASGIKASHNGEIDDWLLIGLIVTHACPTTVSSNVVMTKQAHGNDILTLCEVFIGNVL
FT                   GAFITPALLQMYMTGTWEIGNPSHQTDGDSTVQELYAETMKQLGLSVFVPLFVGQVVQN
FT                   IFPKQTKWCLTTFKLSKVGSFMLLLIMFQSFSTAFAQHAFTSVSHASIIFLVFFNIGIY
FT                   LFFTVLTYLYSRPFWILRVFKEEPNESSSKLYRYSYAFFRPFYYNRKDTVAVMLCGPAK
FT                   TAALGVSLVSSQYGSHNPKLGIILVPLVLYQAEQVMTANVLVNFMRKWIHAEDKVPEDE
FT                   ETSVGSDNDPKK"
FT   CDS_pept        65532..67355
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231272"
FT                   /orf_name="CD36_40430"
FT                   /product="Cell division control protein, putative "
FT                   /biological_process="cell division"
FT                   /protein_id="CAX41930.1"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG397217"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000192D866"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB1"
FT                   /transl_table=12
FT                   /translation="MRVSNPQSSKTLFVNNFWGNSPEKSFEIVTTRIKDSLNTLNEIIN
FT                   FYQEKINIEKEYTKKLEKLQSKCILGTNETGTLKQSLDKLSIENQSMINYNHKFIKTII
FT                   HTNLEKLQTFQQLYTQRVNKLEHHMGKVLIKRQQALKELEYYKSKYQEECTQLKSLRLS
FT                   LQTTWGRELDKNQQKFNKINSQINSTRKHYHMALVNYKEINEIYKRDWSISLNDFYKLE
FT                   VERIQVTKINCFNYCNNIATLCVDQDSAVDLARPMFAQIQPITDLEEFSGNYGTGNKIF
FT                   NDPEFVDYMTGCEEPRIGYTLSNFPNPDCSNILTRTYSTYTGNGNTSKQIEQKRSDDKL
FT                   NDNIFTQPHVVQYNPAPASAPNKEMSKLPIPKLPPTNNRTKTPSPTRKPPSDYHSNYSD
FT                   DIFSKDERLQSSNGSSDYSSERNWASPRKREKQLQEVQEKISRRATNDFKNIPKVPEPE
FT                   KVPVIKDFSIDFIAKALEDLNAGGNGDVNQFRRSLRNGRPKSDFIDDRDEVAKRHESIN
FT                   FNRPKSTVPRRSLKLTPVNRKPFVTKAIARYSFKPQHEGELYFKKGWQMYIIHKQEDNW
FT                   FVCELGENCLQSSGMIGLVPGNYVIEGDDLF"
FT   CDS_pept        67556..68539
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231273"
FT                   /orf_name="CD36_40440"
FT                   /product="D-arabinose 1-dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41931.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397216"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000192D867"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB2"
FT                   /transl_table=12
FT                   /translation="MLHPIGKPEVIQPYSIKNLPPLIIGGAVFNYQYTSDPHSLPVQEL
FT                   IERAFQLGLNALDTSPYYGPSEEIIGEALQRISFSRDQYYVCTKAGRVKLDEFDYSRSS
FT                   VRQSVKRSLKRLGTSYIDLVYMHDIEFVDPDQVMDALRELHLLKCEGLIKNFGISGYPV
FT                   KFLYEIALRCKNEIAPLDAVLSYCNGCIQNTLLFEYHDKLLQDCDVQIVLNGSILSMSM
FT                   LRSDITHSFHPASQALKQRVADIAQKLKEENVELADLATRFAIKEWLFKYKSGIVLGVS
FT                   NLHELESAVQCYWDVKSGVFNDEKLVEQVQTSLAEHLNETWSSGKH"
FT   CDS_pept        68703..69140
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231274"
FT                   /orf_name="CD36_40450"
FT                   /product="RNA polymerase II transcriptional coactivator,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="transcription coactivator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX41932.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003713"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG626534"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="UniParc:UPI000192D868"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB3"
FT                   /transl_table=12
FT                   /translation="MAFRRGAPASFTSTSNEVEISLDSKKQVTVRKFNNVNLVDIREFY
FT                   TDKEGVKRPGKKGISLTEDAYYKLLEATNKIQNALDDLNGGASNKRVKLDNKQEKRDKP
FT                   LKKEPERKAIVEKEEEVTETKQQVPEPQEEEEEEEISDADE"
FT   CDS_pept        69983..72385
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579789"
FT                   /orf_name="CD36_40460"
FT                   /product="Manganese resistance protein, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41933.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG397215"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000192D915"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB4"
FT                   /transl_table=12
FT                   /translation="MGKPKKHMSFMATNYVPTDEQSHDSSSTTNLRNHANGTKNSSSSL
FT                   DQLINSGTFIDHRKASDWANAHSSPSNTRRRKSNGSFRNQKSNTDSPSLPLTNRNLQTL
FT                   IRRSSTLEDPISPTAVAIDIDKFTNEQRSFVKSNTWQGHHEDRDEDQYSYSEFGESNPS
FT                   SEHSSDSTSLDDVCFPDFREDVKTTSGWPDLHVLEEFIKEELEEVQTDLEPTVNFGGNV
FT                   VHSENEDATESTPLIDSFKVNEVQALDSENNPFQVRPTPIQPWERSQQNIPPILKDTSK
FT                   GQVDKEICRFTYFREDMSKTVHSPTISGLIEDRSKIYESLEELFPPTRSKPPSIHMKPD
FT                   SVSSTNLAPLTKSRPETPTPSSVNDSLSRREPFWLDVLDPTEEEMKVLSKTFGIHPLTT
FT                   EDIFLGEAREKVELFKSYYFVCFTSFDVVYEKRRQRAKEQEKKFIKLQEMYEKGSDNGS
FT                   ISESKSPFKLLKSLFSRKRRLSSYLEKPTSTSIKSQGKKIRDGELSPLNMYIIVFKSGV
FT                   ITFHFSATPHPINVRRRARMLKDYLSVTSDWICYALIDDITDSFAPMIETIETEVNAIE
FT                   DAILKMHSGESDSEDESEEESDHPDNVFVFRKRSKSMVDHKSEPRLAKSASSSSGSSSS
FT                   RILGWKRKGDMLRRIGECRKRVMSVMRLLSSKADVIKAFSKRFNESEGSQSEIGMYLGD
FT                   IQDHIVTMLQALAHYEKLLARFHSNYLAQINIDMTKVNNDTNDVLGKITILGTIVLPIN
FT                   VVTGLWGMNCLVPGQDYEGLAWFWGIVGCMALFSFVAYNYARRVTGL"
FT   CDS_pept        72597..73157
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079903"
FT                   /orf_name="CD36_40470"
FT                   /product="Endoplasmic reticulum transmembrane protein,
FT                   putative"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41934.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397213"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI000192D916"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB5"
FT                   /transl_table=12
FT                   /translation="MSLQMSLVFCTLIGQMITLLVLVLPLPYVVRQKIVDLTFALQKNQ
FT                   NFRVGIVFSIILMSLQLLDCIQRLNKYADAETNPHFPGIDYDRLASKFYSQRNLYLSGA
FT                   ILYLQVAIGTVVTIVRKMVLKEKLYREANIKPATDDEATEVEKLKHLIDLKQQDIDTFK
FT                   KQVEGLQKAYNSLTPQEEKNKNE"
FT   CDS_pept        complement(73303..75732)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248053" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231275"
FT                   /orf_name="CD36_40480"
FT                   /product="Regulator of actin cytoskeleton, putative "
FT                   /protein_id="CAX41935.1"
FT                   /db_xref="HOGENOM:HBG397212"
FT                   /db_xref="InterPro:IPR018808"
FT                   /db_xref="UniParc:UPI000192D917"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB6"
FT                   /transl_table=12
FT                   /translation="MTDQDFNFATTILTSKTPQQAAAIIPNVITGSTGLNKDLITWFKH
FT                   YSSTLEGYTQGLQQLIDEANKIAERSSVGFNNFPRNWNCLVNAIKTEHDNNETINKHLR
FT                   QEIINPLRELVEKDVRVSELIVNGQELQEISGNLNREGEIQWNYKAPQGFQNLEDFKKI
FT                   EIQVMFDIILNFFQLHNGRLTKDLKNNENSTNYLLGSFKLDAEMQNQLKYLVNTQFATP
FT                   QRGFQHQGQHPPTAAPNNKQRRSSSFAKSEKSASPKKPSKLKSKVGSIFGRKKKKEKFA
FT                   GAESIAEDESLSEVSLPPTRTRNSSMLSRSNSTRRSFIDRFHRDESSTAISRQHEHQQS
FT                   PLIEPSQHVEKPQPEIPQPEAPHTKSLEPVSEVQKEQFPPIQNGPEKSSENQQPRVSVP
FT                   TQTLSPVTPTHDGFGGSIKPLPEPVDSPNVIKYNDSDDSSTEERRASLLEKHNLEVQPV
FT                   PSPFTTQPPAPVPQSSRSRQSSDGIYSFEAGDDSNPISATPRSEQNVFAQMPDPNLSSE
FT                   KTLAPPPPPSRKVLHHDEPAVRDSAIFHNLPVASHSGRDSVMAPLASQDTGHSLLKNDF
FT                   KHENLAATLGLSSSIAEVINASFKDGQLIKSQVVGEVAFNYNGNTSDPLVVTIPNSFDK
FT                   VLVNKTFIEDLGQGKYKINPAFITSKTLGGLKYLLKPTQVPVIIQQIWKFEPHQSSLMV
FT                   SIRSTTPLVLENFVVSVALNHDIEATSASSKPQGAFNKEKNRITWRYPSSLTLNGEERL
FT                   IARFMTNGLGSEHESGVQIKFQVKDPQVKYCSIYNENGEEIPTFRNLVSGSYSGHL"
FT   CDS_pept        76982..78424
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536887"
FT                   /orf_name="CD36_40490"
FT                   /product="Ammonium transporter, putative "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41936.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI000192D78B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WF88"
FT                   /transl_table=12
FT                   /translation="MSGNFTETGTGGDVFKVDLNEQFDRADMVWIGTASVLVWIMIPGV
FT                   GLLYSGISRKKHALSLMWAALMAACVAAFQWFWWGYSLVFAHNGSVFLGTLQNFCLKDV
FT                   LGAPSIVKTVPDILFCLYQGMFAAVTAILMAGAGCERARLGPMMVFLFIWLTIVYCPIA
FT                   YWTWGGNGWLVNLGALDFAGGGPVHENSGFAALAYSLWLGKRHDPVAKGKVPKYKPHSV
FT                   SSIVMGTIFLWFGWYGFNGGSTGNSSMRSWYACVNTNLAAATGGLTWMFVDWFRTGGKW
FT                   STVGLCMGAIAGLVGITPAAGYVPVYTSIIFGIVPAIICNFAVDIKDLLQIDDGMDVWA
FT                   LHGVGGFVGNFMTGLFAADYVAMIDGTEIDGGWINHHWKQLGYQLAGSCAVAAWSFTVT
FT                   SIILLAMDRIPFLRIRLHEDEEMLGTDLAQIGEYAYYADEDPETNPYVLEPIRSTNISQ
FT                   PLPHIDGVADGSSNNESGEAKN"
FT   CDS_pept        complement(78504..80747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231276"
FT                   /gene_name="OPT7"
FT                   /orf_name="CD36_40500"
FT                   /product="Oligopeptide transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41937.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328266"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI000192D918"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB8"
FT                   /transl_table=12
FT                   /translation="MSKEAEFVKTISKNGDPQVDVHERDTESNSEDALEPDIEELPKVV
FT                   REIVPLEDDPTIPVLTFRYFILSIIFIIPGAFIDTMNSFRTTSAAYSIFFVQIASHWCG
FT                   KWLARVLPKKQVGFGRFSFNLNPGPWSIKETVLITITANSGATGSMGTNPLALAELFYG
FT                   ESVNPAVAIFFMWMIVFIGYSFAGIARNFLLYDPQFTWPQALMQTTLFQTQNKSDKDAK
FT                   QASKQMKVFFFVLIGLCAWQFFPEYIFPMTSSLAFLCWVAPENYTANFIGSGLGGMGFL
FT                   NLSLDWSNITSSIMLYPYWVQVVQFAAFVLGAWILIPAAKWGNLSSYHYGLMSNSLFLG
FT                   NGTKYPTTELLTTNLRLNETRYAELGPVHLGAQRAWNMFFDYAAYVSGFMWVVAFGYKS
FT                   LSGSLKRLVTSRKQKGSINLQYTDRLNRLQAAYEEVPLYWYVILFICAFVTLLVIFATD
FT                   SLFMPWWCLLVGVAFGAVIVTPLVWLYALSNFQLPIGTFNELLYGYMIQHKTSRHPAGA
FT                   MVYGAVGGDLFYRAQYILNDQKIAHYMHISQRAVFFSQIFGELIGVPINYAALKWVIST
FT                   KRDFLDGTKVDKLHQWTGQTIVGYNTNAVQYVILGPDRLFKNYPVLPYGFLLGAGAPLV
FT                   LYLLHRLFPKSKLKFHLWNTTVFFSTMSTFYGNLSTGYFSKFIGGTITMFWAFRYKHSL
FT                   WKKYNYLLAAALDTGLNLSILLIFLFFSAGKTVNFPEWWGNNGKSVERCFAMS"
FT   mobile_element  81452..81706
FT                   /mobile_element_type="retrotransposon:solo LTR, iota S"
FT   CDS_pept        complement(82121..82873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384104"
FT                   /orf_name="CD36_40510"
FT                   /product="Protein involved in biofilm development, putative"
FT                   /protein_id="CAX41938.1"
FT                   /db_xref="HOGENOM:HBG397070"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="InterPro:IPR014005"
FT                   /db_xref="UniParc:UPI000192D919"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFB9"
FT                   /transl_table=12
FT                   /translation="MLSSSSILIVSIALAATASAVPDGANPYTIYPSVAKTASINGFAD
FT                   RIYDQLPECAKECVKQSTSNTPCPYWDTGCLCVMPQFGGAVGNCVAKNCKGKDVGSVES
FT                   LATSLCSAAGVWEPYWMIPSSVSDTLAKAANAATATTTAETTTKSSVAVPTTATETSPI
FT                   ASTSHESKVAETSAALKTLSTESTTPAETSKSKETSKAAETTKAEESSVAQSSSATGVA
FT                   SVSVETANAGNMPAVAIGGVIAAVAALI"
FT   CDS_pept        complement(83682..86990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094025" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579790"
FT                   /orf_name="CD36_40520"
FT                   /product="ATP-dependent helicase, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41939.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397211"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D91A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC0"
FT                   /transl_table=12
FT                   /translation="MFKKLKELENIQYSNNGTPSKQDLQPVPPASFVTGNDIDVKQATG
FT                   QHEYKTPLSTISRMNPAPGNTLPSQPYLSQQPPIKKQRLESLHTRNTSPFSFNHGIANN
FT                   NNSNHQFLADQNNKPPESIEIISLSDSDDDKNPGNQSDNEDIEVLDEQQAANISWKDTS
FT                   FDQSNPISSVNTSQQQQVVEKFKPEPVLPGSFVPRDQGKQVPGNDKDGDGDDDLEILSS
FT                   RSLQVNNPTNIGLYNVPAPVPQVGSMQADAIFKEELENRARFRSNDLVNLQKQKDAISR
FT                   ELVVSQVSIDNFKKNIATLGRALSQAVSLGRHGDVQKLRQAIQTQTELSKAPKMKLNKN
FT                   QDILMKIETMISSTKRELEAVYRQVRNIGHLANSSFNPYEAQIVAETQRVKVDESEIKD
FT                   LLDNIRPDEDLEEGLEPTPPELKVNLLKHQRMGLTWMKRMEASKAKGGILADDMGLGKT
FT                   IQTLALMMASKGSNLIVAPVSLLRQWMAEIESKTKSDVFLSVGIYHGKDKKKMKGFELM
FT                   KEYDIVMVSYTTLVQEWKKHFSEDLKEHSCERSYFPDPSRGGKSYMSPFFSRQSQFQRI
FT                   ILDEAQAIKNKQAIASKAVTYLKAKYRFCLTGTPMQNGIEELYPLLRFLKIQPYCAEEK
FT                   FRTDILTPIKSKTDLYDEYDVKESMKKIQAVLKSILLRRTKDSLIDGAPILNLPEKHVL
FT                   SDYVSLENEELAYYQSIESRVQKAAKKILGEHTKNAPALTLLLRLRQACCHSYLVEIGE
FT                   YKAKVKDSEADASFSNFKLDWRSMVNNARDLKESAKQQVHSLIDALNGRGFDENTLACP
FT                   VCFDNIDIESSLLIFGECGHVICKGCCNTFFENCNVGEEDDESPYRIGECKDCQKTVKE
FT                   HNITEYLIFDMLHIQKLDMSQVHKFCSQHYQHKIKSNQALIREFIKRDNGFESSAKIHK
FT                   CVEMILDLFSKNPGEKVIVFSQFTSLFDLMALVLQNQHIEFLRYDGTMSMDVKNNVIKE
FT                   FYQSNKNVLLLSLRAGNAGLTLTCANHVIIMDPFWNPFVEEQAMGRAHRIGQTREVFVH
FT                   RVLIAGTVENRIMELQESKKHLINSALDEHGMKSISQLNRRELGFLFGLNSLTG"
FT   CDS_pept        complement(87789..89600)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579791"
FT                   /orf_name="CD36_40530"
FT                   /product="DNA-3-methyladenine glycosidase II, putative "
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41940.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG397210"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000192D91B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC1"
FT                   /transl_table=12
FT                   /translation="MANSTSTPALIVAKDDNTVPGQHKSSSQNHRFKQTNKNQKRQNRQ
FT                   SRYDHSNDRELTIIESQLKNGKKVKGSKNQISINHLLDFQSYRDSEEYRSNQQRNRRRR
FT                   SSSHKRPYSHNKIQLTGMKFINVNFKFVVDGRKDYRIQELDPNVPVDTEDIIRIIAPRG
FT                   NSCPICLTDEFVAPRMITSCGHIICLKCVLSLLANEVPQAKKRESAAIVEKYRECPLCF
FT                   SIIRKHELKPVLINNVDERFEVPKVGDEVVMTLMARRVDQILALPKLLSFDNHIRGFPD
FT                   TKQLELLPYSRIFKGDSQYILEMYEKEKRDITAAYEEEKLIYGDDSSLVVESITYIDKE
FT                   IESWNTKLLQNVEKQPSHSHATDNNHPTYYFYETGFNAGCTYVLSPLDMKVLKTTYNDY
FT                   ATLPSSLVAQIENIRYEELTTESSMNKYKYLSHLPLGSEIGFLECDWSNSEFISTETWE
FT                   SFKDDLLKRSNTSKRKLRKEERDKKRAMNEEETRTRNFFLHENGEADIEQGSSTLGFGS
FT                   LSIVDNRELPALSDQHVSTESEKEYETTVWGTRIPRNEAVSAQSAIEDDDWEAEEMIRK
FT                   AKEEMSRQEQAGGSKKKKKKKLVLLSS"
FT   mobile_element  90521..90781
FT                   /mobile_element_type="retrotransposon:solo LTR, rho B"
FT   CDS_pept        91262..93241
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536888"
FT                   /orf_name="CD36_40540"
FT                   /product="Urea transporter/permease, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41941.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniParc:UPI000192D91C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC2"
FT                   /transl_table=12
FT                   /translation="MEPSLSQGAGFGLIIGGGVFFAVVMNYVTHLQNKFSHYNSHKVDE
FT                   FVSGSRRVGFGLLLAGILSSWTWSLTLLESAVKSYSMGFCGSYYYAIGGLLQVSIFSVI
FT                   SSKIKKNANLVTTFPEMGYFRFGVPGHLAFLWCGFVCNAIVSSCILLGGSAVLHAVTGV
FT                   SQYASLFLIPFGVAIYVSFGGLRATFISDASHTCIILIFIIVFMFEVYVSSDKIGSARK
FT                   MWELLESLPPVENNYHGSYLTFRSEQGAIFAVISVITGIGLVVADQAYLQRAVAADPRI
FT                   TSRAYFFAALCWFVIPFAMGASLGLGARALSVYPDFPKLTEFEVGEGLPAAAAATYLMG
FT                   KTGSAMIIVMIFFSVTSSYAGELIATSTLVSYDIYKRYINTTATPSQVVKVAKYSVFGW
FT                   AIFSSCLASIFYGAAKISMGWLFNFLGCATASGVFPIALAFTWKDLNQAGAVGGSVGGM
FT                   ILAFIVWLITCKTYTGSITVDNLSNQWVSFAGNVTALVMGGVISVVLSLIWPANFDFDN
FT                   TRNKTSLAEQNTEVKKESSGITKLDKTKDQNVEIETEIANSDLDMDLNAEIDHKHLDQQ
FT                   FKKYTILVIVLAIIFVFIIPVPLGGSPYVFSPNFLLGCVVIIIIWLFFSLFYVVVLPLF
FT                   EARQTLWRITKQILRIDSTTKENI"
FT   CDS_pept        93911..95527
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384105"
FT                   /orf_name="CD36_40550"
FT                   /product="Diphthamide biosynthesis protein, putative "
FT                   /protein_id="CAX41942.1"
FT                   /db_xref="HOGENOM:HBG446814"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="UniParc:UPI000192D91D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC3"
FT                   /transl_table=12
FT                   /translation="MSSDTVIAPSLSTAQDDGTFTYDKVKSTTKERKHLNLKNPSDTSE
FT                   IKSKIWNYYSLSELIQYLSQKENNEFKYKRITLQFPDELICDSATIVHDLQRELNIAPQ
FT                   NSLHSSDCCQDTCEPNATQRIWILADTSYSACCVDEVAAEHVKSDLVVHFGDACLNEID
FT                   KLQAVFVLGRPTLDVEAIVKQISLAYSPEQKVVLMSDAPHTYLLPEIAKELPDYDILIA
FT                   NLPKTSRGRIIGYTPPATGYRKFNRVFNIEEVDFAEYELFHVTSPESPRLLQLATNFAS
FT                   VTTYDPISGTISTGPFPNLMRRYKYVHQARMAGTVGILVNTLSLANTKILLNTIKEKIR
FT                   EAGKKHYIFVVGKPNVAKLANFESVDIWCILGCDHQGIIIDQLNEYYRPIVTPYELLLG
FT                   LSDELSWTGKWVVDYKSVLKEYGNEVIQPNQDADSDEDLPPVFDPVTGRYVSTSRPLRQ
FT                   INHLMVKSNDQSHDNDNDNDSQLVKRFSNAVAIKGTVSTSAIHLQNRHWTGLGSDYTED
FT                   ENAAGALVEDGRKGIARGYDI"
FT   CDS_pept        96199..99120
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248079" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536889"
FT                   /orf_name="CD36_40560"
FT                   /product="Ubiquitin-protein ligase, putative "
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41943.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG397191"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI000192D9D9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC4"
FT                   /transl_table=12
FT                   /translation="MYNFSGSSKKRVVNLGNKKSGNNNKTNFLEQSRLQRQEREYKKNR
FT                   EKSAIIIQNHIRKYLDLKRNSFAIINDWLNSHINNEQDFNSWINQFINLSKWYLLKQDG
FT                   GLIYQVLESLLDHISDTMFDIYNTDGMIHALNKLLSCLKDINALYLTVQALYIVASKTE
FT                   NLGEVNGVIDNLSRLFNEYQLSREQQSKIFDLIFMINIHDSHYDFKKALTLNYFEGENK
FT                   KYLQVLRNAIGSTTHALKFNDDALVRMLSSYLIVHGDQKLTQFDYAFIGSILENIDCEV
FT                   RLEDDDADDDDFFEKRKFINVDKVDPTYPRRIDILYIDEKISNSLEKLYTRSFIQGVIN
FT                   LLRNETSELRGLALKILPALVNLYPALKGKLCMLLSIVPNFYKWVFETIREHELFHLFI
FT                   NCNKDYVRTQELENIDEASMYSFWKIVFLFEESYSYWLIVSNDLESFSHEKLPIDDVKL
FT                   FIGFLKVACLTLIFTYNRTLFPHYSNLKSISTTLLNQLYLRNLRLKFLPRDYWKLKDLV
FT                   FNVDLMLSIITEEEESRINAEADNEEEIVAVKRSKPVPIEILSKLEVLKTLPFFIEFNH
FT                   RVEIFQSLIDLDKKRNFSFNPFTFSESKLVAEINRDSILEDAFNAYHKEGANFKNRLQV
FT                   EFFNEYGREAGIDGGGITKEFLTCIVKEGFNPDNAYELFKETGDNQLYPNDKIFEILYI
FT                   GMDKEFQQIKLDYIRFLGMIIGKCLYENVLIDVWFAPFFLNKWCNDAMKNSINDLSYLD
FT                   NELFKNLMKLTKMTNDELKMLELTFSINLKIDNKSYTVELLPNGAVIEVDSSNILSYIH
FT                   QFANYKLNQSLKIQTKYFLEGLYSIISKSWLSMFDCFELQMLISGGKDDINIDDWKNNV
FT                   EYGGYSDSDPAVIMFWEIVEEMSPHERCKLIKFVTSVSRAPLLGFGSLVPKFGIRNSGT
FT                   DSVRLPTASTCVNLLKLPNYQDKKTMKEKLLYAINTEARFDLS"
FT   CDS_pept        complement(99258..99881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231277"
FT                   /orf_name="CD36_40570"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41944.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniParc:UPI000192D9DA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC5"
FT                   /transl_table=12
FT                   /translation="MRIYQCHFCSSPVYPLHGITFVRNDAKEFRFCRSKCHKAFKQRRN
FT                   PRKLRWTKAFRKAAGKELVVDSTLTFAARRNVPVRYNRDLVATTLKGMSRIEEIRQRRE
FT                   RAFYKNRMKGNKERQLAADRKLVADNPELLRLREVELRRKAEKLAAKENAMEEDEEIEA
FT                   EEDEEMISEDEEMESEDESESESESEQKRVKQKVILKNKRKSRN"
FT   CDS_pept        100339..100812
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579792"
FT                   /orf_name="CD36_40580"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit, putative"
FT                   /function="heat shock protein binding"
FT                   /protein_id="CAX41945.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG526913"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000192D9DB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC6"
FT                   /transl_table=12
FT                   /translation="MAPLEAPILAIPGENNTQQQQQQQFQYTGQLQKKKAAEGSIEWYF
FT                   DKTINYMGEHPVITGIGAFAVAYFAAGFIKSNQPGINGKAFVRGGFGAKMTAKEALQIL
FT                   NLKETNLSKLKLKEQHRKLMMANHPDKGGSSYIATKINEAKDLLEKRGGMKPK"
FT   CDS_pept        complement(101275..102339)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384106"
FT                   /gene_name="PHO2"
FT                   /orf_name="CD36_40590"
FT                   /product="Acid phosphatase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41946.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG397192"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="UniParc:UPI000192D9DC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC7"
FT                   /transl_table=12
FT                   /translation="MRLILLLFITTAVTSLNILITTTDSWVSKNTRLLYSSLKANHNVK
FT                   LIAPLYQYNLEKNNIPLFSNKLAKDGGEYGHLLPVHQTYFHNLRSINTKRAKGVKFEQD
FT                   QPESTTQGIVQSSQFGQDPLDKDCWYVDSNPFNSLQIGLDVILPNYYPDFKPDLTIIGP
FT                   NEGLNNQQMINKMIHSTIANKNISTVAFSTEDEHHIYYQDENYFHISSNSIHQLMKHNV
FT                   FTKNIKFINKEIGRIIDDLSNKDVIGLDFKFPSFNHFNSHCVTSNSLQLKVQEYFSTLS
FT                   IPNTKFNFKTEREGQTIKIVDVENTQGEAGPEIVDMFTSNKQQLLKRMTNLDVGKGLIN
FT                   CNLIANVLYGETNF"
FT   CDS_pept        complement(103599..106649)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231278"
FT                   /orf_name="CD36_40600"
FT                   /product="Nonsense-mediated mRNA decay protein, putative
FT                   (Karyopherin"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAX41947.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG397193"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D9DD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFC8"
FT                   /transl_table=12
FT                   /translation="MDCTLILECFAGTLQVDLNLRNQAESKLKELSVSPGFLGACLDVI
FT                   DLSSSPVQAKKAAAVYFKNRVIRYWNIKDSQFKIDQDEKPIVKDRILPVIINADYNIKQ
FT                   QLIPALRSLIFWEFDNWNGLLDQTGQLLQQDNSEDYLYTGMLCFAEITRKYKWVSNEDR
FT                   KNKLYPIIDQAFPHLLSIGGAIINNEMTELRAEILKLILKSYKFVTYFDLPEPLRNKDA
FT                   VISWGQFHGSVINMAPPSYVLGTNMSEQEKSFLQISKCYKWAIANIYRLFIRYASSKNL
FT                   TRKYDYKSFHQLFLNDFIPHFITQFLTIIEEYCQGKKWLSTTALYQLLEFLSHCIVEKS
FT                   TWSYIKPYFETLITHLVYPIICPDDQTLEIYEEDPQEYINLSFDQTNDYDSPENAALGF
FT                   IATALYKKPKTTLPCISTFIYQQLTELQQQPEETLEVAKKKEGALRILGTISGNLPKDA
FT                   TIEPMLASLVVPCFGSKFEFLQARTIEVVSQFSDVPFDNQETLSAIIHGILRNFDNSEA
FT                   SLPVLFESALSIQAFMVNDEFKQVLSNIVLPTMSKLLDLSNEIDNDAISVVMQDCVENF
FT                   SEQLQPFGVDLMGKLVQQFLKLAHEINEASQVDVDDFDGNYDDQGDKTMAALGFINTMI
FT                   TVLLSFENSREICIKLEELFSQVINYVLVNNLDEFFAEVGELMENSTFLLRTVTPVMWE
FT                   NFKLLYKTFEDGTALMYFEELSACLKNFLIYGKEDLKNNSELSSLFFKIFQIVTKGASE
FT                   DLGYADLVESFEYAQTFILSLEEASNGYIPSFLECVLSNYQSGDKKLVKSTFVVNSNNV
FT                   IIASVIYDTNNTMALLQQSQMLMPFLQKWFEIIPHLERVYDLKLSVLACMNLIRLDLDQ
FT                   QTLATISNNLVSMLKKLPNAIQTLEKKRKNFGDLSGSNYQLEGEWPEGGEFEDEEYDEQ
FT                   DEGEEYSNIVNSVDLNLHKTGGFFDIKEDEVYEDPLSTTPLDAVNIFAVVKQFIQELQV
FT                   NNNEKFNSTFGRMNEDDQKIILDIMNV"
FT   tRNA            complement(107210..107280)
FT                   /gene_name="tRNA-Gly (CCC)"
FT   CDS_pept        complement(107473..108765)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579793"
FT                   /gene_name="MMM1"
FT                   /orf_name="CD36_40610"
FT                   /product="Maintenance of mitochondrial morphology protein 1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41948.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397194"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI000192D9DE"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WFC9"
FT                   /transl_table=12
FT                   /translation="MSQGLIETTTIVETRELGHQIHASLLEQLKLQQEELLQQQRDLFF
FT                   QEQQLQQQANHPVSNNGNTWSFTQGLVIGQISVIFIIIVFVKFFVFADSSSHIPTKPGL
FT                   DGATGVIVKRNKKKQHLNGQFANDDGNEDDISLNSNESKISSILEKTYYDVNNHASESL
FT                   DWFNVLVAQTISQLRSEALLKDNIYHSLNNFLTNAKLPDFIDTINLTEIDIGDDFPIFS
FT                   NCRIKYGEDLKRLEAKIDVDLSDTLTLGIATKLLLNQPRPLTAVLPVSLTVSIVRFSGC
FT                   LTVSLINTKDIDLKNFNKASNMNGYSKENGSADSASDNDEDEDDGGTALMFSFSPDYRL
FT                   EFIVKSLIGSRAKLQDVPKISSLIENQLRTWFIERCVEPRFQVVRLPSLWPRTKNTREP
FT                   VIKKTPTTSTTINGTSAATVTTPGEFVNSNI"
FT   CDS_pept        complement(109001..110368)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579794"
FT                   /orf_name="CD36_40620"
FT                   /product="Cholinephosphate cytidylyltransferase, putative "
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX41949.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG397195"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192D9DF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD0"
FT                   /transl_table=12
FT                   /translation="MARLTRKKTIEKELNGSSKITRTLSMESISSLFKRNKKRKHNDDN
FT                   DSSINSSDNENNNITDEDTHHIESKPNHKKRKIKTKAEEEFEANEKKLDEELPIDLRKF
FT                   RPRGFKFNLPPTDRPIRIYADGVFDLFHLGHMKQLEQAKKSFPNVELVCGIPSDIETHK
FT                   RKGLTVLTDEQRCETLMHCKWVDEVIPNAPWCVTPEFLQEHKIDYVAHDDLPYASGDSD
FT                   DIYKPIKEQGKFLTTQRTEGISTSDIITKIIRDYDKYLMRNFSRGATRKELNVSWLKMN
FT                   ELEFKKHINDFRTYWMKNKTNINNVSRDLYFEIREFMRGKKFDFQKFIDDANSQNSSNH
FT                   GSDEESTNSSKVSSPLSDFASKYIGNRNKDLNRRGILNNFKDWINRDDHSEQDTEEEIK
FT                   PIVIKPIRRSRRLSGGSNSSAPSTPVKRTAASVSTTPRKKSPLKKSSSVKNTPKTK"
FT   CDS_pept        110773..111228
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231279"
FT                   /orf_name="CD36_40630"
FT                   /product="Dual specificity phosphatase, putative "
FT                   /protein_id="CAX41950.1"
FT                   /db_xref="HOGENOM:HBG587364"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000192D9E0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD1"
FT                   /transl_table=12
FT                   /translation="MTKIYSLSDLKFIKPKTLKSWFTNGSSPHGKFCVVDVRDSDFVGG
FT                   HIKGCYHYPAANFHYTLNELYQKIYQNKIQDIVFHCALSQVRGPSSTLKFLRGIDDITD
FT                   SKVKKYLNGDNIQVYVLHGGFTKWQEEYGNDNEVTEAYDQEIWEFGS"
FT   CDS_pept        complement(111395..113320)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579795"
FT                   /orf_name="CD36_40640"
FT                   /product="Conserved hypothetical protein "
FT                   /function="1-phosphatidylinositol binding"
FT                   /function="clathrin binding"
FT                   /biological_process="clathrin coat assembly"
FT                   /cellular_component="clathrin coat"
FT                   /protein_id="CAX41951.1"
FT                   /db_xref="GO:0005545"
FT                   /db_xref="GO:0030118"
FT                   /db_xref="GO:0030276"
FT                   /db_xref="GO:0048268"
FT                   /db_xref="HOGENOM:HBG332941"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniParc:UPI000192D9E1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD2"
FT                   /transl_table=12
FT                   /translation="MTTYEKIVKGATKVKVAAPKPKYIEPILMATSLDHSLISKENFNT
FT                   IMRTLQARLHDSSWSVVYKALIVIHLMIREGDKNVTLDYLSNQASPNILNLNNNNIIKN
FT                   SNSFSSDIKFITRYAKYLHTRVKQFESTGVDYVRDERSNNNTNQQGGRLRLLEVDKGLL
FT                   REVESVQKQIDSLLKNNFMENEINNDIVLTAFRLLVNDLLALFQELNEGVINILEHYFE
FT                   MSKVDAERSLKIYKKFVDQTKFVIDYLRVAKHLEYATKLHVPTIKHAPTALTSSLEEYL
FT                   DDPNFEINRRQYLAEKRGKENVGSKPTQSIFNKKNSKNESTEQQQQQQQQSAEKKHQLQ
FT                   STSSDLNRHSSLVVQQTYNPWNTMFVPIVGIVDPSQQDQAQQQALQQQAQQQVLQQQAP
FT                   QQQQALFSQLPSISQGQTLQSTFTGVGFGGYGSQPQQLQPQHTNPFIQPTSQLQQPQQP
FT                   QQPIGLQRSNTNPFSSMATGQHQLSQQQFAQPYGQSNLNQQPQPLQAQSTNPFANTRFA
FT                   SASHTTAFTMDNGSIQQQQQQPQKIQASATGNNPFKVSQTTSQLFDNYAHNQQQHPHQQ
FT                   LKPQATAGGLEHLPTIPVFPETQQEAQKQFYFQNAQTGLYSQAFSSQQQQQQVQQYNNH
FT                   DGPSLI"
FT   CDS_pept        complement(114163..116814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079904"
FT                   /orf_name="CD36_40650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41952.1"
FT                   /db_xref="HOGENOM:HBG397200"
FT                   /db_xref="UniParc:UPI000192D9E2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD3"
FT                   /transl_table=12
FT                   /translation="MSFWDNNKESIKSAGKSTVKGITSGTKAVGQAGYRTYKKNEAKRK
FT                   GIEYHDPIEKESKSGETYAPYNPSPLPSKDKLNSYQPPPKRNVATFSVPKRGEVSQYSA
FT                   PAPAPSPTYNQGSYPANQQQYQPSNEIQTSSTYQEPPPVYSVSSTGETQGFPAGSEYSR
FT                   VAPPTPPTTSCTPANQSSFGVQPQTTSLNTSNTIQNSQQQYNGMSRQSIAAPEFPPLQH
FT                   QSGNVVHAPLPAQVSQKSNIPPSLPSRTSVSSVVSSTSSQSVGQGSFTNEHEQPKPKPA
FT                   LPDPGSFAPPPRRHDQQPIKPKILANNSTTELKNVSTPLTQGQGSNIDIGLSSVKHFKE
FT                   TERQSGYNDSSSKPPSLPSRTSSAHSNIPLKQKPPKPKKLHSDSPSTSTHTPGYNSNST
FT                   NSILSARNEEKYSNPPKPPRPVEDEEYTNPPKPPRPVEDEEYTNPPKPPRPVEDEEYTN
FT                   PPKPPRPQNQTPSGMPQRAIPDATGLSNKKPPPPKPLKKPSTLDGSTNAPPVYSEFDKA
FT                   FSKPNQTNSKSSNSQSAVSSELNSIFQKMNINQTATEAPKPKPVPKAKPESLTKKHEQS
FT                   ETISPITTNTKPPPPPRRISTPQKSPSPPPVPPVRNYNRAPAPPPPPPKQSGPPNLDLE
FT                   LSSGWYAKTNGTLQLPKVFDGTNHKFSYTTSSSSYGKSTTNLTVRLKDLSIITYKFEYS
FT                   NKDISNVNVVIEKYIPSPIDSIPSKQELIANHQRFGEYIASWCEHHRGKTVGRGECWDL
FT                   AKEALQKGCGNHAFVSNYVIHGYPILQIANTGSGIYFINNSLQLDEVRRGDILQFNACT
FT                   FYDASTGVTQSAGAPDHTSVVVGKTGDKLMVLEQNMGGKRYVVDGEINLKNLTKGEVYV
FT                   YRAMPHEWAGEL"
FT   CDS_pept        117244..118119
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579796"
FT                   /orf_name="CD36_40660"
FT                   /product="Uncharacterized oxidoreductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41953.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397201"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192D9E3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD4"
FT                   /transl_table=12
FT                   /translation="MLLASLLFAFMYKFSVYYNLPKTWKKISSSDIALVTGGSNGLGLA
FT                   LVEELLRKGALVYIFDVSKPKLSHDNLVYVHCDLNDEQSVNTELKKLIDELNSRNTWIT
FT                   ILINNAGIRDNKSLINLSCDRVRTMFNINTLSPIWILQKVISNHIDNVLSVYPEGQLFV
FT                   VTVSSILGTLAPKNLSVYSATKAASISIHEALHQELKEYSNNIRLLLVTTGQMSTAMFK
FT                   DVEPSKLFFAPIVNHIQLAKVIVDKINVGYVGCISKPFYANFLPGVRTVPQCIQDFCRY
FT                   ISEMDNKIKE"
FT   CDS_pept        complement(118138..118647)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079905"
FT                   /orf_name="CD36_40670"
FT                   /product="Signal peptidase complex subunit, putative "
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAX41954.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397202"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniParc:UPI000192D9E4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD5"
FT                   /transl_table=12
FT                   /translation="MSQLKKTNLNSVNDLRQTTDDNLGLVFQQLGYNESFTLIDLKLGL
FT                   GLSTVVIAGLLFLVDKKYTWKDSYNITVIACVLYGIISGILYLINHFNKNVKYIGYDNK
FT                   GNKLAIATSSNKLDPIYNVTITLNDRSVHAALSFNKFFDVVGFFNRDAFTELVENELNK
FT                   LNKKSE"
FT   CDS_pept        complement(119079..119693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579797"
FT                   /orf_name="CD36_40680"
FT                   /product="Subunit of the secretory polypeptide
FT                   translocation complex, putative"
FT                   /function="binding"
FT                   /protein_id="CAX41955.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397203"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192D9E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD6"
FT                   /transl_table=12
FT                   /translation="MTEVAVNYDSKTKKLSLPKGTQSGTDLSALKLEIDQLNTLTQEII
FT                   NQGSDVPPAPTPDNFNKDLSKMIRKMYEGGVQSFKIGKFEESARQFTIGIEMINRRPKF
FT                   ESFQGTIQELSLFLMSRTDAYLRTKDYVKAFNDADFLLNMQLNTPDNFLRRGVANYFLG
FT                   NYEAARSDYQRGLTFDENNERLQKELTICLDKILEVNGDYL"
FT   CDS_pept        120049..120579
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579798"
FT                   /orf_name="CD36_40690"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41956.1"
FT                   /db_xref="HOGENOM:HBG397204"
FT                   /db_xref="UniParc:UPI000192D9E6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD7"
FT                   /transl_table=12
FT                   /translation="MENRAIHTSPTRWLHHYSSTTDSTNSPLRKADTRWLNKTYFPKQS
FT                   TKLGYFEEKHVMTQGKSSMFSRLLSKFRNISKKEITSPNNRSSSILSEKIHKSHSVSAF
FT                   FPSTTSKETPYENIFSPLVDKPMDTIDTIQENDCTMAFIKHDCRTESNFFSSDFFRDSV
FT                   RPVIDYDESEITD"
FT   CDS_pept        120962..122131
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000288512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079906"
FT                   /gene_name="HIS5"
FT                   /orf_name="CD36_40700"
FT                   /product="Histidinol-phosphate aminotransferase, putative "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="histidinol-phosphate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="CAX41957.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004400"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG646350"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192DAA0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD8"
FT                   /transl_table=12
FT                   /translation="MFDISAIIRPNILTLEPYRCARDDFKTGILLDANENTHGPALPSP
FT                   DEKEAALELNRYPDPHQHELKQQIISFREQNPNKYATEKLSIENLCLGVGSDESIDMLL
FT                   RCVCVPGKDKMLICPPTYGMYSICATVNDVAIEKVPLTIPDFQIDVDGILAKVKSDPSI
FT                   KLLYLTSPGNPTGKLINVEDIIKLVQESLKVWQGLIVVDEAYIDFTKPGSSMSTLVNQY
FT                   PNLVVLQTLSKSFGLAGIRLGITFSCKKLSWYLNAMKYPYNISSLTSNVAIKATNEGLN
FT                   IMENYVSKIVEQRELVLEKLLSLKYVGRNIGGLDSNFILIEILDKNGKPSNEVAKKLYN
FT                   VLATDNSVVVRYRGSELNCVGGLRISIGTAEENKQLLTKFESVLNEINK"
FT   CDS_pept        122420..123157
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579799"
FT                   /orf_name="CD36_40710"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41958.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG398535"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000192DAA1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFD9"
FT                   /transl_table=12
FT                   /translation="MARQNFVGVVISQGKMTKTVKVRVQGRVYDKRVDKEILTRKDYLV
FT                   HDEGSICKEGDIVRIESIPKISKRKAFAIAEIKVNKGQQFAAYEEMAKKQVKLEEEKEA
FT                   KNFIEHRDKFSKIITQLDDLKRMDRLTHEITSNLEDDHTKLIEEINQIKEKYNIKSWPT
FT                   TESTVDLALNEPAFSDEKEKRLYFIQYILNELMNNVKYDEIRKSIVENKLKKSIEKVSK
FT                   SIQKNVVRRYMLDTRNECPVPLP"
FT   CDS_pept        123377..125596
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384107"
FT                   /gene_name="TOK1"
FT                   /orf_name="CD36_40720"
FT                   /product="Outward-rectifier potassium channel, putative "
FT                   /function="potassium channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41959.1"
FT                   /db_xref="GO:0005267"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397205"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniParc:UPI000192DAA2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE0"
FT                   /transl_table=12
FT                   /translation="MGFRAPMNGLAKNSKSSAFASFDSVSVMHIVNKAKDKIVPDPQFH
FT                   KSITDQGIRHYQEKLSPLFQNSYHGVSSNTNEQDSPYMKSPVTLQHALNVRLESILNLN
FT                   VRPGEPYFVLWFLISSYFPLIAACLGPLANMISIVALVEHWKLDIITNKKVPDIPKVVV
FT                   MNAISLALGLIGNVSLLMNFSRSVKYLVSQSVSIIAWLCASALLAAALLVTNREFGGEN
FT                   PKYVPSEGFYFAAFTSGNYFVCMLILVINFMGFSLKKYPPTFNLDQKQRTLMLFTILFS
FT                   SWTIIGAFTMGSLIDDISYGSALYYCIVSFLTIGLGDILPKTSGAKVAVLVFSLGGVLI
FT                   MGLIVATLRSVILSSAAPAIFWNDVEKARTALLAQLERENRELTSEESFHEMRVLRRKV
FT                   KSRHKKVSLVLTITVFMIFWLIGALIFQRIEKWSYFNAMYFCFLCLITIGYGDYAPKTS
FT                   LGRVFFVSWAVGAVPLMTILVSNVGDALYDIFNDISAWFSTWMFSTKEEYTDLKRRKKR
FT                   LQEDQEDQLTVNSEAVRSSELDEDLDLAKMEREASLEASDGDSNGNIRTVSNNEEDISN
FT                   EDNDTCITNASGSNMQQDKENNSCSERSVSKSGKQDFNIERIRQKIASKKQVHEMLIDY
FT                   LEKMKPLIGDSIESPNRKYSYKQWKGAYDGFWLSESSPLRLPLKEPNYLILKIYFEIEM
FT                   MLRGLVDKEIEDLKAMTIQDVPNGSSPSASTDRNIARTIKFDDDK"
FT   CDS_pept        125959..127320
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579800"
FT                   /orf_name="CD36_40730"
FT                   /product="Nucleoside transporter, putative "
FT                   /function="nucleoside transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41960.1"
FT                   /db_xref="GO:0005337"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397208"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="UniParc:UPI000192DAA3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE1"
FT                   /transl_table=12
FT                   /translation="MSTDSAGNLTTNNTHDPTIFQIKGLLKVKLSQLKYFTFTVIGIAL
FT                   LWPWNCFLSASAYYGERFINSPSLVKVYSSTMMSVSTITSTAYNFYLSQRQTNVNYNFR
FT                   VQVGFYITIFVFLFMAVSCVADWIIDMNDVAFFIALMFMVLLSAMATCLAQNGTMAIVN
FT                   VLGGIYANAVMVGQAVAGVLPACALIISILLVGDKASDQHHRVEKNYGVFVYYITASLV
FT                   CIVSLLLLYLVTYHKNEIGYQRLDQLVEEDDSGAVEEQETVDPIHTQKKFVPFTVLWGK
FT                   LNLIVMTIFFTFGVTLIFPVFASVVESVHTDSQSRFLNKNIYIPFIYLVWNLGDLLGRV
FT                   LCGYPRLHMLIESPKSQLVYALSRLIFIPLFLTCNIHPGRSEPYIKSDLWYIGLQLLFG
FT                   ISNGQLCTSAFMIVGDYCDTDDEKEAAGGFTTVFLSTGLAVGSVLSYLLVFVVN"
FT   CDS_pept        complement(127317..129161)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579801"
FT                   /orf_name="CD36_40740"
FT                   /product="Diphthamide biosynthesis protein, putative "
FT                   /protein_id="CAX41961.1"
FT                   /db_xref="HOGENOM:HBG446814"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="UniParc:UPI000192DAA4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE2"
FT                   /transl_table=12
FT                   /translation="MSSCSVCFLLFHVNKIQSMDGLLNKSVVPGFSLNDMIVPAHRITI
FT                   KDTKTKKKKSHTSRNSQKKKKKVSIKSSPTIMSSDTVIAPSLSTAQDDGTFTYDKVKST
FT                   TKERKHLNLKNPSDTSEIKSKIWNYYSLSELIQYLSQKENNEFKYKRITLQFPDELICD
FT                   SATIVHELQRELNIAPQNSLHNSDCCQDTCEPNATQRIWILADTSYSACCVDEVAAEHV
FT                   KSDLVVHFGDACLNEIDKLQAVFVLGRPTLDVEAIVKQISLAYSPEQKVVLMSDAPHTY
FT                   LLPEIAKELPDYDILIANLPKTSRGRIIGYTPPATGYRKFNRVFNIEEVDFAEYELFHV
FT                   TSPESPRLLQLATNFASVTTYDPISGTISTGPFPNLMRRYKYVHQARMAGTVGILVNTL
FT                   SLANTKILLNTIKEKIREAGKKHYIFVVGKPNVAKLANFESVDIWCILGCDHQGIIIDQ
FT                   LNEYYRPIVTPYELLLGLSDELSWTGKWVVDYKSVLKEYGNEVIQPNQDADSDEDLPPV
FT                   FDPVTGRYVSTSRPLRQINHLMVKSNDQSHDNDNDNDSQLVKRFSNAVAIKGTVSTSAI
FT                   HLQNRHWTGLGSDYTEDENAAGALVEDGRKGIARGYDI"
FT   CDS_pept        complement(129274..130239)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000068104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079907"
FT                   /orf_name="CD36_40750"
FT                   /product="4-nitrophenylphosphatase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41962.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG646794"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniParc:UPI000192DAA5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE3"
FT                   /transl_table=12
FT                   /translation="MTIKPNPQHISSKQEAERILSKYDNFLFDCDGVIWLDEDLIPGVA
FT                   KFLEWLTKNNKRFAFVSNNSSKSRNSYLKKFENLNIPNVTKEILYPTCYSAALELQKLN
FT                   IPKGSKVWVLGHEGIVDELREMGYFPLGGNDELLDKAFDHQSPILSVDPEVKAIVVGST
FT                   KEFNYMRIASTLQYLLHDHKSLPFIGCNIDRTYPGPKGLILPAGGSIVNYMSYTSNRDF
FT                   INVGKPSKQFLDIILEDQKFDRSKTLMVGDTLYTDIKFGNDGNLGSEDENGGTLLVLSG
FT                   GTKKKDLNHFLKNRHEYKDSESLVPSYFVESLGKLIDLLE"
FT   CDS_pept        130877..132814
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079908"
FT                   /orf_name="CD36_40760"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41963.1"
FT                   /db_xref="HOGENOM:HBG330981"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="UniParc:UPI000192DAA6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE4"
FT                   /transl_table=12
FT                   /translation="MFRSMSRITRSCQSYPRHPHLRLFHSPTRLKFNQIVDNFLQDLKQ
FT                   DEQENSGGDKNNGKKSGSGKGANDRFEKFKTFLLKCFETIGITLSSVGVLGLSGFLYHR
FT                   YYNIHVLKKMNDAFEVGDPSAQLKMHTRTHDDSLDNEINAHWVDRPQQKLLNDIIAGDI
FT                   IGRYFLIIGEKGTGKTSLILESMKRVNGFNVCIFDAHADPEIFRIRLGKALNFTFNEDY
FT                   IGSLFSIRGPRDTTALLDIERAFSKLEELAIKRVNKVHKPLIMIINNAHLIKENEEGVK
FT                   LLELLQQKAESLSGSGLLTMIFNSDDYWVYEKLKQLGTRLELINVRDFNRIETINALKF
FT                   VRHRYFPKLEKLDDGLCNAVYDLIGGRPQHITQVARHRDIIKACHQIIDREKTWFLNQC
FT                   GLLGNDMDDDVMESGKFSSSAMLLMREFVEMDRQKSNPLLINSSSSEEINVSQLKNHRL
FT                   PELPLWRARQIMTRPDYIQRFDNLNIFTIDSESRVRADSVPMMRAFHEIASQPHFDQLL
FT                   EDTIDRVADIEALGRTRELVLKDLQLGSHYEMLKKKHPEGENFKFTMIKSPKQNDLHGD
FT                   FDKYNTEEINQAGEDDEDEDDLYLEEINRKDSRKWWKKRMQKYDRLFLPDDNKHSEEGD
FT                   LDINRPREDE"
FT   CDS_pept        133839..134660
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231280"
FT                   /orf_name="CD36_40770"
FT                   /product="O-glycosylated covalently-bound cell wall
FT                   protein, putative"
FT                   /protein_id="CAX41964.1"
FT                   /db_xref="HOGENOM:HBG396239"
FT                   /db_xref="UniParc:UPI000192DAA7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE5"
FT                   /transl_table=12
FT                   /translation="MKFSTAALTLSLFAIVNSSVTTYGAGFSGDDDDNSKHHKYDCEID
FT                   TFDWKFALAVKEWKHCQDKKFCQDTDLDLVYEGDDGQLYHGCDGTYPYSKCKHCTNVFT
FT                   GDDDDDANCDDDCKKKKKKVYYAKRGDDDDDDNCDDDCKYPYCEIHNTDCDLLITLCGG
FT                   VLKDEKHATGEIVANHQFQFDKPPQKDALHKEGFSIVHTEGTYYLALDHKIDFWHCKVD
FT                   DKGLYKIYDKSIGEQCSKIKLIVLKSDERATFSDDNDDCDDDCKNKKKQHD"
FT   CDS_pept        complement(135085..135480)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384108"
FT                   /orf_name="CD36_40780"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41965.1"
FT                   /db_xref="HOGENOM:HBG397190"
FT                   /db_xref="UniParc:UPI000192DAA8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE6"
FT                   /transl_table=12
FT                   /translation="MMTSRKRTFEEFSTSHSFSFSEDTSTTKTNIFNCLPPSSPPPAET
FT                   TNSNYNVFPTSINNRSDGEKRFQKHKIHSEVHTHTIEIMMNAQLQLQRQEKLQCQQPPP
FT                   PQQQQEEVKSDSEGSNEESTYYQRPYW"
FT   CDS_pept        135737..136246
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079909"
FT                   /orf_name="CD36_40790"
FT                   /product="Subunit of ribonucleases P/MRP, putative "
FT                   /protein_id="CAX41966.1"
FT                   /db_xref="HOGENOM:HBG397189"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="UniParc:UPI000192DAA9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE7"
FT                   /transl_table=12
FT                   /translation="MGTNTNNLHHQSSNRIQGKRHIKHSPNLTPFNETQNASNFLIKSS
FT                   TPYISAIKQITKKLNKFSKSKNSHTVNKFQNEQYKTIKYITVKGMGKTIEKVASIGIHF
FT                   QKDYKVDVLTRSITVLDEFAPIESNQEPKNEGSSHNDDEEDEEEDTIYEKRTVSSIEIR
FT                   IWIKRD"
FT   CDS_pept        complement(136302..136850)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579802"
FT                   /orf_name="CD36_40800"
FT                   /product="Uncharacterized protein YPL108W homologue,
FT                   putative"
FT                   /protein_id="CAX41967.1"
FT                   /db_xref="HOGENOM:HBG448735"
FT                   /db_xref="UniParc:UPI000192DAAA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE8"
FT                   /transl_table=12
FT                   /translation="MASDSSSILPHEAISGLTLYSDDEDKSSQQQEPKQQESNSTITPS
FT                   KKKRQRKIQTEEEYNYQLNRWRETGPMINTDTWLNELNLADLDINDKLDRVKLLHVCEL
FT                   HYYKRDYSTCLKVINIGESLYGVDLNKVGHKIKQLHDKQMIEDEDDEEEEEEVKWDKNI
FT                   EKNIAELYHIKMKCLAKLS"
FT   CDS_pept        141641..143548
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094031" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231281"
FT                   /orf_name="CD36_40810"
FT                   /product="Uncharacterized zinc finger-containing protein,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41968.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397188"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DAAB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFE9"
FT                   /transl_table=12
FT                   /translation="MMDIYQKALKNPDPPKKPTSTTTTPPSSTSTDYPTRLPPINYNNT
FT                   NVNSMNYNYSPDNGSITGNTAITDTNTTTTTTNVSNENSNSNSSTNSPNSRPASTHTSE
FT                   EIKNTVIKKKKNSRRKHRNSHLGCGTCKKRRIKCDETLPACLNCLKGKLHCAYLNLDNN
FT                   ARNALRVAQYNQTIRQEKLDANSSSSTANITNNTKLIDPLKGNILVQQQQQPGLVQSLG
FT                   HGISIIPPHPSTSAGAAAAGSQNNPLMAAGPGSYPIAATVLPNNQTLVTAVPQSSQASM
FT                   TMPPFANSILAPGIQANASPPISTTNLNSSITNSTSTTNTNTGTDITPSGSTSDNVQNI
FT                   ASAPQVVQSPYGPMIPLLTQTGSVVYAPTHSLVPAQPSQLTPQQLSNNVAFANATVPAT
FT                   GPLAPTLSQPSILPTTTATTHTTSPSIPTSVAPLTVSRTSTSSGIMTNVSPVLTNKQQP
FT                   SSTPITSSAASVATIASQSIPVKTGNGTLSTTSAGSPTTATVSPPNIASILPPPINTLG
FT                   NNSNGAGSNSGNDVFKQSVSDPPIKELKPINDSNSNSPSLPPLSSTTPATGNPSEGVKL
FT                   SPNSSMTNLKKLTIKEDNNSGNDIKLPSITTLKRETSKSPSETNGAIDEKVPTISKLIT
FT                   "
FT   CDS_pept        complement(144137..144877)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579803"
FT                   /orf_name="CD36_40820"
FT                   /product="Translation machinery-associated protein,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX41969.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG436297"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="UniParc:UPI000192DAAC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF0"
FT                   /transl_table=12
FT                   /translation="MTDIEPKSILYCGICSWPPEFCEFGITKKKCQTWLNENHPDKYPS
FT                   IYPTGGDLSSSSTTTNELDKDTKSNTIDKKDIIGENNDGKDENNNNNDIVTKKLLEQGV
FT                   SELSIAKEEKLQKELNKRAAKEELKLERKQLEKISNSKIIIKKISRNKKKSIVSISGLE
FT                   ILETTTGTTTSNNKVSIKSLQKKFSSKFATGTSVVKNAENKSDILIQGDVFEEVHQFII
FT                   NLLQEQGLNDIKIELTDDKLKKKK"
FT   CDS_pept        complement(145315..148524)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579804"
FT                   /orf_name="CD36_40830"
FT                   /product="Conserved hypothetical protein "
FT                   /function="binding"
FT                   /protein_id="CAX41970.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397187"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192DAAD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF1"
FT                   /transl_table=12
FT                   /translation="MYIESSINEKYIRTLNFGCFPKNVLEFQQSQDYFQQLIFIDYQLQ
FT                   LLIDNEFFQNELLPISLLSENNVSANEKLQQLINYSNSISLNYENTPKSYDEKLYYATL
FT                   MSHLYYLQDNLFEVNKHLNLVKVSYQARSNNQIETVSSASSVSFNQIEFIEYLTTRYYV
FT                   LFGLSAGNNGVNVWLEYLQNFKTPFNKSQVIANHWLDLLFGKLALELSQQGTIPFSFIN
FT                   HVKNLSLSKNKLALIAFSNYLLRPENSSIINASFKQDYTVFLTTEIEESILVKSQFPNA
FT                   NTANNDESQDINNFINNLYESLSYVPFNLSILKPSLSKRYLLNATLKTFQSKIILSNLI
FT                   YTLIDLNEYDEALAAFTTYIDYLEKDEELKDGYIDDILSIIDTFSTCIIHFNPLKSFKS
FT                   SNKFKHNDDSLVFQQLKKFVTLLQKYLNELQKLIDLTYDEEEEEEESGNGNGKTTAAGD
FT                   KNPLSFLYRKYNLNILQSDNTQFIELISKAWYAIGYYYYYLSSYESSNQNILQHNISMV
FT                   LKTYKNSLIVNSTGNVLYLFSYALALANSGSLKPALKLSKFILKKFPESFKTWNLLVLL
FT                   LSSFDNDNSDTNKPIASHTSVNILPDELTNGNGANGGLTANGSNDNKSKLREPEKFISK
FT                   ALNIAGLYILKHRQRNIKLTVETKYEILQLKLTQLAVLESIHGSQYMIDYLSEVFVLYH
FT                   ELFEVNLSSNSNKNAAIQSSRQFGASDKWSHRPSFIDPSPNAKKNPHHSNKEIDELQFF
FT                   DAPKLSINNDGDSITELNKKQSRTGSISGGSRVEKLKRLSTTISSKEGPISRRGSLLYN
FT                   SVQQKIRKSDSKSTVNKSFAVDNSGSQQQQLEDENSHFDQPKLPLHPPEQHLSKPSKPA
FT                   YIKDPPRRQHDNLIERKILQQVWLWTARVFLKVGLIDECEQCIVEAETIYEPNFKTYTA
FT                   LGFLTSKSRKFLSLQEFERSLEILTKKDNSLSSYNKYNSKYDYGLTLLGLSKLFLIDDD
FT                   PKNSLFISTKDLNSGIIRLKNLLEDYSLTWPYGYNNPEIWFYLSKIYEFIDDKILLTKS
FT                   LWRCIELEDKRPVREFIFDEL"
FT   CDS_pept        complement(150131..152272)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384109"
FT                   /orf_name="CD36_40840"
FT                   /product="DNA mismatch repair protein, putative "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41971.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG631009"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192DB4F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF2"
FT                   /transl_table=12
FT                   /translation="MTEPTCTIKRLDESVINKIAAGEIIIQPANALKEMLENSIDAKAT
FT                   MIEILVKDGGLKLLQITDNGHGISKVDLPLLCERFATSKLSKFEDLESIATYGFRGEAL
FT                   ASISHISRLSVITKQPDSKVAYKAYYMNGQLCSSNFKPSNTNVEPKPIAGKDGTQIIVE
FT                   DLFYNIPSRLRGLKSKSDEFAKILDIVGRYAIHCETVGFSCKKYGDPLQQVNTRPSMPI
FT                   KERIRVVYGSGIANELLEIDGISNGELGLVKVSGVMTNANYNNKKKIQPIFFINHRLVT
FT                   CEPLKRAINAVFSYFLPKGSHSFYYLSLEIKPENLDVNVHPTKREVRFLNEDEIIDIIV
FT                   SEIHTKLSSVDTSRKFKTQSIITKRRNSNEELEEHSLPKASQPSLKKYRQENKMVRVDA
FT                   SQSKLSSFMQSQPSSNYHDVMKKEFEYYSSSIVEDDTINTEQDIPEKESEEEPPNESNS
FT                   ILESPSKIATKIETNHLRQPVQVNLESIASLKNDLTLIIDKPLTNIFNNAVYVGIIDPL
FT                   KRLCCFQYDVKLFLCDYAAVLLEFYYQIGLHEFCNFGEIEFDEPIKLIDILQPLYDKND
FT                   DLIPMDKVIDSVFLMKDMFREYFQIIIDNDKQLTTLPMLLVGVEPDFNKLPYLIYRLGA
FT                   KINYGDEKDCLKGILRQIALFYLPEPTNDETKNNAFENQLESILFPEIKRQFLAPKNLL
FT                   RDVIQIADLPGLYKVFERC"
FT   CDS_pept        152477..153607
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579805"
FT                   /orf_name="CD36_40850"
FT                   /product="Non-structural maintenance of chromosome element,
FT                   putative"
FT                   /protein_id="CAX41972.1"
FT                   /db_xref="HOGENOM:HBG397186"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniParc:UPI000192DB50"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF3"
FT                   /transl_table=12
FT                   /translation="MTDTQPRKLRKVTTQEQIEDYEKLRQRIKNHFKDALKGKGSAMSL
FT                   HYIDEITELYKRVQSQKVRDTRVHLEDSEVFKEASDFAALNARNIVFDDSGIALDDREF
FT                   FKCLRRFAVTDPSLLSRNDIGDNNDHDSYVNAEDDDDDDDDDDDSDEEEAITDEYTFNK
FT                   TNWLKLGILYHQVSKKSISVDFLNGPLKAEKRKIVRTRNVDDTKSSGLAKTARQVQASD
FT                   ISGNEEQNTANMVKSVYQTYIEKYDGNGVNLFKFFINPRSFGQSVENLFYTSFLVKDGR
FT                   LKLYVNDEGVPCIQRVSSDEIREAQLESNKIFTSHHIASFNYKAWKKYTQLYNIREAFL
FT                   GHRDEPEDQMPPEDIIDYTEDEPIPTSQRRDSNLSE"
FT   CDS_pept        complement(153670..154992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000109570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079910"
FT                   /orf_name="CD36_40860"
FT                   /product="Metalloprotease, putative "
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41973.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniParc:UPI000192DB51"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF4"
FT                   /transl_table=12
FT                   /translation="MILNTFKIRCSLPLKRIPASLRTYRVMAIESSCDDSCVALLEKSH
FT                   PDTPPKIIDQFKRTLHSADIGGILPTAAYNYHMATIANMVQEFCSKHQISALNPPDLLC
FT                   VTRGPGMAGSLSTSTEFAKGLSVAWGVPLIGVHHMLGHLLTANLPKSEQPDSPPPKYPF
FT                   LSLLCSGGHTMLVLSKSLTEHEIVVNVGDIAVGDSLDKCARELGMYGNMLGKELEKYIN
FT                   SIPEETRNRYEKLSVNTRIANPYNFRLTLPYSAPKYGIPEDVKFAFSHFLSNIQEYKAM
FT                   HYNKSGGGEIDVALDEETKQFIAYKTQEFIFDHIVDRINIAFKKHGIKNRNSDGTFIGV
FT                   KDFICSGGVAANKRLREKLRENLDFQEIGADNVNFHFPDLSLCTDNAIMIGAAGIEIFE
FT                   KLRLRTDLSFLPIRKWPLNKLLDVDGWVRVEEEEFNRICKY"
FT   CDS_pept        155778..156869
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079911"
FT                   /orf_name="CD36_40870"
FT                   /product="Transporter of the mitochondrial inner membrane,
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX41974.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325384"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192DB52"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF5"
FT                   /transl_table=12
FT                   /translation="MSQIFTSSTIPLTFESREHKEHHNIRNKPPSSQPESRENETLQPI
FT                   WQCMLAGGFGGVVGDSAMHSLDTVKTRQQGFPYKVKYKHMIPAYSTILKEEGFFRGLYG
FT                   GYTPAALGSFPSTAAFFGTYEYSKRVMINKWHVNETLAYFIAGILGDLASSIFYVPSEV
FT                   LKTRLQLQGKYNNPYTKKCGYNYRGLWNAIVTIAKTEGPKTFVFGYKETLFRDLPFSAL
FT                   QFSFYETFRQWAIYSNNGSDDLSISMELLTGAAAGGLAGTLTTPLDVIKTRIQTATNTS
FT                   ELSSSISTKQTITNPIIRLLNRNATLKALVSIYKHEGILGAFSGVGPRFIWTGIQSSIM
FT                   LLLYQVALKQLDILSDDRDKLES"
FT   CDS_pept        157450..158322
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17579806"
FT                   /orf_name="CD36_40880"
FT                   /product="Peroxisomal-2,4-dienoyl-CoA reductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41975.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192DB53"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF6"
FT                   /transl_table=12
FT                   /translation="MPNTLDKSYLEKSVWKSDIFKGKVAFITGGAGTICRVQAEALVLL
FT                   GANVAIIGRNAQKTEDAAKEIATLRPGAKVIGIGNVDVRKIQTIKDAVDRTVKELGRID
FT                   HVIAGAAGNFLSDFNHLSSNAFKSVIDIDLLGSFNTVKVCFEELRKNKGSVIFVSATLH
FT                   YYGLPMQLHASAAKAGVDALSNALAVELGPLGIRFNCIAPGAIGGTEGMSRLAPPSEVP
FT                   MESKIPLQRQGTTTDIADATVYLFSPAASYVTGDVLVVDGAWWQVGGFLGDLYPSLVIH
FT                   QNEDPQGKL"
FT   CDS_pept        158554..161457
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579807"
FT                   /orf_name="CD36_40890"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41976.1"
FT                   /db_xref="HOGENOM:HBG448738"
FT                   /db_xref="UniParc:UPI000192DB54"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF7"
FT                   /transl_table=12
FT                   /translation="MLVKTFRYTHKPIDERKKTETIDEQTLALNKYLPPQKKKKEKQKE
FT                   KKRILYPLIINNKMTDRFGRQKSTRWVNSVPTYGDWGDDDYEDEYTYQEDNSSQQQRKV
FT                   TPQRFELPSDHVPPVPVIDEKYKNFTAENNIESNVSQPKELVLSVDGQTNLESDSSDEE
FT                   SEIISQGCVSPYKQANKQTFGISQNFDEKSTTPGYSVNTPVIVSNNGSDSNVERNDNNE
FT                   EDNKNFTRALKEIQSKESHHEDLEKLELQHRQKDESESDKQVSESSSTKKQPNLILSVD
FT                   KHKNIYSDSSDDDDNDDDMGSSLNFGASTHSLGNIAKATTSKNNVTTLEVQSKEGHQFE
FT                   PPTPTYSYSQQSSNLPPESPSMESENSFNSEYSFQREPVSLQLATHHEEIETMSPKKDS
FT                   LPEPNEQIEELNTAVKSPQPELVLSVDKPDFKASDDEDDDDDYNWGYNSQSSSNDEKEA
FT                   LNVPGENSASDIDSFIDNLNKVYSGDPSAEVLPPIDHDLSLPDFENTSFSKYEDDDEDN
FT                   YSPIKPLAVSQQKEAHDDYLSSFSGRTQSIRKPPRHSAIFTDDFSGIPNDETEKATEEE
FT                   KDDSITEDSVPAIAQTNESEFEQKALGNNNTELAPPELHPVASSGSLSTGKLSLDTASQ
FT                   KQQEAQEEESITKDIKDSRRISTSSNATFNLGGWAPNTDNFRNQFISENDNESVNFNTD
FT                   RSGYDKFTKVRTESSLEEENVNASLPSIPETIDAVMPIIQEDGGSEEEGEGDDDQEKDD
FT                   VQDYNGDSQSVLPTITMTSKSDSVLNEHFYPKPLFKEERLTPAASKENLLPQKYNSLLP
FT                   PENRRASDSSEVSERQRSESTSTVTTNSTVQVTPKELVPGKYPVSDWKSIVTISQPIDR
FT                   IAAFKDALHKEQQYDSKLTSWLHYALKRSPNTSTNLSIGRVASQAYQNAEHNDLRRHAS
FT                   FRSRVNIVKDKVEGTGSFGKKLFSRSKKFIKSTTGDK"
FT   CDS_pept        complement(161727..163865)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579808"
FT                   /orf_name="CD36_40900"
FT                   /product="Sphingomyelin phosphodiesterase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41977.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG756508"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000192DB55"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF8"
FT                   /transl_table=12
FT                   /translation="MQANFLIAFICFAVAAVIAQVVPNVEQLKAQSLQKRDEDLMEPVF
FT                   RNLPSKDYDYIMLQLKQLQIAKGNVSKCDQCKNKMRFVKKLIDEKPEKAHLTTLMMYKD
FT                   CVLNTTPYMYCTIGNFFVTTKAYTDKKFDQKFESGIDGYDVVNFLDNDFLDFLGRFNTS
FT                   DEFDLEYYCHAQMGSCDLPDLETVVDSFNIESWWPEKKPQHYSEPIYNKTNRERFNVLH
FT                   MSDAHIQFTYEQGNEAKCSQLVCGLTKSFNNKLVEKNYNFTSAFAADNPNKSPKDFKFS
FT                   FYPDAHYDGEKYVKGEYYDFPKSRGWNFNFQPATVFGAYLSDTPEILVNNSLIEMAKMH
FT                   KEKNFEFALYNGDTAEHDLQSVTVDLVKSEEIRTFKAMRQYLNGIPVLPSMGNHDTAPY
FT                   GLLAPLKLDYNNSYSWNNNEMVDVWIGNEWFEKSEKQTMKDHYAAFSYETERGLKIITL
FT                   NSNTYYQSNTWRFLNASSDPDLFGGWKFLVDELIESEKKNQRVWISAHVPPNKDDVMPI
FT                   DSLIFQKIVRRFAPYTIANLYYGHTHNDQKIVAYSDAKSPKPNQPITSAWVIQSLTPFG
FT                   NHNPAFRYYEVEDESFNIINSFNYYTKLNETYVNGGDEPVWEYEYSARAAYDPNNEWPA
FT                   SAPLNATFWDKFAISKMKDPTNIKFNQMYTDYQYRFSPYTPNCTHPSGKNITTSCYVNN
FT                   YCNAANLDIVSVEECMKK"
FT   CDS_pept        complement(165137..165634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579809"
FT                   /orf_name="CD36_40910"
FT                   /product="[PSI+] induction protein 2, putative "
FT                   /protein_id="CAX41978.1"
FT                   /db_xref="HOGENOM:HBG626450"
FT                   /db_xref="UniParc:UPI000192DB56"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFF9"
FT                   /transl_table=12
FT                   /translation="MTIIYDFITRRDVRDTISNDADKVTSFAKSFKNYDTCMANTGCKI
FT                   VFIVGCVLLGLLVIWAISTIVQCLCMGVKCIEACCCCCCRNQNNATYQQPPQTYINPNM
FT                   YPDAQYNQRYAYQPQPPPTSAYPGPSNDSVKSEYGYTNHDGYEPVNNNTNYQSPFNDRY
FT                   KY"
FT   tRNA            166387..166457
FT                   /gene_name="tRNA-Gly (TCC)"
FT   CDS_pept        166614..168257
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536890"
FT                   /orf_name="CD36_40920"
FT                   /product="tRNA nucleotidyltransferase, mitochondrial,
FT                   putative"
FT                   /function="RNA binding"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX41979.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG619392"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniParc:UPI000192DB57"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG0"
FT                   /transl_table=12
FT                   /translation="MFRKGLLRFQHTFTHTMKRLVSNSIVLTTTEENIRNVLVGYCDYY
FT                   NKTNNDSLELRITGGWVRDKLLGNESHDIDIAVNHLTGEEFVNGLHDYLRQHEPELSMN
FT                   HVHTIKMNPEKSKHLETCTTKLFGVDIDFVNLRSEEYTHDSRVPSIEFGTPEQDAVRRD
FT                   ATLNALFYNLNQGQIEDYTKRGLSDLQNGILKTPLAPIKTFLDDPLRIIRLIRFASKFN
FT                   FVVESETLNAMKEEHNKSALSTKISKERIEIELRKILTSNNPGYGLQLINYVDLASSIF
FT                   YVPELAKEFDNESLEQARSQLARHIEIASLIYPNFKQTIMNSTEKFKKEFSALMANDDY
FT                   KSVFWLSVILHPYTNVKSHKPNRDIFNQYLRLGLTSKKSDIAKVSAINMNSAELSRLFS
FT                   APELVKRSDIGLYLRKFPEFASLNLIVNALLDCVRNVDQFIQLPKELPVPFPEVGEKIL
FT                   KDENINKVISDVVSRYEKLFIQIENWDLTNVHLVKPLIDGTTLSKSFGMKPGPWLRPTI
FT                   EEILVWQLDNPQSSVDECFEFVKTIIPKYK"
FT   CDS_pept        168570..173222
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384110"
FT                   /orf_name="CD36_40930"
FT                   /product="Pentafunctional AROM polypeptide, putative "
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /function="3-dehydroquinate synthase activity"
FT                   /function="3-phosphoshikimate 1-carboxyvinyltransferase
FT                   activity"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41980.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="GO:0003856"
FT                   /db_xref="GO:0003866"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG398536"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR002658"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR008289"
FT                   /db_xref="InterPro:IPR010110"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="UniParc:UPI000192DB58"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG1"
FT                   /transl_table=12
FT                   /translation="MSIERVPILGKETIHVGYGIADHIVNEVIANLASSTYVIVTDTNM
FT                   ARTPQYSKLTDDFKTNLSKKRPESRLLTYCVSPGENNKNRVTKAAVEDFLLQQGCTRDT
FT                   VILAVGGGVIGDMIGFVAATFMRGVRVVQVPTTLLAMVDSSVGGKTAIDTPLGKNFIGA
FT                   FHQPEYVFCDVSFLETLPARQFINGMAEVVKTAAIWNEEEFTRLENFSKKFLSVVTSKK
FT                   PDLQSIKAELVKTVLESVRVKAGVVSSDEKEAGLRNLLNFGHTIGHAIEAVLTPEALHG
FT                   ECVSIGMIKEAELSRYLGILPPVAVARLSKCLVAYGLPVSIDDKEFLKKVGPKRHYVEI
FT                   DILLKKMAIDKKNDGSKIRCVLLEKIGKCYQLKAHQVSKQDLSFVLTDEVLVHPFTNPP
FT                   KENIIVPPGSKSISNRALILAALGNGTVRVKNLLHSDDTKHMLDAVASLKGAEISTEDN
FT                   GETIVVKGNGGNLVTCGEELYLGNAGTASRFLTTVASLVGKSPASDDVILTGNARMQER
FT                   PIGPLVDALRSNGSEIEYLNKQGSLPLKISAGNGLKGGRIELAATISSQYVSSILMCAP
FT                   YAKEPVTLALVGGKPISQLYIDMTCAMMKSFGIEVTKSTTEEYTYHIPKGIYKNPTEYV
FT                   IESDASSATYPLAFAAMTGTSCTIPNIGSSSLQGDARFAVDVLKPMGCKVEQTATSTTV
FT                   TGPPRGHLKPLPHVDMEPMTDAFLTASVVAAVAKGGSTSITGIANQRVKECNRIEAMVT
FT                   ELAKFGVSANELPDGIEIHGIDIKDLKTPEISDRGVCSYDDHRVAMSFSLLAGLCKEPV
FT                   LILERSTTGKTWPGWWDILHSKFKIELDGYEPPFNTDKHVIKSSDKGVIVIGMRGTGKS
FT                   TLSEWLASFLGFKMLDMDKYLEEKLGTDIKSLIKAKGWEHFRKEEAIVAKECFTKFSKG
FT                   YVLSTGGGIVEGEDARQQLKSYADNGGIVLHLHRDLDETVTFLAADTTRPAYSSEVQEV
FT                   WLRREKWYHECSNYHFYSSHCSTEDEFNHLRKSFVNYIKLITGAERSVVPTGRSTAVVL
FT                   TLPDLNNVAGDLESITIGADAVELRVDLLKDTSAAFVAAQIATTRKHADLPIIYTVRTV
FT                   SQGGKFPDENVDELKSLLLLGIRLGVAYIDLQLTAPNELIEEISSKKGFTRIIGTYQDI
FT                   NGELKWNNVEWKNKYNQGVSMNADIVRLVGRANSIQDNLDLEDFKKQNTLKPLIAFNLG
FT                   TQGKLSQVLNGTFTPISHQLLPNDDGLLTIGEINQTYFDIGGFTAKKFWVIGSPIEHSR
FT                   SPNLHNAGYKALNLPYQFGRFEATDVDVVYDNLINKSDFGGLAITMPLKLDIMKFATKL
FT                   SDAAETIGAVNTLIPVEGGYFGDNTDWVGISNSFIRAGVPPKSSSNGLVVGAGGTSRAA
FT                   IYALHQMGCTKIYLVNRTVAKLEELVKSFPKDYNLEIVETEQQADKVNKVLLAVSCIPA
FT                   DKPLDSDVLKKIERILSNGSEQVAGFKPTLLEASYKPRVTPIMKLAEEQYKWKVIPGVE
FT                   MLVNQGDRQFKLHTGFSAPYEIIHRAVVEE"
FT   tRNA            complement(173432..173502)
FT                   /gene_name="tRNA-Gly (GCC)"
FT   tRNA            175188..175258
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        175427..176344
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579810"
FT                   /orf_name="CD36_40940"
FT                   /product="Subunit of Elongator complex, putative "
FT                   /protein_id="CAX41981.1"
FT                   /db_xref="HOGENOM:HBG397180"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniParc:UPI000192DBF6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG2"
FT                   /transl_table=12
FT                   /translation="MSLNNPSQDLIFFKDNSLISKKILNNEINTKSKNSNSYLSVITYN
FT                   QSTSPNWLINGLIEDTLFGNASKSLNNHELSNVSNESISNTNRRIMVISFLHNKEFYIK
FT                   NCKRIGINLEDKQEKEGKFQFIDYFNDLFINLIKNPNDALKDINKMFDDIINNSSLDKN
FT                   DDDNGSDVDVIILEGVEILLFATNIASNELLFNINRLNKKCRQLFVVSSKDCLKKHEEL
FT                   VTPSADPMVKINEFLIKLLHRSQLNITLEPLITGRAKDITGSLIISKGCIPYDDNDENL
FT                   SVSINEKEYVYHITKDSQVKLFYR"
FT   CDS_pept        complement(176363..178390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231282"
FT                   /orf_name="CD36_40950"
FT                   /product="Lipase, putative"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAX41982.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="HOGENOM:HBG397179"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI000192DBF7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG3"
FT                   /transl_table=12
FT                   /translation="MIRTLITTTIIPIIAYIINNTPSYIWAIIDFIMDICFFWVKQLYQ
FT                   IYNRKDPLKEYVKQLKTAPNYNDWKEVAYEVDKLTNMDLWRQNFISKHYDYVLIDERLK
FT                   LLREARLNQDSQVMMSLLRSGLIRNFAGVAQKRLYLKSYMGTKFKIEEYINEVLNCLDY
FT                   LNEALNNDNNDEYIMNSKQLKLDFFHDARQSFGCSALLLQGGSLFGLCHLGVVKALYFK
FT                   GLMPRIIGGSAVGAAVASLVCTLTDEELIPILVNIGDLMKNIDLLNHEIDERYGNVIEN
FT                   VVKKGYSQEILLFLKFVRDTIGDLTFEEAYMKTEKILNIVVHPTNQCVPSLLNYITAPN
FT                   VIIWTAIYASIGTGVLSDDVALYVKDFNNEIVLQTPDVDVKFLKPQDVTYHQQYFKFKP
FT                   HDNFSGGVGGGGGTSSGGSSSNGVGSGSGNSSSSNGIPGDGEKPTTNIVLQQQSPYTKL
FT                   TELFNVNHFVISLARPYLAPLISNDLQHYHEYGKIRYDKNTSTAATSTVANNNNNNNDS
FT                   YGINKRKRTSSGGGAGGGGGSGIEFTKKKDIEKYTQDATSYNLMKKLKTIIGMEIQHRL
FT                   MVMNKLGLLTDVMKRFFIDEKPPTLQSLASIREVTIVPELRYLMKDFGRVFDVHKTMEN
FT                   IPYWVLVGERSVWPLFPLLWSRCAIEFALDDLYNLHRKRG"
FT   mobile_element  179639..180531
FT                   /mobile_element_type="retrotransposon:kotuku H and J,Tcd32,
FT                   LTR"
FT                   /note="internally-deleted and rearranged element"
FT   CDS_pept        181772..183025
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579811"
FT                   /orf_name="CD36_40980"
FT                   /product="Conserved hypothetical protein "
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="CAX41983.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG397178"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="UniParc:UPI000192DBF8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG4"
FT                   /transl_table=12
FT                   /translation="MSSARKILLQSILTTSSKQLTTLTSIRPTYSIIIKQRNYSGSSIF
FT                   KGARNYFLGFRNNSGEDSQTSNNNSSMHYDSVDESIPYVQYPLFTKEQLKKIATDKFNL
FT                   QVGHASFGYHSDSIVPSINSLSDLTDPTSLNSLLPRRRPQGSPSDTLSIKAGDDTMLVS
FT                   PTVIAVADGVSGWESDGITSSSGIWSRSMVETFSRLMTEYKLNHFPHYLNQRDIQEILD
FT                   DSYLHTSHLMDLQKLNGSSTLILGMLNGDLLSIISIGDSKIFIIRDGKIILTNEEQTKA
FT                   GLCPEQIGTHTLDHLPSDIAWIKSFKLMEGDYILMCSDGISDNLYEWEILNYLNDWINA
FT                   KRNNVKTIASKLLIKAKEVAFDDYAYTPYNEKVNSLSNTGSGGTNHQHSQGGKVDDMSV
FT                   IIAKVELNKKDGSKLIIN"
FT   CDS_pept        complement(183342..198317)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164494" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579812"
FT                   /orf_name="CD36_40990"
FT                   /product="Midasin"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="transcription factor binding"
FT                   /biological_process="regulation of protein complex assembly"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41984.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0043254"
FT                   /db_xref="HOGENOM:HBG330810"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR012099"
FT                   /db_xref="UniParc:UPI000192E39C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG5"
FT                   /transl_table=12
FT                   /translation="MNNHITISFNQVEELYSTYKSFYTLKKLPTQLFTFNKSVSLDENL
FT                   NQLSLLALDHSLPTYYCYKPIFLELIARWVNKTVEFENKYTKSKLETRKVPGSVVLLAL
FT                   SRLLQISTEYLNLFELFLSQNAFWDNIDIERYELESILLAFYRLLKFDTNRFKAFIKPK
FT                   ALYQIINKSGNEFQVSKFLAIQILSIYLQASEISKNKMIDTHLPKDKDLKSNYEGEIVD
FT                   YYFIALLEAKRTSNFLTLPEVEYNSNPSKTNSIQIPPESLSSTVTSVCGVLVPHLNISK
FT                   SQSVSSQQEETKFVPTNSAVEVLRKLASSVQFNKPVMLYGKAGSGKTFLINQLANYMSY
FT                   SDSIVKIHLGEQTDAKLLLGTYASGEKPGTFEWRTGVLTSAVQEGKWVLIEDIDKAPTE
FT                   VLSVLLTLLEKRELSIPSRGEVIKAKNGFQLFSTIRTSNDSRKDSIPDLIGIRLWELIK
FT                   VEVPNEVDLKNILVTKFPLLINLIGPFIKCYNEIIRIYSLSSFVTLNKGSHPRVISFRD
FT                   LMKFCSRCNNMLMVEGISKPDQLLESSIFDNIFAEAVDCFGSAITEPQALTPLINVIGE
FT                   ALEIPTSRINLFLSKHVPLFINDEEKLKIGRAVLKKTAQDKALYNKRSSNNNTSFARTN
FT                   HSLRLMEQIAVAIEMVEPVLLVGETGTGKTTVVQQVAKLMNKKLTVINVSQQTETGDLL
FT                   GGYKPVNTKTVAVPIQEMFENLFIGTFSEKKNAKFSKILSKCFNKSQWKNVVKLWREAL
FT                   KMAKDILSEPESEQEEDGGPRKKRKLKSFEKSVLLEKWIEFEKKIKEFEIQSSTLDNSF
FT                   VFNFVEGSLVKAVRNGEWLLLDELNLATSDTLESIADLLADTVNQRSILLSERGDVESI
FT                   KAHPEFRIFGCMNPSTDVGKKDLPLSIRSRFTEIYVHSPDRDIQDLLAIIDKYIGRFAV
FT                   GDEWVGNDIAELYLKAKQLSETNKIVDGANQRPHFSIRTLTRTLIYVCDIVSIYGLRRA
FT                   LYEGFSMSFLTLLDRKSEDILKPEILKHTVDRLKNSKSVMNQIPPVPSSNPDDYVQFKH
FT                   YWMKHGPQEIVPQPHYIITPFVEKNMLNLVRATAGRRFPVLIQGPTSAGKTSMINYLAN
FT                   ITGHKFVRINNHEHTDLQEYLGTYISDSTGKLVFKEGVLVEALRKGHWIVLDELNLAPT
FT                   DVLEALNRLLDDNRELFIPETQEVIHPHPDFMLFATQNPPGLYGGRKVLSRAFRNRFLE
FT                   LHFDDIPQDELEIILRERCQIAPSYGKKIVEVYRQLSVQRQSTRLFEQKNSFATLRDLF
FT                   RWAMRDAVGYEELAANGYMLLAERVRKEDEKEVVKKTIEKVMKVKLDMDEYYKSLEVEA
FT                   IFKSDSSIVWTKAMRRLAVLVSTSIKYKEPLLLVGETGCGKTTVCQVVAKFLGKELITV
FT                   NAHQNTETGDLLGAQRPVRNKYETQSSLFNHLIELFAKLGIETTDSSLTLDNLLGQYRK
FT                   ITIPEEHQELVEQIEAETKNVSLLFEWSDGPLVRAMKSGDFFLLDEISLADDSVLERLN
FT                   SVLEPERSLLLAEKGTDDAFITASESFEFLATMNPGGDYGKKELSPALRNRFTEIWVPS
FT                   MEDFDDVSQIVESRLKHKQLTTSIVKFSEWFAKQFGGGHTNNGVISLRDILAWIEFINS
FT                   CPDNLNPMAALYHGASMVFIDALGTNNTAYLAENESRLQNIKQECVFKLSSFADYDLTE
FT                   FLANQIQVNVGLHDLVAGLFSIPILEGSQHNKSFNLEAPTTAANAMRVIRAMQVKKPIL
FT                   LEGSPGVGKTSLITALASATGNPLVRINLSEQTDLVDLFGSDAPAEGGKAGEFVWRDAP
FT                   FLRAMQRGEWVLLDEMNLASQSVLEGLNACLDHRGEAYIPELDKSFKRHPNFTVFAAQN
FT                   PQYQGGGRKGLPKSFVNRFTVVYVDTLKAEDLNMISYHLFPSVNKNDCSRLIEFMSQLE
FT                   EQVVIKKLWGAQGGPWEFNLRDSLRWLSLYTSGNISQDIQLSDFIDMIICQRFRNEDDR
FT                   LHAQKLFKSIFGEIIERDNYFNSSESFVQAGGALIGKNDLIQYVNGGNLLPLQCNFKFM
FT                   ETAFRCISNNIPLILTGPTNAGKTDLVRYLANLVGAKLDEFSMNSDVDSMDILGGYEQV
FT                   DLSRETNALFEKTHKLINELIVMNLRYQESNADILAKALELLEFIEKHNSNGSSFEQFY
FT                   AILSGFSNYHSIPEIKDLVNTAENLAHKLNETASVRFEWFDGLLVQAVEKGNWLVLDNA
FT                   NLCSPSVLDRLNSLLESNGSLIINECSLEDGQPRILKPHANFRLFLTMDPKYGELSRAM
FT                   RNRGIELFMDSLEQRATEFDRQILGLCYLGSSTTDESLQIKIEELDISDKKVVPTSGFN
FT                   FNKESTLKQFSLIDDAFSSGNVSPSALWSFIQLNNFPLLKDWANVVFSSSEFAQSSKRY
FT                   AEQLRDTLEYVEQTSLVDISLSVYSPVDVVANNIVQKNIAFTESQGFHFLTNIYIVASI
FT                   LKSHPAITTSESTMIFEVLREIVELKDIVSKIESNAMDKKVHELSFIEKSAASALGRQI
FT                   KSPPKLELFRFVKSLQGFIISCFLDSFKTDLFTGVIYQPLHELLLVLIGMIKAGHEKNE
FT                   SRLKVYQELIVKWSDKYLSTQDRAELSKQYQTAISIFNSQFALNKGAAINEIWEYCRGL
FT                   YPQDFNAWEDLQRLYKVIADFDTVSKLQFPESSDIVTSFGYSIADLYKSIISGEYERDE
FT                   LSSILEKLEQGIEQLSTVSESFVNPRVNIFVDDFTNIANLVEISGNDDQDLMKFYNCSN
FT                   RSMFSLIKQDKFKPYPKIFDSLWKDRKSRVSPLFTSELMLSMLTKAVQFNNTSGKSLEQ
FT                   TSFDLKSVSKCVIEHSFEVLNDVKGAFSNLLLSWFEIILNALGLYEDELLNNPELVLDK
FT                   VSLSFGSDSHSFVAVKLLVDSVNSVVNASELSLGKLGEAWVSFALGLILLYVPDSPYDP
FT                   AIKEYVLYKVFEDRKVFGENLISSWESARGVFSGDKETYLESTLKHLIDLEAPNNPKVY
FT                   RDSKSIDGLFDEWNSIMESTIDMGPVESLLKTVLSSSEQGINMVEMFQNNTSQFIMRLK
FT                   KNYLLYSDLNDILCGYIYGMKLGFEMITIDKNQGKHLYPQTWSIDVCDFTSLTSIEKIF
FT                   PSVQDFTKTVSIDSSAAEFVMAYFIKLGFAHRSATNEQQQPQAQGILIQSLQSLYYRWS
FT                   LRRIKEEKENLQQGSLYKYSDPNEDIEGDFKKLFPDYEDVLDIDGTTTANTLKKNNASF
FT                   ESIYESIASDYIKEYLLQDKDNVIDIVHQGSELITQLNQYQDSLHKNTNNASVMTSLVN
FT                   ELAKTHTKFNQTVSDFNFYQDSNPTEVKRAVTIMTTVYNMSQKLLDQWPEHATLKNIVF
FT                   ATNEFLSYPIGLPLGRYLQKLEQIYTFIAEWQKYASSQVSMKEQFDILTNLIVSWRKLE
FT                   LSTWKSLFEFEEKSVEKNIGKWWFYLLEIIIIPMLGDNEEEPAVKLLSALNVFMSKVTC
FT                   GEFTIRLKLLKAFKNHAFEINKNHPIVDALCNFVTFYDQFQPTVLSTIEDSKKRLEKDI
FT                   TEVILLASWKDVNIDALKQSARRSHNNLYKIVRKYRAVLGTPVQPIIEQGITESAGTLD
FT                   SVKLPQIQSIVTGNEIQIVKEIPSWIERPKRLQNLNVIENNMKVYVERISQEQLPNFLD
FT                   FAHEVVSDMERLRKETPSEFKESNKKLIAALKTQKRKLLSDTLREIRRSGLKTSSRSDI
FT                   LATQKSVNLIIANSVSFQNTIAQGSDCYFFKILDLLPRLRAAVSSSTSAHADEVPQVDK
FT                   EKGLSATENLIHSLIVNRVPIKKLADNIATFNSWYNGFHTVANLNNLSATLTPISVKDS
FT                   IKLNVDNIRIIKMWLPKLLDYGITTLESITKFGFNDTNVAMFYMLKNKLNELVYSINDE
FT                   SNVVQSTSITIGNVENFSKFVNELIITLEKWKSEHKQLAFVADTILNWITNNSHANGNI
FT                   ESSTSLTCVETIENVEKEFRIFTTSILVAVQKIMEIQEKNQEISRDDDDWLILSQHKIT
FT                   NYMKNLHLLTIGNKLQKCIENISLVEHNQQSSKLISALTSFTFPILNHYYQLCLKIFGK
FT                   VRLNYYDLSKATFILSSSLYTLATKGFCTPEAPNEQKDDNNNLHDGTGLGDGEGAQNNS
FT                   NDVEDDEDLSEQAQQPNEENKEKDEGEEEEGNDDAVDIEGDMAGQLEEASDQEKDDDEE
FT                   KGNSDNEEELDEEIDDIDDLDPNAIDEKMWDEEVKEDKKEKDSDKLPENSNNNNDDEME
FT                   AMEDEENETKPKDNNDNKEGNEDEKEEQQEEGDDGDDEKDVGEQEDDVKNNEDENEKLE
FT                   DHVPETETLDLPEDMNLDNDDDDEMKGEDEEDEDGDKFDDNLDDDIEMKDDEHDEEKSN
FT                   DNGEEDEEMDPTNEEREEELEEEPEENDVDNESNGNNEINEDVMESENEDDLVGEDNEK
FT                   PSPENEEGGNDNDNDDQEPTAEGIEGANNIDTEDVDMDSAVKQESGEKGEGADNQVMEE
FT                   NNDIGASGTAASMDQQENQQKSEEEEEDKSVQDDAREKANESLKQLGDSLKEFHRRRQE
FT                   ILDVIKQEQQEKDNEEENSANIKPDEFQHVDGENADFDTQALGAADKEQVQSIDEDKAI
FT                   DDEEEENEGQEDIEIKEEKDEENEEEMDDLESGEIKDDNPDGDFEGEAKSAFMGERKIT
FT                   DNLEDMMKSNEIDDEEEEEEEEELDDEEMSENVSPIELDEINNTPPIELEVARKLWKNS
FT                   ELATQELASGLCEQLRLILEPTLATKLRGDYKTGKRLNMKRIIPYIASDFKKDKIWLRR
FT                   TKPSKRQYQIMIAVDDSKSMSESKSTELAFHSIALVSKALSQLESGGLSIVRFGEDVKV
FT                   VQSFNKPFNNSQEMGAKIFQWFDFQQTKTDMKLLCNESLKIFQDAKSTINGGNNDLWQL
FT                   QIILSDGVCEDHETILRMVRKAREEKIMMVFVIIDGITTSTTGKNESIMDMQQVSYVTD
FT                   NNTGGMILKVDKYLDSFPFEFYVVVKNIQELPEMLALILRQYFSEISSI"
FT   CDS_pept        199930..201657
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000152204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579813"
FT                   /orf_name="CD36_41000"
FT                   /product="Divalent metal ion transporter, putative "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41985.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG312498"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniParc:UPI000192DBF9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG6"
FT                   /transl_table=12
FT                   /translation="MMENKSSESSEMTTEKSLNHETTFDKYTTTTTTTNKIQKKSTETT
FT                   TQSISLNGDDSKIDSKFSRVVKVSRRALTTYASFIGPGLLVSVAYMDPGNYATGITAGA
FT                   SNKYSLLFIVLLADIIAIFLQVLCIKLGCVTGYDLARCCREYLPKKLNWALWILAECAI
FT                   ISTDVAEVIGSATALNILLKIPLPAGVVITVVDVIFVLTAYRTDTSSLKFVKIFEYAVG
FT                   CLVMVVVICFAVELSQITANVGQVFRGFVPSKEMFDGNGMTVATSVIGSTVMIHSLFLG
FT                   SGLVQPRMRDYDVKHGYVNLYEIAKEEQEKKQAQVEVGAEEISPVVSSESSQNNIAPTY
FT                   EQEAKFFRTKYKPSYKSICYCLKYSKIELIVTLATIALFVNAAIVIIAGATLYGTSEAM
FT                   NADLYTIHNLLSKSLSPVVGTIFMVALLSSGQSAGVVCTIAGQMVGEGHINWTLKPWMR
FT                   RILTRAISIIPCLTISVFIGKNGLGVALNISQIIISILLPPLTAPLIYFTCCKKIMKVE
FT                   LGDEDEVEGIEDADSGKRYKYMTNSWITTIIVVIIWLLVAILNVYAIYQMAVSGVTGS"
FT   CDS_pept        complement(201883..202596)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079912"
FT                   /orf_name="CD36_41010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41986.1"
FT                   /db_xref="HOGENOM:HBG397429"
FT                   /db_xref="UniParc:UPI000192DBFA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG7"
FT                   /transl_table=12
FT                   /translation="MLFTQLIILFTFVSQVLSVSIRDFNNNILVQFTKRKGSSGGHSSG
FT                   GGHSSGGGHSSSGSKGGSSSGSKGGSSSGRKGGSSSGSKGGSSSGSSSGTKNWGNNQYH
FT                   CTGSSCGYGNYYAPSAAAAAVGYGTGRYTGGTQFGNNQYHCTGSTCGYGNYFAPSAAAA
FT                   AVGFGTGHYTGSTNWGDNQYHCSGSTCGYGNYYASSPAAAAGYNSTKTSFGVSLNIPCT
FT                   HFYVVGLAVAYSIVL"
FT   CDS_pept        complement(204220..204972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094036" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536891"
FT                   /orf_name="CD36_41020"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41987.1"
FT                   /db_xref="HOGENOM:HBG397174"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000192DBFB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG8"
FT                   /transl_table=12
FT                   /translation="MKFSSVVLSALLANLVASAPIKTVIVTAFTTVLVDSQGNTKVQTE
FT                   AATATATIGSGNAAAAITDAAQEDNTPSTTSTSYNNNNNNWASAPSSVETSIVQPVTSE
FT                   LTQPSTTNNIPTTLSTQTTSSSTSSPSSTSSSSSSSAQPSGSEFSGEGTFYSTGLGSCG
FT                   ITSTDSDFIVAISHELYDSKAVGNNPNHNPLCNKKIRASYEGKSVDVTVVDRCEGCAYN
FT                   DLDFSPAAFDKLADESLGRIDITWEWLD"
FT   CDS_pept        complement(206990..210652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384111"
FT                   /orf_name="CD36_41030"
FT                   /product="Conserved hypothetical protein "
FT                   /function="binding"
FT                   /protein_id="CAX41988.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397173"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000192DBFC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFG9"
FT                   /transl_table=12
FT                   /translation="MNNTFDSRLHSFDNYSGTPQKRQNSLSSQMVHTSNKRTPNPLQTP
FT                   LGMQSAQEYPFTVNHHNNNNNSTLNSPTTVPQVSSPRYNVRSRKNVIQHMKTPTPSAYE
FT                   VPSSPNINHLSHLSNHNHSDSSDSNAMLDNTQEAMDTKSASRSYSQQQSYSHSTHPQNY
FT                   QQQQQQQQQQPTPQTSAPPPSSQQQQQQQQRAMSEEEQQLAAKLKETYKNIVNYEEIVQ
FT                   KNCIEVTLKINQITSTNNTNLVYGSPMASQNLSSSLTSNSSVVSSATRTSELSNDLWTV
FT                   YHQNVTLLDNYYDFLVTSLKPSSNQTQYKTGKNIVELYKIPRRMWVYGIVGFLEVLKNI
FT                   MSIFQDHEICSCFISYCFNIISNLADPILEMEGWWSEKLGDLSRMAIALYASKFIDWKI
FT                   SAECWYSVAMKTLYGHGKIYYHMCTVQQDNLDALVNIGKSVICRDPFVPTQHYLRLVVE
FT                   NICTQRNILSLLELPIIDFIKIHKVLLSIHNGRSSDGNSSESIQDSQLQYGIDLVTRYG
FT                   LTFGSDSNGYNFFTRELYAAGNGANSVNDSQQQQYYQQQQQQQQQMQQMQLQQQQQQQH
FT                   PPPPQHHIQQIQQPSATNTIEKMNFWFNKGSLFAISNINHLVGFGDAKNPFAKLFQLPE
FT                   ALKERKDKKDRKRKSRSASQTEDANLATIGSGGVDGQSVIAGDLTTNDWFYCLQFINKS
FT                   VLELSMRILNHYLIGPKQASTAHIIVWLYFLISIGESVQKYPSSQTMINWLFKKIFPWE
FT                   SLINYLNSLLSFVKNSPKLCAMYTHYLQVNYIQFFNENEFLPEVWKCWGTLWFDLISEK
FT                   NDYIDSETAGVKNNNLFDLPICGTYPVINMSGDNFDLKSKNQMENDNDERIVRIILLAR
FT                   TIADNYGFGLVRTSDEFKFDENLYHREVNDAFAEEFILDSRFSQNNFMQPISRENLTFE
FT                   TNHELSSIQKDEVWFGGFDSHLYDDENIELGEDIIDCEEDIEVYANEYGRASTAVGGGS
FT                   SHHDIYGDSFIGTPTDPLSLGGSSDEDYEGNFGDKIDSNVTHITLDTNIWLKHCGRIYK
FT                   CVRNGVIKVSIPLIVFQELRALRKSPEATIADAATRSVIIIRELYLTREVVPLRFDGTV
FT                   ASDINETTEFENNSTWRSNVDETILHAVNEHDEMGKRLMKGLNLRLSSSTKEDFNKRDP
FT                   PVLNSRMAKTFKYCILITDDRNMRLRAKTIGLTSFQSKWLFGQLETVFSDKCID"
FT   CDS_pept        complement(212944..213102)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231283"
FT                   /orf_name="CD36_41040"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41989.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="UniParc:UPI0000036CCF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH0"
FT                   /transl_table=12
FT                   /translation="MIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQL
FT                   RPKKKLK"
FT   CDS_pept        213549..218999
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231284"
FT                   /orf_name="CD36_41050"
FT                   /product="Myosin-like protein, putative "
FT                   /biological_process="protein import into nucleus "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAX41990.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006606"
FT                   /db_xref="HOGENOM:HBG397172"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniParc:UPI000192DBFD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH1"
FT                   /transl_table=12
FT                   /translation="MSEDIPPKEIIQEENSNHEENQNVEQEEVAASQQPAPTEEEEEAN
FT                   KAEPIEEDKEELQDKEELPRQEINVQEVGNDSVQEEPHTSFLQPPSDKQQFATPSKDLP
FT                   ALKDIETITTPKTFDVAKDNEDDATKGLADIVASSPIKHSILAELQQPEESINEDTLRI
FT                   ISGYLSLDESSIKSIGDTDVLKALVSKSAEFSNLSSENEFLKLKMEQNAQNITKQLQEL
FT                   QEKYSNADNLSTSLQESKDKLEYENRRQVEKIQELEAANDRIQRELGDLKQSDIAKDEE
FT                   LNKFREGQTHQLLEFEQQINQLSSTNVTQSKKLNELTKEINETRNDKFSLQLELTKSKN
FT                   EASYLRDQKDWYDNELKSAQARFTELIKKHESEFLGTSTKVSNLTAKNETLETLNKQHE
FT                   ATIASLKSKLEQQITKASKTETEFELEKSRFLKEIDSKEELIELTKLQAQQRATRIEQL
FT                   ESYSEEIKQSMSETITSLETALSEINEKLLETQERLKRTEEALDAELHKETDLPKLSES
FT                   SAMIAANGNGISLSTLYSEYNHLKKQLVVERSQKQKMEMQLESFITELDARKPVIANYR
FT                   EQIQFYENSMKEMLGKVETIRSEKGEVEKDAKRLRSRVAENENELVSMKRLLKDLGRQL
FT                   CFYLIHSKIRDNSENPLTASEKKSIEKILSQTGNFDEENETDSDKLISERLLEFKSIIE
FT                   LQQRNEELLVAIRQLSKKLEAREEENNNIESVAIEEAKDAILTLESELDSLNIKLDAVT
FT                   KERDALRSINVKNPTSTQDSDYLSQTNADLRKRLSDSEKIISEIREQSAKSVYELNEKI
FT                   REITDKKNEFALQVSVSSKSTELAETRLSIAQKSLSDCREELASVRKELEFWRDQTSKF
FT                   ETQLVSKTHQLHEFEETISQNKVTIVSLQREKEFQISMNTTLESKIEALKNDKIKLNEF
FT                   VLNLQTMLKDREESARDISSKLSASIENYQNLQQKLSEKEERIFILSNQSELSLKAQNT
FT                   KLEQVNEISRQLLETKNKLIEKENVVEELKRKLATRRESILQPTIAANAVSSGGGVTGV
FT                   SSSTTSDSNNFEIQQLKEDLRIAESQVEELSNLAKASEATLTDATNSFEQYKTDSETKY
FT                   QSLLKEKELVDDEVKRLADLYNITYKDLESAKTMHIEEVNDLKSKLNEFKYKADQYDTM
FT                   ESDYQEKIESIRHDLEDQTNLYNDCHTKYQAELVKTGTLTEHISALKTQLEEKGEQINS
FT                   LQEEVRTVQNSIKEQQDQLVAEKSQIETDLSLSKNRIAELKEQNDILLNQLELTKNSLT
FT                   NGDGYDVSSAESGDDFRQVVNYLRREKESSDAKLLVATEENQELTIKLRQIQNELATTK
FT                   SVFNTTTHIDLDAVSKEQKNLSAQLEQLNLLRESNSSLRQENVKFSGEIKKLKEQIITL
FT                   GNELNPLKEHINELTTNLEFEQQKAKLLSEENERIKSAALSTEEQKSDANKHTSEAIAR
FT                   MQEQMDKLKTKANERIRSMNETIASKDETIKQLNEKVDQLTNAATNEDKSKEQIEQLNT
FT                   KLTSLQSEVENAKNEKDELFKKLNELESNLRAEFDKEKQEIIKSLELAKQANASDEQLQ
FT                   KKYKELEETLAKSKQEFETKLEAERKKTREEVEKKYDIKLKMMNRKIEKYEKANNSIPT
FT                   TTTAAPTAATSKPNIPAKPDIPVANTAPSTQSVFPIVSTTIPAEQQQQSTNHVGSTPVI
FT                   GSSVSASATPPPVASSNSGVGVSASVPDQDTKSQSKASVAAAVNRPVGHPGNESTLRIH
FT                   RPGGHPGNESTLTVHKPIVTNRNENRKFSPVPNPTPQDNSKKRANEGQHQRPQVKKPKD
FT                   N"
FT   CDS_pept        221343..223187
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579814"
FT                   /orf_name="CD36_41060"
FT                   /product="Conserved hypothetical protein "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41991.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG324618"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192DBFE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH2"
FT                   /transl_table=12
FT                   /translation="MTGTTQEKNQETYSVDSLEHKYNSSPSASIDHEEKTLKKNKSKFR
FT                   WSVDLSDHPPEIFNVTLYLSIFVFGVLGAARGLEEGNSGSNTTLGSFKKQFGLADKTKT
FT                   KDQLANLKSNITSMVMLGSIGGSLIAMKTVDFFGRIRALQIVCVVLIVGVIIQITSTSI
FT                   GQLYAGKIIEGLAVGHTTSIGPVYLSEVAPSPIRGLATCIFSGAVYLGSMISYFTNYGV
FT                   ALHVPAEKNGHLNNNQWRITLAPKLILAGLIFIMSFIFCVESPRWLLKTNKPDKAAGNL
FT                   SKLRRLPADHPYIIAEISDINEQVIAEKEATHHSSLLSNFKALVSNKSIAYRFFVISCG
FT                   CQIIGQWTGANAVTIYASELFSLIGVTGTGTLKMSAVLGVVKFISAYLSAFFLIDVIGR
FT                   KRALYTGLSLQMACILYYAIFLTIVPQAAEDNANLSGSNKRAAQGALAAIFLSGTGWTM
FT                   GFNSVQYLIGAEIFPLGIRSFAQSLVMVLHFANQYGNSKALPKMMIAMNPYGAFYFFVG
FT                   VMIIGLVYAFFLPELKGRSLESIEEVFTLPWYKLRHCNRLVPDHSQIHKIKYNQDEQGN
FT                   TDFNHIQYELDSGKPTDQFVENLMESDSINKENVEHKV"
FT   CDS_pept        223634..226570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384112"
FT                   /orf_name="CD36_41070"
FT                   /product="5'-3' exoribonuclease, putative "
FT                   /function="5'-3' exoribonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41992.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004534"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="HOGENOM:HBG592534"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR017151"
FT                   /db_xref="UniParc:UPI000192DCAC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH3"
FT                   /transl_table=12
FT                   /translation="MGVPALFRWLSRKYPKIISPVVEEEDHEIGGAKYENPNPNGETDN
FT                   LYLDMNGIVHPCSHPEHKKPPETEDEMFLDIFKYTDRVLMMARPRKVLMIAVDGVAPRA
FT                   KMNQQRARRFRAAKDAELKAKQLEIEVKERELRGEIINDAIKGKKQWDSNAITPGTPFM
FT                   DRLAEALRYWVAYKLSSDPGWANLQVIISDATVPGEGEHKLMSFIRSQRSDPQYDPNTK
FT                   HCIYGLDADLIFLGLATHEPHFRVLREDVFATQDKKFTIKDQIAEANSNDGDVVAKDDR
FT                   KPFLWLHVNVLREYLQVELFTPRMSFPFELERAIDDWVFLCFFAGNDFLPHLPSLDVRD
FT                   NGIDTLVQCWKRSLPILKDYVTCDGKLNLKSVEVLMSNLAYKESEIFKNKHAAEQRREE
FT                   NNKRRKLAQEQDRALKRIYSSQVSKGKDKAPLTADVNMPLMDTSGQIVEGYANLSNSDI
FT                   VQNRAILTKANLANSDAAAELKKLIDSKKTQVTVVQDQIATDSSANSETTTSESELEEN
FT                   QSDNSLKRKLESEEKDNKQTQSDDIKLWEPGYNKRYYEAKFHCQSDEEIEQTKRDVVRH
FT                   YVEGIAWVALYYYQGCPSWNWYFPYHYAPFAADFTNLEELFPEGVKFKLGEPFRPFEQL
FT                   MSVLPAASGHTLPQVFRDLMSNPDSEIIDFYPEEFEIDMNGKKMSWQGIPLLPFIDEKR
FT                   LLDAVQKKYELLTPDEISRNTNKEAELFISPANKNFSKFSETLYKENANEVVFKYAKSG
FT                   LSGKIFKLATFNPEGVFNFPLNEGHMPNVNSSDYFQAIYHFPKTKTGKSMILNGHIAPL
FT                   PALTTADKNDLVYQLDKFNNNRRNGGRFNSTQDNSDYINKGPAGKELYKTYSMRRGGYR
FT                   SYLQFLTSGHHPDHHQSRNNSQYSSYGQQKSYNAQGSYNQQGYYNQQGNYNQQGRYNQQ
FT                   GNYNQQGRYNQQGQYNQYRSNTQRFNNQNYNQSSNNTRSGYLPPRPPR"
FT   CDS_pept        complement(226606..227754)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074534" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21079913"
FT                   /orf_name="CD36_41080"
FT                   /product="Conserved hypothetical protein "
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="CAX41993.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="HOGENOM:HBG397171"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniParc:UPI000192DCAD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH4"
FT                   /transl_table=12
FT                   /translation="MTSYNLSYQPKNIALEFGENDGKYFLRSGHPSATGKTLHLSTLPS
FT                   YLIDKKVIVIDSIKSGTGRTPGKDIYLDIINPLFKQLSIKHEYHATKSATSISELAQNL
FT                   QDHEATILFISGDTSINEFINSLNKSEIGEITIFPIPGGTGNSLSLSLNITNPLDAIIR
FT                   LFSSTKISPLNLYEIDFPQGSRYLIANELGSQVSSHLKFLIVVSWGFHASLVADSDTPE
FT                   LRSHGIKRFQIAAHQNLNREQKYEGDFYINDIELNGPFAYWLVTASQRFEPTFEISPEG
FT                   DILKDGLYAVAFNTQNTEDYIMDIMKQVYDKGSHIRNPNVIYEKLQKNDKILLKTKNSK
FT                   PLLQRRFCVDGSIVALPETESHEIYIHVRDNSQHSWKLYIIH"
FT   CDS_pept        complement(228065..229810)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384113"
FT                   /orf_name="CD36_41090"
FT                   /product="General amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41994.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192DCAE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH5"
FT                   /transl_table=12
FT                   /translation="MFKSTLQNKIWNNEKTKEAEAEAERSKIQEEELFDTKVDRQTSVT
FT                   SESSLSQDNSSVDVGHTQRKLYNRHLQLIAIGGSIGTGLFVTIGTTGLTVGGPLGLLLS
FT                   YCLSTLLTLLLTSAVGEMVSYMPVDSPFLNMAGRVIDPAFEAAASVNFWVMQSLYIPFE
FT                   ITAVNGMIHFWREDYSPAITFCIQIAIYAAINLYAVRIFGECEFWFSLAKLILCVGLLF
FT                   FTLITMCGGNPKHDAFGFRNWHAAGGPIATLYTTGSLGRFQGFLGSFRWSSSFTCVGSE
FT                   YLGMTAGECINPRHNLPIAFRTVLYRLVLFYIGGALSVSILVAYNDPRYLELTSDTSNA
FT                   ASSPYVVAMQNLGIKVLPHIVNAVILTSAFSAGCSYTYTSSRCLYNLAKKGFVPRLFKK
FT                   CSSHGVPIFCVGLSICFSLLSLMQLGDSGSKVLNYMVNLCTGAQILNYAFMSITYIGFY
FT                   HACKAQNIDRHEFTYRAWFQPYSIYFVCFMYCCLVGILGYDVFMPGKWSVDTFLYNYIM
FT                   VFVSLAVFIAWKLFKRTKFIRPIDADLKTGLEEIERHEYEYYEQLEQSSHKPVNKFQSI
FT                   LHWIF"
FT   tRNA            231945..232016
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        complement(232127..233134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246625" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579815"
FT                   /orf_name="CD36_41100"
FT                   /product="Lipase, putative"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX41995.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG397170"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000192DCAF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH6"
FT                   /transl_table=12
FT                   /translation="MFILIIIVLYCLSFAQEYKVDNEPVAQDYKKLVQFSNLAAVAYCV
FT                   GRGLSKGRLGDKGSGCHLAACKNDILKDVEIVKIFDFSRLNEVGTGYYALDNKRKTIIL
FT                   VFRGSVSRRDWATDIDFIPTKYKPIVHDDNFNECEVFIQQECINCKVHRGFYNFLKDNS
FT                   GAIISLGIKLKKIYPDYQFLIIGHSLGAAFTILSGIEFQLLGYDPLVVTYGGPKVGNQE
FT                   FADFTDRLFDTEDVSNCITMDNDFSRGFIRVVHRHDIIPLLPPMFTHAGYEYFIDKKQL
FT                   PHEECDIDRRGMEYSGLLWKRSLGIRPSTFWPDNLGKYEHTHYFRRITSCRDED"
FT   CDS_pept        complement(233370..234071)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18536892"
FT                   /orf_name="CD36_41110"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /protein_id="CAX41996.1"
FT                   /db_xref="HOGENOM:HBG397169"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI000192DCB0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH7"
FT                   /transl_table=12
FT                   /translation="MLVEEVPKSTNAKTSTIYFSSSINLTARSLGKSSNTGESISSSNK
FT                   GRAKVNYNLTQLMNAQTQSNEPSNTGPLKSSQQIQLERLVLKRLVELNQETSIKGFELP
FT                   KNFVYTGIHSTGGGDNTITSHKSRLGNTPTTKKILAARRNLNSYFEEERNLISVNTILG
FT                   INYQFVDFTDINDKSISTTTNKRRKLENVKPKIRLCCICGNKSNYSRCSSCGLYYCSVK
FT                   CNNLHQESRCA"
FT   CDS_pept        complement(234721..234990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17579816"
FT                   /orf_name="CD36_41120"
FT                   /product="Mitochondrial distribution and morphology
FT                   protein, putative"
FT                   /protein_id="CAX41997.1"
FT                   /db_xref="HOGENOM:HBG398501"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="UniParc:UPI000192DCB1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH8"
FT                   /transl_table=12
FT                   /translation="MGNIMSVSFAPECTPAKKAYDDCFNKWYTEKFLKGKSMENECTEF
FT                   WDTYITCINTNLAKQGIKPMLDKAREDQPFDHEEIKESLNNEKK"
FT   CDS_pept        235333..237138
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580800"
FT                   /orf_name="CD36_41130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41998.1"
FT                   /db_xref="HOGENOM:HBG397166"
FT                   /db_xref="InterPro:IPR013964"
FT                   /db_xref="UniParc:UPI000192DCB2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFH9"
FT                   /transl_table=12
FT                   /translation="MKRYSIAPTSSRRKSAIDATLPETNLPARQILEQLDQDTTFVLQE
FT                   IDKNISRANTVINDKIKPMIQEYALQSWKVWENTGFWKHFFEQSANVELDSYVEPINEV
FT                   NPQNNFLLLNEIEKNKQNGRFDDSGMTNKTNQGNNENNDIEDDLEDKEEPEIAFKKPNL
FT                   RQLVADGNTPTWSTEHTKPSMKSIQLSPPKRMNPNNFTGGQVRENTKLTDSITLEPPAL
FT                   SAETRAITSSPHNRHNQHRLQSRESPIKIHTIRQSLDTYHRVSISPKKLKTPIRSTRTS
FT                   RIESILNSSPILPEPPILQSEIGSETPKYMSSSSPRKEQQQQQQQKQKKRESLNLHSDN
FT                   DQQQQQLQRFPNTPKYSRLSGSSVNSLLSNKSNLSDDDEDDHINPPPQLDSHNHGVVID
FT                   NSDNNHGGDAEDSSDDLESLPVPELNTIDLKDKNNNNNNNNKRSIQSTPRSNEKKRRTT
FT                   NNNNNNSNDDDDDMENVFLDHSNKKTPDNQPSNNSTTRYFSTGGNNNSDNNADNDNDNH
FT                   TETQDNSKSFSQIYDEAISKIRGKKSTIKNDGNRDEDMIMSLDMTMTKDLTSGEYTKDL
FT                   SKDLTENSTTDLGPFKERWKKLTRK"
FT   CDS_pept        237909..238139
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080175"
FT                   /gene_name="CDR2"
FT                   /orf_name="CD36_41140"
FT                   /product="Metallothionein, putative "
FT                   /protein_id="CAX41999.1"
FT                   /db_xref="HOGENOM:HBG324438"
FT                   /db_xref="UniParc:UPI000192DCB3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI0"
FT                   /transl_table=12
FT                   /translation="MACSATQCVCAQKSTCSCGKQPALKCNCSKASIENIIPLSNDACA
FT                   CGKRNKSNCTCGVNSICDGNRDGEIDFTNLK"
FT   CDS_pept        complement(238789..241290)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537130"
FT                   /orf_name="CD36_41150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42000.1"
FT                   /db_xref="HOGENOM:HBG396201"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000192DCB4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI1"
FT                   /transl_table=12
FT                   /translation="MEKLIKSTTSLLSLSSSRKISIKHYKSIISILFIISLILIILTTT
FT                   ITVKYDLEKFTPFTTTISTTSNKPFKPFKPSSPKQQDKLQQEIDQHQLDNNNNNKGNKK
FT                   KDKRIIIFPNNFPLIKDDQLVKYYTEIMNQALNPQDLIYRNRFDYKIPQFSYSTQQFEL
FT                   FSDDINNNNEQSSSQCSKLSNQINIKTSRAINKNGNLRQILTRFLQDDGPYFQEFSPFF
FT                   PNLKEQLQLSNNNDNNDDDNDDIIKKHWYQFIGSTVWLQQYGVHLMISRIIYTEKDQGL
FT                   PIISLAYLQLFDRNWNELNDVELIIPDPKSNSKPNYNKDNNNNKENNDKQLKYKSIIYP
FT                   YFAPIPIYHNIKQLKKNNGRQFYGVEDPRIILIQNEFGYEEPIIIYNSHHRKISKIDHD
FT                   NNHDNDQEGKINFKNYRSLFIGWLWQTQIGKFNLEQLSDIDYSKKNEYIKIKQLTRPNN
FT                   QQNLIEKNWSLFLNHQEKLIDGYHSFIYFIYQFKNLKILKCPITTTTTNNNKENDNDND
FT                   NDNGCQWEYQIHDDNKFDSGYLHGGTELININEILENYLSSTSTISSSSSSSSIFGNGK
FT                   QLINSIKDKLPSNRQLWIGFARAAMKNCGCGEKMYRPNMVILIKDTTTTTTTTTTTSTT
FT                   DSGFGFGESKYKLTHVSSFMDLGIEILPWWEDQGLCKGNNVVIPNGISSWTIENENENE
FT                   IESKLKSKSKLKVNNLMDYLILTITRRDATIDLVYIKGLLNALLSLNPNHNNNNNNNNN
FT                   NNQINGGGDGDGIGKSSIFKSSIFFHGNLINDDDDSNINKNIDCALQYSHKYCQIYGET
FT                   LKIEDEFQNKEKQKEKDKGSE"
FT   mobile_element  242574..243093
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon J"
FT   mobile_element  243164..248298
FT                   /mobile_element_type="retrotransposon:iota Q and T, Tcd23,
FT                   LTR"
FT                   /note="two inverted LTRs flanking internal region"
FT   CDS_pept        252451..255051
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080176"
FT                   /gene_name="CAS5"
FT                   /orf_name="CD36_41190"
FT                   /product="Zinc finger DNA-binding transcription factor,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42001.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397164"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DCB5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI2"
FT                   /transl_table=12
FT                   /translation="MENYLLSSPTQLSQPYDDGTNSLLFMDNYELSQNLSQPLDQHLQS
FT                   LQQSQSQSQAQVQVQQEPQSLNQHQQLPQIQSFQPMVNNQQYVQETFQQLSQQQQQQQQ
FT                   QQQQFPPFQQPQLQQQFQYQYSQQQQQQPGTIEEEMVPISNNTNIQISKFFDDNKDDED
FT                   NVNSGGLNDFNHSRNISLDDTTITDLHRRENSINPPTGLPHSISSNTIYSYSSFESPQS
FT                   HIQSQPSYSQGYYNQNSLSTPLRRNKSYSISSVTFNQSPVNLATTAMNKIMKTPLRGHS
FT                   RSRSKVDTNTAITTAMNLGQATKSNSTSSYNSTLNPFYTPSQQLSSTDDDDITTPLLTP
FT                   ATKLRTSKSTFFSPFNKDDVEDQDDDAVKQLRKAKSYTSLLRKKKREDGTPSKQQQSQQ
FT                   QSQQQQQQQQQQQQSQQGQQSYNGQIQNLSFPNSSSQPKIDLLAYDQNPMTSYPPMDKN
FT                   VLKNLNQSISPFNKSKLSPPPINFPSISIDLTTIATNKSNPTLHNNYNENTPFNSINST
FT                   SGGLLPPMATFTVPTIIKEEVQQQVQQQVQQVQQEEEEEEQMEIDSIELNEKNSESLSL
FT                   SSSASLVRSMKMTNLGIPNDEKKSLNENKNVIIDDITINQEKKRNLVINDGNKNGNKNN
FT                   KKIKKKNKNKTKDNSNKKGKVMIESVNVNDKDKHKHKHKDKDINNKNECPVSSSSNGDK
FT                   TKNHVRSKVGHDNSNNGNGNGNNVHNDDNYDEDGEDGEDGEDGEDDDNNDNDDNDNDDV
FT                   VDVDNDNDDDDDDDTVTIPIPEDLNVTKVKVRNNRSKSNDKSDPKKKHKCPICESRFQR
FT                   PEHVKRHLKSHSSEKPFECQIFNCGKRFNRKDNLKAHLKKIHKLSKEHEEFTKI"
FT   CDS_pept        complement(255460..256680)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580801"
FT                   /orf_name="CD36_41200"
FT                   /product="Cytoplasmic aspartate aminotransferase, putative "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAX42002.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192DCB6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI3"
FT                   /transl_table=12
FT                   /translation="MTIKSKFTHLTKEEPDPIIKTLTQYQQDQSPNKLDVSIGIYKSSD
FT                   GSLYTFPSINQAKEIYHNEKNYGHNYTTMSGIKEFINGSKQLLFGEIYKKNIASIQTIA
FT                   GTGAIHMGLLFFKEAGYKNFYVGLPTWSNYIPMIKQINGEINTYEYYNNNNDNDGGINF
FT                   NEIKQTLEKAPKNSVFIFQTCCHNPTGADFNQQQWIEIIKLIKQYDHLILMDTAYLGFS
FT                   SGDLIKDSWILRYMYDNQIEFVVAQSFSKNMGLYGERLGALHVIIQDENYIDHIQSTLI
FT                   NNFRQECSFAPSFPARLAQIIFENEKLYLQWIKEINQVTKRLKNLRQLIYKNLINLKTP
FT                   GNWQTVIQQNGLFWYSGLTPQQNQRLISHHNVYSTSIGRVNIAGLNEQNVEYFCKAIDE
FT                   VVRYNYD"
FT   tRNA            complement(257023..257104)
FT                   /gene_name="tRNA-Ser (TGA)"
FT   mobile_element  257231..257361
FT                   /mobile_element_type="retrotransposon:solo LTR, beta D,
FT                   partial"
FT   mobile_element  257527..257652
FT                   /mobile_element_type="retrotransposon:solo LTR, beta F,
FT                   truncated"
FT   mobile_element  257844..258112
FT                   /mobile_element_type="retrotransposon:solo LTR, kotuku I"
FT   mobile_element  258288..258345
FT                   /mobile_element_type="retrotransposon:solo LTR, beta E,
FT                   partial"
FT   mobile_element  258639..258824
FT                   /mobile_element_type="retrotransposon:solo LTR, toroa B,
FT                   truncated"
FT   CDS_pept        complement(259150..261297)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580802"
FT                   /orf_name="CD36_41210"
FT                   /product="Glucan 1,3-beta-glucosidase, putative "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX42003.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG397163"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192DCB7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI4"
FT                   /transl_table=12
FT                   /translation="MNRRSTLNQKRSATISEFRFITGENTDANVSSSSQHSQQLKQDQL
FT                   QSQHNQQKRNQCQPKLTKVLPYKVTRSKSVHAFQEYGKGFVGSPLMNSSIKSSQINSPQ
FT                   PKKLLKKEVTPLQPTPPIISPIPNQPHASTSIAVALEEPPLQQSPPPPPPPPPPIHPSP
FT                   FISNTIDDDNAQTSLSYSSNLLNYCQESVATSNYPAGATKSPGSGIRNTTVIYRKKNTP
FT                   ELDYNLNEISPISYDTNSLRVVKRQSKFSVNSKLEAPTSSNDLIMEKNKNLSPDLEIVM
FT                   AKSDDDNNSSIEIKQKNILETPISFNNDLPNKSVGDNDSYTSPVSTGLFSNITRRGFWW
FT                   IIVILLCVIIILIGGFAPAVFILGKGTKTSVGKFFSDPKNLPMLYLLSSKYLTKVEEVR
FT                   EPIIHKPNSIEGLSEELQQDNEVVSLMSIVTNALFSGVAYSPSNALEPQCGFTRRDAML
FT                   DLARLSTITTRIRNYGMQCDQSEFILDAIEYMNLNMTLAMGVWIGSNDTVNQEQMDLMK
FT                   KIISKYPNPSELINSIYIGNEVLFREDKTRDELIEYIQDAKTFLQSRGIDDIPVGTSEI
FT                   GSLVDSPLLQACEIVGANIHPFFAGVPVEFATIWSLEFLNLQVQPYNDYNTKIVLTEIG
FT                   WPSGGGTFGSSIASLSNSEYFANDFLCTFRDLPVEYYYFEAFDEPWKEIFWEGNRRWET
FT                   QWGVFQDDRSPKFALQNIGCV"
FT   CDS_pept        complement(261866..262288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580803"
FT                   /orf_name="CD36_41220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42004.1"
FT                   /db_xref="HOGENOM:HBG397162"
FT                   /db_xref="UniParc:UPI000192DD6D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI5"
FT                   /transl_table=12
FT                   /translation="MASKQQGIPLEDLDQRPQININDKPITDEPKASPAMKQEPQSNNE
FT                   NSQNLKSKESSNSDNPSSSSGSDSDSDSDSDSDDDVNSHFTATSGYQRESNECTEFCIE
FT                   CCTCFGVLNCCPNNGEGCVTNTATFIGNMLFACCKC"
FT   CDS_pept        complement(263023..263625)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080177"
FT                   /orf_name="CD36_41230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42005.1"
FT                   /db_xref="HOGENOM:HBG397161"
FT                   /db_xref="UniParc:UPI000192DD6E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI6"
FT                   /transl_table=12
FT                   /translation="METPTTPNSKNSSVNYTYQEESPNITHNDIPSSPPMSVLNQLMKH
FT                   QQARSTKLMKPFSSSSSPPNSESDDLSPSRPNKGRGKYYHHPVESSRSQNFNLRNKHDK
FT                   IRQVRNQHRHDKLMISREKINDQQFKRDINDQYEKEYEHVTDGLDIDRLIEDEQENTDT
FT                   QVWLQHYEEEAEEREWEEDADLIDMIQSLEIEDKTMS"
FT   CDS_pept        263858..264532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231539"
FT                   /orf_name="CD36_41240"
FT                   /product="Histone-specific N-acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAX42006.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG447616"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192DD6F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI7"
FT                   /transl_table=12
FT                   /translation="MRVRFELNGQKYNKFSEDDPFLMEEIAEDLVLNHLTTNTFSLPNY
FT                   RTHIETTHNIQENQLHDFIQLIDDNLGDLYVKSQEQNWKDNKQEEMSEPGLIYVWFTET
FT                   TTDDDDELVGFVSFKLCEDDDGIFVLYLFEIHLTEKYQGQKLGQLLIDQFHEFAKSLQN
FT                   SSNKLYSMLEGTALTVFTKNTKALNWYKKMNYELTERSPMDKKLRNGTVIKPVLYLMRR
FT                   KL"
FT   CDS_pept        265932..267662
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580804"
FT                   /orf_name="CD36_41250"
FT                   /product="Transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42007.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397160"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI000192DD70"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI8"
FT                   /transl_table=12
FT                   /translation="MGRRKIEIEPLTDDRNRTVTFVKRKAGLFKKAHELAVLCQVDLTV
FT                   IIVGSNNKVYEYSTVEANEIFNAYNKTLKVRKQLHESKSPENYSKFRKKRHLHEPLTNK
FT                   SGSIVGTNTHLNDEDYDHNVHEAGDEDSEYDSDDNSPQPKRHKRSESLKKDQNPKVFNS
FT                   TQPPPPPPPPHISLNNVPTFTNPKKYKKSIDETNNNLAPPPIGTKDELTVQRPVLRVQI
FT                   PIDAKSNKNNPHSGVNNSDGKDTARTVTAIENSATNQNTQSSNTTSGTGVADTNSSHVS
FT                   SNGNSNLVPGNVPNTRFSGYSSFRSPDSRRPTLPLPLQTKSQTSSPASAAAPGLPLTGG
FT                   SNAYFAGMQQSPSGSSYANYPAQVYQQYQQFQNQLQEQQQQHQHQQQQQQQQQQRQPPQ
FT                   PVGTQNSQLESAVRFRSGLPTGVQFNGEQTPISGLPSRYVNDMFPFPSPSNFLAPQDWP
FT                   SGITPTTHIPQYFVNMPLSGIGPQQQQPQQAQQQQQVPVVATPTQTQTGQQMASVTNYK
FT                   SANPPIPGFFQNPTQATTTSNATNVSRLSDVGDGTNPTTAGSGGSTDVNNLNNGPNKNT
FT                   "
FT   CDS_pept        join(268446..268451,268862..269566)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580805"
FT                   /orf_name="CD36_41260"
FT                   /product="Ribosomal protein, small subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42008.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316337"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniParc:UPI000192DD71"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFI9"
FT                   /transl_table=12
FT                   /translation="MKLNISYPANGTQKSIDIDDEHKLRVFYEKRMGQEVEGDSVGDEF
FT                   KGYIFKITGGNDKQGFPMKQGVMHPTRVRLLLAKGHSCYRPRRTGERKRKSVRGCIVAQ
FT                   DLSVLALSIVKQGDNEIEGLTDTTVPKRLGPKRANHIRKFFGLTKEDDVRDFVVRREVT
FT                   KGDKTYTKAPKIQRLVTPQTLQRKRALKAKKVKNAQQQRDAAAEYAQLLAKRLHERKEE
FT                   RAEIRKKRAESLKN"
FT   CDS_pept        complement(269833..271284)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080178"
FT                   /orf_name="CD36_41270"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX42009.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG397158"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR022030"
FT                   /db_xref="UniParc:UPI000192DD72"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ0"
FT                   /transl_table=12
FT                   /translation="MDFTTTHYISELHLNKLLSKNATPPAKNKIIITHRWQNNQVILTP
FT                   NSFIIMTSIPSDIKLPPSDIKQTIDKTVGYVLKNGKSFEERLLTNNKNDKFTFIKQDNE
FT                   YYPYYKWKLDSLKKTQELTEPFTEDQLQDEENIRIAKPPDLPFLIDLPIISQRDLDVIK
FT                   ATALYIAQNGKQKIPKLLQHETKLNNRAQFEFLNESHSLHGLFQKYIQQYKTVIALYKN
FT                   SPEENDEEYHLLRQLIQSPRGEYDILTQAYNRAQYIKQNKVIEKREQEESKARQLHYAS
FT                   IDWQDFSLIAKVDFNAIDAVKELSIPLKRDDLIKRSLDARSKDIELPKVAAAAAAAVVA
FT                   TTTPEVINTKDQVQTQDEKQSSSEADNGTPVPSAPPIKGMKIRAAGTSRLKKPSETNTT
FT                   MTTKNTIKCPITGKLIPENEFDTHIKTLLRDPRYKKEQENYIRKNFSYASNITTDQVYE
FT                   NIKRFVKKRTNIEDENSTKKKKVHK"
FT   CDS_pept        271803..274097
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537131"
FT                   /orf_name="CD36_41280"
FT                   /product="RING finger and CHY zinc finger domain-containing
FT                   protein, putative"
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42010.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="HOGENOM:HBG397157"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="UniParc:UPI000192DD73"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ1"
FT                   /transl_table=12
FT                   /translation="MTPLPDTTTTTTTKTPHQYNDSDSDINDMSRDLDEIGLLNLNNLT
FT                   SYFSTDRFFSQMPSFEMKNFPLEFTKYVTKYKNYYQDQYKKYNKSFGTSTSTTTTTTEA
FT                   DEMKDISDDSNILDSIKTVLSTRIQMDKFLNDLKLGVNITTAIDRLQPLTDVINETIFL
FT                   PTDDFSDIENDEIEPEIEKEEITEPVGIAEIVNKCQPLINEIVKPRVGIRNELKRDTRR
FT                   KRKRKQYKNNIYSNNDSMTSQTSDIDGLTIDEVNELTELNSLDDFVKQDLLRSKIKKIH
FT                   NLSISQDSKNKLVTKLMMGNYYKYVDEKLSNNDKQLLRPLKNQKLVIEKDDFEEEEPVE
FT                   ETQSKSSLDLVDEVINENDDIEEIQSESESLEGSDDEGEDEVMLTEEDLQPTYHDSLDT
FT                   ILGCSHYQTNCKIECPTCFKWYTCRFCHDSQTTDHKLIRNEVKHILCMYCHTPQIPDSN
FT                   FCVNCEQELANYFCGKCILYDNDQTKDIYHCDKCGICRLGLGLEKDYFHCDTCNTCLSI
FT                   DLKGHHKCLSDVTHSNCCICNEDLFSSIHKVVFMKCGHSIHEQCYSKFTKFSSKCPICK
FT                   KTITNVESQYRILDVEIAQSPLPEPYDKWRCIISCNDCGGKSNTMYHVLGLKCKYCKSY
FT                   NTNQLKLIKPEEEEDEEEVEILEGEERGKLSNNSRSKNSITQFDANVMKLVKTNLSNNF
FT                   GIDEEISGYEDDIDVEDEEEEEDDDDDQMGNLINIKKLSENGSNNVSYITSMLQNFVNN
FT                   ATKLSSKEEGK"
FT   CDS_pept        276481..278007
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580806"
FT                   /orf_name="CD36_41290"
FT                   /product="Nuclear envelope morphology protein, putative "
FT                   /function="phosphatase activity"
FT                   /protein_id="CAX42011.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG397156"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192DD74"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ2"
FT                   /transl_table=12
FT                   /translation="MNSIKSLVNSFDKFYPNSSTFDGSVIPQINDIPEEQEEEELEDDR
FT                   QTSLLPIQLQSDKSTVDSKDSLSETYTQQMEIEEKGGVDNDEEDEEEDDDDDEEEEEED
FT                   SINLIEEKKKQDIDSVKSHQDEQFRSQKQAQQSILFTIIIFILRCVIFLPNNLIIKPIL
FT                   YAYYIITFPIRYTTQQFGSTSYSSKNEDESQISPAIIPEEINDPFVTRANNSQFASTTK
FT                   PTPESELEPEPEPEPEPEAELPILDECYDKKTEQIKHNNFISNTMKSPTSFSKYMIPPP
FT                   QRLFPLSRNPEKRRRKKILILDLDETLIHSLSRGSPRSFNPATASKMIEIKLNNISSLY
FT                   YVYKRPYCDYFLQETSQWFELQIFTASVKEYADPIIDWLEMEILDRKNKRSSNGSATTT
FT                   TTTTTITTNQTKIFTKRYYRNDCTYRSGVGYIKDLSKFIKDEDLKHVMILDNSPISYAL
FT                   HEENAISIEGWINDQSDKDLLNLLPLLKSLSLAIDVRYILGLKNGEKFIE"
FT   CDS_pept        278620..280509
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580807"
FT                   /orf_name="CD36_41300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42012.1"
FT                   /db_xref="HOGENOM:HBG397155"
FT                   /db_xref="UniParc:UPI000192DD75"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ3"
FT                   /transl_table=12
FT                   /translation="MNELIENLVTTTSSSSSISQNTINVLHELGDLLRDDTNRIAIHDK
FT                   LSILLPQFNKFLSISISTTSTNESLTDELKFETLRVVINILANNDLNRDFFTNSIQVPK
FT                   LLEIDIKETINEDQESLIIMINEFWSIIKIHLDKNEKFQLIKFIFILLNQFIYDTNHKS
FT                   QYLEFFNSLKIQWGLYPLINKDTIDDIGEFLYELLASKSLSLTDIDRIFLSGKILDNIS
FT                   IKDLEDEETGLIMIDLLSLNEPSNELYKTILQQISLCDTNVSGLIKRKLLVLASDLAPV
FT                   YNDSNNNNNSSSSSTIDEQEKALNISIDQLQSTNDPYVFACCCITIGNFIHDKSSMEKA
FT                   LTILFNESNISEEGELLTIDKLISLYFEKNIITDVIQIQSIHMWNNLMNETIANKILTN
FT                   ILEDDLLKITKIIIDNEKYYQEILILYLKFIKKLIKLSNKSLVPFKVIEYILQNLDNNN
FT                   NGTILDIKYLLLQKQQQQQEYGGKYTEEMFMELLKSLVNTINTTNVLEQLKTIAIINQQ
FT                   ILNGELEIIISSNINMEQLLENYFHPLEHLLNQFISLLSESKSKLKLKSKSKSKSKSNN
FT                   NIVNPNWEIKIFQNNLKFVAISIIKIIEKNSNELLSTKTNLLKICHDIINEKE"
FT   CDS_pept        complement(280588..283500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580808"
FT                   /gene_name="OPT6"
FT                   /orf_name="CD36_41310"
FT                   /product="Oligopeptide transporter protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42013.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG590918"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI000192DD76"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ4"
FT                   /transl_table=12
FT                   /translation="MTKKGHEYIQLSTFPQHEQEHEQEQEPESSSTTSPGPPPKLYQGK
FT                   LTDSQLTFVLLRLGVISDEVYHNHNHNFSLLESDIHISKQTEYIIDKIEQLSITEATEI
FT                   IREALVDHKGDVNFLIEDYQLLERLISQIPNNIECQDQEITTTTTTIKNDNNLDEFSDI
FT                   KYPIQSSSPFKNKTYLTIIDWSLQIRLEAALIHYHSPYPEIRAITDPFDDPTIPVETFR
FT                   AYFIALFWTLIGSLINSFFYQRMPGISLSTHTIQILLLLSGKIWEKLIPKNKFIKINNN
FT                   WKINLNPGPWNFKEMMLSTIIYSCSASTPYSINNIFVMKLNRFYGLNWVNWIFQILLTI
FT                   STQLLGFSFAMIMKKVCVYPNKAIWPTILPTIALNKALMNQNNPTTTTSSSTTSSIVHG
FT                   WKISPYSFFLVTFTISFIYNWIPNYFFKALSLFNWPTWFNPKSIHLVNITGSNIGLGFN
FT                   PIPSFDWNIIGNGSSMIIPFYTFFNRYLGTFLGFIIILMVYYTNNNWTAYLPINSNRLY
FT                   NNKAQLYNVHDILNDTNKLFDNEKYQKIGPPYFSAANLVIYGAYFCLYPFAILYHGLTE
FT                   WNSMKTSFINVWSSIVDAFKSEQEIDFGIESNNDDDNNNNNNNFGLYRQYGRYANDPHC
FT                   KMMAHYPDVPDWWFITILLISTSFAIAAVWFYPVETPIWGIFFTIIINFIFLIPLTSIA
FT                   SVTGFSFGLNVLVELIVGYAIPNSGIALITLKAYGYNIDSQASNYITDQKLAHYTKIPP
FT                   RAIFKGQLLSTLLNIIISLIITNWQLNNIENICDPHQKNQFKCPGANTYFYSSIQYGEI
FT                   GPTKVFGKLYPILKWCFLLGILLVFPCVWLKRKFPNKIIQKYFQPTIIIGGMLDFAPYN
FT                   LSYFTGGLYISFIFMFYIKKNYLLWWEKYNYILTSGLSAGVAFSTLIIFFTVQYHPYPL
FT                   KWWGNSIGQQGIEGGEISPIWKNIDTAPDGYIGLRKGHFP"
FT   CDS_pept        284516..284878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580809"
FT                   /orf_name="CD36_41320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42014.1"
FT                   /db_xref="HOGENOM:HBG397154"
FT                   /db_xref="UniParc:UPI000192DD77"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ5"
FT                   /transl_table=12
FT                   /translation="MKTVTIITILQLLFIQINAITIEEKGVVIANNNNDDEQQQQEKQQ
FT                   KQPKGAPIGATSQFDPYSNISPLSRSLEISSTTKSSMAIANTIIGIIGSTNNNNNIQWK
FT                   LLLSCVLFAITSLCIM"
FT   CDS_pept        285960..286376
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384356"
FT                   /orf_name="CD36_41340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42015.1"
FT                   /db_xref="UniParc:UPI000192DD78"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ6"
FT                   /transl_table=12
FT                   /translation="MQFTRKFLSSSSLLLSLITLLLLLSESINGLIIQKSLKVNGIGNG
FT                   IGIGIGIGNIKRNRVTVDNDPMDRTIAITHNNPIPTDNASNSQSQSSSLSSSIAETTTS
FT                   SVTSSVTSSVHNNGNQLQIITSVPIIAVMILGLL"
FT   CDS_pept        complement(286657..287070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080179"
FT                   /orf_name="CD36_41350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42016.1"
FT                   /db_xref="UniParc:UPI000192DD79"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ7"
FT                   /transl_table=12
FT                   /translation="MTIFDLIIIIYIYIYLQPQPTIKALIIPKSIYNITYQGININNVR
FT                   NDKSMYEFKVIGGPYKTNVNYYYDSFNGIYFINQNQNQNQNQNLIQNHHNNNSYYYYYY
FT                   AAADDDNDNDIIEVLSRDEIGIQLNEKYNSLFL"
FT   CDS_pept        289510..289959
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580810"
FT                   /orf_name="CD36_41360"
FT                   /product="Hypothetical GPI-anchored protein, conserved "
FT                   /protein_id="CAX42017.1"
FT                   /db_xref="UniParc:UPI000192DD7A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ8"
FT                   /transl_table=12
FT                   /translation="MKFQLLTLISIATTTTLAINLEQVRLINDDELIVQDGQFGYPAII
FT                   NLKDEDAEIAKKTTTTTSSSSSSATTTTTTAKKDKKTTSSASTTISTSTTKSKSKSNST
FT                   STSTSSSSKKHKSETASITKTGGADSVAAVGAVGGPILAALALLL"
FT   CDS_pept        291123..293654
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231540"
FT                   /orf_name="CD36_41370"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42018.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR004330"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR018289"
FT                   /db_xref="UniParc:UPI000192D2AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFJ9"
FT                   /transl_table=12
FT                   /translation="MAKRYKLIKKGSNNPVDDNKTLQAAFKEASSTPEKFMFNGLSNEF
FT                   EDNVDLIIGYFKDDEFERWFKSISLNYNWSRKSSFESPEENNNDNKIRKSLYSKEEYFG
FT                   CSSRGKFKSKSKKSNDDIVNQTISSIKSNCPARLYVKQQKGIPGYKLIGFVPTHNHAPQ
FT                   ENGPLNVVARDWLVDMIGKGYTRSQIEKILFNLHGQKNKNQIPMNYKPFLRIQKYHINY
FT                   WIKQYYDNKKFKLDQDNKINLLKWGEKISSDGSFNYIDLKGNVATTTGKPGWCCFFFDS
FT                   WQKEEILKKKKKKNQSIYYLDCTHNICQDFNQPHKLGWTYLYTIMVRDDVTGMDTPGAY
FT                   MLTNCLDEEPLIEFLKFIKSHSLSPDQFMIDCSFVEINSIKQVFPKSMIIICKWHILRN
FT                   VKLKVKSKIANVKLQEEAINDFINLFENKSPQDAQMKIDAFKNKYKENTEWLEYFCYYE
FT                   KLKGHWMNNSVVSFNQKNVTNNYIESYHRFLEQKFIRVFKKRQADDLVCVLYHDITPFY
FT                   RKRHDDDDDDDDDDDDDDDDDDDDDDATSGKRQGKIDKVETSNKRFASCLTKEQLQTLV
FT                   VIQGDGAFVRISEKDEEYVAILHSDGSGTCTCDLKQTGYSWCKHLYMYERLKQLVFDTE
FT                   SVEATDLINGVSDGNQCNPEITEENGIFYPLMDFDTTITPQTIENGSKIRIRIRNTNTN
FT                   TNTTKEKNPVYDKQQTEMVDLSVFDDSGDFDDNLVISHSIESPEITSEYENQDLIHQFM
FT                   KTKSRIVNFQPAFPTNCLPELPEITDEEKEHQGLIDLNLIMKRFNEVSEKSPEKLDNFL
FT                   LNIKNWKDFADQIVTNQDNLAYNIKRRKINK"
FT   mobile_element  293868..294419
FT                   /mobile_element_type="retrotransposon:solo LTR, psi G"
FT   CDS_pept        294770..295690
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384357"
FT                   /orf_name="CD36_41380"
FT                   /product="Regulatory subunit of acetolacetate synthase,
FT                   putative"
FT                   /function="acetolactate synthase activity"
FT                   /function="amino acid binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAX42019.1"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG335310"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniParc:UPI000192D2AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK0"
FT                   /transl_table=12
FT                   /translation="MLRRSPCMIRQITRTSIRNSSNNSSSGSTSALAYKTLHRNQKRPP
FT                   LPTLETPNWSADAAVSSILYETPVPSKAPPKQHVLNCLVQNEPGVLSGVSGTLAARGFN
FT                   IDSLVVCNTEVKDLSRMTIVLKGQDGVVEQARRQIEDLVPVYAVLDYTNAEIIKRELLL
FT                   ARISLLGPEYFQELIATHQLHIDDGSSIPNIDACESAYHPNNLPPSEALRQKHIHLDHI
FT                   STLTKQFGGKVVDISDRNVVVELSAKPSRITSFISLLHPFGILELARSGMMALPRTPLN
FT                   NFSDIEEEDSIDAADIVDASQLPPG"
FT   CDS_pept        297455..301300
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246639" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537132"
FT                   /gene_name="ZCF27"
FT                   /orf_name="CD36_41390"
FT                   /product="Transcription factor with zinc cluster DNA-
FT                   binding motif, putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42020.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397150"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="UniParc:UPI000192D2AE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK1"
FT                   /transl_table=12
FT                   /translation="MSTPVKNEPITTTTSSSTSSSTPNQPSMQNNLSYPVQHIPQPPPS
FT                   SQQQQGQQVQQGQQGQQSRISHLPQPIPPIPIQIIPQPPQQQQQQQQIPPQYAGNYYQQ
FT                   VPTPGYYTPPPHTSGFYSVGPQRGNSVSFQPTQGSPLQHQQHTPGNPTQLPLPQPPHPP
FT                   PPPPQQQQQHVAMHQSTPPPPPQHQHSSTTVATQESWKENNRKRTHSSMQQTSRMAATY
FT                   PRKRALTACDTCRLKKIKCDNVRPRCGSCIKNGNLNCHYRTDDQQKDYSSYDPASLNIL
FT                   SKLDIILKDLKEIKNGNSGSISTNTTDKASPGEPSSSSSATTATTTFSPAPQQQQQQQP
FT                   APQPQQQEQPQTLTKGRGKKFTFDKCVWDMSVISIFKWDYFKNTFNLSTKDIENIEKTL
FT                   KNNYDNDNSKNNDIINSNSNCHTHSHSHCNKSLIESIKQYEILEKLINNNFTTIMNSFF
FT                   INSYTKVPILERFEFFDIIETYQLLIQKSSNISFSKLLELYIDDYTIPQEIQNLFCNND
FT                   DFTNTSENENENKNGNKNMNMNMNMNMNMNMKKSITVKQFIRLIKSIPLILIICALGII
FT                   SVPVQFDNLDKFENSLEEAKSISIGCLSGDNVFDNIPINFPRQRNIIAFMLKDYSEILC
FT                   NIFSFNLSKNYNNTINSVQYYLFLSQLYLQQNCIILAQRSSLMASQHIMYLIEKTIKFD
FT                   NSSSSLSLSKSKSNLKLEIINRLYWTCLKLECELNVELSPFVPLSGITKIEPPSGFPKI
FT                   PMTPNLQELNYKYSSSVIKLGQFYNDQYSWYYFLTEIVVRKIDNVMFDELYSLENSINH
FT                   LWDDEKFIEQTIWSSFIDYLNQYNGIINLLIPEIRNFVLQEVNVEQIFRRLKKKYEKKH
FT                   QQQQQQQQKQQQKHKLKGNNSIINNNNNNDDYDYDDDDVDYDIFDGLDDFLIDDDLLAR
FT                   VQSENIMFIKTRILVSKLLLFRPLVYLFLQDKIPFIEIIQAVISVMNDSMNTTTNNSSS
FT                   SSSSSSLAFGIDNFNPMDSPNSSISSGSGSGSGSGSGSGSGSGSGSSSTIFNLINENEY
FT                   NHNNNHNNHDHDYHDDDYLEIDYFNLINAPLFYQKQFPDEDFSKFIEYDNNKQATTTTT
FT                   TMNGYDQEINEESTITIKDLSLVKQRILRIFISNLISIPKLNIPKLGTHRHPGSWYYIR
FT                   NLFIGNIFQYLIYKKIQSMINKATTDIKFQSILKSQLEQLEQLEQQSKKENGSFSIKSM
FT                   EEIIELINMVINIKGIIASLEHSIILMEYWKLEIKDCQIYQDFIKKILNDLQKSTR"
FT   CDS_pept        join(302237..302284,302382..302645,302745..303407)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231541"
FT                   /orf_name="CD36_41400"
FT                   /product="Transcriptional activator, putative "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42021.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397149"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D2AF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK2"
FT                   /transl_table=12
FT                   /translation="MIMKSKNKIDFYLLPMCLFFFFSKVGRVMKKALPEHAKLSKESKE
FT                   CIQECVSEFISFITSQAADRCLVEKRKTLNGEDILWAMYTLGFENYSETLKIYLAKYRQ
FT                   YEQEQLTLKPPRKKIRKKKKTNDNSSSSSKLQNKEEQDQNLQQNQQYDYDEEEEEEEAD
FT                   ISDIQSNLILQNLPEYSDDYFEDEDEDDKDRQQSDENSDNNDPQSINLQQQQHQQFNNI
FT                   DSDPITESNQQESFFTNSSNAQYYPHQSQYVNTTLPSSSSSSIINIDNNRSIQSQLLST
FT                   HPQPRQYQDQQQSHNDKQQQQQQQRIIPDLLNITNSYSEDEFI"
FT   CDS_pept        306379..308277
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580811"
FT                   /orf_name="CD36_41420"
FT                   /product="Bud emergence protein, putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX42022.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192D2B0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK3"
FT                   /transl_table=12
FT                   /translation="MIKTFRKSKRSSSNSSSPKKTISRVSSTSSNQTSHDGMLQSPKKV
FT                   IKALYDYEPQGPGELKFSKGDFFHVLDDVDDELHKEAEANGWIEATNPMTQLKGMVPLS
FT                   YFEVFDRSRPIMGTNFIDNQHHHQQQQQQQQGTINNGAGHRNLQQTLYAVTLYEFTAER
FT                   EDELDVMPNENLIICAHHDYEWFIAKPINRLGGPGLVPVSYVKIIDLLNPNSHYTSIDT
FT                   SRRSQVVEVINAFNIPTVEQWKNQTAKYQASTIPLGSISGSGTPPTSANSQYFDNHTMT
FT                   SNRSSSGSSISIIEASVDSYQLDHGRYQYSITARLSNGRIRYLYRYYQDFYDLQVKLLE
FT                   LFPYEAGRIENSKRIIPSIPGPLINVNDSISKLRREKLDYYLSNLIALPNHISRSEEVL
FT                   KLFDVLDNGFDRETDSINKRFSKPISQKSNSHQDRLSQYSNFNVLQQQQQQQQLANHSR
FT                   GSDNSPTNESSGSNLVNSSHNDSSLSSSPPPPSQTATATSTIGGESSAKQPKVKVKFYF
FT                   DDDIFVLLIPTNLRLQDLKTKLFKRLELDINYKYEKKLDNKKLSSESIHLFLKNDFEDF
FT                   LIENNSDSNGNGNGNDNEIDLEDEINKEKLGEFEVNDDEKFQSVLFDKCKLMVLVY"
FT   CDS_pept        308792..315526
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384358"
FT                   /orf_name="CD36_41430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42023.1"
FT                   /db_xref="HOGENOM:HBG397147"
FT                   /db_xref="UniParc:UPI000192D2B1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK4"
FT                   /transl_table=12
FT                   /translation="MLNKYSSLFFYNFNHTHFIYLFTFLINYFKSFIQLPPSPFLFLSD
FT                   PRIFTIKRQIFFFFFLTMFKRVFGLFTSSTRDLSDTNNDNDDEKKEKQERKQKQIQRNS
FT                   RIRPKTDSHIYHAKLKLKLKAKAEAESRSQSTPRTTSNNSSSNNALISSIRSPQGSKLA
FT                   YRSSSIGVMNPQQTLNDTVIDDSNDNDDISNSSLRNFPSSPTKQAMAQHKAQTHDHDNN
FT                   LHQYQQVDLQPIDPLPLQQQQQQQQQQQSNDRFVVPSTSSPLPLTIINKKRPQDQLHNS
FT                   NTRKFNGGNIPKRRKLTRATLATTTTGNIRINSGNTNGIDNQLISSKSSTNSPLKHKTT
FT                   TTTTNTTTTTNNFKQIKGVNQLHQNNYKLNLSKSIPGFNHSLSKDIDHYGHSRLKNLKK
FT                   PSIPSMATSLIPSSSSSGSGLITHSVSKIQEMEEINNNQVPSNDLDTSINNVYDNMDNN
FT                   NDYDYDYDPDPIDSVEPEIYLSEEEEEEEEDENGKDIKEKMLDKEVVDSESGNNDTTVV
FT                   IQTNDDLETKKHQQQQKIVEDDIPREREILMIHSPGEKQKLKRSQRKQERQLQSQLQLQ
FT                   SQNQKSVSPQNETVDNQQLEEPSEQNQLNANRSQEEQVVENQPTRPSKSRTSKKPQKQY
FT                   FQSWKEEAALLKQKLANDPTFHFSSDKTQQIDEDNDIIIEKITQLRGCQILSPNQSIKK
FT                   EFDHMDYRKSKHKIPPTSKYYTMDDFFKVRSDNNSTRIKQRQRQRQQQQTDNSTLNSRN
FT                   NEKSTPDPQPQPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQRKQQQQQRKQQQQRQPQRQTNNSTLNSRNNEKSTPDPQVQPKPESQPEKSPTE
FT                   TVANSTKRNRSNASFVRKHDILDDLVQDSSEEENHLTDSTRWARKRKLSSSSSSSTLSS
FT                   HIDSVEDLQCEVIDITGSPDYSTVVRAALDIKTSITEKDVSTEDGETTATSPTKHFENN
FT                   SNIESEVSSSESPVPQKEISSIPKLTYTRSGQSKNKSHDTGKLLQPQSNDSSKLSPRRK
FT                   AGGSTSQKVSHQSERLDSQESQGNLSQEKYGDVELSPSKLPPDEQQEDSDYEFDNVDWP
FT                   GDDIVPENMVTYSQEQQKKLPPPNTNTDDNEAFIDNEINKSNNAISNPRLAERENTNEM
FT                   TDNLEELHHSVTSKKSHETNTDDANTSIYNHLPDSPSSKWHDQIDSTQSKSSHHIIETE
FT                   EQENTLANDKVIEPFTQETELLMSRLPSELQTTISRNILLTLTKQDNPNNDNSNGDSEV
FT                   YTETHVADTENNQPVVLPSSKQNETTISSPKTSIRTPQIFTRNNKKVSKDRIKVSKNVM
FT                   RLLNSSEEEEEEENVQVMVENANENLENNRSDDQNNDKTPPMESTIDPENHQNESNKPE
FT                   STQEQPQTQEQQTTTHKPNIVSNESVQPSSPTQSPSETQVLERANQRNVDVSWEDDIED
FT                   SDSDFFKEMDAKYDLVAYSKSRKSKSNEIVFEKQSNDKVINSVQTETFNGVSPQVTNHE
FT                   PHNVVNDQSKAGNETQLHETTEGKEEKNTGEYHHTDSMMKSNPRDMDVLMSDIESEISI
FT                   TNIKNQDFPPIQESNSNEYASPGNDSESCSEPDNDDSEDNLYNRLKYAGVQSSLACTTK
FT                   LRDKGKVSQQLETKDIDEPKSLIHTIKLSPQDLLGIIDPFPKTFMHTIKLSHGFFRHKI
FT                   KLPTHLLNSLNNSTETAKDTTTTQLPEDLESNLDSMKFNENEKEKENEPIKEPTKEPAK
FT                   EPTKEHTKEPARKPITSTIRSLMDVYASIPDLEQIPPPPPPPPINPVIVNEPQRKSFGI
FT                   KALLEKFPPPEKVTIPVSENVENIKSKPNQLDRIISPDTVEKSSKSSSIEQVRNQFDEK
FT                   LSLNNNNNVTDGNNVETSKSESKLPIEFLNNPKSESKGNDLRKDDDLSKLQPQRVFIDL
FT                   SLDDDSSSSKSSDKNEGDGDVEGDVNNENNTNIGEDGMDGVVREDNINSTTTNNEPESN
FT                   DKPEQRINLSLDISTCGDTLAPGALATAYEQLLKNDMLRNILASNGTSLSDKNESSNTV
FT                   NQDLNPSKEITHQENDSSMVIDSNEDILQQIKNKYRAKYEKFTNFNKNEESRSKEKSGN
FT                   SIALIGNNKESRSRHSNPSGNGPDTSNRSDNPSTTTASDKSDKSNGVKGKTRQSILHDW
FT                   KALSLDSDINSSRGDKSTNSQANGERNQSIVTLKEIEDNIISSTNGETNSKKLEINHNN
FT                   NNAKDKDSNIDDIDND"
FT   CDS_pept        complement(315674..316852)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580812"
FT                   /orf_name="CD36_41440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42024.1"
FT                   /db_xref="HOGENOM:HBG397146"
FT                   /db_xref="UniParc:UPI000192D2B2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK5"
FT                   /transl_table=12
FT                   /translation="MVLKNSKWDKKAKYKYLKKHNILPTNKSNDNDTPSAKWSSKKKSI
FT                   NNTTTTGIILDDSDDEWDSDIDNALINHFYPQLSENDELTIEQKKKIKSQILANLDKDD
FT                   ADEEIDGIYLGSDANKTKELKPPNNNNQDSKFDLEQFINNLDVKPQKNKRKLLHNKISD
FT                   NFLEEYGLSSYQELNRNVDDYNSIYEKKQKELVKNNINNIPIEKLDGFVIGESSIIDTI
FT                   TADKSKSTKKSNIQILTNDEKQKDIERQKLIEQENFYRQIKNKFNDNTMSKSNKSGKVL
FT                   EINNFDNTDVDQLAHLNNRILRNDDNNKTTTLDNDIDLLLGISSDRDKIGSNIQQDGDF
FT                   DTFINKLTINDDKEETSKHEQQYPLKLNSDNLNAKQNRNDVKDLDFLDDLLG"
FT   CDS_pept        317102..318469
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384359"
FT                   /gene_name="NMT1"
FT                   /orf_name="CD36_41450"
FT                   /product="Myristoyl-CoA:protein N-myristoyltransferase,
FT                   putative"
FT                   /function="glycylpeptide N-tetradecanoyltransferase
FT                   activity"
FT                   /biological_process="N-terminal protein myristoylation "
FT                   /protein_id="CAX42025.1"
FT                   /db_xref="GO:0004379"
FT                   /db_xref="GO:0006499"
FT                   /db_xref="HOGENOM:HBG314670"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniParc:UPI000192D2B3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK6"
FT                   /transl_table=12
FT                   /translation="MSEDNTGNTNSNKPNSVPSKSIEELLKLLAMGQELSPAQQKEMKD
FT                   YKFWKTQPVPSLSEKITEEGPIDKIKTPEDVPNDPFPLITDFEWSTLDIEDNLQLDELY
FT                   KLLYDNYVEDLDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVT
FT                   FKLNKSGKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPT
FT                   PLTTCRYQHRPINWSKLHDVGFSHLPANQTKSSMVASYTLPNNPKLKGLRPMTDKDVSP
FT                   VLSLLYKYQERFDIVQLFTEEEFKHWMLGNNEDSDSNVVKSYVVENENGDITDYFSYYL
FT                   LPFTVLDNAQHDELGIAYLFYYATDSFENSNYKKRLNELITDALITSKKFDVDVFNCLT
FT                   CQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL"
FT   CDS_pept        318718..320529
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231542"
FT                   /orf_name="CD36_41460"
FT                   /product="Periodic tryptophan (W) protein, putative "
FT                   /protein_id="CAX42026.1"
FT                   /db_xref="HOGENOM:HBG748186"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D353"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK7"
FT                   /transl_table=12
FT                   /translation="MISSSTWVPRGFAAEFPEKYELDDEEMERINAMANLEINDAKEQL
FT                   AEIEAEAEAEKTSKTSKLAEQIELDDDLKEYDLENYDNDGNDDDNNLQDTKITMFPGLS
FT                   NTDAKLLQDESGEGDKYLSLPTELDEQEEKKENQIYPTDNLVLATRTEDDISWLDIYIY
FT                   DDGAGAPIGAEEEEEDKQDVDVANGMIRESNLYVHHDIMLPAFPLCVEWINYKPGQESS
FT                   DNTTNIGNFAAIGTFDPQIEVWNLDFVDKAFPDIILGEPNKNSFIAKKNKKSKKKKGTQ
FT                   HITTHHVDAVLSLSHNKIHRSILASTSADKTVKLWDLNSGTAVCSFDKIHHNKTVSSSQ
FT                   WHSQEASILLTGGYDSTAAVTDVRISASESSSSDSSKHYSVVAGEEVENVRWDLSKPEL
FT                   FYAGTDNGNIYSFDIRQDSKPLWTLHAHDAGISSLDVNNYIPGMLITSAMGEKVVKLWK
FT                   CPSSSDDNTNNKQGPSMVLSRDFGVGNVLTTSYAPDIEVAGNVVIGGITGGLKMWDAFS
FT                   NSSVRNGFREELKVLQSNARQEAKKNGRASRIARKYNSNNNKEEIMTVEAGGLKDESDS
FT                   DSDEGEDVPIEMQEEEEEDDDMSDDDL"
FT   CDS_pept        complement(320597..321265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580813"
FT                   /orf_name="CD36_41470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42027.1"
FT                   /db_xref="HOGENOM:HBG397145"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192D354"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK8"
FT                   /transl_table=12
FT                   /translation="MISPKYSATHYYLSAKTLSGVASAPHIINLYLDYNCPFSAKLFLK
FT                   LYNTVIPNLEKNHPGRFQFVFVNVIQPWHTNSTLLTEFALVYAKLLRERGTEVDIDSIK
FT                   AFWDFSKTVFENKEKFYDTANIELTRNQIYEQIYNVVTSGLELKVSKEKILEELTIKPS
FT                   EVPSNAGNGATTDVKYFTKYLRGVGVHVTPTVSIDGIVDDSVSSGSSEDDLVKLFESKL
FT                   "
FT   CDS_pept        321537..322874
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580814"
FT                   /orf_name="CD36_41480"
FT                   /product="Ubiquitin-protein ligase, putative "
FT                   /function="ligase activity"
FT                   /protein_id="CAX42028.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397144"
FT                   /db_xref="UniParc:UPI000192D355"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFK9"
FT                   /transl_table=12
FT                   /translation="MSSVSNADVSTLSNPATDNLSLLDQQAISLFEEAIKKESQGLMSD
FT                   AVDLYRKSFKINEQVDKIYRSFHLPNALHKLQNERGKNYITRVDEHKVAKINVDTLLDS
FT                   FKDVEAVAPDPINGESGGAQGEMTIKFANMNINHEMIASVSVSPLVHLPNDIWTYILEI
FT                   LIHHSPESWFKMSITCKKFAYLGFGQSTIWREICQLIYPYQKYEENQFYLQNPTSTGQI
FT                   EDDSELPIPFNQLQILPQYNNSWKFMLHNRPFIKFLGCYISVVNYYSEGGKAEFSNAWS
FT                   NPVKTITYYRYLRFYRDGTVLKVLSVLPPDQVVPYLSKHNKILPSSISELGKPIYLHDE
FT                   NKESHKIYIGKWTISSSGEVHIIIENGSVAYLTFHYWFQVKSLGHINKHAKLTWVRYNS
FT                   VRKPTQTVTTEGEETIDDRVGEIMEFSIRNEKPFKFSRVKSYTHTN"
FT   CDS_pept        323223..325808
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000029414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580815"
FT                   /orf_name="CD36_41490"
FT                   /product="Subunit of eukaryotic translation initiation
FT                   factor 3 (EIF3), putative"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="CAX42029.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="HOGENOM:HBG608917"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000192D356"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL0"
FT                   /transl_table=12
FT                   /translation="MSRFFVSGYTSDSSSEEEDLLSTSEEELLSSSEESDSSFFGEDAD
FT                   ESEESSSDDEDGRPSGPAYFLKKSFLKGSGGDDSDSESDDEGRKVVKSAKDKLLDDMKS
FT                   SIEVINSNKYNNNWSIVLGEFDKFGRFLIRCNQTNLGTPKFYIKLLTSLDNSITETSNN
FT                   ERDDKTLKADEARAFNTLRQRIKKQIREFQVYYDLYKENPEEFDENEDEPLESVQAGLN
FT                   DNVKNEADGSITGALASNRVLSPIFHTLKTISESRGKKNIDKLEQIATLEKLLESHVSK
FT                   GSPFELISIYQMLLSVRFDASSNQAFMPLEQWQKNEQDLGKLLDLLEANVDTYQVSELG
FT                   LTTDDIDIEPTANSKGVKVIFGSITSSIDRLDDELTKSLQHTDPHSTEYVERLKDESTI
FT                   YNMIVRGQTYVESITPEDIKYKSEQLARIVLRRLEHIYYKPKQLIKANEEEAWRNIKYS
FT                   SYIVSKDSTVDQVIDQLAQFLQKQQNKTYGKHAILFSIYYYAVNSQYEKAKELFLGSQF
FT                   YSNINSAESSLQVQYNRALVQLGLSAFRAGSIEESHKILNEIVNSQRSKELLGQGFNSK
FT                   FPNQATVLERQKLLPFHQHINLELLECVFMTCSLLIEIPTLAAIANNHKDPKRKNASLK
FT                   SFKSKLDFHDRQFFTGPPESIKDHIVHASIALQKGDWLKSYNLLSSIKIWKLFPDNDKL
FT                   LAMMKNQLQIEGLRTYIFTYKSVFKKLSIEKLQQIFELSSTEVVSILEKMIATGNVSGE
FT                   IIDNKFISFTSTTEPQRSKLQELAIVLNEKIQLLTEKNEKTQSNGYGKKQQNKDQQQQQ
FT                   QQQQNQQQNQQQQSSTQSQQQNNILSEESANKFRYANVNSNNDEFQATA"
FT   CDS_pept        326135..327289
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580816"
FT                   /orf_name="CD36_41500"
FT                   /product="Uncharacterized protein YGL211W homologue,
FT                   putative"
FT                   /function="ATP binding"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAX42030.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG541846"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020554"
FT                   /db_xref="UniParc:UPI000192D357"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL1"
FT                   /transl_table=12
FT                   /translation="MPESTNTILNNTPSRKIKLTALCELCHGRKAVMKRPKNLMKLCKE
FT                   CFYNVFETEIHNTIISNKLFHRGEKIAIGASGGKDSTVLASILKTLNERYDYGLKLVLL
FT                   SIDEGIKGYRDDSLATVKRNQKQYDMPLEIVSYKDLYNWSMDEIVACAGIRSSCTYCGV
FT                   LRRQALDRGAEKLGINHVVTGHNADDVAETVLMNLLRGDVARLEHSTNIMTTSAGSPIK
FT                   RSKPFKYTYQKEIVLYAHYKKLDYFSTECTYAPEAFRGTARELLKSLESIRPSCIMDII
FT                   YSGEHLVLAPKKQKRKTVAYKNKKKTNDEQEVNPDGSISLNRNGIKKDGNTCEKCGYLS
FT                   SNKICKACMLLDGLEINRAKVAIDNNSAIDGAAKLTKSLEQLSF"
FT   CDS_pept        327604..328410
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18537133"
FT                   /orf_name="CD36_41510"
FT                   /product="Translational machinery associated oxidoreductase
FT                   protein, putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42031.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192D358"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL2"
FT                   /transl_table=12
FT                   /translation="MSFGRKAAERLANRSILITGASSGIGEACAKVFAEASNGQVKLVL
FT                   GARRKERLVKLSDTLIKQYPNIKIHHDFLDVTIKDSISKFIAGIPHEFEPDVLINNSGK
FT                   ALGKEEVGELKDEDITEMFDTNVIGVIRMTQAVLPLLKKKPYADVVFIGSIAGRVPYKN
FT                   GGGYCASKAAVRSFTDTFRKETINTGIRVIEVDPGAVLTEFSVVRYKGDTDAADAVYTG
FT                   TEPLTPEDVAEVVVFASSRKQNTVIADTLIFPNHQASPDHVYRKPN"
FT   CDS_pept        complement(328751..329305)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580817"
FT                   /orf_name="CD36_41520"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42032.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG319315"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniParc:UPI000192D359"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL3"
FT                   /transl_table=12
FT                   /translation="MKILTFFNNYRKMSRLNEYQVIGRNLPTESVPEPKLFRMRIFAPN
FT                   TVVAKSRYWYFLQKLHKVKKASGEIVSVNIISEAKPTKVKTFGIWLRYESRSGIHNMYK
FT                   EYRDVTRVGAVETMYQDLAARHRARFRSIHILKVVELEKTDDVKRQYVKQFLTKDLKFP
FT                   LPHRVQKSKKLFQATAPTTFY"
FT   CDS_pept        complement(330023..330988)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384360"
FT                   /orf_name="CD36_41530"
FT                   /product="C-4 methyl sterol oxidase, putative "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42033.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325679"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000192D35A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL4"
FT                   /transl_table=12
FT                   /translation="MEVLHQLTSNHTSSLSSLINTHPTAFSSILKEVDVAHHSLNYIEK
FT                   LWASYYIYMNNDILATGLLFFITHELMYFGRCLPWFIIDKTPWFNRYKIQPNKIPTNQE
FT                   QWECFKTVLKQHFLVEALPIWLFHPLCAKLGITYDVPFPGWKVQAMQIVIFFICEDFWH
FT                   FTFHSLFHQGWFYKNIHKVHHKYAAPFGLAAEYAHPVEVMALGVGTVGFPILYAYLATV
FT                   YTNMPPLHLFTLTTWIVLRLFQAVDSHSGYDFPWSLNKFFPLWAGAAHHDEHHHYFIGN
FT                   YASSFTLWDWLFQTECGSYAKKRRERNSKASAESKHKKTL"
FT   CDS_pept        complement(332568..333833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384361"
FT                   /orf_name="CD36_41540"
FT                   /product="Glutamine amidotransferase, putative "
FT                   /function="carbamoyl-phosphate synthase activity "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="glutamine metabolic process "
FT                   /protein_id="CAX42034.1"
FT                   /db_xref="GO:0004086"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG286341"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000192D35B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL5"
FT                   /transl_table=12
FT                   /translation="MLSATKRYLATAATNKGFTNTTSQLGRATLTIKDGPVFNGYSFGA
FT                   NRNVSGEAVFTTSLVGYPESMTDPSYRGQILCFTQPLIGNYGVPSSTIKDQFNLLKYME
FT                   SPKVQCIGIVVADAALEYSHWTAVESLQQWCKRSGVAAITGVDTRQLVSYLRDKGSSLG
FT                   RITIGEEYDADEDAAFEDPGAVNLVHKVTTKAPFHIACPPKYSKGIHIAVLDCGAKENI
FT                   LRCLVERGASLTVFPYDYPIDKIANKFDGIFISNGPGDPTHCSTTVNNLKKIINNHQDL
FT                   PIFGICLGHQLLALASGAKTIKLKYGNRAHNIPAIDLITGKCHITSQNHGYAVDANTLS
FT                   ENWQPYFTNLNDLSNEGMIHKYQPIFSTQFHPEAKGGPLDTSFLFDKFFDNIDVYKKTN
FT                   GLNLPVVENSLLVDILPKERVE"
FT   CDS_pept        complement(334202..336919)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580818"
FT                   /orf_name="CD36_41550"
FT                   /product="Ubiquitin ligase-binding protein, putatuve "
FT                   /function="ligase activity"
FT                   /protein_id="CAX42035.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397143"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR007520"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="UniParc:UPI000192D35C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL6"
FT                   /transl_table=12
FT                   /translation="MHLPNLVNIKDSSSSSNKAFKRNPSGNPPSYNESISQVSSPISLT
FT                   PVSSASRVPTLSSSSTRSKTSGNIKNVPYKPSAEQQRQINLLGGGRSPIAELSTVSSHS
FT                   QTEYFDVLPSFQMFQSILKRDDRQFQEDLSSLPPGYGDVTNSSPTPPTLSPSNSRDRTI
FT                   DEAIERLNEYGLAQERDEMNNDEYLFEEHDHNNHNNNNNNNTLSPVGSTVNANVHNQNI
FT                   EVTHDTYGHSPLDNIDKLHKLPHSPIDIQIYVTKQIPQPNANNDLETRLKEYTSGDFVN
FT                   GYITVINKSHEPVEFGLFTVSLEGTIKSVERNPHATTTTSGLTNKFSKILMKKFLKMYD
FT                   LNASYGYVQVPNSAGIEYEPFSHDLSDGSVIGLPTDRLLQPNIKYKKFFTFKFPHRLLD
FT                   NACINSLLPHLLPPPSMGIDRTCFYNRGEGIQLNKALGYGFLNVRGTPMLTKDYSFDDL
FT                   SISYTIEAKFIDRLNSTEPISHDEINNNNATAAEYVISKNAQYFLRFIPDLKEQVQYCK
FT                   RFQIGGYPVNGIGGKFMQQYLNKLTWKDIKLQNFEVEKEIDEKLLHMELSPEEVKNKNL
FT                   IINVNNENTTTNNNKNDNSLRQEFKPPSCEIENNIIITKIPTEIFGKKKKMILSSLVKI
FT                   GESKLSVIIPDKIIPYASPRLLMKYNNSKQQPQDEEEEELDSLRPVLSHMDEIYNRNKE
FT                   DIIDSIKLKLEFITTDNNIRAPEIQSVDVNIIFWSYSTDYPIPFELGYDFFYTNENNQD
FT                   EYIKDPVEITRSNLQNLKDQVSNYISFVKENKISLSRDTFLYLKSIKSLGVKKDTIKDY
FT                   FQIITDSNLLNHEGSWKVEQLNNNSKGFRYCKDLTIPLTILNKNNVNLLPSFQSCLVGR
FT                   LYCLQVMVRYKGTNNDQNEFADNIVKVDVPILVG"
FT   ncRNA           complement(338066..338163)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR73"
FT                   /db_xref="Rfam:RF01207"
FT   ncRNA           complement(338525..338615)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR75"
FT                   /db_xref="Rfam:RF01185"
FT   ncRNA           complement(338743..338836)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR76"
FT                   /db_xref="Rfam:RF01209"
FT   ncRNA           complement(338986..339073)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR77"
FT                   /db_xref="Rfam:RF01181"
FT   CDS_pept        complement(339660..341114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580819"
FT                   /orf_name="CD36_41560"
FT                   /product="Subunit of CPF (Cleavage and polyadenylation
FT                   factor), putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42036.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG736724"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="UniParc:UPI000192D35D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL7"
FT                   /transl_table=12
FT                   /translation="MSSVVYYKFLHQKNKSVIHFDGTSISVFDLKKEIITQNQLGSGQD
FT                   FNLRLYHSEQPDQEYELDQDVIPRSSYVLAKRSPAFVKSGKYNNASRYVTGKPRINRKA
FT                   ITSTISSGQTANSSLSVPIQQLDENATEEDRIKLMFQNQSNAWEQTQEDLAHHKMVFNK
FT                   PTAASTANKQDDHPPPGYICYRCGKKDHWIKNCPTNNDPNFEGKKIMRTTGIPKSYLKT
FT                   ISREEVESKANTLTTNDNGDVVDSEGNVILITDEGDYAIAMADSKTWQNYQEKLQNAAL
FT                   KSKREYESKLVTEIEKDNKLEFLDPLANTKTVLSPPIVMTPCCTDSTKLQSMKNFNYNQ
FT                   PELERVLIDNDFHCPNCGKADVFLDSVIPNKDLEDKLQEYVSSKEKELNIKDPSKRTAE
FT                   EMSADDNSGEPDAKKQKIAPATIQPGMFPVGVMPPMPFALPPGVQIPPPPPPGFGMVPP
FT                   PHFMPPTQVQQFNNNNNNNSGGNPPQ"
FT   CDS_pept        341368..344688
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580820"
FT                   /orf_name="CD36_41570"
FT                   /product="Subunit of the nuclear pore complex (NPC),
FT                   putaitve"
FT                   /protein_id="CAX42037.1"
FT                   /db_xref="HOGENOM:HBG398506"
FT                   /db_xref="InterPro:IPR021717"
FT                   /db_xref="UniParc:UPI000192D35E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL8"
FT                   /transl_table=12
FT                   /translation="MDVSYSFTPLIGYKDSLIDQHVKLPLNYPIIDNNHIKTISTTPNN
FT                   EFHKKIATTGKIIKLSKQSLVSAVSISVFNDMKTIVLTPMELQSNSIGFQFQNLIIDLP
FT                   HSIFSTNCITFHYSNDHILIDLVDENYLFITLKIAIDKFIFGQQLTLDNFEEWGYISVP
FT                   YSFELRSSPFFVKCLDNLNLIVSLKDGGLLHFKRDEDLGEITVFNFQEQGTLIPFLGFF
FT                   GGGKRKEIVLDGVSSNSIVDVLQIGDVVITLSVNKVLKLWNLGGHQNLSTLAIADDDTW
FT                   LPTIPSKYLKSYKQEDGKTIVSLFINTKSGDSSKSMFVFKSFELEGSNLNDLSDLSFQP
FT                   ELPNSVLFSSDVFYHESNFQNTIWFIQDYEIEVQIGQSQIKYYILWKSNTSSVLVEYTI
FT                   NSINGAILSIHISHPNGFEIDENISAYHDTEYYMDRIFDSGNYDSLIVLTSIQILSQHW
FT                   EIDSNNTDMTTQTIRQLAIDAINSKAASDNTKSYWFKLQSLCEEFKNLSQETLSLSIFD
FT                   NQILTLNVNGYGIYRKSAFFESFANQKLNSPDGKLMLIFNKFETFISRKSYHKLHQELL
FT                   QFQKISANDITNLFTKHIEGKISTTEIQTILTDLEQIPGIVEIVKSLIGSSGFELVDVS
FT                   IPSKSLGTFYKIATVMIFRNIMETHKTLLLDLVALFFICETNDQIVEFVNQIRSNLVQY
FT                   NIMEVVFDTCLTSGVVETKNMGQVQNSIFWSSIVGTHSQLKRLIGSLQLNDGYEYFYNK
FT                   VLCEDYLVDVIIELINNKEYFYLREKFLTKLNQEKIVEKFLVGLIYLFNNDAKSFYEIF
FT                   HNYSKFQNFSENKIKKHLNKDENLQNFTEVLFSNPSKSQYYHGLSKLVQSQIKTNTSNK
FT                   SQQEEHSFIEIASDLETLAIDNESNIVTREEFYLNLFELSLRISNYDITTKCLKNLTVS
FT                   TSFKNLMTKFITKIISQSKLDIIFPATNDDDDDDFYRQHFSLIDSIIDKVAKDSNLSQS
FT                   LKVYQYLYSWRLFGCVVEKSHNTELGDKRGAIEALYEFITRFRIENPSVGDVGRKVKLK
FT                   ILEIYMIILNLLKSFENNQDQWFLKNTKEIRSIVTLNDLKLEYLEWLKNLDEDISMFT"
FT   CDS_pept        complement(344760..345860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580821"
FT                   /orf_name="CD36_41580"
FT                   /product="Type 2A phosphatase-associated protein, putative "
FT                   /biological_process="regulation of signal transduction "
FT                   /biological_process="response to biotic stimulus "
FT                   /protein_id="CAX42038.1"
FT                   /db_xref="GO:0009607"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="HOGENOM:HBG397142"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="UniParc:UPI000192D407"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFL9"
FT                   /transl_table=12
FT                   /translation="MEQLTVAERYKLAIQQYENLQNISERQDSVSYQNRLTKILSEFQL
FT                   VLKLVEQLSLFSDNERIEEISTNYIPFLNLWYYIGELYTKLLMNKEGIIDLDYKSENLQ
FT                   TAKQFIFTYLENLTNYDILTLEQSKKFTILRKGQSYELSAMNKRQEKIDNFKKEQELLK
FT                   KLSILNSKDDDINKFDEEIIRTIYLDQLKFFILKSFNLLESINMELQVLKNRPLKNFNS
FT                   STNLEINDSRLQTKINSKRDKDKDDEYGFTTKLESLPKLSYQVSDLINKSGKILQPFTI
FT                   TSQKQNLKEKVFGTGQVLPSMTVEEYLDYELANGKMLKNEVKDKPKNDDNDSDTEDSEV
FT                   EEEKRRWDDWKDDNPKGSGNMKANIG"
FT   CDS_pept        346207..346596
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167251" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537134"
FT                   /orf_name="CD36_41590"
FT                   /product="Transcription initiation factor IIA (TFIIA) small
FT                   subunit, putative"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="CAX42039.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG499936"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniParc:UPI000192D408"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM0"
FT                   /transl_table=12
FT                   /translation="MSAPAYYELYRRSTIGVTLMDALDTLISDEKIQPQLANRILINFD
FT                   RIIAENLKNENIVGKSKLIFKGDLDTYRFCDDVWTFIIKNVIIKLNDVSKDNNNNSNDK
FT                   DSGDLELNVDKFKIVACNSRKAGEM"
FT   CDS_pept        complement(346683..348044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384362"
FT                   /orf_name="CD36_41600"
FT                   /product="Uncharacterised protein YMR027W homologue,
FT                   putative"
FT                   /protein_id="CAX42040.1"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000192D409"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM1"
FT                   /transl_table=12
FT                   /translation="MSLPPPYYNDDKNSFAYPTVRKRWPTIIDGAIEDVQQTIEIHQEE
FT                   ASLGHKIIQQLLNIKEDFANDAIVRPFTDEELKVNPHLKHYNESLEIFNKIKPVTWQTG
FT                   PWLYLECYLYQYINNFFIVDNTNKFWTNYDVFQKLKDKTFKQSELGVLELCKRYEILSK
FT                   QLDQANEEVLHLLFKEFIDISLWGNATDLSLLAGNVTLEDIKSVQGAEVRKKNEEKILV
FT                   NDLSQAWNQLQNASNGNGSKRVDIVLDNSGFELFADLILTLFLLDSNLVQEVHLHCKEI
FT                   PWFVSDTMPKDFQDLLKQLADPKFYPKIHSDEPSSIKLVHDKIKHYYDNHALIINHDPF
FT                   WTLDYNYWYIPKFESLYLELQKSNLIIFKGDLNYRKLTGDLQWLKTTPFKTSIQELATS
FT                   NLPVLSLRTCKADVVVGLPEGINEKLIKEYENMGNENGQLWSSSGKWAVISFNK"
FT   CDS_pept        complement(348896..349174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231543"
FT                   /gene_name="NHP6A"
FT                   /orf_name="CD36_41610"
FT                   /product="High-mobility group non-histone chromosomal
FT                   protein, putative"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42041.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG738370"
FT                   /db_xref="InterPro:IPR000135"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000192D40A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM2"
FT                   /transl_table=12
FT                   /translation="MAPGERKKSSRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGIS
FT                   FGQVGKLLGEKWKALNSEDKLPYENKAEADKKRYEKEKAEYAKKNSI"
FT   CDS_pept        complement(351355..353583)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580822"
FT                   /orf_name="CD36_41620"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42042.1"
FT                   /db_xref="HOGENOM:HBG397139"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI000192D40B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM3"
FT                   /transl_table=12
FT                   /translation="MSTYRKTYKNQSKRFNNGNNSNSTSTELTNLVEMFPDWEADELQG
FT                   LLSENDNSLEIVIDLIVNNKVSKWEPIKKEKHKKKEHKDDTTDSVTGNANGASNSTIAT
FT                   GDRRLNNKAKTSSSSRPPKRQHPNAAHKKNEKTERQKVSSASATSATSSVTKESAPPSN
FT                   SWAAALSNDKPKRQETKSEVSESIPSSKDGVVPEADEPSGEPSGEPSGELETSQQESEN
FT                   VVQERVESVPEQSEIEHTKPVLKQAAIPEPKQGSWASAIAPKTKPKPKAVSKPVPQQPE
FT                   ESKPEEHVPVQEESKPVEDVLEETAVEAVQTIQPTTDEPVEAPTTSTVAAVADVSFSEP
FT                   TASSIIDQQPQVVLPTTQQQVDSVGISFGSLSVDAGEPKEATEVTRDEVIPDQVQPEQQ
FT                   QQQQQQQQQPLQEQQRYGLYNQQPAQQRYQQNNYQQQSQYSKQQQQQPQASQPTQQQQQ
FT                   QQYDYYGQYQQQQYPQQTAQPGAQFAGYPGFDYNAYNQQAFAAAATASPAASHVATIGG
FT                   GVGGYNQYAQQGNSADSTQSPIVNQSTLQQQQAAVLAAQQQQQQLPTPFGYPAYYNYYY
FT                   NNPYFNAGGLGSTGFSAPQQGTQQGAQQQQQQQQPSQQGGQQPVSSASQQGSVSSNSFG
FT                   AQQQYYNPNQFNSRYPGYSYPPQQQGQQASQHTSGQSQQGTQTASDGASDGQQTSQQQG
FT                   QSSQQHQSQQQQHAQPVPQQHMMPQYGAYQQYPQYGYQDSNQYRGGWY"
FT   CDS_pept        complement(354331..356430)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580823"
FT                   /orf_name="CD36_41630"
FT                   /product="Tubulin tyrosine ligase, putative "
FT                   /function="ATP binding"
FT                   /function="hydrolase activity"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAX42043.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324223"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000192D40C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM4"
FT                   /transl_table=12
FT                   /translation="MHVLLTNDDGPLNDKSCPYFKYLVDEIITTTDWDLSIVVPDQQRS
FT                   WIGKAHFAGKTLSASYIYTKVSTLEPNDKINTFEGPFSRPEPKFHNDNEYQEWCLINST
FT                   PAACADIGIHHLYAHSKNKPVDLVISGPNFGKNSSNLYILASGTVGAAMEAVTHGVKSI
FT                   ALSYAFNNLDHDYYILKEAAKISVKLIKKLYQQLQSSSNIDLFSINIPLVDSLNLESTK
FT                   IYYAPILQNHWESIYTPLLETNEKGQLQFSWTPDFKKVYKDGLADKNHTDSRVLLEEGI
FT                   SVTPLQAAFRVVDPLKGEIKLTEEEENQEEEQKINDNTLLITIPKESYIYNPIVEPFKK
FT                   LGYKITSDKSVIGSGIPIFHYGEYEDIELDFVGDSHYFIPSYIYRKALIRKHYLANTVH
FT                   HYVTKNPQSILKVAVPESYQLEVDYAEFLDDALDDSYELRDEVNQGEKLWILKPSMSDK
FT                   GQGIRIFKTLDQLQEIFNSFEENDEEDEKEEEDNGIILSQLRHFIVQEYKSDPLLLSGY
FT                   DKKKFHLRTYVVCVGDLKVFVYKNILTLFAGEPFQLPVDVDEEEISLAGHLTNTCLQEN
FT                   ENPLVVPFWKLQGFDESDKNIVFDQICDITRELFKAATSVDKMNFQPINNAIEIFGIDF
FT                   LVNSDFSVNLLEVNSYPDFKQTGDDLKEIIYELFERVATELIDPIINGNVVPVKDGESN
FT                   LIEVL"
FT   CDS_pept        356765..357094
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580824"
FT                   /orf_name="CD36_41640"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit, putative"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAX42044.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000192D40D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM5"
FT                   /transl_table=12
FT                   /translation="MSVFLGSSAQFSQATVDPEKIKLADIQFSAMAFTFNKLLQRCESK
FT                   CLLHEYGESELTKGEQECIDRCVSKYIKANVIIGEHLQKQRMDPYNAMPEYRKVQDILA
FT                   SSVKS"
FT   CDS_pept        complement(357301..358380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080180"
FT                   /orf_name="CD36_41650"
FT                   /product="Fructose-1,6-bisphosphate aldolase, putative "
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAX42045.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327581"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D40E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM6"
FT                   /transl_table=12
FT                   /translation="MAPPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVA
FT                   ALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRSIAPTYGIPV
FT                   VLHTDHCAKKLLPWFDGMLKADEEFFAKNGIPLFSSHMLDLSEETDDENIATCAKYFER
FT                   MAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYEALHKISPNFSIAAAF
FT                   GNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKN
FT                   GVVKVNLDTDCQYAYLTGIRDYVVNKIEYLKAPVGNPDGADKPNKKFFDPRVWVREGEK
FT                   TMSKRISEALDIFHTKGQL"
FT   CDS_pept        359484..360056
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580825"
FT                   /orf_name="CD36_41660"
FT                   /product="N-acetyltransferase catalytic subunit, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAX42046.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D40F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM7"
FT                   /transl_table=12
FT                   /translation="MSLITTINGLPYHQFDINNQDEFKQISDLISLHLSEPYSIYVYWY
FT                   FLNNWPQYCYTVKEPETLKIIGVIISKIEPHRNVRMRGYIGMLVIDPKYRKQRLASNLV
FT                   KLTIENMKSIDKVDEIMLETEVINQGALNLYESFGFLRTKRLYRYYLNTHDAYRLILPL
FT                   GEKSRTRIAFLPPLEKGVEKSDQTVSL"
FT   CDS_pept        360262..361224
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537135"
FT                   /orf_name="CD36_41670"
FT                   /product="Proliferating cell nuclear antigen (PCNA),
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="CAX42047.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG749295"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI000192D410"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM8"
FT                   /transl_table=12
FT                   /translation="MGASPTIFFYHCRENEKKKKESKYLYIFFFFLLSFPFPFHLSPSI
FT                   FILYSIDTQKKRTTLIMLEGKFEEAALLKKVVEAIKDCVKKCNFNCSEHGITVQAVDDS
FT                   RVLLVSLLIGQTSFSEYRCDRDVTLGIDLESFSKIIKSANNDDFLTLLAEDSPDQIMAI
FT                   LEEKQKEKISEYSLKLMDIDSEFLQIDDMEYDAVVNMPSSDFAKLVRDLKNLSESLRVV
FT                   VTKDSVKFTSEGDSGSGSVILKPYTNMNNERESVTISLDDPVDLTFGLKYLNDIVKAST
FT                   LSDVITIKLADKTPALFEFKMQSGGYLRYYLAPKFDDDE"
FT   CDS_pept        complement(361335..362285)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580826"
FT                   /orf_name="CD36_41680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42048.1"
FT                   /db_xref="HOGENOM:HBG397138"
FT                   /db_xref="InterPro:IPR013904"
FT                   /db_xref="UniParc:UPI000192D411"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFM9"
FT                   /transl_table=12
FT                   /translation="MLDSISLEVISRFKEALSAQKVDADRDSKIINEENENLPVYNRGL
FT                   KLSKTIQPSLNTLRSKITEYGGKKYSVLSNESIEIDNLHSKRKWNEIYGDQQAQDDEEL
FT                   ELELEFEEDKEEHPLKKSRIIELLSPLNHPSEIISHPAISKTYKSQTLSKLASELIDLI
FT                   ELEQTNLNWLNKLLQVLNGEDWFYLLEENLGLKDYDHGLDEEKKKILEEKENNKDNNNN
FT                   NNKIVDEFEDEEENKADPFFALPTALKRYETYQQNLESNDPLKEELINYLQVSIQRQHE
FT                   YIKNLISLRNGLVRADRLKKDLYKWGKEMYEKKSS"
FT   CDS_pept        363462..366977
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080181"
FT                   /orf_name="CD36_41690"
FT                   /product="Autophagy-related protein, putative "
FT                   /protein_id="CAX42049.1"
FT                   /db_xref="HOGENOM:HBG397137"
FT                   /db_xref="InterPro:IPR019460"
FT                   /db_xref="UniParc:UPI000192D412"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN0"
FT                   /transl_table=12
FT                   /translation="MSEISYLSINNAHNGVIIKIPKPVRFHTLSEFKKYIQQSYSIDSV
FT                   DNIFLLTTFGIKLNYNLINEISEVFVYDKRLFTNIVDHSLIDQYTQLTFRVNEPTHSPL
FT                   LKNNVGFLKHNLSSNLKINQGWARIIAQDGELMDQYCRELIQQINVIFKCLNTIFQFAT
FT                   NFTNEIEKNFTNFFNYVKLINYKTLHKSWTANYKNLKTFPTFKIDNKSIKLSDFLEVDR
FT                   LQSFADYIGKFLPLIVSKLNELKQVIETVNEEKLTVDKFIETSRNDSISKFKHVNISNM
FT                   LHQLQAGLQQLTDDIDNLQYRNTDEIYRLHRDKLSVSIYDSAKDIYKNLNDLQQFKTKL
FT                   TKTSLKAFNTIANLQMKMVGVKTEMRKITTEDEAATGTENSKGDVTYKTISNVKKYEDY
FT                   LSLTIDLPLIFGFSLIEERRQFEWYDFYSKGVVNNVSEQLSTIIEHEKVFRGIWYKKFG
FT                   TLLSLINDEPLTPPSLPNIDVTLVGNRQNNFSILYDDLKIERDDIINYISLIETTNTPR
FT                   NFVTLLNKNFKDLIASTNNMKKVTKVISSLSTYTTNSADDKSKSLHEEGTDEEIDFDLN
FT                   LIKGLKSRIKKLENLLHQQQFKNLNNWPVIRNVSSMTNDNRQSTIIQPRVVSPAKTNPT
FT                   QLLSRNPSTKENTNTTTNIHNNHHQQQSEVLDSSVIDKHLDNIRLKKLNNELQTKNTEL
FT                   ENQINQKNETIMQQRKEIEDIKLANDKKVDELMKKLQEKDEEYQSLKSENKLISNEVDS
FT                   LTNKLELSNNRNNELETKISEYNQTVAATSKEVADLNKNVSNLRSELGDAMHMKNDLLS
FT                   NLSSKEAEFTKERNQFNNDLKTLQLKLDEVNEDYENLMELTQAKQKKHDLIINDLNNVI
FT                   INLMNDIKKTLLSVFEYFLEYCLVLESMGLLLVKEDKIYKIKRVKGLKSKKTIGDGDMS
FT                   IISNGTPSSKVIEEIEHEISIVNNIPPISSILPDSYSSGTESDSVVDRYNDQSMKLIST
FT                   FNQLFKFNNENENENRIDHILNILAFKNNVQLQEDSINDTRFFLNAISKRFRDVEGFAK
FT                   RQAKDNKLKEQEQRKLIHRLNSKISVNGFQEKDLVLFLPTRIDRPNGENTPSNEKIQPW
FT                   AAFNIGAPHYFLKTEQTKNKEWIIGRVKKITEHKVTEENLQSLESNPFQLSVNVTWYLV
FT                   EADEE"
FT   CDS_pept        367967..368698
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537136"
FT                   /orf_name="CD36_41700"
FT                   /product="Dienelactone hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42050.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000192D413"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN1"
FT                   /transl_table=12
FT                   /translation="MASNPPRACCAQTNFHEGTPLGTHSEICGIDTYIVGESSNILVIL
FT                   TDIFGHKYNNVMLVADAIAKTGYKVLIPDILNDDPLKPGDDFRPWLPKHTPDITAPIVD
FT                   NFLKRVKEELKPTFFGGIGYCFGAKFAIQNLSTTGYLDAAAVAHPSFVSIEEVKAIKRP
FT                   IIISAAETDEVFAPELRHQTEDELAKLEGVRYQVDLFSGVTHGFAVRGDIKNPIVKYAK
FT                   EKVLADQLAFFNSVIALRDQF"
FT   CDS_pept        complement(368949..369923)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580827"
FT                   /orf_name="CD36_41710"
FT                   /product="Ribose-phosphate pyrophosphokinase, putative "
FT                   /function="kinase activity"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAX42051.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI000192D414"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN2"
FT                   /transl_table=12
FT                   /translation="MHERTQNSIKLIAGNSHPELCESIAQRLSLSIAKIGAFQYTNQET
FT                   AVAIGESVRDEDVYIIQTGCGEEQINDFLMELLMIINACRVASARRITAVIPSFPYARQ
FT                   DKKDKSRAPITAKLVANLLQTAGCDHVITMDLHASQIQGFFRVPVDNLYAEPSVLRYIK
FT                   ENYKQSDIIMVSPDAGGAKRVASLADKLDVQFALIHKERQKANEVSKMVLVGDVTDKIC
FT                   LLIDDMADTCGTLCKAADVLLESKARKVVCMITHGIFSGNAIERLNNSKLEKVVCTNSL
FT                   PVQDKLNRCNKIEMLDISSTLAEAIRRLHNGESVSYLFNNVPE"
FT   CDS_pept        complement(370136..371929)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580828"
FT                   /orf_name="CD36_41720"
FT                   /product="Carboxypeptidase S, putative "
FT                   /function="carboxypeptidase activity"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42052.1"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG324099"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI000192D4BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN3"
FT                   /transl_table=12
FT                   /translation="MTEKSELPLHFKGESSSRKKVYPLFIGINFILVLCTLFFYRSYDS
FT                   KTIKTPIEVFKTFIQEPHEPNSLCPIVPKVDPSGILHNPDTLNYILSDTNFHTSVRKKL
FT                   MNAVKIPTEIFDGMKNPKSVKSLKELYELDPRWKSFEKFHDFLEKAYPLVHKHLKLKKV
FT                   NKFGLVYTWKGKDDTKKPIMLTAHQDVVPVPHETIDQWTFPPFEGGFDGKYLYGRGVSD
FT                   CKNLLIALMGTIELLLEENKFKPQRTIILAFGYDEEAAGKGAEEISEYLIDKYGSDSIL
FT                   QIIDEGDEGYQEVEGLKLVLPATGEKGHLNSVIDLFTPGGHSSVPPRHTSIGIMSQLIN
FT                   KIEDKEFSPILTNNNPVLGQLYCLAEHSTILNKSIKTSILKAQIDENANQQVVEYLSKD
FT                   AETKYLITTSQAVDIIEGGVKSNALPEHVSVVVNSRIAVEENVDTVVSKLKADILTIAD
FT                   KFDLGLIIDNQEIIEPTVHGYFNYSLIERLEPAPVSPINGESWNVFGGSLRYLYEELIF
FT                   PDLNDTFIVAPFLSTGNTDTKSYWDLTRNIYRYQPSIATKNSNIHSIDEKLDFEGHFHI
FT                   IAFYYYYLQLVDGKDDKLFEP"
FT   CDS_pept        complement(372233..372964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580829"
FT                   /orf_name="CD36_41730"
FT                   /product="Dienelactone hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42053.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000192D4BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN4"
FT                   /transl_table=12
FT                   /translation="MASNPPGACCTQTNFHEGTPLGAHKEIFGLDTYTVGESSKVVVIL
FT                   TDIYGHKYNNVLLVADAISKEGYKVLIPDILKGEPVVSFDELQAWLPRHTPEITAPIVN
FT                   GFLKKVKEELKPTFLGSIGYCYGAKYVIQNLSSSGFLDAGAVAHPSFVSIEEVKQIKRP
FT                   LIISAAETDSIFPAELRHQTEDELAKLEGVRYQVDLFSGVTHGFAVRGDIKNPIVKYAK
FT                   EKALLDQLTFFDSVQVLKSYL"
FT   CDS_pept        join(complement(375046..375300),complement(373427..374971))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080182"
FT                   /orf_name="CD36_41740"
FT                   /product="Pyruvate decarboxylase isozyme, putative "
FT                   /function="carboxy-lyase activity"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="CAX42054.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG479104"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniParc:UPI000192D4BD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN5"
FT                   /transl_table=12
FT                   /translation="MGEISLGRYIFERLYQLNVHTVFGVPGDFNLSLLDKIYETENEHG
FT                   GGSFIWAGNCNELNAAYSADGYSRVNRGKIGALVTTFGVGELSALNGVAGSYAEHVGIV
FT                   HIVGVPSNEAQKKQMLLHHTLGNGDFTVFHKMSMNICETTAFLDDLATACNEIDRCLRT
FT                   AYTMQRPVYIAVPSNMVDMKVPQAMLDKSIDLSLEPNNVQSQNEVIDRILGMVSKASNP
FT                   IVLVDACASRHDCKKEVKQLVEVTQFPVYVTPMGKGMIDEGGIGGEDLADASAFKNLAA
FT                   DLSSGTSVASRYGGVYIGSLSKPEVKEGVENSDLILSCGALLSDFNTGSFSYSIGTKNV
FT                   VEFHSDHAKIRSAIYPGIKMKELMQALNKKISSVLINYVPKSVPRVKLVNTPTEVSAPL
FT                   TQAWFWTRVSSWFKEEDIIITESGTAAHGILEARFPNNVVGISQILWGSIGYSVGATLG
FT                   ASVAAKEVDPKKRVILFVGDGSLQLTMQEISTMIKNGVNPYIFVVNNCGYTIEKLIHGL
FT                   NAKYNNIQPWNHLQILSLFNAKDNQSVKISTVGEADDLFRSKDFGVNNKIRLIELMFSP
FT                   LDAPKALVQQAKAAADVNRGNVL"
FT   CDS_pept        complement(375628..376944)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080183"
FT                   /orf_name="CD36_41750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42055.1"
FT                   /db_xref="HOGENOM:HBG397136"
FT                   /db_xref="UniParc:UPI000192D4BE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN6"
FT                   /transl_table=12
FT                   /translation="MSYYQSNMNSQSHYYRENENNSFIDSQNSQSNRLNATANIGQPTL
FT                   DNSSSSASTVSSSLDNIGIFNIESQSIHKNSNKKDDQRQFNIFARLFFGISLLSAILIV
FT                   LFEAYMFAVINIHHDKFAKGKYTENSIYFALFIFAGVFQVLITLIALYSRNLLLLVFLM
FT                   GFYCCMLIYTGIQYNEVSDKISTVLIGKWKTATYAMNIATICVLAAALVLQSILLYFGL
FT                   RRYVSWFTFKKIGASLELKRIYTYFQIHRSILMFDFFFFAGFTIQFLVIMVKDRKSVEF
FT                   ILTVIVIPLTIILLFVSDISATREFIYGSIFAIILFLCGIAYVLFKLIRLYTKYTSAYD
FT                   LAIRPGEYFMGRKSLLTFGIITLVLLVATIVLEIISICNYGKGLLPSVSMSYKWIPGYN
FT                   KSGTAQEISISDDEKEEREDQVDENGVERRTTTNSLYID"
FT   CDS_pept        complement(377398..378699)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580830"
FT                   /orf_name="CD36_41760"
FT                   /product="Phosphomevalonate kinase, putative "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="CAX42056.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG737076"
FT                   /db_xref="InterPro:IPR005916"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192D4BF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN7"
FT                   /transl_table=12
FT                   /translation="MSKAFSAPGKAFLAGGYLVLEPIYDAYVTALSSRMHAVITPKTPS
FT                   LQEESRIKISSPQFANGEWEYHISSNTEKPKEVQSRLNPFLEATIFIVLAYIQPIEPFD
FT                   LEIVIYSDPGYHSQEDTKAKTSLNEKNTFLYHSRVINEVEKTGLGSSAGLVSVVATSLL
FT                   SHFIPNVVNEHKDILHNVAQIAHCYAQKKIGSGFDVATAIYGSIIYRRFQPALINEVFQ
FT                   VLESDPEKFPTELKKLIESNWEFKHERCTLPYGIKLLMGDVKGGSETPKLVSRVLQWKK
FT                   EKPEESSVVYDQLNAANLQFMKELREMCEKHNSNPEAYIKDLDHFVEPLTVAMNKIRKG
FT                   LQTLTQKSEVPIEPAVQTELLDRCQEINGCVGGVVPGAGGYDAIAVLVLESEVENFKQK
FT                   TLENPDYFHNVYWVDLEEQTEGVLEEKLEDYVGL"
FT   CDS_pept        378723..380228
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580831"
FT                   /orf_name="CD36_41770"
FT                   /product="Prephenate dehydrogenase, putative "
FT                   /function="binding"
FT                   /function="prephenate dehydrogenase (NADP+) activity "
FT                   /biological_process="tyrosine biosynthetic process "
FT                   /protein_id="CAX42057.1"
FT                   /db_xref="GO:0004665"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006571"
FT                   /db_xref="HOGENOM:HBG330953"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D4C0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN8"
FT                   /transl_table=12
FT                   /translation="MKYLDSYEFLFWNQSLSFFCLPNFFVFFIPNNPFIIFFFVLFQLS
FT                   LSLKDPVNKQVTYIAMACTETELKNYQECKTIGIIGLGDMGYLYAKRFSDAGWKVVGCD
FT                   REDLYETTKTKFSNEKFEILKNGHFVSRISDYIIYSVEAENIEKIVSIYGPSTKFGAIV
FT                   GGQTSCKAPEIAAFEKHLPEDNEIISLHSLHGPKVNTTGQPLVLIKHRASDRSFEFVEA
FT                   LVSCLNSKQVYLTAKEHDRITADTQAVTHAAFLSMGVAWKSVNQYPWETPRWIGGIENA
FT                   KINISLRIFSNKWHVYAGLAITNPSAHDQVLQYSKSTTELFTLMIQGKKKELTERLTKA
FT                   KQFVFKYITNHHDLLLDDNILQKFSLSKTPPEGKQPNSHLSLLAIVDSWYNLGIIPYDH
FT                   IICSTPLFRIFLGVTEYVFCTPGYLEESIDVAINDSSFRQDDLHFTIAAQTWSNIISFG
FT                   NFELYKREFEDTQNFFQPMFQEANAIGNEMIKTILERVKEREC"
FT   CDS_pept        complement(380381..380938)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231544"
FT                   /orf_name="CD36_41780"
FT                   /product="ADP-ribosylation factor-like protein, putative "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42058.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000192D4C1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFN9"
FT                   /transl_table=12
FT                   /translation="MGQALSFGNIFSKLWGTNKEIRILILGLDGAGKTTILYRLQMGEV
FT                   VTTKPTIGFNVETLKYKNITLNIWDLGGQTSIRPYWRCYYSNTSAVIFVVDSTDKDRID
FT                   TACKELHQMLKEEELQDSALLVFANKQDQPGAMTAAEVSQALSLTDLKDRSWSIVASSA
FT                   IKGEGLTEGLDWLMDVIKDEQL"
FT   CDS_pept        complement(381421..382419)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080184"
FT                   /orf_name="CD36_41790"
FT                   /product="Malate dehydrogenase, mitochondrial, putative "
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42059.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI000192D4C2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP0"
FT                   /transl_table=12
FT                   /translation="MFSKVASRSFSSSASNAYKVAVLGAGGGIGQPLSLLLKLNHKVTD
FT                   LALYDIRGAPGVAADVSHVPTNSTVKGYNPDQIEEALTGSDVIVIPAGVPRKPGMTRDD
FT                   LFNTNASIVRDLAKAAADYAPNAAVCIISNPVNSTVPIVAEVFKSKGNYNPNKLFGVTT
FT                   LDVLRAARFVSEVAGTNPVNENVPVVGGHSGVTIVPLLSQTKHKDLSGETRDALVHRIQ
FT                   FGGDEVVQAKDGAGSATLSMAQAGARFAGAVLDGLAGEKDVIECTFVDSPLFKDEGVDF
FT                   FSTKVTLGVDGVKTVHPIGEISDYEEAQVKEAKDTLIKNIKKGVDFVAQNP"
FT   CDS_pept        383234..384754
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384363"
FT                   /orf_name="CD36_41800"
FT                   /product="Transcription factor Tau subunit, putative "
FT                   /protein_id="CAX42060.1"
FT                   /db_xref="HOGENOM:HBG397134"
FT                   /db_xref="InterPro:IPR019136"
FT                   /db_xref="UniParc:UPI000192D4C3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP1"
FT                   /transl_table=12
FT                   /translation="MPELQQPDKHSMDIPHVAAIDLPLNVQNVTKAVDMLGGEELIRAS
FT                   IRESHPLELRLRKDPFHHPIQASSNNSERILVKIKIPKKSLPKNSESLSIQQLLELNSQ
FT                   DKSTPRERIQPVAIIDKTYSFKAMADFQVSTRNNSFVQDFNRVMINHNSINDIKDYIDE
FT                   HHGWQGYANLSKKYFQNNDHQLIPPPILSSIRFPFDYKYQQNPGTSTVRDIHGEVKVIS
FT                   NQNRQKLHTLLIDYNTPTPQGPLEEIKKNWDKLSNENLSVNSTDFLLLQCIRKLQALFE
FT                   IKPIWNRKQLYSILPEDMKKFLKHALPYVTYTYKSGPWRFCNIKYGLDVVHDPSYWRSQ
FT                   TEYFRVLGFRKGTSTDESKMIVPPSLQGSSEVVEIPESLLFNGVSLPSVATFQIGDIMD
FT                   ADIISILEDHQNSMDEDFLRNVCDPQDGWINRQTMEVIRRVMRYKLKQLVNEESIDQSK
FT                   IHKIINTNYTEDKDDEEEVNDIHGDRNGPDELDEDEDEEEEEEDNALY"
FT   CDS_pept        385154..385432
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080185"
FT                   /orf_name="CD36_41810"
FT                   /product="Dolichol-phosphate mannosyltransferase subunit,
FT                   putative"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX42061.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG714876"
FT                   /db_xref="InterPro:IPR013174"
FT                   /db_xref="UniParc:UPI000192D4C4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP2"
FT                   /transl_table=12
FT                   /translation="MTKATETGLTIFALSAIYFALVTGVIPIPAKIHDEILPYLPWWGL
FT                   VTFGSYALSTLGWGIVTFKDKEHKYNELKIQIDEAKDFYKTKGIDLD"
FT   CDS_pept        complement(385554..386345)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580832"
FT                   /orf_name="CD36_41820"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42062.1"
FT                   /db_xref="HOGENOM:HBG397133"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI000192D4C5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP3"
FT                   /transl_table=12
FT                   /translation="MGKKKRQTKREEICKQIRTSFDSLYFIFFIMIIRRQLATLAKSRP
FT                   TPAKKTSDTTRRKYAFYDLVLRTPSHPQHPIEASLMSTKDLAKLKAHTKTTFVGNYTLD
FT                   NLSAEERIAKVFGGRIKGEDRKASSRIDRGESRVIAGITVPARPPEPDNCCMSGCINCV
FT                   WELFDEDLKDWDLKRKQAAERLVSQGGRWPENFNAPLKYLKRENYPVSLANKSDKEIKQ
FT                   GTEGQPGKDDDDDSWGSVPVSIRVFAEVEKKLKQKKTLASS"
FT   CDS_pept        390832..392637
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580833"
FT                   /orf_name="CD36_41830"
FT                   /product="Na+/Pi synporter, putative. "
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42063.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG325527"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniParc:UPI000192D4C6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP4"
FT                   /transl_table=12
FT                   /translation="MALHQFDYLFAIAMIFAFLDAWNIGANDVANSFSSSVSSRSLKYW
FT                   QAMILAAIMEFLGAVLVGSRVSDTIRNKIVDIAVFKNEPAVLMLTMTTALIGSSTWLTV
FT                   ATSIGMPVSTTHSIVGAVIGAAIAAKGGNNIIWGWKGVAQIIASWFIAPAIAGAFASII
FT                   FLISKFGVLEVKNPRTSLRNAMLLVPMLVFVAFSILTMLIVWKGSPKLKLNTLSTGTTV
FT                   GAIFGTGGVATAVYFLFAYPYYRRKLVHEDWTLQWYDIFRGPIYWFKSTDNIPPIPEGQ
FT                   TLTKDYYKGRRYDEAGNLVVLGTDRDASAGVVEAAHDGEDSNSDGEKTSAVVQNQPSSV
FT                   DSEKQPAPSAAGTAEYKGENSRWPNKFPGYLKLAKESPKNWPLVFFLLLTHGVRQDIIA
FT                   NQAGSKDVLAGDLHKMHTASKYYDNKIEYMYSLLQAITACTMSFAHGANDIANATGPLA
FT                   TVYLVWTTNTTASKAEVPVWVLCYAAGALVIGLWTYGYHIMANLGNKLILQSPARGFSI
FT                   ELGAAVTTVMATQLKIPISTTQSAVGATVFVGLCNREWKSVNWRMVAWCYLGWIITLPC
FT                   AGLIAGLLNAIILYAPSKGVSYTMT"
FT   CDS_pept        393381..394256
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000041208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231545"
FT                   /orf_name="CD36_41840"
FT                   /product="F-actin-capping protein subunit beta, putative "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="F-actin capping protein complex "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42064.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008290"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG445391"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="UniParc:UPI000192D4C7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP5"
FT                   /transl_table=12
FT                   /translation="MDKFDSSLDLIRRLDPRSITTNLSNICALISEDEELVADLLSSVD
FT                   TPLTTSTCLKSGKDYLCCDYNRDGDSYRSPWTNIYYPELSSQDVNDAPYPSSILRDLEI
FT                   KANDSFDIYRDLYYEGGISSVYLWDTSEEDEEVDSTTALQNGFAGVVLFKKETEDKSGN
FT                   WDSIHVFEVVPQSKNRYLYKLTTSVVLNLENKKQVGGNLGLAGNLTRQLEQEQSIELDG
FT                   SINPETSHLINLGQLVEKSEYNIRNLLQEVYFDKLKDIMLKDLRSMGDINDKKLDDLKQ
FT                   NAIIKGLQGL"
FT   CDS_pept        complement(394304..395632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231546"
FT                   /orf_name="CD36_41850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42065.1"
FT                   /db_xref="HOGENOM:HBG397132"
FT                   /db_xref="UniParc:UPI000192D4C8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP6"
FT                   /transl_table=12
FT                   /translation="MTSIMTANSPELTRTSSIRRDTRNSKTTPRKSTTSSLNQPLEFKI
FT                   KRSSSLSSNATSSSEASVKRSSSLRNSTSTNKGLNIFAVSPLPNSATCETPTERISHQR
FT                   KLSSYASPTLTQVSESNFPNDNQNLRYDVPLPSQDKLIAMDIDEQLRYLALKEMCIVEL
FT                   KDNINNLNNKLKYHNKELHKLREIIQRSLYKELSSESTATKNNQSQNNRPRQNSNPRDE
FT                   AIARTRTRRRSSLFHDNREDHLDVSPSNSISNASTSQESSSKLWSGLTKPLDLIQQFDS
FT                   MLQNEFEKSLINERDQKRQLHSDNRKRLSHQSKSSEGSISSIGSITSPLQAKSKAFEQK
FT                   KSNSNNRTTTDDMLQNVSSSIWSFVNDVKNNVLSSLNEVESETRSKPTAMYNLETGSAV
FT                   DIRGPRKLVANESEGDSDTDLLEPVASDDEDNLETLDLSIYRR"
FT   CDS_pept        396478..397791
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080186"
FT                   /orf_name="CD36_41860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42066.1"
FT                   /db_xref="HOGENOM:HBG397131"
FT                   /db_xref="UniParc:UPI000192D4C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP7"
FT                   /transl_table=12
FT                   /translation="MTDTNAVIQSVRKFLADNPAIPKWIKWGIIFKVLRIKNSFYWTNF
FT                   VTLNKPIKNLLIQNSNTKDPNIHRRLSKCANAISCVFLYCATVNSKLIPKDYLLIYLLI
FT                   NYVGKLNPPSNTKILVSPKYSQYLKTSNYQPWLNQLYEKKHFFIFPAIVAQILSNYLTP
FT                   TKYKLNQRYLSSSLKKYILNPIWINYKLGINYNRVNWISLFRTYCFQNVVLMSAMGLYF
FT                   FKSKLLDRLYEIKHNKDEKKDYNTIIQDYFAYVTHKSNSFINLIFGVNLISILLISLTS
FT                   PVFRALTPKTTTNMNWIQSLYVNHLKLFFKSYTKIIGFAAGLITLCLNSINLIPSWGYS
FT                   GHESIREIKPAVFNSINLYLFRLILLSKWRIIKFKHPLFTKVTRGNWNKLETVLMSFAI
FT                   WKIMNLNDFLNSTAKANIEYERKELLANPMVKLVNYIM"
FT   CDS_pept        complement(397857..398534)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190326" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231547"
FT                   /orf_name="CD36_41870"
FT                   /product="Clathrin light chain, putative "
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin coat of coated pit "
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /protein_id="CAX42067.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030130"
FT                   /db_xref="GO:0030132"
FT                   /db_xref="HOGENOM:HBG324781"
FT                   /db_xref="InterPro:IPR000996"
FT                   /db_xref="UniParc:UPI000192D570"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP8"
FT                   /transl_table=12
FT                   /translation="MADKFPEIDTPTAGGDDEYEGDFLSREKELVGDEFTTDQDKQVFE
FT                   DDEDDEINEFKEQFPEVDTKAEPSGTTGAEGLKDDDDDDDEFEGSTSSNGAAKELNLSE
FT                   SQAIKEWKQRRDLEIEEREKLNSKKKEEIIEKAKSTIDDFYENYNTKRDNHQKEILQEQ
FT                   EKFISKRDDFLKRGTLWDRVNELVTEVGELPGDESRDKTRFKELLTKLKGKENVPGAGG
FT                   YQE"
FT   CDS_pept        398974..399210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080187"
FT                   /orf_name="CD36_41880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42068.1"
FT                   /db_xref="HOGENOM:HBG561071"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000192D571"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFP9"
FT                   /transl_table=12
FT                   /translation="MARLSGLQKEVLQLYRKCIRTIKTKPENTREHWRNFIHEEFAKYH
FT                   HLSKKQFNTIEYLIRNGHRKLEMYSNPQLKDIH"
FT   CDS_pept        complement(399338..402871)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384364"
FT                   /gene_name="RGA2"
FT                   /orf_name="CD36_41890"
FT                   /product="GTPase-activating protein (GAP) for Rho-type
FT                   GTPase Cdc42p, putative"
FT                   /function="zinc ion binding"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42069.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397130"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI000192D572"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ0"
FT                   /transl_table=12
FT                   /translation="MPELVPPTNNRPHVHETLDLASQPSSGSNRQPRELCKKCNQLIVE
FT                   GHAYELGDDRWHIHCFNCSKCNTSLGCNSNFLVLGNGNLICSNCSYNCKQCGRKIDDLA
FT                   ILTGDQAYCSNCFKCRSCKNKIEDLRYARTSKGLFCMDCHQKLMAKKKKYDAKKKHLAL
FT                   LQEKRLQLEREKDQREMQILEDHKRSVNSSRNSLIQSYMNNQSNQSGESLLYQQNNRSV
FT                   TSVTSSKNKSLPLPPTATSPTRPTPYTANSYQSKDSISGKNKTDSSLGSLSTSQTLSEH
FT                   TNKGNSTLHNSTGLHNPPIFQSDNDFSIEEVQNSSDSDTNGDEKKSNGTSLRNKNSNRS
FT                   SKVSPFVNQYSTPPLSSDQLSTDEISADTGEKTVYLDIIDTPPESKADPLSGNQLKPAL
FT                   DVSPGGNPEQKSKNFLILSPNQFHDNEFHNTRSPMIDSPGTIISQNSNQNTKAVNLSVE
FT                   DKPRSGCPSPFAKVNRQARVVETNDEISTDGVDDDLAIGTPRQEKPSRAGTSKSVSSPP
FT                   PRVPLPSTPSRGDDASKKFSFVETPKGLGLEGVDYDNHEDQRSYIKSQQDQRQHDISEK
FT                   TSPSSIMSTPKRVVGNFSPAVTNLEPKNSDWSNDQQHKHSQKNQNVSRTASIIKNLKHK
FT                   RSTSGNQNKLAALFTTSNREDHRNGHTRQTSDGSLFSSIANAYISPPITNSGLGGRSHI
FT                   RSTSDSTVLLSDEDHYNNVAMKSEIEQLSSSKALLDQDVKKLRDEKHKLNEQLKMIQSK
FT                   ISSESIRYDNLVAEIAELQAQKTKITNENKELIEQQKNRQASGATGKLSKSFSNDSDPD
FT                   ASTLGKSVNTHLSPYKNSSDSTSVVSRDNYEYSDHLSPERHQAQYQQQQQQYQQQYHQH
FT                   QQQQSTEDEQTHKATRLKFWRRPKVGTTQAIPSNEYNNNSNAPNNGGGRIPNSFSTQAL
FT                   RIPAQNSGNSFNNSGANNNNQQNKFSKSKSSNILDSLLSGDSNQVPLFDSTLQQRADYE
FT                   KNQVPIIVTRCIAEVEKRGLDFEGIYRISGGNSAIVSIENAFASLSNDPDEKQLSRVEE
FT                   TLDVDIHAVTSALKRYLRKLPDPVIPFVLYEDFINVSTKASHSKEVRIAELQKIVGKLP
FT                   PANRETLRLIVNHLHLVNSLQNVNKMGYKNLSVVFAPTLAKDKSGDNEMADMGFRNDST
FT                   ELLLTESHRIF"
FT   CDS_pept        complement(405498..407120)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080188"
FT                   /orf_name="CD36_41900"
FT                   /product="UDP-glucose ceramide glucosyltransferase "
FT                   /function="transferase activity"
FT                   /protein_id="CAX42070.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG735266"
FT                   /db_xref="UniParc:UPI000192D573"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ1"
FT                   /transl_table=12
FT                   /translation="MDQEELSLFRIITGYFFLLWYIIILVAAYSGFFEIFFNFRNRPVL
FT                   QSVHQNDPESDDDEIYEGVTIIRPIKGIDPELISCLESSFCQNYPRSKVQILFCVDDPN
FT                   DPSLSIIQKLIAKYPTVDAQILTSDSYNPQTKTSDDHYGPNPKVNNLAKGFVHAKYDIL
FT                   WVMDSNVWASSNILKNSVISLNSNLNMSRKMGQSRPVKLVHHVPLALSINNVTRGDGLV
FT                   GGQDLEITAMTPVPSSESINSQLVKRKQSPKSKNSLTANSGATYSRFSKKLGAELDEMF
FT                   LHTSHSKFYVSLNNLAVAPCVNGKSNIYRRSDLDQSVRLIPHKDSPFFKDPKVKQDAGY
FT                   YTSLGVGHAIKFFARYIGEDNMIGIALWENSQGRTGLTGDVVVQPYSGLENNALRDYIQ
FT                   RRVRWLRVRKYMVLLATLIEPTTESIICGIYGTYAISTIFLGTWFNKSWFVIHMLIWML
FT                   TDYVQYYILINHTLDVKNVTYLPNWLHDAIPPKQRNCLQWGYIWILRELLALPIWVIAM
FT                   IGHEIDWRGKPFRIKKDLTAEEM"
FT   CDS_pept        408726..410624
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580834"
FT                   /gene_name="CAT2"
FT                   /orf_name="CD36_41910"
FT                   /product="Carnitine O-acetyltransferase, mitochondrial,
FT                   putative"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAX42071.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG618916"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniParc:UPI000192D574"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ2"
FT                   /transl_table=12
FT                   /translation="MFKFRIPQQILKQNSTSSKSIIMPVLKKPFSTSNPKGDLFKYQSQ
FT                   LPKLPVPSLEETAAKYLKTVEPFLNKDQLAATKQKVENFIQPGGVGEALQARLANFASD
FT                   KDNWLAEFWDDYAYMSYRDPVVPYVSYFFSHKDINNVIGNDQLLKASLIAYYTIEFQEK
FT                   VLDESLDPEVIKGNPYCMNAFKYMFNNSRVPAEGSDITQHYDGEANKFFIVIYKNNFYK
FT                   VPTHNESGQRLSKGELYSYLQQVKNDATPKGLGLGALTSLNRDEWLGAYNNLLKSPINQ
FT                   ASLESIFASAFVICLDSHNPVTIEEKSKNCWHGDGQNRFFDKPLEFFVSANGNSGFLGE
FT                   HSRMDATPTVQLNNTVYKKITEESPEELIVEIGGSAPKIGPAEILPFDINPTTRANISD
FT                   AISKFNATIAAHDEEIFQHYGYGKGLIKKFKVSPDAYVQMLMQLAYFKYTGKIRPTYES
FT                   AATRKFLKGRTETGRTVSNESKKFVETWTNPKATNEEKVSSFQAAAKQHVAYLSAAADG
FT                   KGVDRHLFGLKQMLQPNEPVPEIFTDPIFSYSQTWYISSSQVPSEYFQSWGWSQVIDDG
FT                   FGLAYLINNDWIHVHISCKRGNGLKSDHLKWYLVESANEMKDILTKGLLSEPKAKL"
FT   CDS_pept        415889..419230
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537137"
FT                   /orf_name="CD36_41920"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX42072.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG398507"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000192D575"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ3"
FT                   /transl_table=12
FT                   /translation="MSNNPHRTHKRQKSSVSNPGYYFTPENKSEIQQQPSQSQSQETQQ
FT                   QQQQQQQQQQHSQTHNIYDNDNYMNYNFPPTSNRPRASTIAAAAATTVHPGSELSHESH
FT                   SVHTSPLKRTASSELDQPIPAMVPSSPLVSSAPYYYSQSSQQQNLSYHDQQQQQHQQQQ
FT                   STPQGQQISSSSQQISQTGVPPPLYGTSSSIPPGSTMQPSTSFAFHTSHSTYNPSFDSS
FT                   NLYNSAFRLPEYPTTSSNTLMSTTGGKQYQQSSALLPSGTLPPSILGTSSSHVSALRQH
FT                   QKNNLSISSHLTLFSLSGNNSSQLQSQGPSFQQAGTGVDDIKRSSKESTAILNDLLFNL
FT                   TSVDGSNINTFLLSILRKIDSPLTLDDFYNLLYNDRQRTLLDNSNYQNRIDKTVVSPND
FT                   TDMTVTIINQLLNFFKTPSMLVDYFPNLEDKDNKLTNINYHELLRTFLAIKILHDILIQ
FT                   LPISEDDDPQNYTIPRLSIYKTYYIICQKLIASYPSSSNTRNEQQKLILGQSKLGKLIK
FT                   LVYPNLLIKRLGSRGESKYNYLGVMWNTNIVQQEIKQLCDDHELNDLNEIFNSDNNNPF
FT                   ASIAPSGPATASSTPRRGISHKRTSSKQKIKTEHLSGNPFLQPLQASHHHHHSHHHQQP
FT                   PQESLQQQLTEHITAPRLSFLKNDTKYPTDANLSLLDDDNWFVRLSYECYARQPALNRE
FT                   LIHQIFLKNEFLLNNSSLLRNLMDSIIKPLVMQETYANVDLVLYLAILIEILPYLLLLK
FT                   SSTNINLLKNLRLNLLHLINNFNNELKKLDSPKFPTERSTIFLVIIKKLINLNDLLITF
FT                   IKLINRNICKTTMSSDIENFLKINSQTVKLDDDDNSFFFNLNTTSMGEVNFNFKNEILS
FT                   NDLIYTLIGYNFDPTTNNELKNSISMNFINEEINIIDEFFKNDLLNFLNTDFHGGLDDD
FT                   NGEEDDDEEADPSPAHPIAATGSQGSLSPEPVSTGNPSVPPTRNTSISEVNAENKRGNE
FT                   VVLTPKETAKLNSLINLIDKRLLSSHFKSKYPILMYNNCISFILNDILKHIFLKQQQQQ
FT                   LQSSSSQLHDTQPLTQQDSATGISGGSSSANNANNSFGNWWVFNSFIQEYMSLIGELVG
FT                   LHDNLV"
FT   CDS_pept        419794..421227
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080189"
FT                   /orf_name="CD36_41930"
FT                   /product="Polyamine oxidase, putative "
FT                   /protein_id="CAX42073.1"
FT                   /db_xref="HOGENOM:HBG398221"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI000192D576"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ4"
FT                   /transl_table=12
FT                   /translation="MPHKKVVIVGGGISGIKAATDLYKSGIKSTVILEAQPRLGGRLFT
FT                   IESTHNKGTTYDYGASWFHDCLNNPLLDKAQQLGNVKYYFDDGKYLYFNEFEGEIEKWK
FT                   FETVLEEMMTYFQLVYKQNPGKSDISVKQLAQEYVDRYRNILTEEQIDLSLSAVRMWSE
FT                   LWHGESWDLLSGKYCFADDGHLGRNAFVKNGYNTVFINELKELPRTYRDSSIKLNAQVC
FT                   KIDYTNKKRILVYLKDGRTYSCDYIIVTIPQTILKITNPNDANYIQWVPEIPPNIQKVL
FT                   PDVYFGSLGKVVLEFDHCFWPRDVDRFYGLTNGVPSQDTITVDAWDYPTILINYQAVNN
FT                   VPSLVALTQNPLSKYIENLQPHEKQQRIWSIFKPLIAKICERNGIQKIPEPHSIYHTPW
FT                   NNESLFRGSYGTSLVGTQDPSAVIKAFVDGYQNRIRFAGAETMDDSSNGCAHGGWFSGQ
FT                   REAQFIVQQEAQKKVDSKL"
FT   CDS_pept        421378..422466
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384365"
FT                   /orf_name="CD36_41940"
FT                   /product="HMG1/2-related protein, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42074.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329863"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D577"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ5"
FT                   /transl_table=12
FT                   /translation="MPTELEELVSFLHSPQPAVSQIALDNLVGYSTGPHQKVFSYNNYE
FT                   AIKDLKNISKSNGKTLVNQSVTILANLCDDLVMRNLIVEDEEYLKYLATQIINIKNSNA
FT                   DLMCILLTNLAKNDAINKVLDFEVELDDEHKKVFSSKKVIDCLMDCFVKGYDRKLNEYA
FT                   NYDYLSYFFADLSRFKQGRTYFITEQTYDEVVPLSKVLVFTEKYDDKIRREGVASTIKN
FT                   SLFDTNAHMKLLTDPKINLLPFILLPLAGPEEIDEDEMFELPEELQLLPSDKKREPLSG
FT                   ILCIHLESLLLLCTTRAGREYLREKHVYSIIKELHKAIEIEQVTDLCDRVVQMLKRDEA
FT                   PETAEIEEIESDSDDDKIVEIV"
FT   CDS_pept        complement(422583..424406)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080190"
FT                   /orf_name="CD36_41950"
FT                   /product="Transcription initiation factor IIF subunit
FT                   alpha, putative (Subunit of tfiif "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42075.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG397129"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI000192D578"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ6"
FT                   /transl_table=12
FT                   /translation="MSQPDSQIKKEVTVKKEDGSGSAPTSPSKQQEWQTIPLKSCTEED
FT                   VKDIRFHIMKFATKQDVNITKDFTRPVRLHRKDPRNMQFHLTREELDQRKREKEQMEKL
FT                   KQEEKEEATKPIEESEEKEQKDKLAAEAAKVAPEKPTLNKNQADMSQVAPDGGARKNRK
FT                   NLFKRKTRQINLMNEEKRKLRYEEHYPWVIEDYDGKNVFVGNYEAGSTEQQHVLFVFDK
FT                   DGFKMIPAEKVYRFTPRNRYATLTLEEAEAKMERNSSVPRWLMKHMEDRSIAEGTPDQR
FT                   FRYNSPAANGSVIANISNGSSGRRMRTVLGGSGSGNDRDSDHDDLDYDEEFADDEEAPI
FT                   MDGDEEENKLSEKKIKKEMLKAAHFDGQSEAEAEDDLDDLFETEKTRKVDKEGKKLRKV
FT                   LNKREGGVYDSDEEDGLMPYLSKSDLESEEESEEEVQVKKEPLSDSQTENNTNKTFRAR
FT                   EVTVKSIGDGFVIIKAPPSFLGTMPAGDWNPQARKRPSPEATSPRKKLKLDDNIKVKKE
FT                   KTLSPPPPASPTTNASPTSSGMDLNDAGPDNLLVTVKDVLDIVKDQPLTTKELLMGLKS
FT                   RVSAHKDNKLRIISIVKQNLRLVDGKLVLKD"
FT   CDS_pept        425320..426693
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189191" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080191"
FT                   /orf_name="CD36_41960"
FT                   /product="Acid phosphatase, putative "
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAX42076.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG331692"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="UniParc:UPI000192D579"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ7"
FT                   /transl_table=12
FT                   /translation="MVGLSQLLNAGFILGGQSVFQNVAAPHQASIEQYNIVKYLGGSGP
FT                   YIQNSGYGISTEIPEKCTIEQVQMISRHGERFPSKGDGKYFSSVMEVFEKYNGKFRGDL
FT                   SFLNNYQYFVTNPDYYEKETTPQNSKGPYSGTTNLLRHGAYFRKRYQSLFDQKERLVVF
FT                   TSNSGRCYQSGEYFARGFLGDDYSNDNVEFVVVDEDKKMGGNSLTPRYACKTLNQDLHK
FT                   DLISQYDKTYLDDILSRWLVDNPGLEISTDQVSSLFLWCAFEINVRGYSPFCDLFTKDE
FT                   FIRSGYRNDIVNYYETGPGNNMTKVIGSPMVDASLKMLQENSKIWLTFTHDTDIEMYLT
FT                   SLGLIAPSEDLPVDRVQFPNPYNAAEFFPQGARIYTEKLKCGDKQYVRFVVNDAVYPYP
FT                   GCSSGPGFTCELNDFFKLIRSRLHDVNYKVQCEVDGPAELTFYWDYKDKKYNAPLIDQ"
FT   CDS_pept        427036..427965
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231548"
FT                   /orf_name="CD36_41970"
FT                   /product="Inner membrane transporter, mitochondrial,
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42077.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D57A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ8"
FT                   /transl_table=12
FT                   /translation="MSIVVQDKEDQILTQLEHPQLDTKSPPKYIAYLAGVCSGINKNLV
FT                   GHPFDTWKSRLQTAPKGRFKGPIDCAWQTLKYEGPFGFYKGFTPPLVGWVFMDSIMLGS
FT                   LHTYRELVKDYIYPHEKKLPLLGHMIAGLGSGLTVSFVAAPIEQCKARLQVQYDKKSRT
FT                   YSGPIDVAKKVYQAAGIRGIYSGLISTMIFRTNFIFWWGSYEIFTQYFEKNTKMSTPSI
FT                   NFWAGGLSATVFWIFAYPADVVKQNIMTDSPIQSEKKFPRWIDAVKYIYKEKGWHGFTK
FT                   GFGPAILRSFPANAAALLAFEWVMRLSK"
FT   CDS_pept        complement(428058..428780)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384366"
FT                   /orf_name="CD36_41980"
FT                   /product="Exosome complex exonuclease, putative "
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX42078.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192D57B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFQ9"
FT                   /transl_table=12
FT                   /translation="MELYSPEGLRIDGRRWNELRRFECRINTHPNSSDGSSYVEQGNTK
FT                   VMCTVQGPIEPTLRSQQHSERANIEVNLNIASFSTFERKKRSRNERRLVELKTTLEKTF
FT                   EESVMINLYPRTNIVINVQVLCQDGGMLATIINSITLALIDAGISMYDYVSGVSCGLYD
FT                   QTPLLDVNNLEEHDMSCLTIGVIGKSEKLALLLLEDKMPLDRLESVLSIGIAGSHKIRE
FT                   LMDQEVRKHGIIRASKMQ"
FT   CDS_pept        complement(428957..430165)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384367"
FT                   /orf_name="CD36_41990"
FT                   /product="GPI mannosyltransferase, putative "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42079.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG559139"
FT                   /db_xref="InterPro:IPR007704"
FT                   /db_xref="UniParc:UPI000192D626"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR0"
FT                   /transl_table=12
FT                   /translation="MSQLKYLITFSILLRFGFFFFGLYQDEYMPVKYTDIDYLVFNDAS
FT                   KFVYQGLSPYLRETYRYTPILAIMLIPDNFGKYWYHFGKLLFMFSDVITGLIILKLLSR
FT                   QQQQQLSEKKKMILSSIWLLNPMVITISTRGSAESVLTVMIMLSLYYLLDKNNIILSAI
FT                   WLGVSIHFKIYPIIYLPSILYYLSFKETPFWANVPGINLVNSKNLKHFIITLITLATIN
FT                   YLMFLKYGWEFIDNSYLYHITRIDHRHNFSVYNMVLYYKSALLSLENSNKFDIEKIAFI
FT                   PQLLLSAVIIPLIFAGKDLISSLFIQTFVFVAFNKVITSQYFIWFLIFLPHFLSQTNLL
FT                   TTNKITGISCLLLWIISQATWLYFAYKLEFLGENTFDNGLLYSSVFFFLSNCWCTMKFI
FT                   QSL"
FT   CDS_pept        430400..430945
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537138"
FT                   /orf_name="CD36_42000"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42080.1"
FT                   /db_xref="HOGENOM:HBG397128"
FT                   /db_xref="UniParc:UPI000192D627"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR1"
FT                   /transl_table=12
FT                   /translation="MSATTNTQEDIYIEYLNYDWDSFQEFQDGLQEILDNYLQNLKEQD
FT                   PSITSIPNLDKQQLINQAKSFFFCNKTGNIINLDDYEDWKLHSGDKFAKNKQIEEELGK
FT                   DISENTTTNDQTNSDPPYSSNYQEVVELLMSGKPIPGIKQIPDTVLTDQGSTASASQRT
FT                   KPWEKNRSPETTEDVSFV"
FT   CDS_pept        432005..432931
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206959" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580835"
FT                   /orf_name="CD36_42010"
FT                   /product="ER-derived vesicles protein, putative "
FT                   /protein_id="CAX42081.1"
FT                   /db_xref="HOGENOM:HBG388230"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="UniParc:UPI000192D628"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR2"
FT                   /transl_table=12
FT                   /translation="MSYRGPNQFGNQPPHHGIPSQPQPHIGPISSNKGPLEQFEEVAKK
FT                   VEDWIDDYFKVLKPYVPAIGRAFLVATFYEDTLRIFTQWNEQIYYLHNYRHYWRWLTVL
FT                   FLINNMVVMTVASTLVIARKKNNIATIALIIVVIIQGIGYGLLFDAQFVLRNLSVVGGL
FT                   VLAFSDSIVRDKRSLNMPGLPMLNNQDNKKYFLLAGRILLVLLFLGFVFSSDWSLGRVF
FT                   IIIIGLTSCASIVVGYKTKFSAAVMLIALFLYNIFTNQFWAYASQDARRDFLRYEFFQV
FT                   LSIVGGLLLVVNAGAGEFSIDEKKKIY"
FT   CDS_pept        433331..434086
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580836"
FT                   /orf_name="CD36_42020"
FT                   /product="Cytochrome c1 heme lyase, putative "
FT                   /function="holocytochrome-c synthase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX42082.1"
FT                   /db_xref="GO:0004408"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG627179"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniParc:UPI000192D629"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR3"
FT                   /transl_table=12
FT                   /translation="MSDSEQPKCPVDYSTRSSWLSKLTGDKKEEPKPTPTPASEEPSCP
FT                   VDHNARSVWANNVSVQVTAPEAIETTGTCDSSKIPNTLEDTSTTSIDLPAQRELSSIPR
FT                   TSSNTNWIYPSQKQFFEAMKRKNWDPHQEDMKVIVPIHNLVNERAWKHILMWEKPYSEK
FT                   TQLKCGGITLTSFKGDSKKLTPRAWMKSIFGYDKPFDRHDWLINRCGVEIEYVIDFYSG
FT                   QNNQVYLDVRPKLNSLEGIKMRFGRPFGF"
FT   CDS_pept        complement(434271..434546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580837"
FT                   /orf_name="CD36_42030"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit, putative"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAX42083.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000192D62A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR4"
FT                   /transl_table=12
FT                   /translation="MFGLGGATPQISSQQKLQAAEAELDMVTGMFNALVSQCHSKCINK
FT                   SYNEADISKQEALCLDRCVAKYFETNVQVGENMQKLGQSGQFMGRR"
FT   CDS_pept        complement(434771..438100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580838"
FT                   /orf_name="CD36_42040"
FT                   /product="Subunit of guanine nucleotide-binding protein,
FT                   putative"
FT                   /protein_id="CAX42084.1"
FT                   /db_xref="HOGENOM:HBG397127"
FT                   /db_xref="UniParc:UPI000192D62B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR5"
FT                   /transl_table=12
FT                   /translation="MITPSLKYRDTHRYNEHKNKEKIYKGNTQIDSANNKCNSDVVEDY
FT                   GDGNSFSSIPNSSSSLAATKTKSKMEHDQSQNSSRPISFFDRSQSDYGCCDLRNEFNIP
FT                   YSVLKYNLAPDSCSRNIIDTDNDLQFLFTPEMNLDEVPHQGQDNHTKGAITMQNQDNPN
FT                   KNIYQDEHIGAFSGYFAIPKLTINIPNRVQDDEDRLKYISNVPTICYQNHFEIEDSTFI
FT                   FGGLCASETNSFEHLGLPSNTDLEKVQIYFPFELPPFVNTRLLTNPFMEPNPYFLQYNA
FT                   TRGSVTYLDTALMQEFPKNIIGMVSTRISSRHFFFYGGFQIENKSLHPDKNRDCWIVEK
FT                   TVILNEDGYIIDTTTLKFSKVKLARNNKSIKAGRIGMGICSNIHEPVDSVHDGSFTNGN
FT                   HSSAAAFDVESKGSSKKVNTRQEGYAKDKNISDPSVTLADTYENSETMKKISHSLGDTT
FT                   AGRRPTLHKINTAQPLDLHNHESTTRSSGIREHPISTESHRPRSVLGGNPSNSSSASQP
FT                   SSTGTTGTTNSSKMSNVFSRSANIFHRHKHNETVKSPHPLKVTYSESARKKILHSNNPS
FT                   AASSRTASPIPKSFDTKIPSSTPRAISPTSLFKRSPIDPIKLKAWYNVDRSSPLAEPTS
FT                   GNSFTTENYSQNQRTGKHVLEEDIFEKEQPVEFRPSPSFSRSEFEEKRNSTFEIPTSTP
FT                   SDLFTNSVSIETMEETDATNNVLFKSCANVSIFVFGGFVLEENEDKSVVEKTSNILKFK
FT                   ATNELLKIDLTTTEKAPFFNSVNFSKEALVCKVGSDSTCDIIIDEDENWPSPRGYFAYN
FT                   LIDYSLGVDETCTIDVSERESEKQQFSNLNTTEKKSPDSEVNNSSVDKFWDYNLTSNER
FT                   ESYKIQKYFESRALIVQGGCAENNKFHGDLYRFVFKTCKWEKIVTFAFDYYNISQKPDE
FT                   DEEVKTLSPENQVAEPQLKEAELRCCHHTAVYYRNEERDYLFIVGGVKNSHLRFYDTEP
FT                   YTSDKFDVSRFATLQLAAENKNLLRVAVLNTRTQIWRFMRYYYDVSQAVSDTTTYQPYF
FT                   TNCRFSHIGGSACINGKTITLAQGLANIAPEHKKDMCELRKQFPIEELLWGGYLQITFP
FT                   GL"
FT   CDS_pept        join(complement(439139..441057),complement(438852..438987),
FT                   complement(438731..438775))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231549"
FT                   /orf_name="CD36_42050"
FT                   /product="ABC1 family protein, mitochondrial, putative "
FT                   /protein_id="CAX42085.1"
FT                   /db_xref="HOGENOM:HBG327456"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000192D62C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR6"
FT                   /transl_table=12
FT                   /translation="MFRILKPSIRAIPFVSKSTIRNAYTKTNTFPRISTSHRAIFGISI
FT                   GTLVSISAYKRHIDNDVHALDTSVHALTPSKTSETFEMGLYESSQKEEYNQYYGYRETK
FT                   KKHPSWIVRTFYYLRFAIEDYLVDPMFTFVRFIELSCIFVPVLLISPICWFGRRHRSEN
FT                   GNLVRTGATLWYRYLRWSAEVAGASFIKLGQWAASRTDIFPEEMCNELGSLHSNAKAHS
FT                   LEVTKKIISKSFGNLPFDEIFDEFKETPLGVGAIAQVYLGKISPKVLERAKKDEDKLVK
FT                   QLKLQAEDKQEQFFENIVVTEHLDSNEFVAIKVLHPKVELKINRDLKIMKFFANVINVI
FT                   PTMEWLSLPDEVEQFSILMRLQLDLRIEALNLAKFRENFKSRLDIHFPKPYLNFTTRDV
FT                   LVEEYIHAIPLSKLLSLSENYGKNLSKEVSDKGLDAFLKMLILDNFVHADLHPGNMMVR
FT                   FYKNELYRHKKEYKIVKTSNETETNKITNELLKLGDNTNAWCEKLAELYEQGYHAEICF
FT                   LDVGLVTELNKEDRVNFIDLFRALSEFDGYRAGELMAERSRTPETVLNKEIFALKVEKL
FT                   VDRMKQRTFTLGNISIGDLLDQVLGMVRNHHVRMEGDFVTVVVAILLLEGIGRQLDPNL
FT                   DLFASSLPVLRRLGVSKEGREILRNENSLSMMKVWLALEVRQFINASIQDIHTLVKADM
FT                   FSPNV"
FT   CDS_pept        complement(441327..442976)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384368"
FT                   /orf_name="CD36_42060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42086.1"
FT                   /db_xref="HOGENOM:HBG397126"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000192D62D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR7"
FT                   /transl_table=12
FT                   /translation="MSGTTKSSSSTPKSQSTHLFVLIHGLWGTSSHMATIEKFLKENLP
FT                   SSTDDKIATIKPACFRFWKTYDGLELNAKKIIADIFYEIESLKQNNDSEVTKISIIGYS
FT                   LGGLISRYVIGLLDELDFFEKIQPVFFSTFATPHVGIEFFNDNIFDAVANRLGPYLFGK
FT                   SGGQLFIADHDKILVKMADPQEKYMRGLQKFQKHILLANIKNDRTVAFFTSFITDVSPF
FT                   DELDDIKIVYLDNLPQAKIANKLVRPKFVDLTKSHRLTLKDKKIFLGNQQEETPFIRKN
FT                   RWAKILVIALLACLVVPFWVPFVLVSSTTVSIYSFIKIKLVKGPLSAQHWSRVKKFVYG
FT                   NSPIDPADAKAGNVQRLKRRTLDRHESFKGDTSYLTEDTMDRVLYAEERYLNKSRKAGS
FT                   IKNEEDEDALVTENADYNTDSDGVDESLEVDTLKSTNKSIEMDIEENDKVISESIQTLK
FT                   SYESFPLFQDHKYKLPLNEDKSFIVKNLNTLDWIKIPVFLDVWNAHDGIVSRRGAKTNP
FT                   KGASTIGLWVSILRNHLQESGPVAAAASVNGN"
FT   CDS_pept        complement(443255..445753)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231550"
FT                   /orf_name="CD36_42070"
FT                   /product="Conserved hypothetical protein "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42087.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397122"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D62E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR8"
FT                   /transl_table=12
FT                   /translation="MDIDLDKRTKVSRACDYCKKRKFKCSGVSPCELCTKKGIQCEFSI
FT                   VDRRTIRRKNKKRTIRNKPATATSSTGSKIKKDENQIDKRTLKMLTRNSKVPVQLQPLL
FT                   SFPLHKLDNKQNEDEEQALQNPPTTDINSGNEDTLHNARKDDHRKNIKETHSKPENNER
FT                   DPPKVLYDSEGNLRYVGESSPLSFLFECRNIFLDRIGESTFTSESDLLEVIDEPDESTE
FT                   IVQVALPNRQLLNEIVRIFYKNIQQATYFVNVEYFKENSIDPVYENYSGCDAEKIALVN
FT                   LVIAIGLLYAEGTNDPVLSQLQSPTMRSSAYFEFGFYLTKMNMNKGKLWLTEAFSLAFC
FT                   YYQAKQQRNTAWLMLGMAIRNAQALGLHRKFINESFKDRSYIVHRRRLFKTLYILDRIT
FT                   SILLGRPLIIDDYDWDDFDSEDVYDRDLEGNPIKDTRFECMIQACKISKLLGKVVRNYY
FT                   SDGIINPYKAEKLAIELKLWSLSLPEPLQIDKIFNSNNPPNKTIEPWIDHKVTLLLLHL
FT                   SQLYAIVLLSRPFFMYLIFDKKKKRNILKRPKTRPEVAMYNFCKATAKSSALIIQLVEN
FT                   YINTIRITSGRAESHGLTHTCFMATLIIGLSLLYLEDNGYTLEDGYSSCKQMSYLNSAK
FT                   KIFEYYSQTNPISSRFYNIVEQMQLALMNKFNLDMDGNRTNVRKQPQRKHENDINATTT
FT                   REASIPSENFGGGATDIPFNEDYDNFIDNFGNLLPTTTNQQHSTNNNMPFFMTAQPYQS
FT                   IRNTYSDIPEDLGNYQQQFPQLPHHTQQNQQLSQFSPTPDSNNLYSNHDHISLGSKNQS
FT                   ESLDAFMYSVGLNDILYNTK"
FT   CDS_pept        complement(446364..448010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580839"
FT                   /orf_name="CD36_42080"
FT                   /product="Conserved hypothetical protein "
FT                   /function="catalytic activity"
FT                   /protein_id="CAX42088.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG329242"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI000192D62F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFR9"
FT                   /transl_table=12
FT                   /translation="MSSNHYSQIEETKVIFNSLLSLLPEEFVTKNASRIKFENGSDNLI
FT                   VPCPLKQTETISALKGLEALVALKLAQERFGSSDGTCTIDLEHALLFLFSTYCSSVDGF
FT                   FKTDKKEVLKYLKPTDLNQAQSDPYRRMSANLYRTKEKDRFYHIHGSLDATTCLEMIGL
FT                   PAFIPDLEDYDKIIDIYQNKLDQFTVEELEKLNTKNKQAGVEALKPEVFLQTKHGATIS
FT                   KIPPFEVKTLETTTPKIEFARTSSRKIFEGVKVLELCRIIAGPTIGKILAEYGATVIKV
FT                   TSDDTLPDVPFFQVDANMGKHTTNLNLKNPKDRLEFEKLLKDADVVIDGYRKGAIDKLG
FT                   YGPNQLIQLGIERGKGYIYGAENCFGFVGEWSDRPGWQQIADCASGVAWVQGLSMGKNE
FT                   PMVPPFPMSDYGTGCLGAIAIMLGIYKRHKHGGSYFCASSLVQYDLLLLKQGQYPEELW
FT                   KSQIILNDKYKGFTKIRYYDSVDKISKTALDAMVAQKPNLLNNEQYFVKQESKGFGATI
FT                   STLKPVCQFDKIETGYRCSSRPNGYDDPEWW"
FT   CDS_pept        complement(448402..448839)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580840"
FT                   /orf_name="CD36_42090"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42089.1"
FT                   /db_xref="HOGENOM:HBG397125"
FT                   /db_xref="UniParc:UPI000192D630"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS0"
FT                   /transl_table=12
FT                   /translation="MTIYSPGIERNEKLKEFIVKFYRASDKAPPSDEQDPYLEFFAIDS
FT                   PLVMGLKKVNGHEKIAQLRQGMWEKVTHRHHVVNNVAEINENEILLNGYVEYTLINGKN
FT                   VTTEWAGHIKLANSPGSENGYKMNYYQVYLDPSAAAKALSE"
FT   CDS_pept        449143..449937
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080192"
FT                   /orf_name="CD36_42100"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42090.1"
FT                   /db_xref="HOGENOM:HBG397124"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000192D631"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS1"
FT                   /transl_table=12
FT                   /translation="MKSGFSKNNQFYTYIPAANSNSTKLLLFLHGLGSSQNFYYSIARK
FT                   FPQFNVLLIDHEGAGQSKLLHHTNLSLQNLCENVVSVLQELSLNNLEIILIGHSMSGML
FT                   VNYMNLHTDLPIIKNVLIAPVHPRKNLVDIMQKRIDSLQVSRSLIEFSNSIPEAATGSN
FT                   CGDLQIAFIRQLIQGNSADGYIANCQAINSGLNYDFDYAKIDKPTLIIYGKQDQTSPWV
FT                   GCVEEIYKSLPNAKLKELDVGHWIVIEDDKNVYNALEKFIQE"
FT   CDS_pept        complement(449987..452383)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384369"
FT                   /orf_name="CD36_42110"
FT                   /product="Conserved hypothetical protein "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42091.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397122"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D632"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS2"
FT                   /transl_table=12
FT                   /translation="MNIHAAKERRTKVSRACDFCKRRKYKCSGVPPCNLCSKKQIDCVF
FT                   SIVDKRTTKGSKIYKPSSIEVLSHNNLTIQNSYINENTQRRINKQSSTQVPIARPQQET
FT                   TASKSPTETFLENNSSTNATEYIPKNLQPLLSFPLKKEEDDQSSEDTSVVEVDKQKSDR
FT                   TSTANNTPTNRSNTSSTNSNVTTQGLTNNNGNNLRLLYDKDGRLRYIGESSPLSLSYQA
FT                   RKIFRSIRGESEFTDDPDTVNIIDGVSHVRPCKVLQMPKKEYALLLLNLFEANINQTWY
FT                   IYNREWLNDKFVKVIDDPLNVAPERMATFHLIFSLGLLFAEKSKNGIVEKIGAHSSQFF
FT                   ESGFDLIRNILDDGGLWMTETSLLMYFYYQSTARRSSSWMMLGNAIRNAQALGLHRRAV
FT                   NESFPNPQYVIHRRKLWKTLYICDRISSILLGRPLTISDYDWDDFQIPRDHKIITGDIS
FT                   TICLDENTRLSKILGHIVQNFYQDGVVNLMKAETMAIELKKWSFELPSIVQIDKILKNH
FT                   VSYEIESSIRPAMSDNYSILLIHIMQLYGVMLLGKPIFMYLLFKKDKNTSNSITRQQKV
FT                   LNNFCSASIKASVLTIQAIHIYTRCHPHRIESYVTVNCCCHAAIMLGLTVLYRQSNSDY
FT                   EKDEYSIEDLMQQLYIAKSILNFYGSTNTISYRLHTIVSRLINTLTLEAQPREENDECL
FT                   SLPIPTPFQEGDESEPLPRMYQTQVDSKEPTNQGESIFNTPLEHIINFQQFFVPSVTNS
FT                   EDNNSSRASLKEFERRIESVPRLEDFMYDVGMNDLLLEGRSDSGK"
FT   CDS_pept        complement(453006..453917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384370"
FT                   /gene_name="HQD2"
FT                   /orf_name="CD36_42120"
FT                   /product="Catechol 1,2-dioxygenase, putative "
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42092.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG429220"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI000192D6D4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS3"
FT                   /transl_table=12
FT                   /translation="MSQAFTESVKNSLGPKATPRAKKLIASLVQHVHDFARENQLTTED
FT                   WLWGVDFINRIGQMSDSKRNEGILVCDIIGLETLVDALTNEIEHSNHTSSAILGPFYVP
FT                   DSPVYPNGGSIVQKTLPTDVKCFVKGKVTDTEGKPLDGAQIEVWQCNSAGFYSQQADHD
FT                   GPEFNLRGTFITDDEGNYSFECLRPTSYPIPYDGPAGDLLKIMDRHPNRPSHIHWRVSH
FT                   PGYHTLITQIYDAECPYTNDDAVYAVKDDIIVHFEKLDDEDKDLIGQVEYKLNYDISLA
FT                   TESSIQEARTAAKTRQETELKL"
FT   CDS_pept        complement(454686..455348)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580841"
FT                   /orf_name="CD36_42130"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42093.1"
FT                   /db_xref="HOGENOM:HBG332450"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniParc:UPI000192D6D5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS4"
FT                   /transl_table=12
FT                   /translation="MEMDANEILCFYFFCYLFLFCYGSLLRMLIYSILIPSLLCITLTI
FT                   ASSGLLNSIQGTWQSQSEQVITGPAFFEPQKELLQEPKLPGISYSFKNGYWESAQYIVM
FT                   GNNRNHQCPQAMLIWQHGKYNLKRGKLILIPNKNDGRQLISDPCFDNGMSEYKRFHNGE
FT                   TLEVDVRFDEYFGNWKLVLVDYLTGKKKQPMWLTSRNVTMLPTGTITSTKRKYVKKE"
FT   CDS_pept        complement(455656..456582)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580842"
FT                   /orf_name="CD36_42140"
FT                   /product="Glucan 1,3-beta-glucosidase, putative "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX42094.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG683366"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192D6D6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS5"
FT                   /transl_table=12
FT                   /translation="MQIKFLTTLATILTSVAAIGDLAFNLGVKNDDGTCKDVSSFEGDL
FT                   EFLKSHSKIIKTYAVSDCNTLQNLGPAAEAEGFQIQLGIWPNDDAHFEAEKEALKNYLP
FT                   KISVSTIKIFLVGSEALYREDMTASELASKIKEIKDLVKNIKDKDGKSYSSVPVGTVDS
FT                   WNVLVDGASKPAIDAADVVYSNSFSYWQKNSQANASYSLFDDVMQALQTLQTAKGSTDI
FT                   EFWVGETGWPTDGSSYGDSVPSVKNAADQWQKGICALRAWGINVAVYEAFDEAWKPDTS
FT                   GTNSVEKHWGVWESDKTLKYPIDCKFD"
FT   CDS_pept        complement(457336..458451)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580843"
FT                   /orf_name="CD36_42150"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42095.1"
FT                   /db_xref="HOGENOM:HBG756731"
FT                   /db_xref="InterPro:IPR003750"
FT                   /db_xref="UniParc:UPI000192D6D7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS6"
FT                   /transl_table=12
FT                   /translation="MAKRKATESEPLPTKKPSKSVSETTVSICIPSTVISPKNAYNLQQ
FT                   ITNIIYQIAKACTIYKVAEIVVFDVPELNNEQEDVKSTVVVGSKVKFVEDEPEKSLASP
FT                   NKKSSVNGDDVSPSLLVASLLQFFITPPYLVKTMFSSHLNSKFKNILPKFTYAFKLPKI
FT                   TTLPFMQNNQVYKVLKEGMIIPRETPLMRKKNKKTKSDHKITVSKYVNIGEKEALKLEI
FT                   KREIPIYSRVTVDLKNKTVVSPLQAYGVIGHKAAFGYHVRMASEFNKIFTQSPISDGYS
FT                   STIYVNCDDYFGNNNKIKELDNLSTFKEATGNVLMVLGNYKDLQAGFKADSSNVFQNVE
FT                   NVAQLFDSKLNIPDGCRIEDAILISLAKVIE"
FT   mobile_element  complement(458569..458955)
FT                   /mobile_element_type="retrotransposon:solo LTR, xi D"
FT   CDS_pept        complement(459186..460574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580844"
FT                   /orf_name="CD36_42160"
FT                   /product="Nuclear segregation protein, putative "
FT                   /protein_id="CAX42096.1"
FT                   /db_xref="HOGENOM:HBG397121"
FT                   /db_xref="UniParc:UPI000192D6D8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS7"
FT                   /transl_table=12
FT                   /translation="MSTVKSATTSTSAPQRRREIKRPDDKAIKEEIEKLKNEIKKLDLT
FT                   NNEINAQIAKAQIDQKVMDKRNKLQTELKSLIAKQSQGKNERQLINDQIKTIDASMKKR
FT                   IAEIQQQTSKNNFKNVAEIDSRINYLDGLIDAGSLKLADERRFVKEMSSLRKLRKDFGS
FT                   IEKTQELIDQDKAKIAELKKKLSATHNKEIQAQFETIQKELDAINESNKTIISKRDELR
FT                   DKRTEIKKQKDAKYEQIRKIRSDFDEKFATFKKQLAEEKKRRDEEYKQRLLEEKQQKKK
FT                   EQAEKELAEASIPAFTEEINSIHTLLSYFDPSYVKPTKKTETNGTLPTNNNIRKVEFPE
FT                   DVVVIKKEQEEFFAGTKGKKGKQHQKKSAKHKHFTVAPEVVVALSDLTIAFPTKEEEVP
FT                   ETIKTLKETLTALEEKQEEQTKVNIERAKARIAKLEAEEEKEEEESEAATTATEEETDQ
FT                   KVEA"
FT   CDS_pept        461488..462342
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580845"
FT                   /orf_name="CD36_42170"
FT                   /product="Isopentenyl-diphosphate delta-isomerase, putative
FT                   (Isopentenyl diphosphate:dimethylallyl diphosphate
FT                   isomerase"
FT                   /function="hydrolase activity"
FT                   /function="isopentenyl-diphosphate delta-isomerase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAX42097.1"
FT                   /db_xref="GO:0004452"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG416977"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000192D6D9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFS8"
FT                   /transl_table=12
FT                   /translation="MSSEYAKLVASLSNQDILSKWPEVTPLKKISGIPRSAGSDSSDSD
FT                   LFDGHDEEQIRLMEELCIVLDYDDKPVGAGTKKLCHIMDNINAGLLHRAFSVFLFNEDG
FT                   KLLLQQRADEKITFANMWTNTCCSHPLCVPSELGVDSSLEGSKDVNDLTNAVKGAKVAA
FT                   QRKLEHELGIPFSDCPIENFTYLTRIHYKSASGDESSKWGEHEIDYILILKTKNEITVN
FT                   ANYNEVRDFKYVNADELKAMFEDDSLVFTPWFKLICQSFLFKWWDNLDSLDQFKDEEIH
FT                   RLL"
FT   CDS_pept        462866..464026
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080193"
FT                   /orf_name="CD36_42180"
FT                   /product="Lipoyl synthase, mitochondrial "
FT                   /EC_number="2.8.1.8"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="lipoate synthase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX42098.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016992"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG284542"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D6DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WFS9"
FT                   /transl_table=12
FT                   /translation="MITRNSIILRRLYPTAIIRTLATDATESTVVKTKRRRTIFTDELN
FT                   KGPSFDDFVSGKAKDMLEDPLETARKDPNAKLPSWLKVPIPKGKSFHNVKKDVRELKLA
FT                   TVCEEAKCPNIGECWGGKKSEATATIMLLGDTCTRGCRFCSVKTNRKPAAPDPMEPENT
FT                   AEAISRWGLGYVVLTTVDRDDLVDGGARHLAETVQKIKQKAPQILVEVLGGDFRGDLSM
FT                   VEILANSGLDVYAHNLETVEALTPHIRDRRATYRQSLAVLERAKQTNSSLITKTSLMLG
FT                   FGETDDQVKQTLRDLREIGCDVVTFGQYMRPTKRHMKVVEYIKPEKFDYWRDTALDMGF
FT                   LYVASGPLVRSSYKAGEAFIENVLKKRKHNVGETPRLAQEIKPSIY"
FT   CDS_pept        464845..466986
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080194"
FT                   /orf_name="CD36_42190"
FT                   /product="Histone deacetylase, putative "
FT                   /protein_id="CAX42099.1"
FT                   /db_xref="HOGENOM:HBG397120"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI000192D6DB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT0"
FT                   /transl_table=12
FT                   /translation="MSTSRNTLSNHDNDSEDSLIEAFETTLSIRPTTTEYEDNDISIDH
FT                   TTLPHTTINSINYTRDASIVDIEELEENEQISEQIPKFKTKRRYSLLPKITAFKKTGSP
FT                   GLEEYYNQQKLDPKFDAILKPSVLLDESLTKYNHAFDEFLRSNPHIEKESPRFIHDSNK
FT                   TLIVLSPYSAEHAFGRKWVTKSYLSTIFERPQRLLASCIGVASAVSMFPFYYKVTNSTK
FT                   RGSVFSSHVRKIHGRNWPKKLFELCLESHEKLNNDELEVPEDWNVGDIYLTPKTINAIE
FT                   GVIGTIETAIDSLFSKRKKENHNLAFVVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFE
FT                   QYGVTHCAILDIDLHHGDGSQDICWERAGFTGDYGQQEEDEIVDPKLNPRDDYGKRFAT
FT                   YPKVGYFSIHDIKSYPTEIGYATKENIKNASTCIMDHDLNIWNVHLQEWSNEDEFYKHY
FT                   QTKYVAILNRANQFLNSAKKQYEQEYEEYIENLGKYNKYLLKPHLFNSPLTKPTPPPPF
FT                   KPLIAISAGFDASQYENPQMQRHGINVPTSFYSTFTKDVVKLAKIHTNGKVLSFLEGGY
FT                   SDGALSTGIFSHLIGLNNDDEFLWNHSWGSQQVMKELVKGCKKNWTPYKKPQSDITIWA
FT                   NEVIKLGRAMMPNAILPTNYVYDDQTKQSNRPMNKMVKELMDSRGKAVEVDSPIRKDPE
FT                   DDRKVMRHTRSYYKKVSNI"
FT   CDS_pept        468516..471914
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537139"
FT                   /orf_name="CD36_42200"
FT                   /product="Rho GTPase-activating protein (RhoGAP), putative "
FT                   /function="GTPase activator activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42100.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG397119"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192D6DC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT1"
FT                   /transl_table=12
FT                   /translation="MLKPTTLTARSISQNSRHEYTSSDSKFERSELSDAQYIDQLLLEN
FT                   QELKALVDRQKKIIEKLNNQLKSSNGSKLTLDSINNRTPPLSQKSSVDNAEPEPEPEPV
FT                   SQASTATEVSFKRVSGALSPTLVTIPKSPQRSISNNSIQSSPTKQTLSVQKQLFDENIT
FT                   GAPANSVPQEVPLRSSRRRRNSNDTKSSDKKASYISLESSTPSQIPNSDSNGSTLSSSF
FT                   QTNGVGRASEFASIKSPDLEVDMGNTSKNDTMNNTFDSKAGVDTTIGTVDSIDSGKINE
FT                   TGESKFSTMESTKSQSDVSGSSIGTTTGTSTVGGTASSGVSKIYSQSKGIARSSSSVGS
FT                   TYKSSRIKPPNLQTKPNNNSAVDLAPPTSLKTAASNISSPVELKSPSSQYDTSPQIQSD
FT                   TNIKSQLAPPYEMSTSNNEQIPPVPPPKSNSNSKPHPTLNLSNQSSRSAGDSYQLTTVY
FT                   DSPATPRPTVRTPTTSSYNINSAPQTPGSSFNVLHTPKTDMDESSLFIKPDEFHTIFIS
FT                   VISTIHVDLMNQTSKKSDDPNVTITINDRETNKEMWKIRKTFSQLVTFDSEIRPIVEYF
FT                   GLPPLPDKQLFCSSTPAKIEIRKLALQNYFNSIFVMPHIPRMVLYYICRFLSLDFVNPL
FT                   DDFKSGARKEGFLVRRYKGLGATWKIRWCQVDGPYMEIYENPGGPVLEQIQLSGAQIGR
FT                   QSSDAVAEDKGYRHAFLIMESSKSSKLHSSVPKHFFCAESDDERDDWVTALIEFTEDAS
FT                   ESVENSPQQQYDRSNAYDSLSTPNTRYDHANDDLKPGSSNIFATPASIAASVADSLSTY
FT                   TMGVVDDQSQKKIKKRSYFPFRTKTNSSNDDSEDQQGQHLQPDDNHLSLPTTAMTNSQN
FT                   IYLQQQQHQQQPSGFANGQPPPPLSTAVTSSSSGYPRSEDNMQQYLSQMKLDEDSAKKI
FT                   FGSELEIAFELSNHEFMGKKIPSVCYRCLDFLMKTGAIYEEGIFRLSGSASSIRQLKDQ
FT                   FNTRYDVDLFQSSLKPDIHTVSGLFKSYLREMPTPIIGGNAVNHLSALVSHNTYQQQQQ
FT                   SMGGMSNSNLARIFRDYFNDVNNVDKIHYDLSYLVFSFLRQIIQQSDINRMTLKNVGII
FT                   FEPTLNINVEVLSIFLVEFDTIFGV"
FT   CDS_pept        join(complement(472883..472895),complement(472170..472621))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000263447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580846"
FT                   /orf_name="CD36_42210"
FT                   /product="Superoxide dismutase, putative "
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAX42101.1"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG609879"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="UniParc:UPI000192D6DD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT2"
FT                   /transl_table=12
FT                   /translation="MVKAVAVVRGDSKVQGIVRFEQESESAPTTISWEIEGNDPNALRG
FT                   FHIHQFGDNTNGCTSAGPHFNPFGKQHGAPEDDDRHVGDLGNISTDANGVAKGTKQDLL
FT                   IKLIGKDSVLGRTVVVHAGTDDYGKGGFEDSKTTGHAGARPACGVIGLTQ"
FT   CDS_pept        complement(473825..474277)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580847"
FT                   /orf_name="CD36_42220"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42102.1"
FT                   /db_xref="HOGENOM:HBG397118"
FT                   /db_xref="UniParc:UPI000192D6DE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT3"
FT                   /transl_table=12
FT                   /translation="MYTVIERYYTPIDRFINKIKRKGFWLYTGLITLSFVYVIFSISNL
FT                   PSLPPPPPSPSSKRKKDKMVSKSTKKRIENEDEVELGPSDPIIPLEQTHANDHIINSWS
FT                   KRQLYQFLFEEKIYPDVNEDLNTIKKQVIEIYEFKKQHGTLDKKYI"
FT   CDS_pept        474745..475137
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580848"
FT                   /orf_name="CD36_42230"
FT                   /product="Protease B inhibitor, putative "
FT                   /function="identical protein binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="negative regulation of catalytic
FT                   activity"
FT                   /protein_id="CAX42103.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0042802"
FT                   /db_xref="GO:0043086"
FT                   /db_xref="HOGENOM:HBG397117"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="UniParc:UPI000192D6DF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT4"
FT                   /transl_table=12
FT                   /translation="MNQNKKLTGLILLAIISIITLFNFRAISKATAIRSFVSPPSTSSS
FT                   STANINTKSAMSDSKGYIITLKDTCPDSEASSIKSKITELGGKITNEFSLIKGFSAQLP
FT                   TIHAEALPKDFAGIANIEEDGEVRTQ"
FT   CDS_pept        475676..479170
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580849"
FT                   /orf_name="CD36_42240"
FT                   /product="Alpha-mannosidase, putative "
FT                   /function="alpha-mannosidase activity"
FT                   /function="carbohydrate binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mannose metabolic process "
FT                   /protein_id="CAX42104.1"
FT                   /db_xref="GO:0004559"
FT                   /db_xref="GO:0006013"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG286952"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="UniParc:UPI000192D6E0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT5"
FT                   /transl_table=12
FT                   /translation="MGYDNINLQPNFKPIDRLYDDRLRQFTDTGGQFHNLNLPKFYDIH
FT                   RQEIRDLKSWKVPDDANGKTQRPLFKDIKFDEISWDNIGIGYNFGPSWKTFWVKFNLKI
FT                   PEDWLKYEALEIDWDSNSEALIYNDKGLPLQAFTGGGQRNLFRIPKEYRTSEEQLFYIE
FT                   VACNGMFGNGADGEPDPNRYFRLNRAHLVVPNLEARRLFWDFWILGDATREFPGGHWQK
FT                   YQAADICTQIMNTFDPNDVDSIGKCRKLAEQLLGDKINSDEVFHEYPNERNKRIDVYGI
FT                   GNCHIDTAWEWPFAETKRKIVRSWTTQLKLADEYPEYVFVASQMQQFKWLKQYHPEILS
FT                   KIHEKFATNQFIPLGGTWVENDTNLPNGESLLRQFVLGQRFLLEEFGFQSDIFWLPDTF
FT                   GYSSQIPQICQLAGIYRFLTQKLSWNNINSFPLSTFNWKGIDGSQLLVHMPPGNTYTAA
FT                   ANFGDVVRSSQQHKNLRDVPAGMLLYGHGDGGGGPTEEMIEKLRRCRGLANNSGLIPSV
FT                   QLGVTVDDFYEHLLEKSDQGKKLPTWTGEIYLEYHRGTYTTQANIKKYMRFGEIKLHDL
FT                   ELIAGLVSIKHGDKYKYPGAKIQSLWEDLCLCQFHDVLPGSCIGMVYYDEAYPMLRKLL
FT                   KKADELIFEALKVGTDNSTTSGGGGDGGVVNTLPWDRHNEIVEVSRKQSPKLFEQLIKD
FT                   NVGISTPKTLQDKDHDDDETVRISVDSIDGICQINKKVEYPASVSKIDDGRFILTNKLL
FT                   TAKISSNGVITSLFDEVNQREIIDTTATNQTSHGKGGSGSGSIGGNQFILFDDEPLNFP
FT                   AWDTELYSLEKFQLLNNGKAEILVQDELESSIIVTHEISPNSSIETIISLAGINKPHRS
FT                   NSSSTTTTTNEGSDNNYIKFSSTVNWHENYKFLKVQFPTTITTALQANYETQFGITNRS
FT                   THWNTTWDIAKFEVAHHKFMDLSEYNYGVSILNNCKYGGAIHGNLIRLSLLRSAKAPDN
FT                   KADMGIHKFEYAIYPHNGPLGIDTVKAGYNFNYKLIQNPYYQIDDSISHLSSSSLLAAI
FT                   RLKNHHHNGSLILSHIKRGENDIDVSQYKSLTKNEKSIIVRVYESLGGGNSKGQLIIDK
FT                   SISKKIDKVFKTDGLENELEELKLNNKISDDSSDDDVVVVDITLRGFEIATYKILLK"
FT   CDS_pept        complement(481990..482334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094053" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231551"
FT                   /orf_name="CD36_42250"
FT                   /product="Covalently-linked cell wall protein, putative "
FT                   /protein_id="CAX42105.1"
FT                   /db_xref="UniParc:UPI000192D6E1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT6"
FT                   /transl_table=12
FT                   /translation="MQFSSAIILSAVAGSALATYANSTVTDIATTVVTITSCEENKCHE
FT                   TEVTTGVTTVTEVETTYTTYCPLPTTEAPKSSVASNSTTTPPVSTAEGAAAANAVPAVA
FT                   AGLLALGAFM"
FT   CDS_pept        491595..492257
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580850"
FT                   /orf_name="CD36_42270"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42106.1"
FT                   /db_xref="HOGENOM:HBG398510"
FT                   /db_xref="UniParc:UPI000192D797"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT7"
FT                   /transl_table=12
FT                   /translation="MQFSSAVVLSAVAGSALAAYSNSTATDIQTTVVTITSCEENKCHE
FT                   TEVTTGVTTVTEVETTYTTYCPLSTTEAPVASTATDVSTTVVTITSCEEDKCHETAVTT
FT                   GVTTVTEGTTIYTTYCPLPSTEAPAPGPSAEESKPAPAPSAEESKPAPAPSAEESSPAP
FT                   TKAAESSPAQETTPKTVAAESSPAPSSAAPAVSTAEAGAAANAVPVAAGLLALAALF"
FT   CDS_pept        complement(494130..496553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580851"
FT                   /orf_name="CD36_42280"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42107.1"
FT                   /db_xref="HOGENOM:HBG397115"
FT                   /db_xref="UniParc:UPI000192D798"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT8"
FT                   /transl_table=12
FT                   /translation="MSGFSMVPRFTNNTDDDDNSVHLKHNIGKANPLRSPIRKSRNSNN
FT                   KNEVFSYNNHNHSSDVSIDEKIAKIISNSKTSIQENGNDIINDVPNGKFVQEKEEFDDD
FT                   DDEEEEEEELDEFDTNKSYLKFLNGELKESINANEDANIDGGRGDEDYEDDEYILSDSD
FT                   TFNEESLESDFDASGYEDGYLSDGDHEFDTDRFKEKNVFNDDDDDDNDDENNNNFTKEN
FT                   HYRYPRTRSNKLNKQESFGSLSRSPSISESDEINLVGSKLSNVQHDNNINWKQYIIISS
FT                   ISFLITILGYLLITGQISTILPNLFPSIGSFDTIKMAKLDGKLHRLDQELKNSHEKQQE
FT                   TLFQLQSQIDQLNNKVINVIENQQSSSKSNQNKSTITKHDDNDDKIITLENNQIQISPE
FT                   FHQFLYKFIDNYQNSYLDEKLQQLEKFNDLQELQKYVEKLISKSMESIKQDIRLDIDNI
FT                   LDNLTLVSNNNNNNNNGNGNETKNHNVIIDPKTNKLWINSILDLITQGTSSTSINYADY
FT                   STGARILGFLTTSSSSSSSSSSHNHHHSILEKMLYGWWIYKSNFYQDEYNANHVLLDDD
FT                   IVWKGGNQLGIRLSTNIIPTDIILECREDNNSPSPSQGILLSIGFKPNTKNGFNKLSKI
FT                   PLSQLTSSQLPNQNENKYISKFKLIKQYHIKSFDNNGIYHIRLPIRFINLQISGKDLYF
FT                   KFDKIGDNINTFSDTNININNIKVYGINEINAIKYQDKFQLLIDKFIDIEENDQNEQII
FT                   TTNNKRVIEINTNEEEKEKDINGDSGKSSMNFMTSKHSEKYQQQYDMNDDDIYL"
FT   CDS_pept        complement(497034..497564)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537140"
FT                   /orf_name="CD36_42290"
FT                   /product="Peroxiredoxin type-2, putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX42108.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000192D799"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFT9"
FT                   /transl_table=12
FT                   /translation="MTDGKFPTNIEPKYIPYSKDHSSLIACASPVPLDLKSLFQNSTVV
FT                   VTAVPGAFTPTCTEQHIPDYLKHLKDFKDKGVKKIIVLSANDPFVMAAWAKALGYTDEE
FT                   NYVIFATDPNASISKELGDGFVADLTSAGMGLRLQRYASIVVNGEITYLETEDSLGFSE
FT                   ISSAETILKRIHN"
FT   CDS_pept        complement(498461..499240)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580852"
FT                   /orf_name="CD36_42300"
FT                   /product="Glycosylphosphatidylinositol anchor biosynthesis
FT                   protein, putative"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42109.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397114"
FT                   /db_xref="InterPro:IPR009580"
FT                   /db_xref="UniParc:UPI000192D79A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU0"
FT                   /transl_table=12
FT                   /translation="MPATIRPMKKTVSFSKDVSNNNNLETDSESKQSRPSYLTFVPQIK
FT                   NNLLVIPFHNIFILVAMFYSGLTQDLETVMWKGFLTSIPIQVIYNYIIYINLLPLKKST
FT                   KNDLNNGSVSDNNVPLLIGSSIFVSIVLSLPLFVVIVLMGAPVYKYSLKTLYLSLHLSQ
FT                   LIFNPLIILFNLDVNKINKLFKQDHLYRIIFRHCILSSVLLTLGGCWLGVIPIPLDWDR
FT                   PWQQWPITLLIGGYLGGVVGGVLSLIVNYFSHSVDQN"
FT   CDS_pept        499909..504171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080195"
FT                   /orf_name="CD36_42310"
FT                   /product="Subunit of the mRNA cleavage and polyadenylation
FT                   factor, putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42110.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG397113"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI000192D79B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU1"
FT                   /transl_table=12
FT                   /translation="MDAYHEFIDPSKVNNCVGCNFISSTKRNLIVGKGSLLQIFDTIQL
FT                   KQSTINKPQYRLKLIDQFKLQGAITDLKSIRTIENPNLDYLMVSTKYAKFSIIKWDHHL
FT                   NTIATVSLHYYEHCIQNSTFEKLAVSELILEPTYNSVSCLRFKNLLCFLPFEVIEEDDD
FT                   DEEEEDDEEEEEDEDMKDSKEKTDKKQLKTDEIEEDTNGTNKESHLFYDSSFIIDATTL
FT                   DSSIDTVVDMQFLHNYREPTIAVLSSKQEVWAGNLIKSKDNIQFQVLTLDLNSKSTISV
FT                   FKIDNLPYEIDRIVPLPSPLNGTLLVGCNELIHVDNGGVLKRIAVNKFTRLITASIKSF
FT                   QDQSDLNLKLENCSIVPIPDDHRVLLILQTGEFYFINFELDGKSIKRIHIDNVDKKTYD
FT                   KIQLNHPGEVAVLDKNMLFIANSNGNSPLIQVRYRDSLKTSETKESKLKQIEGKEKEDT
FT                   NDEEEEEDEDEDDLYKEEEEEETQKTISKSRIEFLYHDELINNGPSSTFTLGICSKERF
FT                   KCNLPNPNYNEVSILSNAGTDSQTKLNIITPTIQPSISSSLTFSQVNRMWNLNQKYLIT
FT                   SDDVNYKSEIFQIEKSYARMKSKHFINNELTINMHELNNGKFILQVTPKQIVLYDNKFK
FT                   KRFTLNDEIKDDEILSSILRDEFLMIFLASGDVMIFAINTYNESYDKIEIPKLLDDTII
FT                   TTGYITNSHLLSAVSKNVNLLLGNSTTNNDNNKSNNKKKRKYSALSTSGRDKKNTEKPQ
FT                   TTAAHTPKVNKVKTFVLVTGDNRIVAFNRFHGEKCYQLNNVDRFTDNLSLGFFDPNQQT
FT                   VDPFIKQIMLNELGDKFDNKDEYLTILTIGGEIYMYKLYYDGENYFFKKEKDLTITGAP
FT                   DNAFPYGTSIERRLVYFPNLNGFTSIFVTGVIPYLILKTIHSIPRIFQFSKIAVMSISA
FT                   FSDSKIKNGLIFLDNQQNARICELPLDFNYEFNLPMKHVDIGESIKSIAYHETSDTVVL
FT                   STFKQIPYECLDEEGKPIAGIIKNIKDTPAISFKGSVKLVSPYNWTVIENIELGDNEVG
FT                   MTIKSMILDVGSESKSTVGTDPNSLIKKYNKKKREYIVIGIGKYRMEDLAANGIFKIYE
FT                   IIDIIPEPGKPETNHKFKEIFKEDTRGAITSICELSGRFLVSQGQKVIVRDLQDDGTVP
FT                   VAFLDTPVYVSESKSFGNLVILGDPLKGCWLVGFDAEPFRMIMLGKDTQHISVECADFI
FT                   INDDEIFVLVADNNNVLHLLNYDPDDPQSINGTKLLTKASFELNSTISCLRSLPLKDID
FT                   EKVQNETDAAAAATIPLPNNTQNNFQVIGSTQDGSFFNVFPINEAAYRRMYILQQQLID
FT                   KEFHYCGLNPRLNRIGSIKLQNNETNTKPILDYDLIRRFTKLSDDRKRNFANKVSGKGI
FT                   YQDIWKDIIRFEHALNDL"
FT   CDS_pept        complement(504579..506147)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580853"
FT                   /orf_name="CD36_42320"
FT                   /product="Mucin-like protein, putative "
FT                   /protein_id="CAX42111.1"
FT                   /db_xref="HOGENOM:HBG397111"
FT                   /db_xref="UniParc:UPI000192D79C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU2"
FT                   /transl_table=12
FT                   /translation="MRSVLPISVLLTAGLSASMNTIRSTTISSISSCSSSSASSSSLPS
FT                   SSALSVVPDLSSARYLNTTIQTIRANSATSGGDSSSGSDSESPETRYEYETDTDYTHIT
FT                   KTVCDSNNNCYVTVDSESLTTYTTTIDGVLTVITTGVSASAAATADAESTIASTSGVAS
FT                   TSDIVSSSSGTTAVSPISTKAAIESSSSLTSSKPQETQYEYETDIDVSHVVKTVCNSES
FT                   KCYLTTQVQSSTTYTTTIDGVLTVITTDVPISKTNSPSVVTSSGAVATEESTETEVLTT
FT                   VMTVTSCSDNKCSSTVFTSGFSVYTVDETAYTTYFPVTTITSKLSSASINGEATNTKSG
FT                   ATVSATSTTTTAGNPQETETKISTAIVTITSCSNNKCHEETKTTGIKVYTSEETIYTTY
FT                   CPLSSTSETTNVVSVETPKPQSKQPNSSPVVEKSSSLEATSSNTATTTTTAGTSSNPPV
FT                   TINVISGNIVTETPVVNQVQSTSKHSDQSSTIAISTYEGVGATVFTTNITGFLSLVVSL
FT                   IFFMI"
FT   CDS_pept        507215..508240
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580854"
FT                   /orf_name="CD36_42330"
FT                   /product="Conserved hypothetical protein "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX42112.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG397110"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000192D79D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU3"
FT                   /transl_table=12
FT                   /translation="MQIAVLYLLLTSCMIHIYAITSSPTSLSSITDHIIEFDDSSIQST
FT                   LEQADFSFIYFYSDVCKYCRKFEPTFENLSVLYNQVKQKDTKKRRGKKDNNNNNNNGGL
FT                   YFQILKTNARQNNRLSQLFKISQYPTLKLLNYKTKEIITYDNKNNRDLQSIINYLRQNL
FT                   KIEPQFENFKTKVKYYQSPSIDSSKQDLNCFGNENETNAHDKLVFFITSYLPDWIDYQY
FT                   PAHFVHQLALDYQDLTIIVVDVEKLNDYVVLSKYEINSFPSVMYLKNNGDYKKYQFSSQ
FT                   SKHELDYHQIEEFIESIDQDDAIWEKVKKSPVDTETISQQQHEVDNDDEEDDLTFEHIE
FT                   L"
FT   CDS_pept        508573..509211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384371"
FT                   /orf_name="CD36_42340"
FT                   /product="ER lumen protein retaining receptor (HDEL
FT                   receptor), putative"
FT                   /function="ER retention sequence binding"
FT                   /function="receptor activity"
FT                   /biological_process="protein retention in ER lumen "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42113.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0006621"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046923"
FT                   /db_xref="HOGENOM:HBG332839"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniParc:UPI000192D79E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU4"
FT                   /transl_table=12
FT                   /translation="MNIFRFFGDLSHLASIFILLYAIEQNRSTNGLSLKTQVLYVVVYL
FT                   TRYLDLFTKFYSFYNTLLKLVFIASSIYTVYIMVYKYKKPIQENIDNFPIKFLIGGAIF
FT                   ASLIFTHKYTIGEIVWSFSLWLEAISILPQLYILQKTGEAENITTHYIFALGIYRALYI
FT                   PNWIYRYFAEGHFDFVSVLAGLLQTGIYSDFFYIYYTKVLNGKKFELPV"
FT   CDS_pept        complement(509374..510111)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537141"
FT                   /orf_name="CD36_42350"
FT                   /product="Proteasome component, putative "
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAX42114.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG318170"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI000192D79F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU5"
FT                   /transl_table=12
FT                   /translation="MSSVQTTVASEYSSEIQTVPIEHRFNPYSDNGGTVLGIAGEDFAV
FT                   LAGDTRQVEGYSIQSRYESKIHDVGDDILMTANGFAADGIALIDRFKQSLIWYKFDNNG
FT                   KKLAIKSAARYIQQLLYGKRLFPYYVSTLIAGLDEEGKGAVYSYDPVGSYEREQCRAGG
FT                   AAASLIMPFLDNQVNFKNQFVPGTDGKEKKPLKYLTLEEVIQLVRDAFTSAGERHIYVG
FT                   DGLEIKIVTKDGIRTEYYPLKRD"
FT   CDS_pept        complement(510717..511043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580855"
FT                   /orf_name="CD36_42360"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit, putative"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAX42115.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000192D7A0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU6"
FT                   /transl_table=12
FT                   /translation="MAFWNSSSSSSSTQTDSSSSSTSTASLKSQQIKQDLQNQISQELA
FT                   AANATELVRTITENCFDKCILIPKDTLSPTELQCISQCREKYMRSWNVISKAYIGRIQQ
FT                   EQHH"
FT   CDS_pept        512442..515192
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231552"
FT                   /orf_name="CD36_42370"
FT                   /product="Conserved hypothetical protein "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42116.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397122"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D7A1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU7"
FT                   /transl_table=12
FT                   /translation="MDVDLEKRTKVSRACDYCKKRKFKCSGVSPCELCTKKNIQCEFSI
FT                   IDRRTIRRKNKKRTVRNKPVTNTIIGSHKISKDNDDNDQIDKQTLKLLTKKSNVPEQLQ
FT                   PLLTFPLHKLDNKLNEEEPEEDNDQEKNEEREHPQSNISLPSGSNSGSYNPRNPNHDGK
FT                   ESNKSKGRVFTTNATGFNIATTTTDERAGGGNQQSSSMPKKIIITRERYPPKVLYDGEG
FT                   NLRYFGESSPLSFLFQCRSVFVDKIGDSNFTLENNDSLEVIEDSDESYEVIQVALPSRQ
FT                   ILDDIIKIFYRNIQQAVYFVNIDFFKTQVIDPVYENYSDCTPGKIALVNLVIAVGLLYA
FT                   ENTNDPLVNLLQSPTMRSSAYFEFGFFLAKKHMTKGELWITEAFALAFCYYTSKQQRNS
FT                   AWLMLGMAIRNAQALGLHRKFINESFRDHNYRTHRRRLFKSLYMLDRIHSVLLGRPLII
FT                   DDYDWDDFDSEDIYDLDSDKNPIKDPRFECIIQACKVSKLTGKVIRNYYLDGIINPYKA
FT                   EKLAIELKLWSLSLPEYLQIDKIFRPETVNKMPLLTMHLSQLYSIVLLCRPFFMFVIMN
FT                   KKHKKHSTKKANGENLQKRPKTRLETSMCNFCKATTKSSTLIIQMVENYIISTNKLKSA
FT                   RAESNGLIHTCLMASLIVGLSILFLENNGYSIEDGYSSSQLMKYLNSSKQIFKFFDRVN
FT                   NALSMKFHNIIEKMQLALMNKFNLDVNGDRIINLNESQQGQHTHDIVPQSQPTVPPPPP
FT                   PSQSQPQPQQTQPNGNIANYNSNYNNQDNTTMKAEVVTNLPTSFNEDYDRFIDTFGNLP
FT                   NFYSSNHNYGNNSHQYQTNGVDYYNANNYHNNAQKHNGNNYSNHAMNHSPESVTSSTNL
FT                   SSSSSSYSNPTYHQDPTKNNLTTDSLDVFMYNVELSDILYDVKPN"
FT   CDS_pept        complement(515421..519620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384372"
FT                   /orf_name="CD36_42380"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42117.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397109"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D869"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU8"
FT                   /transl_table=12
FT                   /translation="MISPTHQSQYINYFVNPVLMTESGDMIDSVTGTTTMSNTTIDASI
FT                   PASTTNTANASKNYKHKKQNTNTGTSMSPSNSTNSTTNNATTTTASKKSKDIPLELTAF
FT                   GTTPSGKPRLFVCQVCTRAFARLEHLRRHERSHTKEKPFSCGVCQRKFSRRDLLLRHAQ
FT                   KLHAGCADAITRLRRKSIKKSQYGEDDEDDDEEMANSEDENDHEGSAGGTTKNGKKDKT
FT                   DPPPEFNLNLFHSKQKPTKANTTKSKVAKSSTTTSRKNSSNPTRKNSSSLHKQALGQRQ
FT                   KAVIDTKIVSSTNSGVSVTPTRSRRGASFSAQSGANYAINIPEFNDIYPQPDSVEFSTP
FT                   QFLPSSLDNEITWLNNIPNIPGLSDSVSAADLMRQNSITASADHVTPPVNVSQHGSFSH
FT                   QSTFSATDMGQARSESVNSLNTPFDGSYMMPTVTITNQEIQNGVAAHHQQQQQQQQQQH
FT                   HHHHQQQQPNQSSLGLSRNDMLSEDHYGYSFYDIPENILNFPMDSISTTSNAVSSHPIQ
FT                   TFKPLSPITQEMENEMVPGITGRIGDFNNNNTSNNQNNQHINYDLNFLHTIDDIGQDVI
FT                   SKFMPGGYSFYGDNNVSATSSANDYNSPNNIVSPNQQNNQFVLHNQSSHPSGASPHLDQ
FT                   SVMNKMRLHNYSSNKLFTNHMRHMINKALGKYPISGIMTPTIPSNEKLEFYLTIFIQSF
FT                   LSHFPFLHPSKLNEYEIMAMTCNEDINNESARVCLPLLVATVGALLANNKNDAEHLYEA
FT                   SRRTIHIYLESRKTNSGNDKNYKNGKETSPSSNPLWLLQSLTLSVLYGLFSDNENNVYI
FT                   VIRQLNALNSLVKTSIKNKGPIFFSSNGEDEELYNKLNSHDNGTSLFANNLNDEMKYKN
FT                   NINMQSQTRIVFIIYRLTNYLLMMYNVPLTFSINDINQLAVTSRDEETLWNFKNFQEFQ
FT                   EFSQKNNKTLDGYLNSKNEPIVFRDLLLTIMKFGILDNNVAPEVESKVAHQLRNLCKYG
FT                   FNCLVHGIYEIKQYQEMKEVDTFKVLDYLTKFYPSNNGMGFNCFRLPANKDMEKIDYAL
FT                   LVSFTKISSLIDLKLLKEQSWLKNYDDLTQNYHRLLDAHSTANPLNSISDYDYLKLADC
FT                   CISVLKLILFKVEDSNSNNKNQSKNDHTCESNNKINNNNNNNNESNGDQLISAFDTDFG
FT                   YLNMDNNGNSKKEECSRFIDDELRYDKENTMSYFEKHINLDIFEEVEKSSNLIQAQMLF
FT                   HAFAVLSIFSVYVMRKNDNNASPFANTDLIFELNHRYSMVLKLLERLESFLKLRYQTTG
FT                   GGGGGGGGGGVNNNNNALSIKLEQEFTNLYLYNGNVLSSDHHNITTNTTDNGTKQNQHQ
FT                   SQDFGLEKTLYILKMGENVLNYIYDLNLKVCVFKKLGDSLSEIRKYLIDNEANLNG"
FT   CDS_pept        521301..521681
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580856"
FT                   /orf_name="CD36_42390"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42118.1"
FT                   /db_xref="UniParc:UPI000192D86A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFU9"
FT                   /transl_table=12
FT                   /translation="MACLIGKFNRDKECYYHRCHKYLIIYLIDEDCMDLNINMLWVVSS
FT                   PRDLLPGLVLVRRFTPPPKKNRGHACVVVGIKWTRKRCWLLDVTLSVSFFSDSRHEICN
FT                   RHFRPSIKCGVKEYKKKSTRKK"
FT   CDS_pept        523100..524620
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537142"
FT                   /orf_name="CD36_42400"
FT                   /product="Riboflavin transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42119.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397108"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D86B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV0"
FT                   /transl_table=12
FT                   /translation="MNTSTTITPNESNPQEYNLQPLEFVTSNNKEIPYPINNDNFHEEN
FT                   NHSIITRSVTTTTSTTTRSHQSSLHLLDDPSRFPDGWNNRAMITLFGSFLGMIGSLGYV
FT                   NSGGVIQSYISENILINDSQSSIGWIFSIYNFFAFGGILISGIIFDKFGCRIPIFSGII
FT                   IMFSGLLATSFCHSLYQFILAYSILAGLGTAFVFGPFVACLSHYFLQKRALVIGISYTG
FT                   GGLGGVIYPLMCRSLFSKIGYGWTMRIGAFISLFCCGIGWLLVSDRHKEFSPKSEKRQE
FT                   ASSSSIVDVVENEFISIIKEIFYSIDFKILYKNLLFTVLVFGLLFNGIVFLISIVQLPS
FT                   YAISHGFSEQQSYLLLVVFNSFSIPGRIIPSYFADQGLGRFNTFCLINCFSLIAFVVIW
FT                   LPFGNHLTALFIFAGCFGFSSGSVLSLTASLVASIVKTSDVGKGLGTAFFILSIADLFG
FT                   IPIAGAIASGSKQSYNNLVYFLTACAAIGAIVSFISRYLYGGFNFNRV"
FT   CDS_pept        complement(524688..526124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17580857"
FT                   /orf_name="CD36_42410"
FT                   /product="BTB/POZ domain-containing protein, putative "
FT                   /protein_id="CAX42120.1"
FT                   /db_xref="HOGENOM:HBG397107"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI000192D86C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV1"
FT                   /transl_table=12
FT                   /translation="MSNSTPSSSSSKNTTQAPQASPPPPPPFAPSSREAALMVQSSEEY
FT                   NPEVPPILPHEKIYSIQVGYRLYRLSGLSLSSDAPSYFTKFFQQPENEEKVLFFDRDPQ
FT                   IFEKIYNHLQGYSINIENDYIFMNLWLDCFYFGLKNLQKNLNKQDYFAIIGNEKFRIPK
FT                   SLINMPGNSPNFFTINFDRLLIDNINVIEKNNMLRPPPQTFPQVSNRSSKLFADLLEFF
FT                   RGNHLIIMNDDHRQLLIKEARYYRFLELEQRLIKFKITYRNEIVINLNDISRKGLQNPS
FT                   TNYNIELSLTYYRPYIKDEMTRDLIFELNSKDFDCQSEIKLILNKSTKLPTLKVTNKAC
FT                   HKLHQVFKDYFSHVLKDDKELLFFVGFNNSKTFINGKEMNSNWVNDILGIKEVEKEAKE
FT                   DANKRGNDKKRKLSENDDNNNESVESSEIDHPSPGSGEIIEICLSRSLWKVMMRGPLAR
FT                   LHAVTLEGFTRSNDTLIDFL"
FT   CDS_pept        527946..530879
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581794"
FT                   /orf_name="CD36_42420"
FT                   /product="Arginine metabolism regulatory protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42121.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG448231"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI000192D86D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV2"
FT                   /transl_table=12
FT                   /translation="MARRKARTFEGCWTCRSRKVKCDLTKPQCNRCLKSNRTCQGYEIR
FT                   LGWCQPMIYDHNDSTTNANDYKFLNNEEFEKDLDNFQRRNVELVKYPKHMKYETYEQLN
FT                   YILNQFDNLEMMNNEDNKENENTNIEKEFTIGPFKCIKWKNINIMNLKKTTNNKIMKKS
FT                   SKLKSQIKPQNDINTSNKATSKTKAKHSTSIDNDNNKLPNTTSNKIINGNINIYSDLLN
FT                   FAKLTIVGIKGPKYIITDQTIYHIFEPEFFPNVDSDDDWLIDINEYLDKLFQQQQLKSN
FT                   LSLSGKDSRGDSDGGLIITSLLQKLLNNFINRCNEILNFNRMGFQFNYIDIFIIPFIQR
FT                   IFGELICWDLNDIKSTQLNQTLVINNDNQEEPEEEEEEDDDDNDEIGDKHININIDDVF
FT                   RNIKLIIIYLVLSLSSFQLSTPINNQFNMDDYLLLSIHLRKLAMKMLNYHLDESDTIIE
FT                   QLEDLQKKDTHLRKHNYNLVGDYSCYILLALILQIEIDTYLSIFENYELIYAIGDFIIE
FT                   KNNFKSKIFMVKKKNKLNPLLNLLINIFKIKYIFYESTHSINLFNYQINQQDEEINYRD
FT                   LNENYDLISTSSLSDNEIEDEEGEEEEEEEEEEEEEDKRQIKPTIKNLIISNDSITTTY
FT                   EPMSYTISFNKENSNGCNNTKDQQKQKQLKKVKTSNKNNNNNNSNNNNNNNNNNNNNNN
FT                   IDNKFIPDDNFTNELDINYIYLMYGIPKSLIDLFYEIIHLTNHKNIFQRRKVFPRNFPK
FT                   ICAEFEDKLINWSIENDSNWKLTITHLNNNNESFLELLQLNIICFHQSLIIYYNQLLKK
FT                   NCKLQDYQDLIDNNLNNFQKLLFHHNKLYSQQHETNFHLLFKPSMWILFIIGSSTIKPT
FT                   IQSKIKSIWQSIENDYKFNGLANYWRCKQILYEIWNRREIDHHNNKSMTNQDNRSDTKA
FT                   STTVGSGSSSGSGGGGGNGSDGNGDGDDDNFGFMTMIREYGIVLNLG"
FT   CDS_pept        534136..537261
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581795"
FT                   /orf_name="CD36_42430"
FT                   /product="Conserved hypothetical protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42122.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397106"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D86E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV3"
FT                   /transl_table=12
FT                   /translation="MTTTTITNQIPSINTMLSNVNNNNNNNNTTTTTTTTPSANSSQST
FT                   LINQEQQQQQQQHHRQQQHQHQHHHHQSMNGGSPTNNNHSSSTDPPRKRSKVSRACDPC
FT                   RKKKIKCNAEYSELEKKVTKICTSCAKNKEVCTFDRTPLKRGPSKGYIRDLEEKAGDRI
FT                   SLSTSSSSSKSNHIISTKTNIPFPPSHQHPQHPQQSPSIAIIPPNPSINQYPPGNTQQL
FT                   PFPQNSTSHRVTGSISNPSNSNNSGNSPTIKLPPIVNYPSKNLPSPSLSKFNSSISASQ
FT                   TSNPSSPKSQLSNIPGLLNNDSNNINNNNTPNNVGGSEKTNSPPIQGPFWKVPYEMPQS
FT                   SLSRRSSIGSITSTNGGGGGLVGQPIVLRRPSVESISSVSTNGSRLPSIRPSISNDYTS
FT                   DAESEDFYSVQSFRPRSLSRNSQSLSPRNSISSMSSLNGRINKSLGFNSSPMIGSPSQQ
FT                   QVLPPQVQQQQQPIMTNFIPPQAPVFASFGGTMPNHNHNHNHIPLNPLDVNLKLYYEKF
FT                   HMIFPILPNDSRIIYNILNNKSQPPWDWLIEVFNHSLNNLINFQQVGLQSSIGIFIRLI
FT                   QSYPFPSETTTTTTIVNDNSLILFFSSLIILSYTNLINGDQYNPGISFISSIFNDYKIC
FT                   ERFIDYVNKEKNNTSDGDGDDNVDDDDDVVIKYFIKLYYCLNLIDNLNSLTLGTNKNLN
FT                   VNYQIIKFLNNHKDKFLQNKSTNINNNDDGYGMMMINNSILNHCEIFDQLVEMRNKFIF
FT                   INDPNTNTNIDIDEIINIDSISSTSIFNNNNNNNNNNNNNNNNNNNNNNDQFLKYFHQL
FT                   IIDKYKIFKIIFQFISKSINSTINGSIINNSIEIKQFNQELFNLIKSSNDNILNFANFI
FT                   SSNNNSNTTTSSSSSSSKITNANFSWLIINNNPILNLSICQLFKSIKLHKLIIDQLVLL
FT                   LSFFGSFNIELEKLNNQLSISFNLLNLNLQNLKLGNMINHNLKIKFNQLYKFQFNNNNN
FT                   SNSNNKTSNNEENEENEDIDMDIDKDKLNQWYDELNHVIVPFIIQDFKDGWI"
FT   CDS_pept        complement(537659..539551)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581796"
FT                   /orf_name="CD36_42440"
FT                   /product="Endomembrane protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42123.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG524073"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniParc:UPI000192D86F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV4"
FT                   /transl_table=12
FT                   /translation="MLQSLITALICLVSISNAFYLPGVAPTNYKKGDTIPLYVNHLTPS
FT                   FHHSSKQGKTATYVYSYDYYYPKFHFCTPKGGAKPQSESLGSIIFGDRIFSSPFEIKML
FT                   ETKSCQSMCKSKYSKADSAFVNRNIRAGYTHNWIVDGLPASMPLFDATTNSELYGSGFR
FT                   IGKVDDENKVEFYNHFQITIEYHKRKEDEYRVVGVTVSPASLDRSELKEDVNGDQLCSL
FT                   DLKPVQLSKNKETDVLFTYSVNFEESPVAWATRWDKYLHVYNPKIQWFSLINFSLIVLI
FT                   LGIIIAHILVKTLKNDIVKYNEVNLDDDISDESGWKLVHGDIFRPPKQRLLLSIFVGSG
FT                   VQIFFMTFATIVFALFGLLSPSNRGALSTFTFIIYIGSSIIGSYISGYLYRFLGGDNWK
FT                   LNMFLTPILVPGILFSVFVVLNFFLISVQSSGAIPLGTMFAIVLIWFMVSIPLGVIGSI
FT                   LASKKPLLSVPVRTNQIPRQIPTQPWYLRTIPVMFISGIFPFGSIAVEMYFIYSSIWFN
FT                   KIFYMFGFLFFCFILMILTSSLITILMIYYTLCSENYKWQWKSIFVGGGCAIYVFIHSF
FT                   FLTGGEKFGGFSSLVLYTGYSAVISLLVFLCCGSIGFISSLIFVRLIYGQIKID"
FT   CDS_pept        complement(540203..541591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581797"
FT                   /orf_name="CD36_42450"
FT                   /product="Zinc cluster transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42124.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397105"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D870"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV5"
FT                   /transl_table=12
FT                   /translation="MIFSIYGSSGPIKQYHTAHSSPIRNNSLVTESIYGVESSSSNLPP
FT                   VKLTSPVSNQRNKISNPFLESSNNTFDGTPLPREDIIRIINENCLPRLSGSLPSTPSKI
FT                   KKNGQLYRSDNLQVIQSSPPSITKVDNSETGIEIEKDFLTFDYENQDDILKAEEVYRNL
FT                   YGISPNESTTSSSKITGISICSRSLIAYNLFATPCHNNAKECEGSEDNSIISQISNRKS
FT                   RSKQKHQLQSSVIKHDIKSLNSPDKNINVSTKPFSISTCRNSFITSSASSANTDSDSYK
FT                   HSRISEPQKTKNCSSSQDGNFIVKLKLQADSLVCKDETSNNNYDNKKPSPFSMADSSSE
FT                   VSSDNEYIPEKRVTRNNKRKLRPVGTMVTQHEKKRKLGARSKTGCWTCRIRHKACPEEK
FT                   PSCSQCIRLQLDCDYSDKRPSYMSDPNLQIQKLKEIRAITNQNKRANFLSSKGKTGLRS
FT                   SNTQ"
FT   CDS_pept        complement(541899..543713)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581798"
FT                   /orf_name="CD36_42460"
FT                   /product="DNA damage-responsive transcriptional repressor,
FT                   putative"
FT                   /function="methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42125.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG333437"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000192D871"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV6"
FT                   /transl_table=12
FT                   /translation="MQSVYPNHTSLHIEPSYYDNGVPVFKPTMHEFRDFYNFNKAINKY
FT                   GMESGIVKVIPPTQWVSRVQKCYTESNLGQVSIQNPIVQSINTNAPGIYQSQNIERYKK
FT                   YSIFQWREMAKTRQPPRRKQRSDKPEVGHGHAKRIPFYNINTSEYTDERCKELETNYWR
FT                   SLSYSEPMYGADTMGTVFDKSITVWNVAHLPNLLDLMEEKLPGVNQAYLYAGLWKASFA
FT                   WHLEDQDLYSINYLHFGAPKQWYSIPQSQHKEFYALMVDLFRDEFKQCREFLRHKTFMV
FT                   SPAYLEKHGIKVNHTIHREGEFMITYPYGYHAGFNYDYNLAESVNFALDDWFEFGKRTK
FT                   KCECINDSVGINVKHLWEKYYGTKYETAKEEEEGRGNRFSSDSDGSIEVVKVEKIQRKC
FT                   RKRKQDHVDPANTRRPHKQPEIIPRECELCPNTLQQTKYSHSSLFELLEADVNGATPRT
FT                   ARRVHKICASMFPHQLKCNCKTNTVHGLDNITKNQKKLRCGVCRQSNMGACFQCSYEKC
FT                   TRAFHGTCGLVDGVQYDFNSGEAFCKFHCQSSTSLEFRVGMYVQFLFNHRVYFGQLVSL
FT                   GEGDVEIEVYPSAKDIIEIPMTSIINVV"
FT   CDS_pept        544162..544458
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080460"
FT                   /orf_name="CD36_42560"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42126.1"
FT                   /db_xref="HOGENOM:HBG398513"
FT                   /db_xref="UniParc:UPI000192D872"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV7"
FT                   /transl_table=12
FT                   /translation="MSTQRTTRKATHEQISKSRVVNASILTFLTVLIFLILLYHLVWAV
FT                   QVMMYQPYGNLLNNIVYGPGTLIANAGLSSKLIKYINEKLVEDKIEADYKKYI"
FT   CDS_pept        complement(544500..546059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581799"
FT                   /orf_name="CD36_42480"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /biological_process="autophagy"
FT                   /protein_id="CAX42127.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="HOGENOM:HBG397104"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="UniParc:UPI000192D91E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV8"
FT                   /transl_table=12
FT                   /translation="MSNNQVFECQKCDTPLNLDQSLLNLNESQLKLLVSQKKYKLFRKA
FT                   NSQILKDLDPQDYISQDRLEMYQSITNQEPINHRNYFESEDDEDDEEDEYEGEGHNQQR
FT                   KLRDSEFSSDSNSYLVLNESDEFEENSKKSQDGDEAGSQSTDERNDFRMSTRIKTLNKI
FT                   FAILSNNQEIDHPLSEDCAKLLIENYQLKFDQSQKEKETYLSFLRKLKDKDSQLDLYNE
FT                   DDENNEIVNPDLLHQDLDQKLYQSIQEFQKLTVLEKENLKELKKLEQTKTELEAQLSDY
FT                   EQELDNLRNNGLNSVLRLKNNLQLELNEKNKKLEQSKAAYDVQLDHIDKLRNLNIYTRI
FT                   FHISCDSQDKFSTINGFRLGHKIIWPEINAALGQIVLLLVFIIKRLKLDLKNYKLVPMG
FT                   SQSQIIKFNTKDSIDGTTKSKTVLNLYSSDEFSLGKLFNFNKLDVAMIALLDIVKLIEA
FT                   KVTSIDQEIELPYKIKDDTIGGKSIRVTSNSEWTSSCKFLLTNLNWILAFVSAHTSSEE
FT                   AS"
FT   CDS_pept        complement(546344..547348)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20231796"
FT                   /orf_name="CD36_42490"
FT                   /product="Uncharacterized oxidoreductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42128.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D91F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV9"
FT                   /transl_table=12
FT                   /translation="MSLVFPKLSFKEWYQVFYGFWPSNPHFTEKDISSDTLKDKVVVIT
FT                   GGNSGIGYETAKLLAGSTEARIYIWARNKQKSLEAIDKIKLEVAEEYSKNVGDNLQFIQ
FT                   VDLSDLNSIKPAVAEFLQREHRLDIIYHNAGVMESPPDQKTKQDYQMELGVNCIGPQLL
FT                   QTLLDPLFRKTAEKNPPNLSRIVWVSSTAHMFSPIGGMYLQDPEFKSVDVGLKRKYDQS
FT                   KAINLIQARQWNIHYPDTNAISLSLCPGYLKTGIQRHLTGLKKMAYDLFFHDQKMGAYT
FT                   LLFAGLSPEITNKNKGDHVISFGKLGLIRQDLKDDKHGKKVWDYLQDQIKSYV"
FT   CDS_pept        547992..549161
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581800"
FT                   /orf_name="CD36_42500"
FT                   /product="tRNA-splicing endonuclease subunit, putative "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /cellular_component="tRNA-intron endonuclease complex "
FT                   /protein_id="CAX42129.1"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0000214"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="HOGENOM:HBG397103"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016589"
FT                   /db_xref="UniParc:UPI000192D920"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW0"
FT                   /transl_table=12
FT                   /translation="MGKKNNKLLNKIYSQPLPITLTSSKYNVSLPNLYPHNPISWIWYM
FT                   IRYCQINIVYQVPELDNPPLSVIYENQIFKVIDPESMLKLWRQGFFGKGILSRSEPTWE
FT                   KRTITRLNLDKANSGKDLAMEDITKKRREERKFFKLERARFQELELKKRQGIITEKEVD
FT                   EMNKLESQLTELRKTQVRFDKSENGEVNEVHIRDEDEDIITENGELLPLEFLQLQEVEA
FT                   FFLKFALQRVDIVNVDSLLDLFYKCCSHHSFSAIPTSNNQFVIEYIAYHYFRTNGWCVR
FT                   SGIKFGTDFLLYKRGPPFTHAEFCVLVMTKDSKYDWFQIAAKARVIGSVKKTFVLCYID
FT                   YPTQEEFDHILQKQHEKDIDHGLLLKELLNKYKISEVIYKRWNPSRTRD"
FT   CDS_pept        549600..550040
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080461"
FT                   /orf_name="CD36_42510"
FT                   /product="Transcriptional regulator complex subunit,
FT                   putative"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42130.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397102"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D921"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW1"
FT                   /transl_table=12
FT                   /translation="MSNLQDLINHDDDGDYLPSPSPPQQQPQHASSSESKASTTEDLPD
FT                   SITQEHILTSFEKIKTHFPAARIKKIMQSDEEIGKVAQATPVIVGRALEIFMANLVEVS
FT                   LLEAKKQGVKRITASHVKSAIENTEQFDFLVEAVEKYPSLKN"
FT   CDS_pept        551106..553343
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537388"
FT                   /orf_name="CD36_42520"
FT                   /product="Conserved hypothetical protein "
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX42131.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG294587"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000192D922"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW2"
FT                   /transl_table=12
FT                   /translation="MVQNKSNLSLANRRQSSFFRQLPPAEPDIYYVGVDVGTGSARACL
FT                   IDTNGIILGLAERPIKRQELQANYITQNSTEIWDAICYCVRSCLRDSGVQPEDVFGIGF
FT                   DATCSLVAISESTDQPVSVGPNFNNDKENIILWMDHRAVDETNAINATDDKCLKYVGGQ
FT                   MSIEMELPKMKWLKHHKPGGIKDCKFYDLADYLVHKATGTETRSYCSVVCKQGFVPIGV
FT                   EGSETGWSEDFLLSVDMPELVEDDFRRLGGIPGKNGKYLTAGDAVGKLTPESAEELGLT
FT                   SECIVGSPVIDAYAGWVGTVAAKADIPALQEEDAHSDGSIGTACGRLAAVAGTSTCHIA
FT                   MTKEPCFVQGVWGPYKNVMAEGYWLAEGGQSITGQLLAHVLAIHPANHDLIRSAEQSNI
FT                   SKFEYLNSILEGLVNDKNERSVVSLAKHMFFYGDFHGNRSPIADPRMKASIIGQSMDNS
FT                   LEDLAIQYFGACEFIAQQTRQIIEEMEKSGHKISCIFMSGGQSRNGLLMRLLADCTGLP
FT                   VIIPRYIDAAVVFGASLLGAVAAEDAVAEHCRDKTRSRRSSSFLGKGSHTNLKDRGSIS
FT                   PYTAPSATSTTNLSMLAYAESHQGPAQLTPMNEETDYFNQTVQQKGGAAADSRNSAIKS
FT                   DDESDDDTTLSFGSKQQTQKGLSQKLASLNLKPLTAATTKPNAPGAALWKVMKKMTGPG
FT                   KVIYPHPDDNPERRLLDVKYKIFLEQCYSQRKFRDMVDKIELENAKLAQKH"
FT   mobile_element  complement(554234..554494)
FT                   /mobile_element_type="retrotransposon:solo LTR, rho F"
FT   CDS_pept        555758..558238
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080462"
FT                   /orf_name="CD36_42530"
FT                   /product="Sulphate permease, putative "
FT                   /function="secondary active sulfate transmembrane
FT                   transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42132.1"
FT                   /db_xref="GO:0008271"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328073"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniParc:UPI000192D923"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW3"
FT                   /transl_table=12
FT                   /translation="MTGVLETVKSIASNEGFVSEVPHLYGEEAHHKVKSHEFDTNSINN
FT                   TNYNSNVFVPAYDEREVTVKEWFQYIFANPLKMIVDYLFSLFPILKWILHYNIRWLYGD
FT                   LVAGITVGVVLVPQSMSYAQLAGLEAQYGLYSSFVGVFIYSFFATSKDVSIGPVAVMSL
FT                   QVSKVIAHVQDKFGDKYAPPEIATFLSLICGGIALGIGLLRLGFILEFISIPAVMGFMT
FT                   GSAFNIITGQVPGLMGYNSKVNTRDSTYLVVVNTLKHLPDSTVDAAFGLIPLLILYLWK
FT                   FSTDYAQKRYPRYKMYFFYFQQLRNAIVIIVATAISWGIVHPKKVAFNGPSSKFKPPIK
FT                   TIGDVPSGLRHVGVMTVPDGIISAMASEIPVSTVILLLEHIAISKSFGRINDYKVIPDQ
FT                   EVIAIGVNNLIGTFFNAYPATGSFSRSALKAKCGVRTPLVGIFTGAVVLLALYALTKAF
FT                   YYIPKATLSAVIIHAVSDLIANYKITWSFWKMSPIDCGIFLIAVILTVFVTIEAGIYFA
FT                   IAASVVVLLVRVAIPHGQFLGKIQIAEVVNPVIEQTGSHDENNASASDGTSYSSDLEIH
FT                   QVLSEGTNYKSTDETGKLKSKEDIKPVEGVTASALQRNNPQVKFHTRWVPLNNENINAG
FT                   IKVQPPPPGVVVFKPVESFTYPNASRQVDKVSDEAKRLTRRGKPFDYSKIGSRPWNDPG
FT                   PLRWNLPWSKKEKVEEKVEDNRPILRIVHFDFSTVASIDVTAIQALVDLRKALNAYADR
FT                   EVEFHFSGILSPWIRRGLLNAGFGTYEDGLLSTNNYVNIAAGYQDLEDHADEPYYAATG
FT                   TNTPFFHLDIPNYS"
FT   CDS_pept        558642..560360
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231797"
FT                   /orf_name="CD36_42540"
FT                   /product="Chromatin assembly factor 1 (CAF-1) subunit,
FT                   putative"
FT                   /protein_id="CAX42133.1"
FT                   /db_xref="HOGENOM:HBG397101"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniParc:UPI000192D924"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW4"
FT                   /transl_table=12
FT                   /translation="MTSQLEIIDLTNDTADLSEFSTTQTDPIRSKRAASSTVEVNNEEA
FT                   LSPTKKCKTDANTAFIEISQNISADEKHIPKKELEKAEKEKQKQEEKARKEQEKLEKKR
FT                   KQEEERELKRKRLEEEKELKRQKQEEERRARELKKEAERLQKEKEKQEKERIRLEKKQK
FT                   LEEQRLAKEAEKKRLEEEKRKIEEAKERSQMKISSFFQVGQKRKEKKTAPESSEGDTSK
FT                   NSPKSFYETEFLPFFVQKNVSLMNVGNKDISDSKRILDDCLNGALPKESSFKSYLNTFT
FT                   NSSLSTVNDITPEEIINALNSSTTTENQVHQLIQDLPPIKYISFYENSKPPYIGTYCSL
FT                   AHQKCRESIIQNPFDNEITGLDYGYDSDLEWNKEDEEGEDIENDEDDDDDDSIMGDEDD
FT                   EEFVEDDPQSNKKKFITLTVINKWNNEENSQDFQSFATVKLVDIPGQIDPFHNYWATQN
FT                   EPQVQTISVTQDATKSIDNVLINKATPTMGTSSSPNILIAQKKTIKDSVVLANLIKFIE
FT                   NNNDFTIGTLVELSKKEFKDFTKALIKNTIQEIAVYDKRSSKWEIKAEMKEKYCS"
FT   CDS_pept        560644..562998
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094060" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231798"
FT                   /gene_name="SLX4"
FT                   /orf_name="CD36_42550"
FT                   /product="Structure-specific endonuclease subunit SLX4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42134.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG397100"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI000192D925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WFW5"
FT                   /transl_table=12
FT                   /translation="MATETGDDDGGIYFHSTQIQSIHESLEQEKSQRLYLQASIKKLES
FT                   FKHVSDESLNNLNPSPVSVVQIKKKAATRKRKLSARKPNLKKPKSSSEVVRQAFEKDKF
FT                   AYFTNNQARIDEFLTNGSVSTENSTSNQGSLISSDEWNYIKQTYLQQQGESKTTLKGIR
FT                   NKIKQSKNSGIGMWEITASNPDISLNDEDIQYLHDLDEQQMMSDGNSFTDDDIDPTQDD
FT                   GLVLTLSQNCSSQHDICHHEKDHQEHILINSSIGEAVQHDRNLESRSQKYSDNGNTIPD
FT                   QNSAIRTGEMESTDAHEVQEIFSTPSYVPSNQLNTDKDSSQESGSSIIMLAENIVSTQP
FT                   DVIESISDSESEIEIIEKPRLQVLQSVYENDISTNQTRHESAILKYSENSKQSEHQDYE
FT                   SEVVESDSTPIITPNVTPKKKAHISPVNETHGIMNESPVPLASRNTPDRITNIVGRIPS
FT                   SPSPIKLVLESPLKKQRKIEFSDTESIYSTAVSQFGTPKQTTSSPVEVLTSKVGSPQLG
FT                   ICSDSETISVVSSMAHKKSHAAKKLRTTTLEVSAALRVKTYTDPENNITVKKLGEEKKR
FT                   EFIDLDNEIPDSENSDDDTGFSIIEITRQVVERKEHNNDDYSEEQSTDLFQIGLKDKRD
FT                   IANTSHLQVPSSLVMQLGNTGNTFLDSSLVEEDDEIAKLTATELRERFKDWGLKPVQGK
FT                   DKMLEILQGISDFISPESLLALKGDDLQQRVFDKLELLIKQDQFWYDRILTFEPIRLEE
FT                   MRQWLNSHNHYLELDMLRLYCDRNCITTTNT"
FT   CDS_pept        complement(563028..563324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080463"
FT                   /orf_name="CD36_42560"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42135.1"
FT                   /db_xref="HOGENOM:HBG398513"
FT                   /db_xref="UniParc:UPI000192D872"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFV7"
FT                   /transl_table=12
FT                   /translation="MSTQRTTRKATHEQISKSRVVNASILTFLTVLIFLILLYHLVWAV
FT                   QVMMYQPYGNLLNNIVYGPGTLIANAGLSSKLIKYINEKLVEDKIEADYKKYI"
FT   CDS_pept        563773..565587
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581801"
FT                   /orf_name="CD36_42570"
FT                   /product="JmjC domain-containing histone demethylase,
FT                   putative"
FT                   /function="methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42136.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG333437"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000192D926"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW7"
FT                   /transl_table=12
FT                   /translation="MQSVYPNHTSLHIEPSYYDNGVPVFKPTMHEFRDFYNFNKAINKY
FT                   GMESGIVKVIPPTQWVSRVQKCYTESNLGQVSIQNPIVQSINTNAPGIYQSQNIERYKK
FT                   YSIFQWREMAKTRQPPRRKQRSDKPEVGHGHAKRIPFYNINTSEYTDERCKELETNYWR
FT                   SLSYSEPMYGADTMGTVFDKSMTVWNVAHLPNLLDLMEEKLPGVNQAYLYAGLWKASFA
FT                   WHLEDQDLYSINYLHFGAPKQWYSIPQSQHKEFYALMVDLFRDEFKQCSEFLRHKTFMV
FT                   SPVYLEKHGIKVNHTIHREGEFMITYPYGYHAGFNYDYNLAESVNFALDDWFEFGKRTE
FT                   KCECINDSVGINVKHLWEKYYGTKYETAKEEEEGRGNRFSSDSDGSIEVVKVEKIQRKC
FT                   RKRKQDNADPANTRRPHKQPEIIPRECELCPNTLQQTKYSHSSLFELLEADVNGATPRT
FT                   ARRVHKICASMFPHQLKCNCKTNTVHGLDNITKNQKKLRCGVCRQSNMGACFQCSYEKC
FT                   TRAFHGTCGLVDGVQYDFNSGEAFCKFHCQSSTSPEFRVGMYVQFLFNHRVYFGQLVSL
FT                   GEGDVEIEVYPSAKDVIEIPMTSIINVV"
FT   CDS_pept        565778..567583
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246661" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581802"
FT                   /orf_name="CD36_42580"
FT                   /product="Conserved hypothetical protein "
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42137.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG397099"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="UniParc:UPI000192D927"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW8"
FT                   /transl_table=12
FT                   /translation="MAPPRRKKPKYEPVDINSSFDEISSDSQGSSFFEHWSIQPSPVKK
FT                   SETINNNQQWIDKYRPKTINDICINPTKLKQVKDSMMKMINKTSNTRVLILSGPSGSSK
FT                   STTVKLLAEELIIVRDAFDSIVIEYNESEDFGNFLQDCRYKSKNVILVEELPNIYHLET
FT                   LKKFRDAIKHWIYQDDNGFSLPPLIICLTEIEYDSNDLRISYNIENNLTVDTLLGKEII
FT                   GLNQVEIIKFNSIANRFLKPTINKIIKQEGILKIINQQVLMRFLDEIFQIGDIRSIIFN
FT                   LEMWIKNVKQFSSKQKISIDSFMRENSINLFHAIGKIIYSSSKVNIRRSKTSNNNNNNN
FT                   EEEEKEEEEEGERLDKDDIDYQSIEQVLQSFPEKNMDLLNLSLLENYHIYQDSNYDLEL
FT                   ASNIVDDLSVNDIIKLGDIGLRSTRINLSKAKNLSSKRFKSMPSSKLKMKFPRHLKMIK
FT                   IMNKTKNQINSYRRYLNPQISFEDLNLIDGYYMPIIYNTQKQTKFRYNRLGGKFQEVYA
FT                   DDKIPIDEGEIIYEYDQFEIDIKNKINLDSDMKYSQAINEDIDNMSDPIETDDDLEDVR
FT                   DITNNESDAFSSDSELELLLTQGKV"
FT   CDS_pept        complement(567787..568569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581803"
FT                   /orf_name="CD36_42590"
FT                   /product="Monothiol glutaredoxin, putative "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX42138.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG327968"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000192D928"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFW9"
FT                   /transl_table=12
FT                   /translation="MGVIEIESEQQFTELTKADPSKLIALYFHTPWAGPCKTMNQVFKT
FT                   LADSKESDNSIIFLSINADELSEISEIFEVSAVPYFILIRNQTILKELSGADPKEFIQA
FT                   LNQFSNNSNSTSINNDNIQGSINNNSNNTTTTNTNNNNNNNNNINTTEVEESEEALNER
FT                   LNKLTKAAPIMLFMKGSPSSPQCGFSRQLVAILREHQVRFGFFDILKDDSVRQGLKKFS
FT                   DWPTFPQLYINGEFQGGLDIIKESIEDDEKFFEHALEA"
FT   CDS_pept        complement(568996..569958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581804"
FT                   /orf_name="CD36_42600"
FT                   /product="Suppressor of four kinase protein, putative "
FT                   /function="kinase activity"
FT                   /protein_id="CAX42139.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG397098"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI000192D929"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX0"
FT                   /transl_table=12
FT                   /translation="MSSKPLIRFQVIHYYLIPIIALIVWWGMLIAMLSCWGAQGRPIYS
FT                   FMNGKYQNPVYISDIGATNLQPLFISCTGFQAIFFVGTLIMGAYLRYKSGKIQPYISKH
FT                   QPRLAIASIICATIGQLGILFVAIFNTKNFHPVHISMVGVFIAFCFLACVCDFAISFIF
FT                   GTHPSKLDPVHDQVVFGTSKYANLYFVSFMMKLIWLFAAVAFAICFGIYMKTGQNSKSA
FT                   VFEWLISFWYGLLLVMWSMDLLPSALRKYRFKHPDRYPRYVQYHGNINYNNNNNNKNKA
FT                   NDDYESQWMKDAREGNSFSEIDDNQTYVGNGGPMSPRVL"
FT   CDS_pept        582713..584548
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581805"
FT                   /orf_name="CD36_42610"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX42140.1"
FT                   /db_xref="HOGENOM:HBG397096"
FT                   /db_xref="UniParc:UPI000192D9E7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX1"
FT                   /transl_table=12
FT                   /translation="MEQFYISSYIKFIWIIVSHNNSFQQSIKSFQHFNNKYGKFIQKLI
FT                   LNSQLSSTNLMISLYYLYKHYHINNVLLHKHDYHHHHSSAQEESFKEDNDLFNSMLIYN
FT                   VIISLVLSNKSFDDQSYTLKTWLIIIDNTNANTNTNTLNNNNTNNNTINNTSNKSLINI
FT                   DLKLLNHLENYFLSSLNFKLSFIDISINHQFWKILSNCKIFRINQTILNKFKQLVMITN
FT                   TNTNTNTNTTTPTINNTTTITPTVPTTTTTTTTNQLNNVNYKNNIVLSPLPTTPISSSM
FT                   VSTNIRFATSTTTTTITTNNNYKVVGNNGNNGNNCYNNNIITPFTNYSSTPAVHINGHN
FT                   HNHNHNHNHSHNLSHNHGKSISSISISKNNKNNNNFSSPLNNISTFSSPLNYPLTPSTP
FT                   CYDDTNNNNNSSSSGYPYGCMKKRRIMSNNNNNNNNNYNSNCQIKSHYYLPSYQPQPKP
FT                   QPKPQPQQQPQQQQQIMLLPSQEFTFTQPIQYQYQYQYQYQYQYQYQYPLPLPLPQQQQ
FT                   NLPTMPIQTVPPPSSSSSIQYVSSIPFTNNNNNCNYNSLINGMSIGGIGTNSIISTGGD
FT                   SGVAAPTFQKPMVMMMPYYPLQQPQPQPQQQFNLF"
FT   CDS_pept        589770..590261
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581806"
FT                   /orf_name="CD36_42620"
FT                   /product="Hit1p orthologue, putative "
FT                   /protein_id="CAX42141.1"
FT                   /db_xref="HOGENOM:HBG397095"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI000192D9E8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX2"
FT                   /transl_table=12
FT                   /translation="MVLCGICKIEQSKYKCPKCSILYCSLICYKSELHNHDNLPTITDP
FT                   SPPPPPQQQQKSLIDTINTTTTTTTTTASSSSSEDDKFNKLLQDNQIQYLLNQPSLQFH
FT                   LFSIIKILIDSTFTPKNSNIEQKLDIANLKLNDLRIGGVEQNELIEEFVQRCLELMNGT
FT                   "
FT   CDS_pept        complement(590586..591671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537389"
FT                   /gene_name="CGR1"
FT                   /orf_name="CD36_42630"
FT                   /product="Cell growth-regulated gene 1 protein orthologue,
FT                   putative"
FT                   /protein_id="CAX42142.1"
FT                   /db_xref="HOGENOM:HBG397094"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniParc:UPI000192D9E9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX3"
FT                   /transl_table=12
FT                   /translation="MTLTVTKDNIFPKGYRGRLTEGVTYDERNNTLLWVDIIQAEVHRV
FT                   FLDNIETDPNSNSSNSSSCHEILKWDSSDESIGAICLTNNPNKLIICSKYGIAYGDFSN
FT                   FTIEYFFKYPHTNNIKEKLRLRSNDGIIDPWGNLWIGIMNDFSIGENEGIQPEGKLYRI
FT                   SIDHNNNNNNNNNNHDHDQLICDVMIENSLISNGLCFNNKGDEFYWTDSLTFKIWKFNY
FT                   DKLTNKLINKSIFIDLKQFYPNIEQPEPDGLIMTNNGEIYTCVFNSGTILHVDNQGKEI
FT                   ERINIPANRPTCITFGNGEKNNEMFITTGHLQLNDKNVIIDNNINDNDDNNDDDLGGFL
FT                   FKLKFDKNLNGQKKNIWGGKV"
FT   CDS_pept        complement(591995..593056)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231938" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581807"
FT                   /orf_name="CD36_42640"
FT                   /product="Cell division cycle protein, putative "
FT                   /biological_process="cell division"
FT                   /protein_id="CAX42143.1"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG609337"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="InterPro:IPR016525"
FT                   /db_xref="UniParc:UPI000192D9EA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX4"
FT                   /transl_table=12
FT                   /translation="MTERDYTTFETIDLTSEEVLQCSYSNWSKLFSNNIFPSKIIKPLP
FT                   STFLDYLASESIRLPSNTSNKKITVLEADSDNEYSDWDDDDDDDDDEGQQQQQQQEDVF
FT                   SQFQDIQDKIDESIQEIGGAVFPKLNWSSPKDAKWIMPGNTIKCQNVSDVYLLLNSSDH
FT                   IGDDLDNPFSEVKNKKTIPEEINYELVLTKWQDINPAYEFRVFIKHHQIIGISQRDNNK
FT                   YEFLQGLKLELNEKITQFIDNVVIPKLKSNTQLNKYIVDIYVSKNHIYIIDINPFSRKS
FT                   DSGLFTWVELLSENNNNHHHHHHHELRLVENQNFVKEFSESQVPIEVVGATMDTEAMVE
FT                   LAREWDKLQAKEK"
FT   CDS_pept        593382..595016
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581808"
FT                   /orf_name="CD36_42650"
FT                   /product="Cytosolic chaperonin complex subunit, putative "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42144.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000192D9EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX5"
FT                   /transl_table=12
FT                   /translation="MASVARPTVAPSNATFKDKEKPQEVRKANILAARAVSDAIRTSLG
FT                   PKGMDKMIRTKNGEIIISNDGATILKHMAVLHPAARMLVDVSHAQDVEAGDGTTTVAIL
FT                   TGAFLGAAERLLNKGIHPTLIAESFQTAAQRSVEILLDMSYKISLDNREQLIRAATTSL
FT                   SSKIVSQHSQLLAPLAVDSVLKVINEEEIINENNEITKKKNVDLNDIRLIKKVGGTIDD
FT                   THLVNGIVLTQNVVKHAGGPVRVEKAKIGLIQFQISPPKPDMENNVVVNDYRQMDKILK
FT                   EERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVIKDIERDEVEFL
FT                   SKAIGCKPIADIDNFTEDRLGSADLIEEIDSSGSKIVEITGVTSKNIKPTVSVIIRGAN
FT                   NLVLDETERSLHDALCVIRCLVKQQALIAGGGAPEIEVSRQLMKEANKLSGVEQFVYKE
FT                   FAQALEVIPTTLAENAGLNPINVVTDLRNRHENGEKDAGISVRRSGASNTYDEHVLQPV
FT                   LVSTSAIVLASECVKSILRIDDIQFSR"
FT   CDS_pept        complement(595109..596842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080464"
FT                   /orf_name="CD36_42660"
FT                   /product="Something About Silencing ortholgue, putative "
FT                   /biological_process="gene silencing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42145.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016458"
FT                   /db_xref="HOGENOM:HBG397092"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="UniParc:UPI000192D9EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX6"
FT                   /transl_table=12
FT                   /translation="MARRNRNTTVNEEEVELDEVDSFNANREKILLDEAGEYGRDDQSE
FT                   DDDSEEEVMQVEEDSEDDEDDQENSGYNDDEEDEEEEDEEEVEEEEGKGWGGRQNYYGG
FT                   DDVSDDEDAKQMTEEALRQQKKHLQELAMDDYLDEEMMEDWQKKADSYDNKESLSTTQQ
FT                   SQQQLIIESNSSIENLEDNDKLKLLQQSFPEFIPLLKELNILKVKLEDLQKIEDKNRSI
FT                   ETKIVALSAYLGAISSYFAIFVDNLNNEESFVSMKDNPIMETILSSREIWRQANELPDE
FT                   IKMDDVKVYVSDVVSSDIDDEENFVDAKEEQSEDEEISEIEEEEEEEEEQEEEEKENQS
FT                   DDLDIDANSQRIIKHVSKRHGDDFTEADIEDIDMEDKQRRKKTLRFYTSKIDKAAAKKD
FT                   QSYSGDMDVPYKERLFERQQRLLEEARKRGLQKQDDENISDNINDDDDNDNDNDEGFEQ
FT                   NDNYYQSVKQHKLNKKQSRKSAHEAAIKAAKEGKLAELQESVGQDGKRAINYQILKNKG
FT                   LTPHRKKEYRNSRVKKRKQYEKAQKKLKSVRQVYDANNRGPYEGEKTGIKKGLSRSVKL
FT                   V"
FT   CDS_pept        597139..598524
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246650" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581809"
FT                   /orf_name="CD36_42670"
FT                   /product="DNA-directed RNA polymerase III subunit, putative"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /biological_process="transcription from RNA polymerase III
FT                   promoter"
FT                   /cellular_component="DNA-directed RNA polymerase III
FT                   complex"
FT                   /protein_id="CAX42146.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005666"
FT                   /db_xref="GO:0006383"
FT                   /db_xref="HOGENOM:HBG397091"
FT                   /db_xref="InterPro:IPR007811"
FT                   /db_xref="UniParc:UPI000192D9ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX7"
FT                   /transl_table=12
FT                   /translation="MSNRLESLNPRKPLSSSSSSSSGSKSAAKFKPKVVQRKSKEERAK
FT                   VAPTIKQEPQTRQPLPNSRGRGGARGRGGRNNYAGTHMVSNGFLSAGAVSIGNSSGSKL
FT                   GLTSDMIYNSNGDLSSSSTPDFIANFKSKQKASTPGAQSDEDEEDDDPTKINMTQKYRF
FT                   NEEDTVLFPVRPFRDDGITRVENEITMPDVEIKQEPNDSTAESTPMPISLTQSRETTVK
FT                   SELIEEKIEQIKETKSKLEKKIAQGGDSFVSEETDKIISDHQQILDILTGKLDKLSTKT
FT                   EDVHPKQKQMQQDNDDDDIDDIDDIDVELENEKKETYFDDQYILFQLPKHLPTYIQPKS
FT                   AVKLEPGVKSIEVDEPVTEEEISKLATNNSKLRGKIGNINIHQSGKITIDLGNGIRLNV
FT                   TKGAPTDFLQELALIEMNPPSKPEDNEEEDVQMVDDDGRSITGKVVRLGIVNDKIIATP
FT                   CIQ"
FT   CDS_pept        join(598660..599085,599158..601140)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080465"
FT                   /orf_name="CD36_42680"
FT                   /product="MutS homolog, putative"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAX42147.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG397089"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="UniParc:UPI000192D9EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX8"
FT                   /transl_table=12
FT                   /translation="MNEDTTQSSIQDVTFLDTECQRILSLDIKGSLFGASCLNGEIKKL
FT                   KIFEDCHINHPETYIESIINEFGPTIVFVSSRTTTNVVSILEDIKDVYEFTFYVKIVAD
FT                   FTKFDTKRLVESFYSLANNNNVHIFATSALKSSSIRITLGTINALWLGIAEFVDPSCCC
FT                   IADLVDSLEFCSFQDIMFIDVDSLYALQILPETRKSLNINSKSQKLSLYDLLNNTVTIE
FT                   GAKLLKDWVRKPLTDITKLLSRQNTVKILSSSELHEIRSNIRKGLKYTKNCKSIVNGLE
FT                   AGKSSWKVWKNLILFLQNVMYLSKQIRLCFSETNMPPELALFYNQELMIDFNELEKFIL
FT                   SYAEPITSEEDNKMRIINGIDDTLDELRIQYNNLEELLQETTGIIAAKFSEEVFNTVYI
FT                   PQLGFLVSRKADIENADTTFMPDEWQEVFRTSTNIYYKTEEVWQLDEQFGDIYTLINDR
FT                   EIEIIQSMLAKVSEFNTVIIQVGEAAIELDCLCSLSEVSQYRNYVFPCITDTNELEIIQ
FT                   GRHPLVETFSNMFVPNNTIFEPEEKIMVVTGANLSGKSVYLNQTALIVVMAQIGCAVPA
FT                   EKATLGIVDKILTRISSRESLDKQQSTFAIDVYQLSKCISLATDRSLVIVDEFGKGSDP
FT                   IDSTSMFGGTLSYFGKKSLDCPRCIFSTHFLDLFKDKELCEMYQSRKTKMMSTEILLEK
FT                   TTNSSLDNVTYLYKVKPGLAEKSFGIYCAKVCGIPQNVIQRAECIAQMLNNGEDVAYEL
FT                   TRLSEEEEQNYSVAKKVVTKFLDIEFEDAELSINDSIHYTSKFDEIFQG"
FT   CDS_pept        complement(601137..603434)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581810"
FT                   /gene_name="DBP4"
FT                   /orf_name="CD36_42700"
FT                   /product="ATP-dependent RNA helicase, putative (Atp-
FT                   dependent rna helicase dbp4 (Ec 3.6.1.-) (Dead box protein
FT                   4"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX42148.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D9EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFX9"
FT                   /transl_table=12
FT                   /translation="MAKNLKKGKKVFKKSVRKVNRLKEEEELAKLQERINNYNPKTDEA
FT                   SISQFSDLPITENTLKGLKEATFVSLTDIQKKTIPVALKGEDLMGTARTGSGKTLAFLI
FT                   PVIESLIRNKITEYDGLAALIVSPTRELAVQIFEVLTKIGKYNSFSAGLVTGGKDVQFE
FT                   KERVSRMNILVGTPGRISQHLNEAVGMETSNLQVLVLDEADRCLDMGFKKQIDNILGHL
FT                   PTTRQTLLFSATQSESVNDLARLSLTNPNKIGVSSDQEVSATPESLEQYYVKVPLDEKL
FT                   DVLWSFIKSHLKSKILVFFSSSKQVQYTYETFRTLQPGISLMKLYGRHKQTSRLETTMK
FT                   FSQAQHACLFATDIVARGLDFPAIDWVVQVDCPEDAATYVHRVGRSARFGRKGKSLLML
FT                   LPSEEEGMLKRLKIHKIEPKLMNIKQKSKKSIRPQLQSLCFKDPVMKNLGQRAFIAYFK
FT                   SVHIQKDKDVFKVEELPAESYAASLGLPGAPRIKIKGGESNKEKKNASRKLIALAKTDA
FT                   DGEVQTENEKVRTKYDRMFERKNQTILSDHYLNMTGNKVDSDGDSEEEDFMTVKRKDHE
FT                   LKEDELFDLTIPVSKRQAKKALSRKATLASKGNPTKLKFDDDGVAHAIYELEDENDFIK
FT                   AGDAKKQKEEFVNKERETMKISDITDKEVERQKRQEKKRKRKEIERRMREEEEEEEEYD
FT                   HEPAVVTLATPDLERDMQYDNGSDVEEPVSKKPKWFEDDNKSKNTNDGFVEYDEPETLE
FT                   DLESLTARLIGN"
FT   mobile_element  603588..604058
FT                   /mobile_element_type="retrotransposon:solo LTR, eta D"
FT   CDS_pept        join(complement(604964..604980),complement(604190..604892))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581811"
FT                   /orf_name="CD36_42710"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex, putative"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX42149.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG397088"
FT                   /db_xref="InterPro:IPR013921"
FT                   /db_xref="UniParc:UPI000192D9F0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY0"
FT                   /transl_table=12
FT                   /translation="MNMVTAVLLVQKANLETITQFHDQISNELPTAKGKWNFNFKIFRN
FT                   NQYSIPQELVNTHEQAPESKFLFTLSPSYLRDSTITLINGKSAGVFTNSIEEELSELGH
FT                   PSDLSIPNDHLRRGATTGLNDKFDTFIGAKLQSLWTQRQLIKGDGGQIYELENGNLCIR
FT                   TSNVFLHGNFRGLLIQIEMSNSLCDINNHNGFKEHFNKIVEKYGFPEGSLCCDVLDNKN
FT                   LDKYGDLCLQYSKILNF"
FT   CDS_pept        605214..607607
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581812"
FT                   /orf_name="CD36_42720"
FT                   /product="RNA polymerase II Elongator subunit, putative "
FT                   /protein_id="CAX42150.1"
FT                   /db_xref="HOGENOM:HBG327889"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D9F1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY1"
FT                   /transl_table=12
FT                   /translation="MTSSEITQEAIFIGANKQNFVSDYNPANNIIAFGAANTVALWNPL
FT                   SKNHNGVYHTLKKHENEVTGVKFIPNSPYLVSIGEDHVINVWREKGKVYEFVQSLQDHT
FT                   HSVTCIAVINENIFITGGSDHNIIIWLFNEEKQQFEYGDKFQVKSNYFPLALALQDIDA
FT                   DNYLIAIGGTNNNIYIYTFEFKNGKVSALEKKAELTGHEDWIKCLQFVTEEPHKNYILA
FT                   SGSQDRYVRLWRLKLNDLIDDSDEDPTKLVLLSNKQYKFELANGSRAAFSFEALIMGHD
FT                   DWISGLQWHPSCKNIGQEHKLQLLTCTADTALMIWEMDPDSGIWVCVSRLGEMSVKGAS
FT                   TATGASGGFWSCLWFIDPSTNEHYVLASGKTGSFRVYKSDANGQSFESVLGITGAVRDV
FT                   NDIKWSVNGDYFTATSLDQTTRLYAPWKREGIESWHEFARPQIHGYDMICYDNISPTKF
FT                   VSGGDEKILRVFEMTKSISKLLQNLCGTQIVEENDQLPITASLPVLGLSNKAENQIEQG
FT                   DQQDVDNEDNTPEAAEDVLASLSSPPVEEYLQRYTLFPELEKLYGHGYEISCCATSPNG
FT                   NLIASACKSNSAKHAVIRVFNVAQDYQQSQQVLSGHNLTISSLEFSPDGKYLLAVSRDR
FT                   QFSLWEVVNEQSASFKLVELNPKAHARILWDCSWLPVGDSFTTVSRDKQIKLWKVSNDK
FT                   VEMMASTKLNDAVTSVSVYKGSLFNNQAIVAVGLEDGGISIFAVDAANPEFKLISILDK
FT                   ELTPSNRIEKLSFSNKLHNGKLLLGVGSKDTSARLYSIDSTIFI"
FT   CDS_pept        607969..608613
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231799"
FT                   /orf_name="CD36_42730"
FT                   /product="Protein phosphatase regulatory subunit, putative "
FT                   /function="protein phosphatase inhibitor activity "
FT                   /biological_process="regulation of phosphoprotein
FT                   phosphatase activity"
FT                   /biological_process="regulation of signal transduction "
FT                   /protein_id="CAX42151.1"
FT                   /db_xref="GO:0004864"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="GO:0043666"
FT                   /db_xref="HOGENOM:HBG397087"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniParc:UPI000192D9F2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY2"
FT                   /transl_table=12
FT                   /translation="MSDTSPKGILRNKPEGYVEETQFPDKLDRKEVIKNTRLNAQLASE
FT                   SSKGDEIRAKIAEKKKEQGLHSAELPEHLKWDEINLYKNEQEKSATMKIDEPKTPYEGG
FT                   FNPEGEYYREDDDNEGNGNGEVDDIPAFELGEGEFDKLPHETSGSLHGSRVIKDTNHQE
FT                   KEQDEEDDSGEKELTAEEKHRRFEEMRKQHYHMKGLPLRQKIEIPDEDDEE"
FT   CDS_pept        complement(608796..610079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581813"
FT                   /orf_name="CD36_42740"
FT                   /product="Zuotin, putative"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX42152.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG383362"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000192DAAE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY3"
FT                   /transl_table=12
FT                   /translation="MSIVLPSGTTDGFKAVSKYSAPVRRPIEPVGRYFLAHASRTLRGH
FT                   TWSEFEKLEAEKNVKQIEVNEDEDLGDEEQSEELLEHDPREWKTANLYAVLGLSHLRSK
FT                   ATEDQIRRAHRKQVLKHHPDKKSASGGLENDGFFKIIQKAFEVMLDPVKRRQYDSIDVE
FT                   NDPKPPAPKSKYDFFEAWGPVFESEARFSTKQPVPLLGNLESTKEEVDAFYSFWGRFDS
FT                   WKTFEFKDEDVPDDTANRDHKRYIERKNIANRKKLKQEDNKRIIELVERAHAEDPRIKL
FT                   FKEKAKKEKAAKKWEKESGSRKAAEEAAAKKAAEEAAAKKAAEEAAALKANSKKAKEAA
FT                   KAAKKKNKRNIRAAVKENDYFGDAAKSADIDADVDLLIEKFDDVKLGEVANKVKDADAA
FT                   SVKSTFAEVAKELVGAGSLDASYLKYFN"
FT   CDS_pept        complement(610297..611070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581814"
FT                   /orf_name="CD36_42750"
FT                   /product="60S ribosome maturation factor, putative "
FT                   /protein_id="CAX42153.1"
FT                   /db_xref="HOGENOM:HBG333702"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniParc:UPI000192DAAF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY4"
FT                   /transl_table=12
FT                   /translation="MAVINQPNSQIRLTNVSLVRMKKGKKRFEIACYQNKVQDWRSKVE
FT                   KDIDEVLQIPQVFINVSKGQVANNDDLQKCFGTTNQDEIIAEILNKGEIQLNEKERNAN
FT                   LQQKQNEFLNIISTKCINPRSKKRYPPSMIEKALNEVKFHLNPTKQTKIQALDAIKLLV
FT                   EKQIIPIARAQMKVRITLSKKAYLKSFQDEIKPVIDQIVEEDNNGKQFEIVGIIDPINY
FT                   RVLVTLIENTDGSNKVAKGEGSIEVLDMSAIKEQS"
FT   CDS_pept        join(complement(611878..611883),complement(611536..611721))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231800"
FT                   /orf_name="CD36_42760"
FT                   /product="Subunit of the ubiquinol-cytochrome c reductase
FT                   complex, putative"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="CAX42154.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG318018"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="UniParc:UPI000192DAB0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY5"
FT                   /transl_table=12
FT                   /translation="MLTVLGRLLERNSIYVATIFGGAFAFQGFFDVAVNKWWDEHNKAK
FT                   LWKNVKGKFLEADEEDDE"
FT   CDS_pept        complement(612268..613632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581815"
FT                   /orf_name="CD36_42770"
FT                   /product="Cell-wall-associated glycosidase, putative "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="cell wall"
FT                   /protein_id="CAX42155.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="HOGENOM:HBG592277"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniParc:UPI000192DAB1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY6"
FT                   /transl_table=12
FT                   /translation="MKFTTLATIATTLLFAANTNADTCNPLKSSNCSPNPALGSSFLEK
FT                   FDNDLGPHFESLKKQGTIDTGSNGLSLTMKKRFDNPSFKSNFYIMFGRVEVVLKGAEGK
FT                   GIVSSFYLQSDDLDEIDIEMFGGDPYQWQSNYFIKGNTATYDRGGYHDIANPLKDYHTY
FT                   VIDWTQDAVTWSVDGNVIRTIPKDNAQGFPQSPMAIYAGIWAGGDPSNQPGTIDWAGGI
FT                   TDYSQAPFTMGIKSVLVADYSSGKQYSYSDQSGSWKSIKADGGEVNGRYDQAQDDIKKL
FT                   ENGQSVDSNDSSSSSSSSSDSSSTSSSSSTSSSASSSSSSSSSYSSSSSSTTSTSSSSS
FT                   SEKSNSVPSASVIVFINTEGGDKTTITSSSGVSVPASATVSTAAGTTSGSSNSAPATTA
FT                   SSTASTVFISTGGAAPSSSASETPSVSTTENNGAVSVARTTSLFGFIALIGFLFV"
FT   CDS_pept        616161..617702
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581816"
FT                   /orf_name="CD36_42780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42156.1"
FT                   /db_xref="HOGENOM:HBG397085"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR018355"
FT                   /db_xref="UniParc:UPI000192DAB2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY7"
FT                   /transl_table=12
FT                   /translation="MFLSALFVVPFTVAHPTILTQYNGGLDDQQPVIKPPFRHSDGPQT
FT                   SDDDLANFLIISFITFASLIVVILLSLVIFWIVRRSRQLSQDEIDREEENQAYLELNSD
FT                   EQELYFQSKEFLTNSPYLVGDLTLSQELSIQEKGITAFEFQKDAVLTNNDLMILNKCEL
FT                   NFFQSFECSTQTNLPIPMKNEVYYFESKIYSLPNPDETVISIGLSIKPYPWFRLPGRHP
FT                   HSVCYDSNGYRRHNQPFPFISDPPFPRLVEGDVIGVGYRTRSGTVFFTRNGKKISESKL
FT                   GGHVKNFKIANKGQLFPTIGANNVCSVHVNLGQMGFVFIEGNVKHWGYAPLEGNGPAPP
FT                   VYNKYNSDILLERSEIDDDDLSERENDFPPDFWAINGDEDDRAASPRALEQDKFSYNAY
FT                   SEVNSHDERITLASLVPPVKPPSYNEDLEEGNSSTPTNSVLPEEEQVNKKSNERHSSGN
FT                   VADAEEDQNIDVNNVENEDTQTEAADITTEDSNAVEADSSSINETEDIDNDAPEL"
FT   CDS_pept        618332..618856
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581817"
FT                   /orf_name="CD36_42800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42157.1"
FT                   /db_xref="HOGENOM:HBG397084"
FT                   /db_xref="UniParc:UPI000192DAB3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY8"
FT                   /transl_table=12
FT                   /translation="MIQKFTCVPATDYDVIVVSNGTKSQIQSKVAVAKPARITYLHDLP
FT                   SLSSYLSEVPNFTGKIIFMFFDGVQYIQDFICDAIDLYGKTPFSLVQNAYFYFDKLEND
FT                   PVNLDLQFNTVAVIVNDVLKKSNFMLDRVRGVYIDDLSLVGDRSFSMKRLICNFPNVEK
FT                   FVLQSNAKITF"
FT   CDS_pept        619361..621280
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384663"
FT                   /orf_name="CD36_42810"
FT                   /product="Actin-binding protein, putative "
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42158.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG397083"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI000192DAB4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFY9"
FT                   /transl_table=12
FT                   /translation="MEKIDFNTNSNKIQQAYDKVVRGDPNATYVVYSVDKNATMDVTET
FT                   GDGSLEDFVEHFTDGQVQFGLARVTVPGSDVSKNILLGWCPDSAPAKLRLSFANNFADV
FT                   SRVLNGYHVQITARDQDDLDVNEFLNRVGAAAGARYSTQSSGTKKPTPVAPKPVSKPVV
FT                   AKPSTGSKPSFVPKSTGKPIAPVKPKPKSITKDAGWGDAEDIEERDFDKKPLENVPSAY
FT                   KPTKVNIDDLRKQKSDTTSSTPKAFKPEPTEEKNNDEEQPKPLSERMKAYNQPSSSDGR
FT                   LTSLPKPKIGHSVADKYKANAPGNGGAPVFGAKPVFGTQSVDSRKDKLVGGLSRDFGAE
FT                   NGKTPAQIWAEKRGKYKTVASDEKETNSNENVDEPEEHHTADLAKKFEEKAKIVDDTPS
FT                   LPTRNLPPAPPARETTHQSSEKEEEEEDAPAPSLPVRNLPPPPQRQSEPEPEPEKEEAA
FT                   ALAPSLPARNTPSAPKAEETKKQSVTATAEYDYEKDEDNEIGFSEGDLIIDIEFVDDDW
FT                   WQGKHAETGEVGLFPATYVSLNEKSADKEEEEEEEEAPAPSLPSREGTQAPPALPSRSE
FT                   QKPASKTATAEYDYEKDEDNEIGFAEGDLIIEIEFVDDDWWQGKHSKTGEVGLFPANYV
FT                   VLNE"
FT   CDS_pept        complement(621498..621824)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537390"
FT                   /orf_name="CD36_42820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42159.1"
FT                   /db_xref="HOGENOM:HBG397082"
FT                   /db_xref="InterPro:IPR008504"
FT                   /db_xref="UniParc:UPI000192DAB5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ0"
FT                   /transl_table=12
FT                   /translation="MTTSMEKFYYQPSIEANKQKLQHVHDVASLALGVGSGILTLESMN
FT                   GFIFYFIGITVANLLFYIICGEGRPSKYYKNPLQEIFVSGIFDNIPGFIMMWCLVYALV
FT                   KSSS"
FT   CDS_pept        622208..627904
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581818"
FT                   /orf_name="CD36_42830"
FT                   /product="Cytoplasmic ubiquitin-protein ligase, putative "
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42160.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397081"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="UniParc:UPI000192DAB6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ1"
FT                   /transl_table=12
FT                   /translation="MEVNEENKALKKFFLQLPIKADFDFNKNVKKEIRKALFMSISANG
FT                   ECLNWLFPSAFLDSHSYNRDDMIKKVEDDYEWTFNNYYKALLSKRDPKHDTHSHRAYHK
FT                   NSPCGRIFRKGEPIHRCLTCGFDDTCALCSHCFQPEYHEGHKVHIGICQRENGGVCDCG
FT                   DPEAWTRELFCPYAVDEDSASVHDREIPERLAASIVTTIATILDYMIDVIIHSDLQFQN
FT                   PEETTVHEIESNTISSSLDPKKYGCHDNEFVDATNDQYYLMLYNDQVRYYRDAVQRVHL
FT                   ASKKVKDFAIMVTDKVQKFGKAKVISSRNIQLLLERQKILSATGLATCIRSHRDIFRED
FT                   MCDELVSWLNDFSESELFKTNTAVKDLFCRAFCEKWENGLLGGSVSETTYNYRVGTLDP
FT                   FLRIPKISSREQTANGHWYYSPSKWKLCDELCQECNYNINTSEFQKNVSHHGSRLQYLV
FT                   YLDVRFWKDTRALLHDMYSTSLIINLRYKNIICYQYVDIYPTIVDMYLTMDREPELSIM
FT                   PTLSTQLFTCPTNSAEIIKHGDLTQILASIYGFLTAEHVKAPGDIDRTHRVSIKSLKNR
FT                   RWGQIFFDLSYILTRSKNSKFLPNSNIVPMTCDMLVLFQGKPILKREKANHVEYESPDY
FT                   SVFFQAVSVIYQFGEVIAGALKTTRETELCDILHNYQLAIEYVLAFLVNFENKNFPGLV
FT                   DEEVDLNLSVDKTYKVEPNTGSLIQISDIEEDKVSFLHPVHSFLSWLIEFSRFNNINDL
FT                   IDVFQTVKLKHIGSETPGLEVLIFDYPIKTIVLISQIKAGLWVRNGFSVKSQLQLYKNT
FT                   SLRDQGYTRDLFLIQVFANLGHPDVVTYLILDRWKLLDDWLQNEPSHIYDVKVLPYMLE
FT                   ECLNFFNHLLTEDTHLRGYDEETLIKIKIQREIIHTLCFGPLGYSKLCFQIPDHIVADR
FT                   RFELILKSMTSFKAPKGSNDFGVYYLKDEYLDDVTPYYCHYTANVKDEAIKFVKERISK
FT                   KKGKPVTDVIIEPKRIKTEELGIYKHVGNFATSTHFTNFLIKVLLFVSKRDTKFVESLL
FT                   ETVLHLIHICTLEQTINIEKYGNFFDRFINWSEEFNTSIADLLYKILLAEEFKFSHTKI
FT                   RSIFRVFNQKYPSFIPTLKSRRSEFDISKVDLSSDEVNNEDELGKKKRIAKERQAKLMA
FT                   KFKKQQSSFLKKNQFETIACGSDTEMEELDDHAAWKFPEHHCMLCQNAAEDAGPFGIIA
FT                   YISKSCEFRNVPFNDEYWFLKAFSDNVDLNGNEYELDINQSLHNSPRTKTWTSFMQQVS
FT                   NSSVIGPGFKLNEFIESHFVASSCGHGMHYQCYVNYITNSRNRQNQITRSTPENMDRKE
FT                   FLCPLCKALNNIFIPILWSSNNRSLSEFLRPYSGVSPFLDLDLNYSKDKNWTERFQRFS
FT                   EKEFDSRSILTSISKEMISMDSSKELTKQQRDFRLMLSDMFQTLSLFTFPQVFKADSGF
FT                   VLIDTIKSVEISLRGVSSGGQLIIHQLSNNTLITLRTFNEFKNSSTLMKVKNWIDSPSH
FT                   KKSAYSKIFAYIFALSKKSINNYILEVDFFEHLVNTDAFPSLGFSFNSVLETCFIGHLI
FT                   QSLSIMVNEMSANCLKKNWAYTVSDIPTVADIPQGISQAAISCFKKLSVSNDVRCMGIV
FT                   ESRKFGEVIYSMLVKIATPFLRRAAIYAYVQCANIDGIDFAAYPETEIEADRLCSFLSL
FT                   KPVCEYLRLFNEESSYEGSIFHDFLTFSSALLKTNDVLRVKKLVEYPGIVKLVDLPERL
FT                   DFFFTKYYYSDRHNNPNKRVEDPAICLFCGEVIDVQKQAIGCKEGQCTTHYLKECSNDV
FT                   GIFLLPKDRSLLLLHNNGGTFYNAPFLDEHGEIAEESKKAKALHLMRPRYDDFIRNIWL
FT                   SHNVQNCIVRSLENVLDPGGWETL"
FT   CDS_pept        complement(628035..633410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246677" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080466"
FT                   /orf_name="CD36_42840"
FT                   /product="E3 ubiquitin-protein ligase, putative "
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /protein_id="CAX42161.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG397080"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192DAB7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ2"
FT                   /transl_table=12
FT                   /translation="MNSDLLKEFLIKVPRNLGFRDFKGLPHYITKVLYYSATDEGKYLR
FT                   DLFPKVSERDLDPKTVYSIPGSTEILNPFYETSSVAYTHPPDKACAKPFKAGEPVYRCE
FT                   ECGFDDTCVLCAFCFNEQDHLNHNVSVYISRGTSGGICDCGDPEAFLRPLNCKCQTNRD
FT                   ESEIDLSNMMDALRMTIQIAVDYVLDVSNFAISTLPLIHTELNERHPKLDVQALSDYLS
FT                   LPAESYSGASDINSTNRWVLILWNDEFHNLTEAVTAIKAGTGFSDRNSYKIAEKIDSRG
FT                   FCVIKEEDSPQNLIQAKRLVEFNGLVATIVSARDLLRQKIASCILDWLTAVLNSPSAQI
FT                   RKAASSYFAELLLQPDYRFSKVISSSFLKETLESESVQDQLFAYYVNGLPYDGELVSFN
FT                   YNQLRTAANPITLHEPLSSLLDQKRSVEKLKGSRLQYLLTFQIRFPKETRKKLGLLLVP
FT                   PLVKTPALKREFADQFVELYPSLLTMMALTDREEDLNLMADITSQLFTCPQTVRFIIDN
FT                   GKITNLVGPLAKLIEEHSSVRDINSGYRVYCDIGSNLQQKRAIRKAVSYGINNFYHFFN
FT                   PAVSGENIAKFLQPDLFKLLVLLLRYFQGYWPLTRKYGEHVERDDFDITVHFEISMPIL
FT                   KSLYNLAVHSRKYRETPSIVAQLIELLSKRKNEYIEPGVIKFQVSKDPVAMINPLNSLL
FT                   SYFLQLGNIDNFKHLLQSYSSELVNITDISLRSIVLGSQIETGFWIRNGVSTSRQASLY
FT                   FGTLMSEYAFMSDFHLNQIAVLFEDPEKVLMNFLERWGLYSWLKNEERFNETAYEERIF
FT                   SIVERFIAFVYNLFVDRSMLINEAPKDAALRKLNREIRYTLCEGAMSFSKLKRQIDIRL
FT                   ANLNEFEDVLYEVADYQPPSALVDTGLYRLREPMYEKLDPLNMSLDPGRFQVVLEVLIK
FT                   KISKSKKRKSEKCIVTPFIEKAGNDFIDENMGNFVKSLTFMKLNYKLTQVAIDTSDETY
FT                   LPHLLHLVHAIMLDDEMIHGKEYLNELFFDIPITDLLVTIVDSTMSKHVRQKADFLVEQ
FT                   MISKDKRIIESLVDCFGEEYIQRFKKRKNSLFESDAERKKRKAEKRKTSILKKFSQQQE
FT                   KFLTQNEDLQKNMPQTSAVPMEGEDSQRLRTCVACGELESFEKPLAIMAASIKAPVFWK
FT                   LPPESGEVVSNAFRTWDKNLLLDSKATEYGVGYDTVTKSALDTNQFESWVLSSCAHSIH
FT                   HSCLGRRIIGSSQYSCPLCHNLHDLIIPTILVNKDVDIPMEVLNGPPISLKYNQIVQSA
FT                   DSNIKLGHLLRVFLRPEYFTNRANTVELATLSEAPLIASSKMKYLHPGNNTSYARIFDQ
FT                   LMNWTIALADTIRMNEISTRLNGVDGYSGFLSQIPGSAKTLLICMIQLRLLNIASSLSP
FT                   LSTAESYNFEIEVNSFWDSDIILDGVFNEVLVLFFQTGESLATLTRMGMSKLFTIAVNS
FT                   LIARDQRDPIYFECIDTDSINQISDVSLEKFHDFFITVMLVNKCDVSVVDQSISLSVYF
FT                   AIEKILGIFLRQVVIFKDLLTCKQKGENDYESIPELSRLEEKIKLQDRLTDTKALTDAL
FT                   DVPSYDELIEMLLGSSDTLEGNVFNIISYAKMPKHFDKGILTLQYPGMVHLVNLPVDYN
FT                   TCIVGTSQIATRDNCKCLICGQWISAARNVAHMMTCASQIGILFNLKSNTLRICIYIGN
FT                   SPITIDLSAPYLTKHGEVKVVGEKGGATLSGYRFAHFNKLWVTQGLYGFVTRNLFGSGI
FT                   ALNDVTFDFDRNMPEADEDDDEAAFFEWDGQPIIM"
FT   CDS_pept        634292..635515
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581819"
FT                   /orf_name="CD36_42850"
FT                   /product="Cytoplasmic tyrosyl-tRNA synthetase, putative "
FT                   /function="ATP binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42162.1"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG330667"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015624"
FT                   /db_xref="UniParc:UPI000192DB59"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ3"
FT                   /transl_table=12
FT                   /translation="MTVLTDSAEQYKLITKGLQETLNGQIIKDVLEKENRPVKIYWGTA
FT                   PTGKPHCGYFVPMIKLAHFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYEFVVK
FT                   AILKSINVPIERLKFVVGSSYQKGGDYVMDLFKLSNIVSQNDAKRAGADVVKQVANPLL
FT                   SGLIYPLMQAIDEEHLGVDAQFGGVDQRKIFVLAEENLPSIGYKKRAHLMNPMVPGLGQ
FT                   GGKMSASDPNSKIDIIEDPKVVKKKVNSAYCAPGELKDNGLIAFIEYVIQPIAELKTGV
FT                   EGAFKLDIDRPEKYGGPLSYDSIEQLKADFVDGKLAPPDLKSGVADKINELLAPIRAEF
FT                   ESSEEFQVAQKNGYPVEKPKQEKKKKVKKIGTRYPGAAAGVDSADAPAASNADGKVNEK
FT                   KEEKSTKE"
FT   CDS_pept        complement(635656..636315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581820"
FT                   /orf_name="CD36_42860"
FT                   /product="Glutathione S-transferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="CAX42163.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192DB5A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ4"
FT                   /transl_table=12
FT                   /translation="MVKPIQLYTFATPNGFKASIFLEILGLAYETTVVDITKNESKSDW
FT                   FVKLNPNGRIPTIVDPNFKDGEITISQTGAILQYLADNYDKEHKYSYPFGTENYYKTLE
FT                   YLIFQVSENGPIQGQLNHFKLFAKEKIEYGITRYENDTKRIYGVYEDILSRNSANDSKY
FT                   LVGDRYTVADFALFGWAYCLPKVGIDIHDWPLLGKWFDTLNANPAVIKGVNVPEKK"
FT   CDS_pept        complement(637023..637727)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581821"
FT                   /orf_name="CD36_42870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42164.1"
FT                   /db_xref="HOGENOM:HBG397079"
FT                   /db_xref="UniParc:UPI000192DB5B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ5"
FT                   /transl_table=12
FT                   /translation="MIPPASNKNRFKQKWTKIKLRFRKNKNHEVDDQVTIVVRSSYDSY
FT                   SRCVGEKLPLDELTDIATQIHHQQTPPFKEKMTLETAKRIENKQEKPDQTVELSCSVIS
FT                   SPRQPQPQPQFQLESQQLPSYPPPKYQPRSIPQTIKYKSQLNQYLLEKANDPKPYTSIS
FT                   SYYMNLHNSFANYYLIVQNGSYQCVNYKSLEPEIEDSSRMFKCHYRYFYGFFVLYISIF
FT                   VIYIYVVTAQAI"
FT   tRNA            640079..640150
FT                   /gene_name="tRNA-Thr (TGT)"
FT   CDS_pept        640472..643162
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000206760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581822"
FT                   /orf_name="CD36_42880"
FT                   /product="Dynamin-like GTPase, mitochondrial, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAX42165.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG333387"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000192DB5C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ6"
FT                   /transl_table=12
FT                   /translation="MIPRNGRLIVRSRALPLRTFVLLRSSAYKTHIKNVSTFVPTRNLG
FT                   FLKFITRAVKMPAYIGGTMAAGGTYVAYKVEQASNYTQDKLSAFKDFADGVFDKTGDFF
FT                   KNLGGTDGATGGNGAEDGASSGGIGGGGGGSGGNDTATAVGATAAAVGLTSDEDESTEA
FT                   ETDIEEEDEETLIEDDSDDDDDLASDETDDHMLNLTRQMIEIRNLLSSLNHDGIKLPSI
FT                   VVIGSQSSGKSSVLESIVGQEFLPKGSNMVTRRPIELTLVNTPEAAANVAEFPALKMYN
FT                   LTDFQQVQKVLFDLNMAVPPSECISNDPIQVTIRSPTVPDLSLVDLPGYIQVEAADQPT
FT                   ELKNKIRELCNRYLEPPNVILAISAADVDLANSAALRASRLADPRGERTIGVVTKLDLV
FT                   DPEQARKILLNKKYPLRLGYVGVITKAPHSKATTSGLFSRKQVTGYQSFVAQQNFEHTF
FT                   LKENKDAFFGCTVGTRNLKKKLMKVLEKTMAASLRPTHLAIQQELEETSYQFKVEFNDR
FT                   PLTPQMYLANNIDMLKLGTKDLSHNFSRNELKAILKNALDQKVLDLMAERYWNKPFELK
FT                   GSLVEPDLRELTQINIDNDIYWHKKLDLTTSSLTKLGVGRLSTNLITNALLTEVDNLVD
FT                   NTQLRNHPMAKSAVREAARSVLGNKYYSTADQVENCIKPYKYEIELEDREWQTSKENAV
FT                   NLLKEEMRQCDEVYHDLKSQVGGRKLQQVVTYLERLKQQNDSDVDLTTNETLGFSPTLI
FT                   QRGKEAIFLKERMSLLKMRYQFVKNSKKCKKKENKYQCPEIFLDAVTSKITSTSILFLN
FT                   VELLSDFYYNFPRELDLKFFNNLSKEEIEKFAKEDPKIKKHIELQERKDLLENALSKVE
FT                   SVLAVQRTTQKDNTEDRNKKSVFGW"
FT   CDS_pept        complement(643271..645787)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537391"
FT                   /orf_name="CD36_42890"
FT                   /product="U3 snoRNP protein, putative "
FT                   /protein_id="CAX42166.1"
FT                   /db_xref="HOGENOM:HBG397078"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DB5D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ7"
FT                   /transl_table=12
FT                   /translation="MPSAISEWSLSMVTGGKPLYLPYSQATASVFSQDGRYVIMALSHQ
FT                   LRVYFISTRQCIKTIELDLQDLADLKIDVTNGNQVLLFKSSGEILTVNWKDKVSQPIIS
FT                   TTNINKTQSGTSLPLLSVISVKHLFFIIVTGRKEKKKGTPHTRYINYFDRNSESLVPIV
FT                   EVANSINFATSLDNTKIAFITSSNEINLFDLSGIFNVDSIENLSDNDIVKETIPFVYRS
FT                   PVTSIAVSNDSMVAIGTSAGPIQIVYGGLNTPKPQRVLKWHLDQVKGLMFTADNNYLLS
FT                   GGMEKVLVFWQLETEKKQFLPRLNGVIDKVSIDNYKDDYISLQLNVDSLNNNYEILVLS
FT                   AVDLVSRLSVNTIRPKFAHNIATTLSKTKKKFINSSSDFDKFKIRYDYTSQFEIHPKTK
FT                   SMYFPNGALIQSFDLFKNEQNFIQHGAPVLGIGKVRSETKLLDPSVTLLKFTHDGEWMC
FT                   TFDEFTNTEVDSLLLKNEKQYALKFWKYIGHKETTTSGINNKTGHWELTTKIIDPHGTN
FT                   PILAVIPAPTSYFNGLAFLTADDKGGLRIWRPSVPKEQYKTTSARSQQTAWTLRKVRAP
FT                   SALSSDAVALSWSDDSSLIFLGHECSILTIDSKNLEEIPDFKIPSLSGSRVRSLNIVNN
FT                   NLIVLSKTRISSFDLITGELTSLVAKVNTTIGAKNLITIDPIRKLVCLALNYYSDEDNS
FT                   LSIKSKILIFKPNQLKPVWVHLHDQGISSIRYFNSSFVFVDLDCRAGTIYSNEEITETV
FT                   EIGLTQEINNMLITAQATADVINDRNVKTTVGHQQNGNKEGEMDIDNSVAYSPKVVDLH
FT                   TFQPIFQNIEGVQVESLFERIVNVLK"
FT   CDS_pept        646073..646291
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000109502" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581823"
FT                   /orf_name="CD36_42900"
FT                   /product="DNA-directed RNA polymerases I/II/III subunit,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAX42167.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG391971"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="UniParc:UPI000004DE2E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ8"
FT                   /transl_table=12
FT                   /translation="MIIPIRCFSCGKVVGDKWQTYLDYLQDETLSEGDALDKLKLKRYC
FT                   CRRMVLTHVDLIEKFLRYNPLEKKDIN"
FT   CDS_pept        complement(646493..648235)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581824"
FT                   /orf_name="CD36_42910"
FT                   /product="Carboxypeptidase, putative "
FT                   /function="carboxypeptidase activity"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42168.1"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG324099"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI000192DB5E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WFZ9"
FT                   /transl_table=12
FT                   /translation="MIGLPLDENFRSNKRKSIIVGSVVFVALLVTLFSTNLFNYLKIIT
FT                   TPIPKESSLCPLYEPIAPESYYKDNSTVLQILHDKKYKKESIKKLAGAIQVDTQVFDKQ
FT                   PAVDDAPEVWAKFAKFHDYLEETFPLVYKNLKVTKVNTYGLVYHWKGSDKSLKPILLTA
FT                   HQDTVPVQKDTLKDWTYPPFEGHYDGEYIYGRGAADCKNVLIAILETLELLLSKGYEPK
FT                   RSILAAFGFDEEASGYHGAAYIGKYLEETFGKDSIYALIDEGAGLTVEELTNTIVALPG
FT                   TAEKGYVDIQVELTTPGGHSSIPPDHTSIGIISELGYVIEKDPYSPLLPPENPILNFAQ
FT                   CLALHDPKNNIPSSFKKTILRAGYDKFANSKLVEGISKNRLTKYLIRTSQALDIIKGGE
FT                   KANALPEHVKLLVNHRVAIGSSVAEVQEHFVSRVIEVAKRHDLSVTAFGKDVLKVENDS
FT                   GLFNVSNFAGFLNAAPVTPTNDTVWKYLSGVTRHVYEDLVFPEITYPVISAPAIMTGNT
FT                   DTRHYWNLTRNIFRFTPAFIGDFIGDTHIHSVDEKLPFDSHLQLQAWFYEYIQAIDTAK
FT                   ANNK"
FT   CDS_pept        651702..652583
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581825"
FT                   /gene_name="PGA54"
FT                   /orf_name="CD36_42920"
FT                   /product="GPI-anchored protein, putative "
FT                   /protein_id="CAX42169.1"
FT                   /db_xref="HOGENOM:HBG397077"
FT                   /db_xref="UniParc:UPI000192DB5F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG00"
FT                   /transl_table=12
FT                   /translation="MRSNYLLLLAATAVQAVPFIKRYENTTAPASQLSTSLADGSTTIL
FT                   ASSSSVEEDETITSTIVQYVTVTSSDTTYTSATNTLTSTLTTKPTPVITTEAEDEEDET
FT                   ITSTILQYITVTSSDTTYTSATNTLTSVLTTKAAASAQEVSENAKAASTKDNGETTTST
FT                   ITSVVTITDANGATEVLTEALAETSSDADASYCTPTTVTVTVTAEPTSEVVSTIVHTTQ
FT                   VPLTAEFTLDDTTTTLTSWVDLTSTDLVTITSTSSIHESYSTGASQSHPISSYSNYTIS
FT                   DYAPPISSYYSL"
FT   CDS_pept        653527..655926
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581826"
FT                   /orf_name="CD36_42930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42170.1"
FT                   /db_xref="HOGENOM:HBG397076"
FT                   /db_xref="UniParc:UPI000192DB60"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG01"
FT                   /transl_table=12
FT                   /translation="MSSRSNSPSKTLTESIEKSFSPIKINLTTTDDSPNKSIIHHKTPQ
FT                   RIIYHPHGLSAKHEARRNTIGYSNSIKRRGLVHTPLIPPGSIRNPITSPRLAVRPPINL
FT                   ESIKRTNQKMAQQIKLAFPANNDDDKENELHLDLSSDPDEDYSSPIKRHTRPRNDDDDD
FT                   DDNENSGHLSKIPKLAEPNEEKQRFPETVVNDDEEIESVEENNRSNLANEEQNDNDSDN
FT                   EDITKESHGSVMYQQNQTLDNTQINKIIREDLKLDYITPERATEAVAQSPHPHHQHIRL
FT                   IEEDKTEDFGKFNDTTSPLKKRNQDENEFDDETANLTLVRQLENEPTINFLMSPNSKPV
FT                   FSKDQVNKIQKEHDAKVDTLLQELNSRDDKIKELYDELAKVNEQLISSQKEQRALKDEK
FT                   SKLANSENLLTIQLQHNERELASLTKNFRLKESSLNNLKRKLNEQKISIDETRHENDTL
FT                   KSKINELQVLERDLKAEIVETSNSNIESTLKLDQVIKEKEELWIKNQELNEKLQSSEST
FT                   SSSKYDKLKDEYEDLQKENQDLVRNNKRLEADKLELEDKTKKLETVNQKLKDDNINNEN
FT                   LIKEYEKVATSRIEELESERDSTIEEISKYKQIVHDLETQVEKLKSQYDEKENTNKELE
FT                   LRIQELESKSVSDDELQELKRKLEAKDKDMESKEKTIEDYLSKMDDLVGHIKPLKKENE
FT                   ELKQDQQRLTQEVTSLKDKLEKSKIQADEDLDKLSKYLYAEYAAKHIKKLEGIIKENKK
FT                   LERELEFYKMKLEKANKDAELLSERNVSSSALSPKITAAPKNRGKH"
FT   CDS_pept        656693..657499
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581827"
FT                   /orf_name="CD36_42940"
FT                   /product="Transcription factor IIA (TFIIA) subunit alpha,
FT                   putative"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="CAX42171.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG737994"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR013028"
FT                   /db_xref="UniParc:UPI000192DB61"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG02"
FT                   /transl_table=12
FT                   /translation="MSNIETSKLYESVIEDVINDSRQDFENNGIDESTLQELRRIWCEK
FT                   LTQSGVAKFSWDEDEEEEEEEADVDVEVGQAAQQPEQQTESNDAGTSDSGATASGTSAV
FT                   NTSATVETNVKKETTSGNDLEVPDAQLSYNTTDNLGIEIPSISREKAADGDDHGLIVPK
FT                   IEQADGAVFFETKKSNKQLRQVDGESEFEEFESDGDLSDDINSELDSESDKEEDEEDEE
FT                   ETNFALCLFDKVQRIKNKWKSTLVAGIANINGKDYVFHKANGESEW"
FT   CDS_pept        658685..659662
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537392"
FT                   /gene_name="RBT7"
FT                   /orf_name="CD36_42950"
FT                   /product="T2 family ribonuclease, putative "
FT                   /function="RNA binding"
FT                   /function="ribonuclease T2 activity"
FT                   /protein_id="CAX42172.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0033897"
FT                   /db_xref="HOGENOM:HBG397075"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="UniParc:UPI000192DB62"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG03"
FT                   /transl_table=12
FT                   /translation="MLSQSLLLALAAAPFTLASPYYNPYFGKFFHGQRTSADSSSSGNF
FT                   YPVKDCSAFIDQNPEASWSCHNKSPVSSANSCCFEENGIILSTQFWDYNTTLLEIAVNG
FT                   STSDIVEAELKSKLDTVYNDLSRTFTIHGTWDDFCNGSYPQYCNKSLEVSDEKDNLTHI
FT                   LVDQFKEVELYNIMSKYWIDTIASNVDSSASTALWEHEYNKHGTCMTTLSPSCFTSSNY
FT                   TRFENIVNFYKKTVEIWSQLDTFEFLAAAGIYPTVSRKYKLSQVQEALQKAHGAEVYVG
FT                   CLNNSISEIWYFYNLQGSVLTGTYKPIDTTTNTKCEDEVWYIPK"
FT   CDS_pept        660999..666269
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231801"
FT                   /orf_name="CD36_42960"
FT                   /product="Phospholipid-transporting ATPase, putative
FT                   (Aminophospholipid translocase"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42173.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG676968"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192DBFF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG04"
FT                   /transl_table=12
FT                   /translation="MSDTQTSSSSNFSNSQTPIQNDLTSSVPSNDNSLKVPTPLNTRRK
FT                   RGLSLRSQLFNKAFNIQQQPLEQTQSSAPPLQSPELTNNLANETNTYPVSDHFQQNIEL
FT                   QNIPITPEINVYEAPEQFPTSIRSVANNDSNANYPSNLSRSTTHLTVETNGTSISTQSF
FT                   ISKREKSDWKRYGSKNRFYQILVDIKNKVFHIKYLPPTEEGRIIPLTVDPKSTNSYYQD
FT                   EYYDKKSKAYIDERSNEPYIDNMITSSKYTVYSFLPKQLRAQFSKVANCYFMVVAIMQM
FT                   IPGWSTTGHFTTIIPLCIFMSISIAREGFDDWKRHGHDKEENNKRTTVVREDEELSSFD
FT                   THSIATIMTETIPVADRLHTNNSNSNNNNNNNHLNKNSLNNLLAISSTSSLSDIEDSVS
FT                   KEDLCFTNSEMMRRYNLKEYTTRWKNVKVGDIVKINENEWFPSDVILIATSELETQEAF
FT                   VETMALDGETNLKQKSPHPEIAKKAATVTGLKNLHTLVTVEDPNKDLYNFEGSFILDGE
FT                   KHPLGPDNVVYRGSILRNTKSVLGLVVFTGEETKIRMNNIRNPRTKAPKLQKNINYIVI
FT                   FMVFVVIMLSAFSTMAQRLQFESYKNRAWYLYGQDAGVAATLMGFIIMYNTLIPLSLYV
FT                   TMEIIKVMQLCFLQYDIDMYHVETNTPADAKTATILEELGQVSYIFSDKTGTLTDNKMI
FT                   FRKFSVCGVSWLHDLDIMLNEKQEPNSQVTAPLVPRYSIHIQSPAATNKKSTNDRTSVE
FT                   STHRDSTTSIVRESMDISSPRASTAAWKSSAQPNKIQDLSNSLQLLRHIQSHPQTLFAK
FT                   KAKFFLLSIALCNTCLPKKKENESKCNSNNSTFSLEEIPTNEDPQDDGCITYQAASPDE
FT                   LALVQAARDLGFVVYDRQNSKLTIKTYPDGFNNEPKFEEYQVLDVIEFSSARKRMSIVV
FT                   RFPDNRICLFCKGADNVILEKLKNSKLAQAKAKEISLQSAERKTQEADVILQSRLSQEA
FT                   EARKSGLSFRHSMNLGSANSTRLNTIDNALMGTEEGEIADIALKARKSLHLQQSKKYNL
FT                   DSEEYEAGTEISPNVTAVGGVSSELPPHYIPNDKLLVNDEFLIEKTLEHIEEFSTEGLR
FT                   TLLYSFKWMDKKEYELWSQEYGEAKTALTDRSKLVEKVGAKVETNLQLLGATAIEDKLQ
FT                   DGVSEAIDKLRRAGIKLWMLTGDKRETAINIGYSCRLIKDYSTVVVLSNDEGRDALMDR
FT                   LISSTQEIKAGRVAHSVMVIDGGTLADVESDPTMLTSFLELCVEVDSTICCRASPSQKA
FT                   NMVTAIRNLKKDCVTLAIGDGANDIAMIQSADIGVGITGKEGLQAARSADYAIAQFRFL
FT                   LKLLLVNGRYNYVRTSKFVLCTFYKELLFYLTQCIYQRNTLFSGSSMYESWSLSMFNTL
FT                   FTSLPVICVGMFDKDLKPATLLAVPELYAKGRLYQAFNLKLFISWMVLATLQSVGISFL
FT                   TFYVWGFTALRDNTTFALGSLAFTVLVVVINAKCTLIEMQNRQWLAWASFIISVGGWGL
FT                   WNVLIMGLYRSKQPTIFFVDYGLIMWGRDQSWWATLLLMITIPLFFEILVKVFKFMFKP
FT                   NDDELFRVYEKDLELRRFFENSAFRELYQSWTFPHDQSTTKTQILKGLQKIGLKLGSTS
FT                   SNESLEDKLQANQNHYSSDDLQSAISRKRAGTNPLAHELPPSGEGVNVYSSDFKPQLQH
FT                   FENGYEILPSGKRVKIRDKSRGWSISKAFGKDEEEDVDAIIDERLNNLRNEEDGNSSLK
FT                   "
FT   CDS_pept        complement(666384..669083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248151" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231802"
FT                   /orf_name="CD36_42970"
FT                   /product="Checkpoint serine/threonine-protein kinase,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="cell cycle checkpoint"
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42174.1"
FT                   /db_xref="GO:0000075"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397074"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012572"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192DC00"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG05"
FT                   /transl_table=12
FT                   /translation="MAIQKSPQIANMQLLEQQKENIQPLSGGRSATKLTKTLSSRPNSA
FT                   SAINYQDHRTKLEKEREELEQKLLDSDELDDPLQVYIEYINWVHYNFPQGANADSGLVI
FT                   LLEKCTSKFRDVSHYKNDPRYLKIWLEYTNYSDSPRDIYVYLAKKEIGNQLALYYEEFA
FT                   RYLEAQKKYTDASQIYELGIQSNAFPLKRLQRSYENFKDRLQLELNSVSTTSELVREAL
FT                   KVKRGSSVYPSTHVEQGPVPKKPKLEVFKDDDDQNQSVLHLIFGTGLNDDIKLNSTKQR
FT                   IKENTITATSWKGQVLKQKVPTPPNSSGGKIQVFRDFESLAFQAKKSVCYDDKGRAYTL
FT                   IENSGKKPERVLVNMDLVYPDESQEFGMIELLAISRRSERRKQPNPPHQHHTVVDEDTR
FT                   TITLALNNSSTIKSRDVDPTITMNGNIAHNELQGIYNELGYDYNFDDEEEKLQEPTVTN
FT                   YEGYVTETINTHAANANLIPTQVDSPQVDQVATPPTDREEDFDDRVLSSPFVEQPMAST
FT                   QSVDPFDTSLQESFLDNLSIPMSTYSGYYDKSTTKVDRIRKFREITNKNQTINRGSSSA
FT                   IIDYCGQELYCLLHELGQGGYGFVYLIEAGSNGKLKALKIETPSSRWEFYILHQIHRRL
FT                   LGEAGYKQRYFIRAEALYYFQDESFLILDYCSQSTLLDVVNNYKNKGSSLEECLVIFFT
FT                   VELLKALEALHSVGILHGDLKADNCMVRFEPINETEWSERYDRSGKFGWSHKSITLIDF
FT                   GRAVDMTLFSPGTRFVSSFKADEQDCPQMNNGTPWSYEADYYGLATIIHTLLFGSYIKI
FT                   KKDSDRIKLNANFKRYWQHELWQDLFELLLNPYSSTEVTHAPRTESLTTIREHFEEWLE
FT                   NNSKMKYLKGLIKMVEGELNSINRARVN"
FT   CDS_pept        669468..671339
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231803"
FT                   /orf_name="CD36_42980"
FT                   /product="GPI transamidase component, putative "
FT                   /cellular_component="GPI-anchor transamidase complex "
FT                   /protein_id="CAX42175.1"
FT                   /db_xref="GO:0042765"
FT                   /db_xref="HOGENOM:HBG603351"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniParc:UPI000192DC01"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG06"
FT                   /transl_table=12
FT                   /translation="MNLSILLVSLFLSFACADESKPTSEFHEHLHLKPLSRNRLLTNFE
FT                   FDVESSPFQIDYYNSSSPIEVSRRSHYNYFPNSLGLIIESTNTKELQLKFTQGWWDASS
FT                   WGQLPFNGKYSGGTGVEVSAVIEAPNVEAAKRNWLKLTKTLSGFFCASLNFIDDRITTY
FT                   PKHAVKEINLDQYAPEEGNRLYLLRAALPSEPVCTENLTPFLKLLPTRGKSGIASLLDG
FT                   HKVFDSLWHGMSIDVTTNCDVNNQCTLKLHQTVNQVVDIIRSLRKRKEGAIPKPTPGGQ
FT                   LRCDTEKTYNSWQCFPLSDPVNIEWNLETIYGRGINGPALADDPHVSKVTIDVDPTSWN
FT                   IMLLREKESSIEGDSLSNQEGTNQIVQYLHENVKFDFQFIAQNSSIVLPVDTPPLYASR
FT                   SLTGYSLDKGGLRTVFTNNDDKPVEFVYFESTPWFMRLYLHTLKLTLKNSTGLFDVFNH
FT                   EQYIKNIYFRPAVDRERPSHMELMMEVPAKSTLAISYDFDKSLLLYREYPPDANHGFDV
FT                   EPAVISVFNNDNEKVYEFRTTSLLLTLPTPDFSMPYNVIIMTCTVLSMVFGTIFNLLTK
FT                   KVVTEEEFEEIAANTKLAKLKRGIKSTIQQLKGQKKQRNLQTETSKQ"
FT   CDS_pept        complement(671411..672307)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581828"
FT                   /orf_name="CD36_42990"
FT                   /product="Subunit of Elongator complex, putative (Elongator
FT                   complex protein 5"
FT                   /protein_id="CAX42176.1"
FT                   /db_xref="HOGENOM:HBG397073"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniParc:UPI000192DC02"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG07"
FT                   /transl_table=12
FT                   /translation="MASTSQNATVLLTRLLSLKENSSFHLILDSLTQSSYYLIQEYVHR
FT                   CSKTTSKIIYLSFETINEPDYCNEFIDCSAMTLLQIIEKVKPLRESNERLLIIVDSLNY
FT                   VNNDELAHFVAQLVGPTITLVGVYHTQCTTSLSKYPNYPSSETLLTYIASTIFELYPLI
FT                   PDSLDEEELEAKVKNLTFPINTNLNSSIFKVILTNRRKSGRSLTYALTINSLSHEYELW
FT                   KDKQDSEETLQEDESLLKDLTTFNLTTSSKQKLAREQVELPFLQAQESLGAAGGAIVYE
FT                   FEKDDDYDEEDPYEDPF"
FT   CDS_pept        672516..675803
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581829"
FT                   /orf_name="CD36_43000"
FT                   /product="U2 snRNP-associated splicing factor, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42177.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG330902"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DC03"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG08"
FT                   /transl_table=12
FT                   /translation="MKQNMAPIERKRNLAGNYSIPESLNKELRKEFAEDVSTPMDKLQD
FT                   DIINQNNYNKKRFQRSIVLDLDEQKSYKQIMNERNLEREELRVEKLIKEKGEGATQTIE
FT                   STQEKLLPRKRKQRWDVSPEEYKRQKESEESNELVKHSTSSLIAELVQGKVPVVKGIPL
FT                   TDSILEKILPPGYIKVNPPAHFKQNEETLPPDLSDAVTTTSEYYLPPTNESVSISTTEI
FT                   PTDVPGVKGLEFFKEEDMKHFGKLVHSNPESLNDEEKKELNAMKLVLKIKNGSPITRKR
FT                   AMKQLTNNALRFGPKVLLNQILPILLEPNLTPQERHLLIKMIGRIIYQLDELIRPYTSK
FT                   VLTVISPFLIDEDPTVRLETREIISGLTKAVGLANIISTLRPDLDHVDEYVRNLTARIF
FT                   AIVANTLGLKSFLPFLKAVIKSKRNWTARHTGIKIIQQLCIMLGQGNGTTILPYLSNIV
FT                   EILKPPINDESLQVRTITALTLAQLADNVSPYGIDSFEPILEPVWFGIRKHRGKGLASF
FT                   LKCIGAMIPLMSYDPNYEDYTNYYTTELMHIITREFKSPDEDMRKTILRIIMGLPLSRK
FT                   LIPGYEKSIVKPFVNAFWNRRTASDSTQITRLVVEATNHLAIKFDFLDMLEHIVYFTKD
FT                   DNEQLRKLAIEAVNKLISNNRQELIGMDSQLDRKLVDGVLFAFQKQTQHQKIYLTCFGT
FT                   LADALNVRLKPHLNSILSTILYRMKNKLAEIRQQASDLIAIIAPVIKQCSEHDDELLMK
FT                   LILILYESLGEVYPEVLGSILNALYSCLDSIDKATLYTMSNPSINQILPTLTPILKNRH
FT                   EKVQEACIKLVGLIARKNSETINAKEWMRICFDLLEMLKAQRKRIRIAANSTFGYIAKT
FT                   IGPQDVIVMLLNNLRVQERQLRVCTAVAMGIVAETCLPFTVLPAIMNEYRIPEKNVQNG
FT                   VLKAMSFMFEYLDGKITKDYLFAITPLLEDALTDRDLVHRQTAATVIFHIAINCIGLAD
FT                   NDYSDVFIHYLNLIMPNVFETSPHVISRILESIDALRLVIGNGTFTNYVWSGLFHPARK
FT                   VRTPYWKIFNNAYVQCSDALVPCYPRIENLPDDKELSYKLEELDLFL"
FT   CDS_pept        complement(675938..676951)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231804"
FT                   /orf_name="CD36_43010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42178.1"
FT                   /db_xref="HOGENOM:HBG397072"
FT                   /db_xref="UniParc:UPI000192DC04"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG09"
FT                   /transl_table=12
FT                   /translation="MDDKTKRQQSILHPLANNNQLLVKTVDTNNTANNNCNSNNSSILS
FT                   SSINPQQQQPKRSIPKNVAYPPMYSFNISTANTLKNGVSTKKVTSGLPVAPDGYIYVKG
FT                   YGSGSVADHIPRNIPSYYPRRGTSITNNYTESSAVTPTPLHIPRPLAPPHLLQPPNSHQ
FT                   QLQHPQQQHDSGETTVSPTLEVFNTLNPRKAPNMTYKEKIMNWMSSIPQFNDSENNEIY
FT                   IDCYPGVISTSVTPSTSDEEIDLADIEDILELQARKVTRYVTRLYIRESENWEEIPAED
FT                   GDGDFDGRAEYEVEDGDDDVDDDDVDDDVVDYDEDKVQVRNYVYRNANLNIAYETD"
FT   CDS_pept        677635..678657
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537393"
FT                   /orf_name="CD36_43020"
FT                   /product="Non-structural maintenance of chromosome protein,
FT                   putative"
FT                   /protein_id="CAX42179.1"
FT                   /db_xref="HOGENOM:HBG397071"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI000192DC05"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG10"
FT                   /transl_table=12
FT                   /translation="MSSLKRKIPLDEIEDFIAEEEEEEEEEEDGGLYEEDNEYVEPSGT
FT                   ATPLDESEIQHVVNQVVRLFLSRELNGRTTRPDVIRKHIKHNLGRKITTEKLIQQANII
FT                   LTEVYGLKIEEVPTIKQEDKKSLKSRKVASDRNPYMVTSALSSKSRAILGELWNQNLSQ
FT                   SVKKIDIGGNKFFLPKYSITSIPGSHYELVKTGIMLVIISLIILNENHVSESALLKNLH
FT                   KFGISSNLNVKNSNFNLNSQDLLKELVNKDYILKNVIKGRSESENIFDYSIGQRSLVEF
FT                   SPQGVFDYIKIIYGSKFDSTIAERALVTIERAYGVALHNAEENNEREGSTEANSQDGSE
FT                   "
FT   CDS_pept        680195..682237
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581830"
FT                   /gene_name="NCP1"
FT                   /orf_name="CD36_43030"
FT                   /product="NADPH-dependent cytochrome P450 reductase,
FT                   putative"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42180.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023208"
FT                   /db_xref="UniParc:UPI000192DC06"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG11"
FT                   /transl_table=12
FT                   /translation="MALDKLDLYVIVTLVLAVAAYFAKNQFLTKPQDTGFLSNEGTGGN
FT                   SRNILETLKKNNKNTLLLFGSQTGTAEDYANKLSRELHSRFGLSTMVADFADYDFDNFG
FT                   DISNDILVFFIVATYGEGEPTDNADEFHTWLTDEADTLSTLRFTVFGLGNSTYEFYNAI
FT                   GRKFDQLLEEKGGERFAEYGEGDDGTGTLDEDFLSWKDGVFDSLKNNLNYEEKELKYEP
FT                   NVKLTERDDLTVDDSNVSLGEPNKKYINSQGADLTKGPFDHTHPYLAKITKTKELFNSK
FT                   DRNCVHIEFDISDSNLKYSTGDHLAVWPSNSDENIKQFLKCFGLENKENTVIELKALDS
FT                   TYSIPFPSPITYGAVIRHHLEISGPISRQLFLSIAGFAPNEETKATLTRIGNDKKEFAS
FT                   TITRRKFNIADALLFASKGEAWVDVPFEFIIENVQHLTPRYYSISSSSLSEKQLINITA
FT                   VVEAEVESDGRAVTGVVTNLLKNIEIEQNNTNEKPLVHYDLNGPRSKFSKFKLPVHVRR
FT                   SNFKLPKNTTTPVILIGPGTGVAPLRGFVRERVQQVKNGVNVGKTILFYGCRNEHDDFL
FT                   YKQEWSEYASVLGDKFQMFNAFSRQDPSKKVYVQDKIVENYKTVNELLNNGATIYVCGD
FT                   ASRMARDVQAAIAKIVAKDRNITQESATELVKSWKVQNRYQEDVW"
FT   CDS_pept        683213..684556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384664"
FT                   /orf_name="CD36_43040"
FT                   /product="NADH:ubiquinone oxidoreductase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42181.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397064"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000192DC07"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG12"
FT                   /transl_table=12
FT                   /translation="MADLTEQLPKGYDDLSTPTIFNDRNLHPIAKSFTTNILIVGGAYS
FT                   GLSALRSLQLRLDEQIELFKQKQPSSPARKLSLTIVEPRNGLLNILGIPKSIVDSAFAK
FT                   TQFVPFKDLHNCQFTNIFSDSQDEYDISWFGNDNEWLDINYVHGRVTYLDQHKAQYTLG
FT                   SPASEKAIIEFDYVILATGRDRNWPTTPSATTYRQYMLEMDNTRQEIANADTISVIGAG
FT                   AVGIEFAGDIQTEFPHKTVNLIHPHECFPQEPLSNEFKKLTQDSLERAGINVYLNTRIK
FT                   PELTEKRHGDLATTNNKIIHSNLNIWSCSKHNNIGFLSQHICENYATSTKNLSVNQYLQ
FT                   LYSPETNTTIKNFFVLGDLVELPIIKSAGWAMYMGRQVANNLSHLIFNGVFVEPFPDLN
FT                   AIPYGMVIVGGNNEIISELAGEVEVDNEHYKQEYEDYCIGKIRATIDM"
FT   CDS_pept        complement(684756..685631)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231805"
FT                   /orf_name="CD36_43050"
FT                   /product="Mitochondrial hydroxyacyl-thioester dehydratase,
FT                   putative"
FT                   /protein_id="CAX42182.1"
FT                   /db_xref="HOGENOM:HBG397065"
FT                   /db_xref="UniParc:UPI000192DCB8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG13"
FT                   /transl_table=12
FT                   /translation="MITPITKECIYKWANIVKSKPMMIKDTFSIGKYNNLTNLLNSILQ
FT                   INHHPPINKSWFQGFHFLFNNQLNIKLGSDGYDNYQAPVNEQGEQLYLRRMWARGELDF
FT                   VSTPPLNSPIDCRESLKSVRIIDESVLVSIWRNFIFQSEEVLKESRTLTYTNELYSPVE
FT                   NYKLAESVSSNGPSFHVSSIDLLKYSMLTYNLHKIHIDANYCRSIENLPNMIVHGPLQV
FT                   TLLLYWFAITYPDLKPVNFKYRTYAPMFVNDETSISIESKSNNSFTLEIYNQESKKLYL
FT                   RGDLTATLST"
FT   CDS_pept        685861..686823
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231806"
FT                   /orf_name="CD36_43060"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAX42183.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000192DCB9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG14"
FT                   /transl_table=12
FT                   /translation="MYIRDRTISSHHPFYTTEDLLHRYTIMSTSEALKNIKNKQRRQKV
FT                   FAEIKHEKNKQRHKQRAERAKEERDNPELREERIAANIPDTIDSKRIYDETIAAEVEGD
FT                   DEFQSYFTNLLEEPKILLTTNANAKKPAYEFADMIMDFLPNVTFIKRKKEYTMQDMAKY
FT                   CSNRGFTALIVINEDKKKVNGITLINLPEGPTFYFSVSSIVDGKRIKGHGKAGDYLPEI
FT                   VLNNFNSRLGKTVGRLFQSIFPHKPELQGRQVITLHNQRDYIFFRRHRYIFRNEEKVGL
FT                   QELGPQFTLKLRRMQKGVRGDIVWEHRPDMERDKKKFYL"
FT   CDS_pept        687601..691338
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080467"
FT                   /orf_name="CD36_43070"
FT                   /product="Karyopherin, putative"
FT                   /function="binding"
FT                   /protein_id="CAX42184.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397066"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DCBA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG15"
FT                   /transl_table=12
FT                   /translation="MTMDSGGVQQIVSALQIVYDPKSTNDRRREAQTFLDTIKTNEESP
FT                   FWGYQLALPENNGDNYIVRYFGLSLLQQSITTNFHTFDQAKTAAVKQWIIDLSTKVEPS
FT                   DPHYIKEKIALLWVSIAKRVWGNHLIKSRDSHHNSVDENTTISTNLENNNKSSVSLTEQ
FT                   ESVDGWVSMDADLLKLWNNNITCRELSLIVIRTLFEDIYLLDDPISSKRSTLLNQLSIL
FT                   IVTPQSVLESMYENNPNVTICKASADGWFITWSRYLVELLTNNDYKDKICQTFVPKILS
FT                   AFKTCLHWINPSVLRQENIMQTLIGILTIPDVPMKILAVDCLHILFTRTYTQPEDFDFF
FT                   IGSVFTSEGITKLSEFYHSLHLDPDDVDETVYSLLKKTVEMIVSLSEYLNIASRNKVSW
FT                   ESSDVDSYLKLVLETTSHPSLIISGLSLQMWITILRFDELSAKPQFVKLMPDLLEIAAN
FT                   RTINYTYDENNISKKFLDVDFDSTPDANSFLQNYRKFNEDITRITVCKDPENGLAWLEN
FT                   RLQVFFSSELGNRCVSEFKLGEKSEEFNYGSSQLSTIDYTLRGVTRWNEWYNREDKNTI
FT                   KERLNKLVESLCERLLAMNFASPLLVRKQMQTLVHFAPLLKDVNPPLMFRALEKILTTA
FT                   TYPYPPNVSDEDMELIRDLRGSCGTELNRYAYMMPEGLSKIFTDLENAIANILSAKKVS
FT                   DHENVALKSFLLVIAFRSSIGNKDEIFAKIVDPDLAAWSAPETEKGLMDLHWFMERIGI
FT                   VEIASYFQSRGITATTNLLEAKMDEEGKLLKTKLKDHWSSIFPIRATRIFIQYSIEKLN
FT                   HNSPEYLHLLKLWKPRIQPIVPHILQLLTQIQAYHDPQNWKDLPIEVQSFVKESCTERF
FT                   WQQGVSIQSKETFMEENVKAALTLRDFADSVGHLIRYTREYAFLTVGSIAQLEDTLYEI
FT                   PGIASMIWKAVAGDTIGVTLHSWKHMINSCLRVVIKFCPVKYVEVFMSELLPAVFLDLD
FT                   KLLVDRWTKINGNGIQLQGNEDDETLSEEMMEEHMLRQLTATVVRLLMDVVGQYNARPA
FT                   TDTQFACKKLVAENKEVLAPFLQICCHLFLFKDTKCSFNTILVIRNILPEVLLKDDEVD
FT                   KYLSDHLIKSLLEVLLDDYFAETHSEAAIALTTLYCALRSKNDYPARILIQNLQNINTR
FT                   DISNFESQLVNSKSLRHQRGALIDLVRRSKNQEVDEMTKRKKELEAVSIANRKKRNGGV
FT                   DVMNDPYTENGALGQLFGED"
FT   CDS_pept        691731..694382
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231807"
FT                   /orf_name="CD36_43080"
FT                   /product="DNA repair protein, putative "
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX42185.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG397067"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR022039"
FT                   /db_xref="InterPro:IPR022040"
FT                   /db_xref="UniParc:UPI000192DCBB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG16"
FT                   /transl_table=12
FT                   /translation="MPITSLESYLFERKLAHTSSIEILENAVIGIDVEHYLSRIYTFKK
FT                   EQFLPAIGGAPSSLRDYIKSDLKVFQEFNIKPIFVISGLQTQLQQKYKNDLNEFDTQHV
FT                   ENIWNKINTKDPYSHGSHHQHPHFHNAIIENFRNLNESLPIYSMINYIIKFFLEFDIDY
FT                   MISPYDASFQLSYFYQRGVIDSVYGSTDLLLTKIDKFILGMEFQSKDFKFVNKSKVLKA
FT                   LNLNEQQFLDLCIIVGCGIQPETFPLFPALSNKPPSGGSVSSSSSTSSFGMGSSAVVSG
FT                   GAGGTVVGPGAGSQLNYFKIGLDTLYQYAQFSGDNSSLLGYIISLNNPKLLDLYYKGVC
FT                   SIRYIPILNQEGYVELYHAAMAKLGLSENIDYLHEEEEDVGGEVQEEKQEGKIGNAEGK
FT                   PTKQETGQEGDASDERSSIDSSISHRSVRIPNDVHEIISQRLPPELYFYQSMGLLPLSL
FT                   LGSIVKGELEIRPPIEGSTGSKSNESYKNLITSKFYEELLDSQFNLLTQFLARYYQVKK
FT                   IRVKYWFKNDILELNNRFTPPISKKLNKFILANDGNGENFVINRFFQSRLDGEYTSTKT
FT                   VETKDDIISTVLLRVLHLYGIVNEKSELLTIGRILVEFAKSADNEVSQEEVEHIILLVL
FT                   LLNSKVLTLNEPSKEYTDVSNYYKTSMLNQQQNPNQFSKQGLTADVIKKITLISRIFSF
FT                   KKLNVSPINYQGPISRSLLNFRSHVEFINHNLINTLQLVLIDFVVRQEQNNIKTEYETK
FT                   DDWYKLIDQLPFYKGLDNTLMGVISEIYFEMAIKQKQEQPQLTKQEIIKNCQNHLSEHI
FT                   FLVNIPSFNINVNGVNSTSRSQLIDDFKGGVEWWKKFIILIDIINKTDKKLVDDNLYRE
FT                   IKQTDEFLKEFV"
FT   CDS_pept        702259..703371
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231808"
FT                   /orf_name="CD36_43090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42186.1"
FT                   /db_xref="HOGENOM:HBG397068"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="UniParc:UPI000192DCBC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG17"
FT                   /transl_table=12
FT                   /translation="MLSTCRNNPIVAKSFKYSSLTKSSIRQIITSTTNNQQTILNSDTI
FT                   IIDKPLVTGSGPFVEVPKFKPIGNPANFLQVVLPQSSKLNVRSISSSIIAIDNSSTKQK
FT                   QDNEAFVVTNKHSVIDYQEIYSKCSLNLIIQGNNENNFKLLELKNQQSQIQDDWIILQE
FT                   SNLIGWIDKFKLNIESIDLLEKFSSLKINGNGYILIDGGSNEVYELNLHENEDMLVNLN
FT                   SLIAINKPSSSITTDLKYQVIPYFYNITNPINSLVRIPKFSIPKYGIASELFNPIRKSM
FT                   NTFTSNYKNFVQNIRNEANKYHWLKIIRATTIKIYQCIYSKLFYNSEGVLLRRNPIFMK
FT                   IKGPAKLIMNNNETINNNRLFTYKEIKSIN"
FT   CDS_pept        704289..705374
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080468"
FT                   /orf_name="CD36_43100"
FT                   /product="Inositol-pentakisphosphate 2-kinase, putative "
FT                   /function="ATP binding"
FT                   /function="inositol pentakisphosphate 2-kinase activity "
FT                   /protein_id="CAX42187.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0035299"
FT                   /db_xref="HOGENOM:HBG397069"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniParc:UPI000192DCBD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG18"
FT                   /transl_table=12
FT                   /translation="MEISKITSPDDWEYFAKGAANILFKYTGNNDYLKRKLLRLRLLKQ
FT                   EEEYISTCELYDFIELRCKDLFPNQIIDIQLTVLDSNFTNKLNSQGNKLMLNERYGLLL
FT                   PNILDGDYRKISLSHKCQLYFNDNHQDINSVIFEIKPKWLYDNYTDNYCRTCSLNQLKK
FT                   VPRHFCPLDLLYTETIDQGLNDLFAPIPQDIYAKIEKLIPLKKLTTIYFNNPDNVFQKL
FT                   KQYQKINNKNDLIKNLTSSSDVSQNLSLVMTLRDVGLFIKIEKFDKNNHIHTSHNNIKN
FT                   VYRINDNESNGTKDQDQEIGTNDQEDNDEKFLITCNIYDLDLKSKMKYKHWLKVENDLQ
FT                   EIYNSSNPNWRYCIKYDQIQH"
FT   CDS_pept        complement(705639..706862)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231809"
FT                   /orf_name="CD36_43110"
FT                   /product="Oxidoreductase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42188.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397064"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000192DCBE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG19"
FT                   /transl_table=12
FT                   /translation="MASKVVIIGGSYAGLAALNTLKSLITKNLSTISKPISITLIEPKS
FT                   GFLNILGLPKSIVNKDFASKQYVPFCDFLKFDNVISTSNDLKLQLTRNTNTDNNNLVLN
FT                   YIQGKVTKLASNKISYSINDIDESSIEYDYAILATGRNRNWPVNPMASTFELYLNEIEF
FT                   TNNKIEESPIISIIGGGAVGIELAAEIKLHYPNKIVNLIHPHGTLPPEPISETFKNKTL
FT                   QSLKLANINVFLNTRIDTLKATAAENDRGTYNLKTTDGRTIESNLNIWATSFRNNLDYL
FT                   SPDLDIRITANHNIQTNDYLQIPNIPNIYAVGDLIELSTIKSAGWAFHTGIQAGTNVYN
FT                   SIVENPLQLSRIPFDQIDSHKLTIVGGEGKIIHEVKRNLEINPISMVQEYQDYRLATCK
FT                   RFIGAVVK"
FT   CDS_pept        complement(707291..708634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581831"
FT                   /orf_name="CD36_43120"
FT                   /product="NADH:ubiquinone oxidoreductase "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42189.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397064"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000192DCBF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG20"
FT                   /transl_table=12
FT                   /translation="MADLTEQLPKGYDDLSTPTIFNDRNLHPIAKSFTTNILIVGGAYS
FT                   GLSALRSLQLRLDEQIELFKQKQPSSPARKLSLTIVEPRNGLLNILGIPKSIVDSAFAK
FT                   TQFVPFKDLHNCQFTNIFSDSQDEYDISWFGNDNEWLDINYVHGRVTYLDQHKAQYTLG
FT                   SPASEKAIIEFDYVILATGRDRNWPTTPSATTYRQYMLEMDNTRQEITNADTISVIGAG
FT                   AVGIEFAGDIKTEFPHKTVNLIHPHECFPQEPLSNEFKKLTQDSLERAGINVYLNTRIK
FT                   PELIEKRHGDLATTNNKIIHSNLNIWSCSKHNNIGFLSQHICENYVTSTKNLSVNQYLQ
FT                   LYSPETNTTIKNFFVLGDLVELPIIKSAGWAMYMGRQVANNLSHLIFNGVFVEPFPDLN
FT                   AIPYGMVIVGGNNEIISELAGEVEVDNEHYKQEYEDYCIGKIRATIDM"
FT   CDS_pept        complement(709026..711155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209413" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581832"
FT                   /orf_name="CD36_43130"
FT                   /product="Vacuolar transporter chaperone, putative "
FT                   /protein_id="CAX42190.1"
FT                   /db_xref="HOGENOM:HBG333008"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniParc:UPI000192DCC0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG21"
FT                   /transl_table=12
FT                   /translation="MKFGEHLRKALIKNYSFYYIAYDDLKHQLKKGLYDNDGVWNNDLE
FT                   EQFLNALETELDKVYSFTKVKNTEVNRRIKENESYVYEVVDALHRYENHDPSITNPPSE
FT                   EDFQDLEEELSDIIADVHDLAKFTRLNYTGFQKIIKKHDKTTKFTLKPVFQARLNTKAF
FT                   YKDNYDNLIVKLSKLYDLVRTRGNPVKGDSAAGGGQQNFVRQTTKYWVHPDNITELKLI
FT                   ILKHLPVLVFNADKEFEPEDSAITSIYFDNKDMDLYYGRLRKDEGAEAIRLRWYGGMKS
FT                   DQIFVERKTHREDWTGEKSVKARFALKEKKVNQFLSGEFTASQVFEKMRKEGKKSPQEI
FT                   DNLERLAKECQYRILKEKYRPVMRSFYNRTAFQLPGDARVRISLDTELTMVREDNFDGY
FT                   DRTHGNWRRMDIGVDYPFPQLPEKDVCRFPYAVLEVKLQTQLGQEPPAWVRDLVTSHLV
FT                   EAVPKFSKFIHGGATLLTDYVNLLPFWYTQMDVDIRKPKIQQEYGIRRNAPSRIESSTS
FT                   ANELDEEELSGYSGSGVQFSNDVNPLEEDLEETSPLLFQNSHRSRHGNSLLNQLKNYFK
FT                   DDREFTVKEGTNFDLNGTFKDKLPKGKSICVPIRIEPKVYLANERTFLSWLSVGMLIGG
FT                   VATALLNYGSNSTLTASIGFFIAALFIIGYSTYRYLWRVLMIREKKAVEYGDKFGPNMI
FT                   CGVIFLAIFINYLVL"
FT   CDS_pept        complement(711971..712429)
FT                   /pseudo
FT                   /gene_family="HOG000146797" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(713078..714229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581833"
FT                   /orf_name="CD36_43150"
FT                   /product="D-amino acid oxidase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAX42192.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG735740"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniParc:UPI000192DCC1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG22"
FT                   /transl_table=12
FT                   /translation="MIEKPHIVIAGAGILGLTTAWVIAENLSACNTPYEITIVAEYGPH
FT                   SPTMNANLTNSAKYTSPWAGAHFRPFPSKNEQELKEMKLTRLTLQKFKQLSQTSPESSI
FT                   KFVKGIEYLETPDEYYSKFAYGWSEEIGNFKPKTDKPGFLGVEYDTWVVNSPMYLQFLY
FT                   RKLSIEYSNINFLKIRLDSLKQINDLFPKAVSKTPPIIINCTGNGLQYNGGFDPECYPI
FT                   RGQTLLIKPPSHENETNQKCQYLDKTITYQLKDGSWSFVIPRPFNGGVILGGMKQIGDS
FT                   FLGINESDTEQLIEMGKKYFPDLMTQDVNVNNGKPFFEILRVNVGLRPARKSGLNLNVE
FT                   KHENKQFVINNYGAGGMGYELSYGAAVKVYEKLMEILGRRHHL"
FT   CDS_pept        715030..715737
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537394"
FT                   /gene_name="CSH3"
FT                   /orf_name="CD36_43160"
FT                   /product="Endoplasmic reticulum packaging chaperone,
FT                   putative"
FT                   /protein_id="CAX42193.1"
FT                   /db_xref="HOGENOM:HBG397062"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniParc:UPI000192DCC2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG23"
FT                   /transl_table=12
FT                   /translation="MMAYKDIVPIGTSLIIGSTCFGLGIIYGNWPYDVNTLWIHDVPEA
FT                   FDASLRHYQQWGNSPMYIHYTLHAVGLLGLLGHFIKLYKPDEDAKYFEYGSLGLFMVGV
FT                   VIYLTNLRTGVNSCIVGEWGDVDYQTGINVMAASQVMIIFVLLGVLLLQGGLYYAQWYD
FT                   NKLKEEFYRQEANEAALAAETQAKQEHDIATKGKKDKAQPQVEQIEEAASTAATTGASA
FT                   TKGQKKTTKKRKS"
FT   CDS_pept        join(715999..716055,716338..716532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173723" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581834"
FT                   /orf_name="CD36_43170"
FT                   /product="NADH-ubiquinone oxidoreductase subunit, putative "
FT                   /protein_id="CAX42194.1"
FT                   /db_xref="HOGENOM:HBG332619"
FT                   /db_xref="UniParc:UPI000192DCC3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG24"
FT                   /transl_table=12
FT                   /translation="MSEEKVWGDKPVYFKQPFRWIRYHAHVNPALFVSVALGVSAPLVL
FT                   LLTPLRRKYLYADHEPIPQVYPLPQRPRDKNLTGFDDE"
FT   CDS_pept        716933..717808
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581835"
FT                   /orf_name="CD36_43180"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAX42195.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG397061"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="UniParc:UPI000192DCC4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG25"
FT                   /transl_table=12
FT                   /translation="MNKFCIITRSLFRPSRHIGVSIPIQRFFSTTSPRLSNLLGEVTKI
FT                   DSEPESPITTNSKSTSSSDDTKDISKITPENDEELIEYHAKNAESKQFKIENYIHPLKL
FT                   QLYNENVSQFGFFKNGQIMKHNGKKLRFTLTSQEIDILEPSIYLTSYRIKSSMKKATIV
FT                   NRMVRKFNVKLAINQLHFNHKKISTELEQLLKRGLEQAKQLELNEDELYIDRLWVGSDG
FT                   KWRKRLDPKGRGRMGIIAHRYVHLKCILKTNQTKLRLDWEKQQKELKSKPRMFLNDEPL
FT                   NLKVRPWYKW"
FT   CDS_pept        721667..722458
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581836"
FT                   /orf_name="CD36_43220"
FT                   /product="Yippee-like zinc-binding protein, putative "
FT                   /protein_id="CAX42196.1"
FT                   /db_xref="HOGENOM:HBG397059"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI000192DD7B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG26"
FT                   /transl_table=12
FT                   /translation="MGLKCTNYFENSKYDSPNIQIITCKGCSSHLCLSDLILSDNFNGA
FT                   SGPAYLVEDLINIEFNLQSEETPMKTGVYKINKVKCHQCKNQLGWYYKKSYSYAETYKE
FT                   GKFVIERKFINFTDNLTTTQLLTERALQNKFKRRYSNNSTSSTSNSSTISNNSISDLEI
FT                   DESGSPQHESFLTKEKFKLLNRRRSSGTNGNINATLLNHLRIPYHSIRNEGNEEKDNDE
FT                   EEEEDDDDNVEVDHHDHVNIVSGTTTNRPSNIDDDDIFVDA"
FT   CDS_pept        complement(723448..725637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248158" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581837"
FT                   /orf_name="CD36_43230"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase putative "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAX42197.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG397058"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000192DD7C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG27"
FT                   /transl_table=12
FT                   /translation="MYQSSSPKPQLSINNNSSSITTNSTTTINPLLFATPLNFKPASST
FT                   TLTSTFDNQIPKSYIVLSNNSNMKNSKLQKDNKLVKANTKKSTNDPPKPKSLNEAIANY
FT                   TGNKYLTHKERKRKRKLQERNNEEKQDQEEEEEEDNGERRVTKKAKRGMWDSIKSFLSG
FT                   TPTPLSDEEDLGENIEENREQKEEKEEEGDDKIEDDDSSSSGEVLTETSPFTGFSEPEK
FT                   SEIDDIEEEEDDADFVDEDSDSPESSDQDDEDVESDSVSSQPSDNDEEDLEKLKYDLKI
FT                   DQLVNGKDDNEEDEDEDEEEEETQERTSTTPPTSPEEDTEKQQPEPSEVSYYDINEYED
FT                   DRGSNNSTRIYKNWRELVNKKPPVGLLNHGVTCYMNSAIQSIIHIPAMQHYLNDVNDNK
FT                   YSQLKPRSVTHVLAELSKRMWLASNTNNNKKGKNSGGMKYINPKKIIQRLDEINCMMSE
FT                   WQQEDSHEYYMSLISRLQEDSTPKGKKLNESIIYDIFGGLLNQRITCHKCHNVSITKQE
FT                   FYDLSLGLNKKKAKPHSSNDDNNSINNNNNNNNNNSNDETTSTTIDPSSTTMFNSNKFS
FT                   IEKSINDFFSNELIKKSENDSKSGYFCEKCNRFTHANKISSIEIAPETLTIHFKRFKFN
FT                   NNSSSKVKQSINYSKYLDLSKYMVQGTAKYRLTSVIVHEGRSISSGHYVAHCLQPDGYT
FT                   WCTYDDEYINKIEERVALNDPSAYVLVYTKLTPKV"
FT   CDS_pept        complement(726459..728255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581838"
FT                   /orf_name="CD36_43240"
FT                   /product="Catalytic subunit of the COP9 signalosome (CSN)
FT                   complex, putative"
FT                   /protein_id="CAX42198.1"
FT                   /db_xref="HOGENOM:HBG397057"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000192DD7D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG28"
FT                   /transl_table=12
FT                   /translation="MTCLDELACLLELKPDTIRSNSRNSKIKTIDLYQQNETIGEPSQD
FT                   QDKFYRLPAMDPVVRDKKPWKQDVNYFNKCYISSLALMKMCIHAQTGGSIEIMGMLVGK
FT                   ISGHAIIVMDTYRLPVEGTETRVNAQNEAYTYMVEHLTERQQLSNGRNEENIVGWYHSH
FT                   PGYGCWLSGIDVSTQSLNQGFQDPYLAIVVDPVKTLKQGKVEIGAFRTYPEGSQQSSAN
FT                   RIKKNQNKPHNNANQKILPKSKQKDFGSHADKYYGLDIEIFTSSWDDKVIEMLKDEDSL
FT                   TWMKNLLVDSNNDKVLGIKKDEIRYIELIKNYELISQGNYNADEGGTIFDLIEQLKKQA
FT                   NASKLMLNKITNMQLDPNFESVLYKRLLKKSQKSSTTTKKNKRDLATDIDDETMLDESD
FT                   LEKNVSTGGIETSVSSDDDEEEEGEGEEEEEEEEENAPSKNENEDDKNQVDEVDSDDED
FT                   DDLLQEVSALEKYNFDERYANESTNRFIHPKQKMKHKNRPMMSEWRRFGHQNQQIPPDY
FT                   MYQWSSNSANLAKASKINRRKERLARLEGPNIEDKKQFELGQQGSPESRAKSANLVKLA
FT                   KSIGLNEVFDLITLDAQQKLFG"
FT   CDS_pept        complement(728539..730404)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581839"
FT                   /orf_name="CD36_43250"
FT                   /product="RNA-binding protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX42199.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397056"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DD7E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG29"
FT                   /transl_table=12
FT                   /translation="MKLEVSSCSSNSSESSTTSDLIESFPPLETTVSPKENINSLYSNN
FT                   QWRDKIDSASSTLSSTTGKLKEKFTAKLAIDSVGEMSAPNKASELNSAYVRGRPSACVF
FT                   VASLCSNMSDDALCVSVTEHFKQWGTLATVKVLRDTCNRPYAFVQYTTDSDSKLAIEKG
FT                   HNSVLDGRNIRCEAAKVNRTLFVSSKSFLSKSIIEDRLSNFGEIEELLPSTSKGELYNS
FT                   AIETRGYKNWFCKFTYRDDAIRAYANLTEEGIYKVDWTQNIDKSNAPRNDNEPEQESVK
FT                   VKFDKYSIFVGQLSPNVSEGQLSQRFERHGEIVDLNLIKRTNNTFAFIKFKRESSAAGA
FT                   VERENHSMFCGKTMHVQYRETHIHAPMRTRSSYNNGIPLAPPPINLNKKSFTKNDYVKS
FT                   KGTIEMSKPKFNSYPSNSFNKGFNKLKQFKSFRPASFEKKFGNTKTESTWHASQLNLKG
FT                   EVSESNQVDKKVNGNSGISSAPNDSRGSGASSRNNSTNSFPPPPPTTTAPGFPLFYYVP
FT                   ADNVNFANSSSTNTPPFYNVYPQYYPATAAAATALAAAAAAAAATGGTNGSLPYDTPGC
FT                   PPSGVANVVAGSPEFTSIASHPSYGIANYMYYPTETEMNINDKKV"
FT   CDS_pept        complement(731062..731868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384665"
FT                   /gene_name="ECE1"
FT                   /orf_name="CD36_43260"
FT                   /product="Cell elongation protein, putative "
FT                   /protein_id="CAX42200.1"
FT                   /db_xref="HOGENOM:HBG397055"
FT                   /db_xref="UniParc:UPI000192DD7F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG30"
FT                   /transl_table=12
FT                   /translation="MKFSKIACAAAFVLSSQAAIIHHAPEFNMKRDIATADPVVAEPDV
FT                   SVAANVDTSIAKRSIIGILTAILNNVPQIINVITTIIKSITGNKREDIDSVVSGVIADM
FT                   PFVVRAVDTALTSVASTKRDGTNDDVTNAIVRLPEIVAPVATGVQQTVENAKRDGVEDI
FT                   GLNIVANSPRLVSDVIGGVSETVKQAKRDNAEDILTKVLQELPDIISKVSNSTLKNSPP
FT                   FKRDANTVTLSKLIKKSIETIGVENAAKMVSKRDISSLIAEYFEEA"
FT   CDS_pept        complement(735189..735776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384666"
FT                   /orf_name="CD36_43270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42201.1"
FT                   /db_xref="HOGENOM:HBG397054"
FT                   /db_xref="UniParc:UPI000192DD80"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG31"
FT                   /transl_table=12
FT                   /translation="MKFYKIASFAFLALLSQAAVAQYDLETKRDVVAANADGTVGFNLV
FT                   DKREVTEGEISKRFAELLLIPIILVAIKHALPEIIKVASALLEHLPDSGSVSVNATLLA
FT                   EISAGHEPDLINQIVNQVSNNLPQAITTVQQQQQQQQSQKVKRDTIGDIVNEIIAEGEV
FT                   LAPEVVAFLEKVLPQVVDALLRLAPALLGGLA"
FT   CDS_pept        complement(738705..739259)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231810"
FT                   /orf_name="CD36_43425"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42202.1"
FT                   /db_xref="HOGENOM:HBG397054"
FT                   /db_xref="UniParc:UPI000192D360"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG32"
FT                   /transl_table=12
FT                   /translation="MKFSKVASIAFLALSTQAAIVQNNQEPTKVKKDVVVGGANGDGNG
FT                   NILSQREYNYDVLAKDDEISTIISIITSALTDVLPELIKIISGLLGDGSSPSGAPGSLD
FT                   LQKIIDDVIEEIKKILPQTVLAVQQGSSKVKRDAASDIIQEFINEGIKLTPEVIAFLEK
FT                   IVPQIIGAIIKEAPQLIGGSS"
FT   mobile_element  complement(741465..741937)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon E,
FT                   truncated"
FT   CDS_pept        742047..742460
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231811"
FT                   /orf_name="CD36_43290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42203.1"
FT                   /db_xref="HOGENOM:HBG397043"
FT                   /db_xref="InterPro:IPR013924"
FT                   /db_xref="UniParc:UPI000192DD81"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG33"
FT                   /transl_table=12
FT                   /translation="MSTIKTTNELAKEVVASVIPMNIQYSGPANTEEYFTPSKTQEIQP
FT                   DGTSLDVAYFRGCKLVGKTLDLDKYNVKGYVLNKSEHLVSDKETGEVKTAVTYIPVGNF
FT                   QKLTVYGHDTLPSRTNQWSLIPEYLSISNIVNE"
FT   CDS_pept        742588..744501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581840"
FT                   /orf_name="CD36_43300"
FT                   /product="DNA repair protein RAD34 orthologue, putative "
FT                   /function="damaged DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42204.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG397044"
FT                   /db_xref="InterPro:IPR004583"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="InterPro:IPR018326"
FT                   /db_xref="InterPro:IPR018327"
FT                   /db_xref="InterPro:IPR018328"
FT                   /db_xref="UniParc:UPI000192DD82"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG34"
FT                   /transl_table=12
FT                   /translation="MREGGLFVQSDDESDYDEPPTKRAKVVEEEEEDSDIELNESDWED
FT                   VFLDNVVDPAPSEFSITIQQNEIDHQRKERIKQLIREKQKRVSIHYLSMVSYIIHARFR
FT                   NQLMRSKRVQKLLKKLIPDQVKKVYKKFKKNTDTQSADEQLVYILKYLIKWFRKNFKHD
FT                   SNGMRVLGYSSDPQRFPNNAKNITNESDLLSVIKKFQHNRDTGAQIFTAILGALGFESR
FT                   LVFSIPLLSIKNTNTQPKLNNDILKVNKDNDLLYPSFWTELINPLDPSEIIVMETQCFY
FT                   EEDKRLLRIKRYGGTLSQSFTDQFYPIQNQLCQMSMYYVLSFNSENLILDVSSRYMKDI
FT                   SYRWFNRLDLRTDLGKAALLLQSLLRIFNRTKNYTTDDNRELESLMQMAMTNYTIPESF
FT                   TAMKNSPNFITPSTLRYNEVIISETKPVKQIKINNKKEPVYFKNSLLVGKSEQQWKFLG
FT                   RSIKPGEIPIKLAKATPRTIYNKRLYNQNEINDPSLNQVKLYSFSQTCPYIKLKVTKSP
FT                   DNGKLILPRNKYGNIEIFRENMIPDDCVWLKLTNIENILKNKAQFVPVVTGFAFKAGQA
FT                   IPIKQGVIVLKQEETRIKKIWLSGRIKEHKAQLAQRRLKLLYTWKFIYKHLQIKKRLDD
FT                   HL"
FT   CDS_pept        complement(744492..746804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248164" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537395"
FT                   /orf_name="CD36_43310"
FT                   /product="Sporulation-specific protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42205.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397045"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI000192DD83"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG35"
FT                   /transl_table=12
FT                   /translation="METLPRGFFKWIVPTLKCSINTYLSLGLDAYFFIRFISVLSLFFL
FT                   FIGTLNMVILIPINYTGSSTEYTAFGLDKLSLSNIATTNVARLNAHFLMGLITIGFFHW
FT                   LIIYEFQSYVIIRQSYLLSQPHKDSVMAKTLLISNVPSYLQNHEVLKTIFQVVPGGIKD
FT                   IWDINEFEVIDHQVEIAQDALHYLEKSQVLGLKKYYRKKSQWCGPPVGDSIEEIKEFIE
FT                   THETYFYPPLYSGPIRIPQIERTIRITLPGWLRVFCFQKPIPMYEWSLQTLSECNQKID
FT                   EEKLKLTEGQLAKHSKIFIEFTSQEGSYIAHQCLLSQSQGFLDKTTIEINPNDIIWRNV
FT                   CRNDGIACKFEKYLVTIVFISIIILYVIPVSLIGLVSQIPLLTQLLPFLEWIYQFPEEA
FT                   RETISGFLPSILLGVLTEMVMIIFRFLTYFKGRTTGCEVEIDLQKWYFAFLFVQQFLVV
FT                   TISSSVTVILKQIIDQPTSIPVLLATNLPKSATFFFQYISLRAFAFCGNNFLRISPLIQ
FT                   TLIVHKFIDITPRQKFNRITNLPKIKWGTTFAVYSIYACIGISYSIISPLISIFIIFFL
FT                   NLSILYYKYALKYVYNHINESETTGRLYPTALLHLYTGVYCLECCLIGVFFLSKNDKGG
FT                   YPMRVQGWIMTGILILTIFANTIIYNRYTPHFSNLPILSDKAFKDGIKPISESNSPSTD
FT                   DTYYSNHKLLYLHPAFKYESPKIWLPKDPHGYTDLLLQKMLTRSQFEGENDGAQVQLGK
FT                   FFSSLKLVISEAPPDYK"
FT   tRNA            complement(746901..746972)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   tRNA            complement(747057..747128)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   tRNA            748262..748333
FT                   /gene_name="tRNA-Asp (GTC)"
FT   tRNA            748977..749047
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        751801..756303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080469"
FT                   /gene_name="CDR3"
FT                   /orf_name="CD36_43320"
FT                   /product="Opaque-specific ABC transporter, putative (Atp-
FT                   binding cassette"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42206.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000192DD84"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG36"
FT                   /transl_table=12
FT                   /translation="MAKTTQEGGQPYKGYYNNKSQGQPYRGYYSGFNKSASAQIHHLAR
FT                   SLTQGAQSHYDDTYTTATMHPHGINPISDKTDPTLDPESPSFSSKRWVQNMWKLYQSDS
FT                   EYYKPGKLGVAYKNLRVYGDAIESDYQTTVSNGVLKYARNLFNKFRKHNDDYSFDILKP
FT                   MEGLIKPGEVTVVLGRPGAGCSTFLKTIACRTEGFHVADGSVISYDGITQDEIRNHLRG
FT                   EVVYCAETETHFPNLTVGETLEFAALMKTPQNRPMGVSRDEYAKHVVDVVMATYGLSHT
FT                   KNTKVGNDFIRGISGGERKRLSIAEVTLVQASIQCWDNSTRGLDAATALEFISSLKTSA
FT                   SILNDTPLIAIYQCSQNAYDLFDKVIVMYEGYQIFFGSSQRAAAYFKKMGFICQDRQTT
FT                   PDFLTSITSPAERIIKPGYERLVPRTPKEFYRYWRRSPERQALLEEIDEYLDNCENYDQ
FT                   KQKIFEANNAKKANHTYNKSSYTVSLPMQVRYIMKRYWDRMRGDIIVPFSTVAGNVAMA
FT                   LILSSVFYNLQPTSSSFYYRTSVMYYALLFNAYSSVLEIYNMYEGRAIVQKHREYALYP
FT                   PMADAIGSIISDFPLKVVCSVLFNLILYFMVNFKREPGAFFFYLLISFCSTLFMSHLFR
FT                   TIGAFTNSLAEAMTPSSLLLFALSTFSGFAIPVTYMLGWCKWIRWVNPLAYAYEALISN
FT                   EFHGRVFDCSDVVPSGFGYPKTGNSVVCASIGAIPGEFKVDGDLYMKLAFDYSYSNAWR
FT                   NFGVLLAFIIFLFGTTIFFVQTNKSSISKGEILVFRKKNIKKMRKMEEDEEAYMDGMAP
FT                   LDFSGSTEISDYSYDYMDRKLLDTSNIFHWRNLTYTVQIKSEERVILNNIDGWVKPGEV
FT                   TALMGASGAGKTTLLNALSERLTTGVITSGTRMVNGGELDSSFQRSIGYVQQQDLHLET
FT                   STVREALRFSARLRQPGSVSITEKDQYVEKIIDLLEMRTYADAIVGVPGEGLNVEQRKR
FT                   LTIAVELVARPKLLVFLDEPTSGLDSQTAWSICKLIRKLANHGQAILCTIHQPSAILLE
FT                   EFDRLLLLQKGETVYFGEFGANCHTLIEYFERNGASKCPPHANPAEWMLGVIGAAPGTQ
FT                   ANQDYFETWRNSPEYRAVQNELHRLEELPGLASGEKEPDTNQAYAASFWKQYIFVVHRL
FT                   FQQYWRTPSYIYSKFAMAVLCSLFNGFTYYKSQNSMQGLKNQMLSIFSMFVVLTTLAQQ
FT                   YVPLFVTQRDLYEARERPSKTFSWLAFVAAQITAEIPYQVLAATISFFSWYYPVGLYRN
FT                   AVYSDAVTHRGVLMWLIMTLMFIYSSTLAQFCISWNQLADYAANWISLLLTIAMIFCGV
FT                   IATKDSMPRFWVFLYRCTPLTYLTSAMMSIGLGDSYVKCAPTEILTFPPQNPGVQKCQD
FT                   YMGAYISIAGGYLLNPEDTDSCKFCIMDKTNQFLNFMNISIHNFGRDTGIFIVFIVFNM
FT                   AATVFCYWLFRVPKGNREKGSIFDKLPFFNGGDTNHENV"
FT   tRNA            756745..756831
FT                   /gene_name="tRNA-Gln (TTG)"
FT   CDS_pept        757248..758663
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231812"
FT                   /orf_name="CD36_43330"
FT                   /product="Signal-transducing regulatory protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42207.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397046"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D2B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG37"
FT                   /transl_table=12
FT                   /translation="MSSTEESTQEPILDGIETQDIPEEYDDTTTTIVDYPTSFNYLDTK
FT                   DSPDIRNAKYKSPTDHLNCPICQQPFINPLTTICGHTYCKECIYECFKMAKSNSSSSSS
FT                   SRTDELTGYCPLDRTPLDGANINDLFPTPLIITNLIDELKVYCANHERGCDWVGTRWEL
FT                   EHHVKDICQYTGIRCNGVRSDGSICQLIIERRFEDKESSKCVHLIFECEFCKTKVTKIT
FT                   QTKHLEQECLFNYKTCELCDNDMIPEKNMARHQENCRKIGRFVCPAHEIGCKWIGTNET
FT                   SLELHLENNCQLYHFLPTYSTMKEKMDSLVLENETLQKQINKMLDSIIQGKITNLGYSE
FT                   SIEEINKFESIEDQDKLVYLNFEIDRLKYEINERIIPFMNKSTVNERENIMNNLINDNF
FT                   MIREDMNVQRMMINSLRKQLQFLLFSKNRNTTLGGNANNMFPTMFPTEESGIGEIYETV
FT                   SRSNSEERLNLKL"
FT   CDS_pept        759891..762413
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581841"
FT                   /gene_name="OSH3"
FT                   /orf_name="CD36_43340"
FT                   /product="Oxysterol-binding protein, putative "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAX42208.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG397047"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI000192D2B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG38"
FT                   /transl_table=12
FT                   /translation="METLEIHSKDFLIKWINAPDNSVIDWEAKPLKKSINFSFYKKKEE
FT                   SLNQSEASLDSNSTAVLEPPIAPPQRTRSRSASTASVNQFSKPNDVYRSKSRASTLLSI
FT                   NESDLILIKNYYKLVANELVHGKFEVERGGMFAFVFDNSFSKTIAKSVQFSAKIVSKSK
FT                   SEEHIAEEKVAEVHDQHLFDENDVAPGETLQSIMLKKRRKKLQGFTKRYFVLNYGRETL
FT                   SYFKVDDNKLRGQMPIKDCIVSANPSTREFIIDSGMEVWHLKAINKADFNAWVNAFNTV
FT                   KKEDTVVPTATTTEENDSKEPALASTPLGASTSELQLIAQKLVQLKTENPSPLANEIHQ
FT                   DFVNLLTRFKGGANLSSPGSADVQSVFSSDFHDAVDHFEETGVYFLDDEGKIQEDVEVA
FT                   DDAESSSEEDEEDDEFIQTTPSGVHEGHEVIQDKDLPQPTVEADDDNLYPLPHDPVSRP
FT                   SDIPICTHTPPSILSFVRKNVGKDLSTIAMPVTYNEPTTMLQKFAEMLEYPEVATNALI
FT                   SDFQDESGEKLLRVAAFALSYLSTQRAKERNKRKPFTPLLGETYELVREDLGFRLISEK
FT                   VSHRPPVFAYHVDTEHWTLDYALSPDQKFWGKQSEVTTKGIVYLRDKSTGEVFTWTQPT
FT                   TMIKNIIAGETYAEPSGSVTIKSSNGYKAVAEFAKGGMWSGRSEGVVVKAFDNKKKELT
FT                   YSVEGNWTESFTLKTKTTEKTIWQAGELLPQYQKKFGFTEFAGTLNKITEIEKGKLAPT
FT                   DSRNRPDLQLYEKGDTDTAETLKNKLEQDQRDRRKELETAGEVHIPKFFKRKGNGPINE
FT                   SEWEFIQGEKSYWNRRKKGDWDDLIKLW"
FT   CDS_pept        complement(762531..763616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537396"
FT                   /orf_name="CD36_43350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42209.1"
FT                   /db_xref="HOGENOM:HBG397049"
FT                   /db_xref="UniParc:UPI000192D2B6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG39"
FT                   /transl_table=12
FT                   /translation="MSKQDSPPDYTNRASDNYNPHETDNSIPPAFTPNSLEVHPPPFSL
FT                   SSPPPPPPPPPDQHNFHVPAYFQNQITPAWTIVINNRFWTDGFRIFVSEDASNKFDAFK
FT                   KSKNPEIIQLQEQGIGVPLFKAITSYIPLATKFITFRRYVPTNLHPFDIDKDYYDYCIV
FT                   KRKLHVGYDSYIFEFTPDPKQPKLNFQVILFSHSVLPIHDYIYKGERHRWIDESNLRRF
FT                   KELWQVKYGFKHTYLIDGQPALTDNWDGQSDKLNKNKKNPYLDNFFKMKFSISSRYPKP
FT                   EYYGPHCTDTLGEAEAFFKLGYAELKIDDLGKGYSQNDDVNYESIFSIPEEELVTICIA
FT                   TVLKRQKDIEEEKKNRRRRAN"
FT   CDS_pept        complement(764430..765695)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094077" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537397"
FT                   /gene_name="HWP1"
FT                   /orf_name="CD36_43360"
FT                   /product="Hyphal wall protein"
FT                   /protein_id="CAX42210.1"
FT                   /db_xref="HOGENOM:HBG397050"
FT                   /db_xref="UniParc:UPI000192D2B7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG40"
FT                   /transl_table=12
FT                   /translation="MKLSTAKLVAIAYYMLSIGATIPSVDDQQVEEGLIQKRTYGYYQE
FT                   PCDDYYPPQQQQEEPCDYPQQQPQEPCDNPPQPEEPCDNPPIPNIPTDWIPNIPTDWIP
FT                   NIPNEPTNPPTTPNIPATTTTSESSSVPSTTPKTSASTTPESSVSATSPYTSVPTTIPK
FT                   SSTPATGPETSVPGSSILATTSESSSVRATTPNTSVPTTASESSTLETKTSITPLTTST
FT                   EHDTTVITVTSCSNSACAESEVTTGVVVVTSEDTIYTTYCPLTETTPGTESTPEASTPI
FT                   METIPADSEPSVPASETSAVVPELSVPTTESAPGTKMTPGGLEPSAPVSEMTPAGIKTN
FT                   QAVPESSIPAGSSVAITTPVNSTIVSTTEGAIPTTLESVPIMQPSANYSSSVAPVSTFE
FT                   GVGNNIRLTYGAAIVGLAALLI"
FT   CDS_pept        complement(767404..769671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581842"
FT                   /orf_name="CD36_43370"
FT                   /product="AP-3 adaptor complex subunit, putative "
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAX42211.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG397051"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D2B8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG41"
FT                   /transl_table=12
FT                   /translation="MSDSFSRITSMIDSAKEFTIETAVSASARLTDTPSGSRPQEISKL
FT                   LNSRTDREILNGMKCVISLITREEDALPYFADVVKNITNSDPKIKQLVIIYLTKYAEVE
FT                   PDTALLSINSIQKSLNDKDPINRANAIRSLSGIRIGSIIPILVLSMKRTSTDRSPLVRA
FT                   ATAISIGKIYQISGRSKRQMIEYLNQLLTDSEVMVVGAAIKSYAKIRMELNEDKRWVPI
FT                   HGNFRRICKLLNQFDEWTQSYVIELLTEYSRKFLSRPITDEITDDDLELFLMSMKPLVQ
FT                   SISESVILSVAKSVYLLAPRQLFCDFQLDLVLTRMATSLNQSEVSLFVLEVVSFISKSD
FT                   NLFESYYKSFYVTPSDSTDVAICKINILSALSNQENFKYIFEELKYYAIYSTNKSVSKE
FT                   SIKAMGKCSGLSLEWSQKILKWCLKKIKTSRGETLNELLTVIRYLIQQKSDSNDSLNKT
FT                   EVLKTTYNLATILEDSSVELETEARASIIWIIGEYTALAENSFAPDVLRNLLKRFAEEE
FT                   EEVRYQILVLASKIFAYEMIKIKNEGGDQFKDYVEEKFSNSIEYKMFQHTLHLAKYDSS
FT                   YDTRDRARMFSVLLSSVDRAQLASLFLQVPKPVPFVKSDAADNLRLRAIDNYFEVCDWS
FT                   DQDKLPPKSIRTELPVQVNRLGNVSFASSSISREKTKSPSPVGEHSFSSQQFAQQRESL
FT                   SQVEKKQASRYKLQSLDEFFGSEDDYSSSSSSSSEEEEEEEVSEKEESDEEKNGEKTDK
FT                   ET"
FT   CDS_pept        complement(769846..772824)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20231813"
FT                   /orf_name="CD36_43380"
FT                   /product="DNA-repair protein RAD2 orthologue, putative "
FT                   /function="endonuclease activity"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42212.1"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG397052"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI000192D2B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG42"
FT                   /transl_table=12
FT                   /translation="MGVHSLWKIIGPTARPVRLEALSRKKLAIDASIWIYQFLKAMRDK
FT                   DGNSLPSSHIIGFFRRICKLLYFGILPIFVFDGGVPVLKKQTINNRRQRREKNSESRQE
FT                   TAQKLLAIQLQREAENALNRSKKLSSNNVNDDSGIGNDNVIYFEDLPINKSERESSTPS
FT                   SIIYRKDDEYHLPDLKEFKVSKYDERIMPEEDLIEFYEDFDHVDGININEIDPKSKEFE
FT                   TLPIATQYMILSHLRLKSRLRMGYRKEQLEELFPNSMDFSKFQIQQVQRRNFYTQKLMD
FT                   VTGMGADSTISKRLAGDKDRKYALVKNEDGWTLALEENSKDNPIHVDSDETEDITREVN
FT                   SYKHDSGQDKKDEDSDSDFEDVPLEEIPETEEDKDYHRALIKSIYEQYNTEENIQGPTK
FT                   VVNEFDEKELREAVEKSKIDYFELQAKETQQSGEEKFDWGSSMLFAPDTVKQDVSLHNE
FT                   ESINSVEHTGTQVNAVKSDEFKRIKNSDIKKDTSNNIGQSFLFNADPHRTGKIELRTKE
FT                   ETIFEPEESDSEEAITNNVQQSSDIEKPKKLESVKDQQKLPDWFQNEVSKTLNPHNVKF
FT                   VNYNNYQIRNRNNQEEKDAGLVPWFEAKEILEQEQSDEQEQEPEKPDNANDDIKEINQE
FT                   QMNVLIIEEKETVPPSPVEDVRKPAVMDYQFEEEDEEELVQQLRKEELDHESLKHQIKS
FT                   SHAIPLTSLETRITDEQLLQEKFQKAKRDSDEVTEAMINDVQELLKRFGIPYITAPMEA
FT                   EAQCAELFKIGLVDGIVTDDSDCFLFGGDKIYKNMFDQKQYVEFYLQDDLFNKMALTQH
FT                   KLIELALLLGSDYTEGIKGIGPVQAMEILAEFGNLEKFKEWFDKHAKTVADKTELTKLQ
FT                   KSLLDRIKKGKLFLPDSFPDKVVEQAYISPEVDSDKTEFQWGVPDLDQIRSFLMYNLSW
FT                   SQTEVDEVMVPLVQDMNKKKSEGRQSILNEFFPQEYIQSRKELNLGKRLKTAASKLKKR
FT                   KHL"
FT   CDS_pept        773538..775325
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581843"
FT                   /orf_name="CD36_43390"
FT                   /product="Gamma-glutamyltranspeptidase, putative "
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="CAX42213.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="HOGENOM:HBG738311"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI000192D2BA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG43"
FT                   /transl_table=12
FT                   /translation="MSKQFIKFPSRRSTVYSSKGIVASTQPLANAAGIKILERGGNCVD
FT                   AAIAVSAALTITEPGSTGIGGDCFALYYKLNDKSDPKSGVVLGLNGSGRAAQNITPQDV
FT                   WNEHNNGEYMSRIPYTSVLAVTVPGAIGGWFDAYEKWGSGKVTFEEILNPAIQLAEEGF
FT                   PISELSSHAWRNNIPKLLNQNLDVKENPFILEGNRGPNEGEYITNHQIAECLKLIGKHG
FT                   KKIFYEGPIADAIIKTTNARNHKLTLDDLKNHTSTIVEPIQLNFQDYKVWEIPPNGHGL
FT                   VALIALGIIQELHNSGKINLYELKHNSSQYLHILIEACKLGFYDSDEYVTDPIFKDIPI
FT                   DDLLSPKYLKTRSEFIDLNKIIDGNKMNHGIPDPKFKSDTVYLTVSDSNGEVCSFINSV
FT                   YEGFGSAIVVEDYGFCLQNRGSNFNLTPGQSNCLEGGKRPYHTIIPGMITNNDGSLYAG
FT                   FGNMGGFAQPVCHVQHVLNLIIFGMTPQQSIDSPRFVLNSNNNNNNNNDDDEATTDRGR
FT                   GAEGPVCTPITVVQLEEGIELDVIEDLKTLGHKVEVLSGYDRVTFGRAQIIQNVSKDGK
FT                   LIYAGGSDMRGDGAAVALI"
FT   CDS_pept        779672..781825
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094079" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080470"
FT                   /gene_name="RBT1"
FT                   /orf_name="CD36_43400"
FT                   /product="GPI-anchored cell surface glycoprotein
FT                   (Flocculin), putative"
FT                   /protein_id="CAX42214.1"
FT                   /db_xref="InterPro:IPR018789"
FT                   /db_xref="UniParc:UPI000192D2BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG44"
FT                   /transl_table=12
FT                   /translation="MRFATAQLAALAYYILSTEATFPLLGDIFDCIPHNTPPVCSELNL
FT                   YHDTSASINGSQNNKNKRDVEKRTFGNFGFNSGVNAAFVVSGAKKLSDGSYGIDCNFKS
FT                   DSSVQLNSAFGKKIKQLSVTGTGYSDIDLLGHVANPFEWSASFKIKAEIIKGKCCLPSG
FT                   FKIITDFESNCPEFDAIKQIFGTSQIIYKVNAISHAIGTFDASALFNAQLNAFPVKREL
FT                   NEFEELNNNNGITHSKRTLGLLLNLLKKVTGGCDTLQQFCWDCQCDTPSVSTTIVSTSS
FT                   APETSTTPESSVPETTIVTTSSAPETTPESSAPETTTTTTPESSAPETTTTTTPESSAP
FT                   ETTPVSSSVDSTSVTSVPESSAPETTPVSSNVDSTSVTSVPESSAPESSAPETETSPIV
FT                   QLSTTTAQTTTVITVTSCSNNACSKTKVTTGVVVVTSEDTIYTTFCPLTETTPVTSNVD
FT                   STAETSAPESSVPETTAESTTPESTAPESTVPETTAESTTPESTAPESTAESTTPESTA
FT                   PETETSPTVQFSTTTAQTTTVLTVTSCSNNACSESEVTTGVVVITTEDTIYTTFCPLTE
FT                   TTTATESSTPSVETTPIAPESSAPASESVPVTESSSVAPIAETTPVSPVAPNAESTPVA
FT                   PNAESTPVAETTPIAPTTAPETSAIVSTTEGTIPTTLESISIIQSSANSSYTIAPVSSF
FT                   EGAGNNMRLTYGAAIVGLAALLI"
FT   CDS_pept        785652..790196
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581844"
FT                   /orf_name="CD36_43420"
FT                   /product="Cell surface flocculin, putative (Gpi-anchored
FT                   cell surface glycoprotein"
FT                   /protein_id="CAX42215.1"
FT                   /db_xref="UniParc:UPI000192D35F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG45"
FT                   /transl_table=12
FT                   /translation="MRFATTQLATLAWFILATEATIPLKGFFNDTNKNAAPVITELGVY
FT                   HEEESTNDQQQKVEGFNIDTNIKKKRNNGNSGDFNGEVFITSTKELKTTVVVTSCLNNV
FT                   CSETSITKPKTTVIATTSKHSTSKPTHATTSKHTTAKSTHATTSKHTTAKSTHATTSKH
FT                   STSKPTHATTSKHLSSKSTHATTSKYLSSKPSHATTTSKHSTSKPPFPFTTTKSVTPLS
FT                   SSIASTKHTNHKSHKPSKTVVTMSSCSNNACSHSEVTTGVIIVTDKETVYTTFCPLTDT
FT                   DTEIETISKHSTHATTSKHLTHATTTSKYSTSKPPFPFTTTKSVTPLSSSIASTKHTNH
FT                   KSHKPSKTVVTMSSCSNNACSHSEVTTGVIIVTDKETVYTTFCPLTDTDTETETISKHS
FT                   THATTSKHLTHASTTSKHSTSKPPFPFTTTKSVTPLSSSTASTKHTNHKSHKPSKTVVT
FT                   MSSCSNNACSHSEVTTGVIIVTDKETVYTTFCPLTDTDTEIETISKHSTHATTSKHSTH
FT                   ASTPKHSTGESSHATTVKHSTAKHSTHATPSEHTSVESSHATTIKHSTAKHSTHAIPSE
FT                   HSTVKHSTHATPSEHTSVESSHATTVKHSTAKHSSHATPSEHTSVESSHVTTIKHSTVK
FT                   HSTHATPSEHSTHASIPKHSTGESSHATTIKHSTAKHSTHATPSEHTSVESSYVTTVKH
FT                   STIKHSTHATPSEHTTVESSHATTIKHSTAKHSTHAIPSEHTSVETASGTTSEHTSVKS
FT                   SHVTTIKHSTAKHSTHAIPSEHTSVESSHATTVKHSTAKHSTHTTPSEHTSVESSHATT
FT                   IKHSTAKHSTHAIPSEHSTVKHSTHAIPSEHTSVESSHATTIKHSTAKHSTHAIPSEHT
FT                   SVESSHATTVKHSTVETALGTTSEHTSVESGSVTKSIHVKTSRQSTVESTSSVASASES
FT                   SDLVNSSESTAFESSISTTTSKDSTSKPSTSVSTLEYSTSKPPAPATTLEYSTTESTIL
FT                   SSTSKSSTLGSSVPSSAPESSILTTTPDSSSESLISTTTSKYSSSEFSSSPTTLKSYST
FT                   KSTIPGTIVYSSSTTLGYSVTKFSNLTTTSKPSLSTTTTELFTSATTLKSLVSESSVPE
FT                   SSIISTTLMYSSFDSTTSIETPKSTISESSGSANPSKSSTSAWSTLTTTPESSPMTSIL
FT                   STNKSSKPSTTPESAVVTTKNPSTESTTEATTWESSAFESSVSTTTPKSSVAVTTPEWS
FT                   SVDTTSNPSVPNTILEHSTSAGETSSGSVYTISEQSTTVITVTSCSNNLCSKTEVATGV
FT                   TIITSDTTSYTTFCPLTETTPVSPALESSVTVGKSTSNIETTPVSESAVSTTSVASSAA
FT                   STTSVGSSAASTTPVSKSAVSTTSVASSAASTTSVGSSAASTTPVASSAASTTSVGSSA
FT                   ASTTPVSKSAVSTTSVASSAASTSITPDVKATTNSQGTKSTLVGTDSTSTSETTVMVYT
FT                   TKSVASTTLESISVAVSSAAQSSVAAISTYEGTGNNMKFSFSVAIFGIAAFVI"
FT   mobile_element  790736..790966
FT                   /mobile_element_type="retrotransposon:solo LTR, rho C"
FT   CDS_pept        793392..793946
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581845"
FT                   /orf_name="CD36_43425"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42216.1"
FT                   /db_xref="HOGENOM:HBG397054"
FT                   /db_xref="UniParc:UPI000192D360"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG32"
FT                   /transl_table=12
FT                   /translation="MKFSKVASIAFLALSTQAAIVQNNQEPTKVKKDVVVGGANGDGNG
FT                   NILSQREYNYDVLAKDDEISTIISIITSALTDVLPELIKIISGLLGDGSSPSGAPGSLD
FT                   LQKIIDDVIEEIKKILPQTVLAVQQGSSKVKRDAASDIIQEFINEGIKLTPEVIAFLEK
FT                   IVPQIIGAIIKEAPQLIGGSS"
FT   CDS_pept        797255..797665
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581846"
FT                   /orf_name="CD36_43430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42217.1"
FT                   /db_xref="UniParc:UPI000192D361"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG47"
FT                   /transl_table=12
FT                   /translation="MSFDLEIFVFYNSIYTPHSNQTQTQSSNMKFYNIAAFAFLASFSQ
FT                   AAVAQYGSETKRDVVAANADGTVGFNVVGKREVSQEEIQNVKRDTIGDIVNEIIAEGEV
FT                   LVPEVVAFLEKVLPEVVDALLRLAPALLGGLA"
FT   CDS_pept        798803..800545
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537398"
FT                   /orf_name="CD36_43440"
FT                   /product="MFS multidrug efflux transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42218.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG397042"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D362"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG48"
FT                   /transl_table=12
FT                   /translation="MTIQDHNSIHPNVIQDISTDAPGIVAGELAAEDEGLLSNNALKTH
FT                   TYGSVATQETHYEIDDPNGGYALPKAQLYTVVSSLFMASFLAALDGTVVTTLLTLIASE
FT                   LHAVSNISWIATAYLLSSAAFQPIFGKLSDIFGRKTLLLGCSTLFAVGCAICGIADSVL
FT                   VLVIGRFVTGCGGSGLTSLGTITMSDIIPLRDRGYFQGLANIFFGLGAASGGAIGGLLA
FT                   DWLGWKYVFILQVPLALSVFFAIYFFLNLPEGSPGLGMEGNVSEKLKRVDFLGSFFLVS
FT                   SLMVFLSAASLGGREIAYSSFTFIGLSISALALLAAFVAVELYVSQEPILPIELFANRT
FT                   VLASSLTNWFYTMAIFTTLFYVPIYYSSVIGLTPTQNGMRLVPNFFGVSFGSVGAGIYM
FT                   KKTGRYYKLAVVAGVLAIFGVAKIVLLTPNIPTWQQFLLLIPSGLGYSCILTVTLLALI
FT                   AAAPLKYQACTTSIQYTFRSTGSTLGVSAATAVFQNVLLHQLTNKINKLVTDPKEAAKI
FT                   IAKALDSTEYVNEAPKYVREVIRASYDAGCKGAFGFAFATIVLGVISSLFMREHVLHTS
FT                   INRD"
FT   CDS_pept        complement(800594..802117)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537399"
FT                   /orf_name="CD36_43450"
FT                   /product="Thiamine-repressible mitochondrial transporter,
FT                   putative"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42219.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397041"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000192D363"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG49"
FT                   /transl_table=12
FT                   /translation="MPNTPLLSIRSPRFDRLSPRITADPNDIIDIINQQEIQNYKLGII
FT                   LLVIALATWIIGLELVNAVLKGDDYEKPWLFAVITGSCFSINLLPDIILVKSWSIFSQT
FT                   PIKEEEEDSPLLQTKSKEKNDNVSELTPQEVFILAFQISVIYYLYNVLGMSALKFTSAS
FT                   NQTVMGSTTSMFTLIIGVILKTEIFTIKKAICVIGSCLGVFLVSFSNTSGGKGKFQPKN
FT                   PVLGNTLALGAALMYAFYLLIMKLKCGTGDKTTNERRLFGYVGLITFVIGVPILYVVDL
FT                   LEIEEFQFPPPNNTILASIFINGVFSVISDYTSVLAMLLTSPLVVSLTLTSVIPITILI
FT                   DYLVLISTGNSVKTSFVYVFGIVCILVAVVLVNVNITSENDLIEEVIEHALEEAIRNDE
FT                   VMSPMLSPLLSPRNNGANAFGSSSSQQQQLQLQLSPHASPIGISLFSPKLKSKHPLRIS
FT                   HFNLNDNDESEPTFNANHEPLYGITSSPPNIFVVQGKNHQYQIKRNIDE"
FT   CDS_pept        complement(802648..803658)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581847"
FT                   /orf_name="CD36_43460"
FT                   /product="Iron/ascorbate oxidoreductase/dioxygenase family
FT                   protein, putative (Thymine dioxygenase, putative) (Member
FT                   of the 2-oxoglutarate"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="CAX42220.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000192D364"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG50"
FT                   /transl_table=12
FT                   /translation="MSNPLKVINISEDSLTTAKELLDAATSQGFLFLEGHDFTQAEVDK
FT                   LFELSKSFFELPSTYKSKYSVDSSNHGYVMLGKENLDPNSQTQGDPKEALNIANLNFET
FT                   GKSLNVIPDWISNNKERDELISNTILRLYQLSIKILRMLARALEIEDDDDDKVKGENWF
FT                   ASRYASDCESGSTFRFLHYPCQKSLNPESVIRAGAHTDYGSMTLLFQKENQEGLEIFSP
FT                   ISKKWEQVPFISSTVEKMAPPLVVNIGDLLSYWTAGLLKSTIHRVKFPAKAQELGQDRY
FT                   SIVFFSHPSDNALLEPVPSEIIRAIEGRGANKETTYITAKQHLQKRLAATYGWKK"
FT   CDS_pept        complement(804169..805566)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581848"
FT                   /orf_name="CD36_43470"
FT                   /product="tRNA (Guanine-N(1)-)-methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX42221.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG592917"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniParc:UPI000192D365"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG51"
FT                   /transl_table=12
FT                   /translation="MNIKLFRHLPKSITRSIIMSKFSPPINRNMVELDRSFFHKEIPLL
FT                   AAYFPNPKFLGQFVKSCPKDILYVQTVKHIISMDDSKAILLRDDVKSISDLNPETRLKI
FT                   NEFGIILKPYILKLDYSFWKSDEILKSILPENLIDDIPSGFSQAGHLAHINLRDEYKPF
FT                   GKLIGQVILDKNPSVLTVVDKANTIANKFRTFPLELLAGEPNYIVEQSESGCKFKFDFS
FT                   KVYWNSRLSTEHERIIGKFNPGDVVGDVFGGVGPFAIPASKKNDIVLANDLNPESYKYL
FT                   QENIKINKVEPFIKPFNLDGREFIRKAPELLLQWYNSQNGILEKKIIKKVSIDNKSKNF
FT                   ERKTIIEKTKIPKFYHHFVMNLPDSALTFLDEFIGLYASNPELKQDPEFKLPIIHVHCF
FT                   EKFDNNEDPTPEELHNRVYGKICKLIQFPLNKAKMEFHEVRMVSPTKPMFCVSFELPEE
FT                   VAFKSTQ"
FT   CDS_pept        805725..806633
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080471"
FT                   /orf_name="CD36_43480"
FT                   /product="Exosome complex exonuclease, putative "
FT                   /function="exonuclease activity"
FT                   /protein_id="CAX42222.1"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG735314"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000192D366"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG52"
FT                   /transl_table=12
FT                   /translation="MDISEVISITRPSAFNNIDNVNNNDDNLDIEMSDEQGHTQSATTA
FT                   TAGNSIVTPGELITEDPTWMKGHGTYFLNDKTYSSVAGSISRVNRLLSVIPLRGRYSPE
FT                   TGDHVIGRITDVGNKRWKVDIGAKQDAILMLGSVNLPGGVLRRKSESDELQMRNFLKEG
FT                   DLLNCEVQTIFNNGIASLHTRSLKYGKLRNGIFIKIPSPLIVKTKNHAFDLPGNVSIVL
FT                   GTNGYIWLYKTPKINKSLENNTPGITRLEEESSWEIYSDKNEFIDVQTRNNIAKYYNII
FT                   KSLAEKEQKINNDVLVEAFDY"
FT   CDS_pept        complement(806709..807887)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537400"
FT                   /orf_name="CD36_43490"
FT                   /product="Peptide chain release factor, mitochondrial,
FT                   putative"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42223.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI000192D367"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG53"
FT                   /transl_table=12
FT                   /translation="MNSLLRIPRFALKWGSIRPILPKKIPNFPRFNSSTRSSLTIPTLS
FT                   PSLLERAQTIQQEHKELSEKLADKYIPDLQVKFDNYTNILSMFGKLETLTQEYIELTEI
FT                   TDDPGLYKEAQEELKSIVIPQIEKLVSELTVKLRPPVKYADKGCIIELRPGVGGNEASL
FT                   FTGDLLNMYINFASEMNWKYKIISEGKNSSGFINEAILSIDTLGSYDIMRHESGVHRVQ
FT                   RIPETETKGRVHTSTSAVVVLPKLSEGNESSLKDDERVFAPGEVRIDTMRAGGKGGQHV
FT                   NTTDSAVRLVHIPTGMIVIQQDERSQPLNKAKAFAILRSRLAQKEQEEEILRQKKLRTD
FT                   QVSSTDRSDKIKTYNYKENRVTDHRINYSMHDLQGVLEGRKLGQLIDTYRFQ"
FT   CDS_pept        808800..809402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384667"
FT                   /orf_name="CD36_43500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42224.1"
FT                   /db_xref="HOGENOM:HBG397039"
FT                   /db_xref="UniParc:UPI000192D368"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG54"
FT                   /transl_table=12
FT                   /translation="MSNIQFNLCTSFPGLLQTYHESLYDLITTYELYLSYKRRQISLLF
FT                   NLLFFSSAAELPSITKLESSWMVLQNSIMTKNQQLWGYRRILNETMTTMITSGYISKKQ
FT                   LFEFNHCIVLELQQVEDRFEDLIESETKDNTSNDQNVITTTFGNDNDRCFELSLLDKQP
FT                   QLFRDILDLHNSLISKYYVVQRQSINNNNISRRCVYI"
FT   CDS_pept        810088..810567
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581849"
FT                   /orf_name="CD36_43510"
FT                   /product="Translation machinery-associated protein,
FT                   putative"
FT                   /protein_id="CAX42225.1"
FT                   /db_xref="HOGENOM:HBG448698"
FT                   /db_xref="UniParc:UPI000192D369"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG55"
FT                   /transl_table=12
FT                   /translation="MSSTQFPTLTLEEFKTAIKDVSQFELESKKNQQKHFIFKLIDTNN
FT                   ELWQEINNIKQLQDSTSFENQENLILYQETLWENKHSLLEQIARIESINDELIRRNLIS
FT                   EQDKSQDESKLMDDINKKDIENETPQKDVTEENTNSLAERDGDGDGDGDAEGVYL"
FT   CDS_pept        complement(810661..811986)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581850"
FT                   /orf_name="CD36_43520"
FT                   /product="Mitochondrial methyltransferase, putative
FT                   (Methyltransferase oms1, mitochondrial "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX42226.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG397038"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI000192D36A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG56"
FT                   /transl_table=12
FT                   /translation="MLGQRLILRSSYRLAIPKSVVVPRNYSTSPSNNPFPLNDKERKQA
FT                   KKQSQLPWYKRWSNYSNSEQFQNKTMPKVYLCAFVVSLVPMYFYMRDRYHEDKQLKHIN
FT                   AKYAQDPSSLSEYEYLVLKSMNHSEKLRPLELKKYKIYQLMRKEFRRKNLFNQEMFNPT
FT                   PQELNDWYQNQVKYKSASKVVPILVDKIDSKDKINVSNPAIQNAEDTTAFYDSKAKEYD
FT                   DAVKWEERGIFMGSKRKWLMSQAKGDVLEVSCGTGRNIPYLYLQQINSLTFIDSARNMV
FT                   EVTKEKFQKAFPEFKKVAFAVGKAEDLTSIAEDVKYDTIVEAFGLCCHEDPVKALQNMA
FT                   KLLKPGGRIVLLEHGRSNWDFINNHLDFRSEKRMETWKCRWNLDIGELIDEAGLDITKE
FT                   KRAHLSTTWMIVVKKPEDPINPDEKPFLDKLFGRESKKVQKS"
FT   CDS_pept        811896..813515
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384668"
FT                   /orf_name="CD36_43530"
FT                   /product="26S proteasome regulatory subunit, putative "
FT                   /function="binding"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAX42227.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG523811"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI000192D36B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG57"
FT                   /transl_table=12
FT                   /translation="MVMLNSFLAQLPVLELPIYKNFAILIFGPTSCLKRWLFNALQYCS
FT                   GRSVKKKIVDVKFCMESRATMEKFSPGQIFFFFSFYFNTNTFDGKYPVPFISFPFLSIV
FT                   YNHSKTMSEQQLLEEARKAVTNKQYDEAETKYKQIINQSESQSSNTTPTAKQLQQQESA
FT                   ILELGKIYETLNEPSKLSDLISDSRSILGNFAKSKTAKIVKTLIEDFDKLSAKDEKSLD
FT                   IQIDATKSSMQWAIESKLSFLRQSLQLKLSDLLYQKKHHHEAIKIINELLREYKKLDDK
FT                   SSLVEVQLLESKIYHALRNIPKAKAALTSARTSANSIYCPTILQAELDCQSGILNSEDK
FT                   DYKTAFSYFYESFEGFNSQDDPRSIIVLKYMLLTKIMLNLIDDVNNILNNKNVIKYKSK
FT                   DIDAMKSIAMAYSNRSLKEFENSLLTYAKELKSDPIIKNHFNALYDNLLEQNLLKIIES
FT                   YSCVELSHISKVIGLNLQQVEGKLSQMILDKVFYGVLDQGNGWLIIYDEPRKDAAYEAS
FT                   LELVKNLSNVVDLLYEKASSLN"
FT   CDS_pept        complement(813544..815997)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248169" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537401"
FT                   /orf_name="CD36_43540"
FT                   /product="Nuclear pore complex protein, putative "
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAX42228.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG398517"
FT                   /db_xref="InterPro:IPR007252"
FT                   /db_xref="UniParc:UPI000192D415"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG58"
FT                   /transl_table=12
FT                   /translation="MPIDLVTYDQNTSIEVQFAQALERFQLNKSNTSLTSPPPPFNFLQ
FT                   KFKSIAATQALQLGEELQSKNDTDNVLREQFENWNLETKLWILVEELYSFRLSNPEENI
FT                   EIHEYSSLSLKQENYLSTHPKLKELLIIINWIQQTTNNSNLNVSGDYDTNIEQTKWQNT
FT                   KIAIETKEVNSLLNNKGVDNIVDKLDIDAPLRTNSIIDPKDQLIDSENYAIIYKLLLNG
FT                   KIQEAIDYANNTGNFALALILVGGAQDYIDPVLDGIKDSNISVASGIKHKLLWKETVYK
FT                   LSQQKGLNDYERLIYNYLSGGDISENLKASRNSWEESLLLYAYQLLSYKLQSFILENSN
FT                   EESLSLAISIPKPQSDSIEEILNILSNANSEVSLESRNPLRIISGAIMIDKVESLIDNI
FT                   NQDLVNNNNNNNENILRILVHLSIFIAIIKPWGNDQSENLTTIITLYISMLSETNKSEL
FT                   IPVYLSFIPDEKDARETYSIILSSITDKEQQTKQLQAAKKLTQPFISVNNNEGDDVDID
FT                   VDTDMVIVEDDDNKLINVLRRTVERVMIETAPNYERQQNDPVIVKDDELSVDEIDFKLY
FT                   RSVEWFYENQMYEDAIKATIVVIRRFLINGKLASLKKFAKENNFKQLISNYDIETVGED
FT                   DQQQQQQQQDEKKEERVTDDTKQELIEYTNFIEGLELIDDWKLFINQGHPFKGTSVDSS
FT                   LEKTEKVLKNILQNWLLELNTNRDDDLNPPIVQQFRILYIPYLIIELLTIYENARAQNW
FT                   KYIKQAYQLINEVADDQSNDYLNCFIKSGRIKEFMAKCGELSIIACEHGITGIFGGTTK
FT                   GKESI"
FT   CDS_pept        816998..819118
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248170" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581851"
FT                   /orf_name="CD36_43550"
FT                   /product="Autophagy-related protein, putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX42229.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG398518"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192D416"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG59"
FT                   /transl_table=12
FT                   /translation="MSSASGNQDIPPTIPEPSSNFKENTENSNSKSEEISSTFENPTFV
FT                   DDEEDNNPFSHHGEGLTSFMTANSFNEGPNIKSDKGTTKEKDNNNNNNDNNNDEDDDDE
FT                   SLLLYNTSNNNNKSNIVSRTNPMLKSTGEVFKTVNMNFESRVTKLLKPNTKIKIQITEA
FT                   GNSNEGMSNSSKKYTVYTIKLINLEDPNNDILTRRRYSDFESMRDVLTKIFPLIVIPPI
FT                   PPKNYFDFSMLNGLVGSNHENSSSSITGSNGNSGGSGGGSNITSPRTYSYINSTHLTKA
FT                   KLIDHRKRLLTNFLNNCLEIKQIRSLEFFAKFLDPNANWGDEIALIQSQLPKSIYLSNP
FT                   ENGLKTDPIYSNLPNPSNKNTISFFKDNKKKLTKKTNKLLSNGNDSQDITNGGNGISGN
FT                   GTNSQSQYIANTSMLDDINKRIMENYIGISNDYAKLGSTFNSFSLILTETTTTTTTTTT
FT                   TTEASSDTKKNNDNELNLIFDKIGQVFDRSYITINSLIGELETKFSEPLGEIVQYTSIL
FT                   HYVAKYQSKKIKQKSMLDNEIKDKRKTLEELLKIEKESNRIENAINSQVKPKNGKYNLE
FT                   QQQQQQSGVPSAPPASSSSSSSSSSKFKFPSFKKITQYVSEIIDQNPEVTRKQKIVNLQ
FT                   EKIQILEKCQNIMLADLSFITDEVNKNIQSFQKRQLNMIYKILLLYNKQLIGWAKKNID
FT                   IWEEVRDEIVKM"
FT   CDS_pept        complement(819172..820428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581852"
FT                   /orf_name="CD36_43560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42230.1"
FT                   /db_xref="HOGENOM:HBG397557"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniParc:UPI000192D417"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG60"
FT                   /transl_table=12
FT                   /translation="MNSNNTEFLQTIINNYYSNSNNNVQTTTLFILSISTLVFIYYYRK
FT                   ISTKKKNPLPGQKSPKKSLYDKSKEYQPLKPTPLVDFQWDQVEPIKSYPFKNAEYKLTM
FT                   GIRTLDPQDWLLIEPTYKARIETKSKILNNNHPDYPPTKDLRSSTLFATPESTPAIKEF
FT                   YEIVMNYMCDKYPTCFKKQEDEKMIYNLITKKKYPMHISSSTIDPYELQEFLAENIEED
FT                   FIILLKDPTRQTEENGNEYFFKAGVFGFAAGFNPIDRFNTPLSFIHHPIPGYESKLKLS
FT                   MNRFFNRLSPGQFVTRSNFSIQTHNKFYVDDSNKGYHNSNDGGDGDSGILEPMKFEDLD
FT                   FENQVHYRSERQVLTKLPQSGAIVFTIRTYLLPLSQVKNEGKEVCDRLIGAIKGFPKDI
FT                   AHYKRSEEWGEAVIQYLSK"
FT   CDS_pept        821419..825654
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248002" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581853"
FT                   /orf_name="CD36_43570"
FT                   /product="tRNA guanosine-2'-O-methyltransferase, putative
FT                   (Trna guanosine-2'-o-methyltransferase trm3 "
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX42231.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG397035"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI000192D418"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG61"
FT                   /transl_table=12
FT                   /translation="MSSALLIAKYLGTEKQAELIGNLLVDIQEEPTNNNVEILIELLDG
FT                   FDLDKYPQFYNQILNISKEKLLIENELEIILKFVYKIPQLKHDILERMIQLLYGYIKEQ
FT                   IYYFNQQLIKLIPISIVDEKIADTAADSITTDELILLFRFLQSLFTKTTGSDTPLNLEI
FT                   DYLLLLFLGINDKNVSGISSKLLRWRMDSICQKIEGQLIWDIIFTLESTNLEFHKSHAY
FT                   ILWLRYLNTGLIENNTFQTIIQNPDYWMALQQGLISDSHVYRKFSLSILQVSLISINTN
FT                   LKNDYIVWRMDDKQKYLNEWSRYMTLYEIIAIDTSLNQAEAGQNDITGLISPTSLIPSS
FT                   WGWCLLSTGLQATLESVRKFTLRLLLSIPLENLYLIKHGLPILERAFLPNLMNASNLNV
FT                   KITSTNDKLDCEYAYQLKNYICNMVKNLSTDQEFQDITLSILRVLADLKDSYGPSRILV
FT                   LHGLYDGLNQAKNTKQVLQYGIHDIPLLVLFEKKCEGEIYERYHQTLNLRLLLNFKLDI
FT                   KSFLSKLNKFTKHNGFELLKENHQLLASYIKDVPIEKFMSNQEFGDCGPEYKALFLGIT
FT                   DKDISSVLEQSKDKDLLLAKLFASGLKTTELEKFDSRLQELVLSNDIEIIQTLSQAEFE
FT                   LSGVIPDNEDISKLWGTITMEIQSNEYRILEECLYKFRLFNQIYKHSTFQFESISTIID
FT                   FYKIMLNNSYETSKTSRFFYKLKNEILGEYYSTLNITFEKTANANNSISAIIDVLNPGI
FT                   AQNKANYNMVNLLYHYLEIAETPDSIYQIVEFLSELWFNLSATRLKLQALPLHLSIIKT
FT                   FFHSKVVFSGVNVSDMLHKFGLSIIENSKVRRSFLPTLTLCLSNCQIENQKQFESYQWI
FT                   PELLVKAYLIYQPKAHFFILPIILANIYDNQVAINSNSSIYYEVYGNEEISARINLMAI
FT                   FNSIKSSNFAQSIYDYIIENQQQFHLFKPLKSTDALEEWTRMQLYSIILSLSDDTLTNI
FT                   DLDNFLARLATEPSPMVRSYIEWIIALKLTDNETYVDKLLNELLQKINVLKPSVVTSYL
FT                   KILFLFIQQQQPANKECQLLTKLLYAVIPGCTVSRKMIRHFSLSLIISIHDEIKRKNLP
FT                   LDPRVLDIVNNMYLNAIESETFTQYRSGDELLWDILKDLTLVNISGGVMLRLSDRTDLD
FT                   YIKRENFVKYLSQNQINLLKYDIGQDPQIWMVDDDNDHVNKVSMKKPIVTPIKPITSEV
FT                   SSFLQTKSGAWNTIMDADDDINTTNLRGSEIPRSELIVVSSLVDKPPNLGGICRLCDVL
FT                   GAGLLTLHDIEVKNHINFKTVAVTADQWMPMIEVKMENIKNYLLDKKREGYTLIGLEQT
FT                   DKSIELNNDLKFPKKSLILIGKEREGIPGDLLAELDFCVEIKQVGIVRSMNIQTATAII
FT                   VHAYSSQHC"
FT   CDS_pept        complement(825733..826647)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581854"
FT                   /orf_name="CD36_43580"
FT                   /product="Exosome complex exonuclease, putative (Ribosomal
FT                   rna processing protein, putative) (Exosome complex
FT                   exonuclease rrp42"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAX42232.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG397033"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192D419"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG62"
FT                   /transl_table=12
FT                   /translation="MVQLSPAEKSYLYDSLTQQPIIRPDLRSIHQYRPLVAKTSFLPGS
FT                   NGSARVRTEDGSECIVSVKSKVVLISEEEEEKNQSQNLIEVDIDIVGHRDDSNYVANLK
FT                   FQLTNLLQQNFPFEVLKLTSRYTFKLYIDCIIISHSCYPLSLISLTNYLALKTTRLPLL
FT                   ISDVNDEEIAELPTFSDDWENAKLIQDYHLNDTKEGQPSKFQPPIFITIGVIGKNLIFD
FT                   PSFEEEQVLENGLIISFYNNKVITPISNTNFAVNSNNSNFKGLDQSLLIQSLALCNKYC
FT                   PNIIRALDSLIEEDNDDNDGSIF"
FT   CDS_pept        827238..828923
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581855"
FT                   /orf_name="CD36_43590"
FT                   /product="Nuclear pore complex subunit, putative "
FT                   /protein_id="CAX42233.1"
FT                   /db_xref="HOGENOM:HBG397032"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="UniParc:UPI000192D41A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG63"
FT                   /transl_table=12
FT                   /translation="MSTLFGGQQSTQPSLFNSSFNAASSQQQQQNQQQQQQQQSQQQQS
FT                   QQQPQQQQPQLFNTQQHQQQQQHPIWLQNQKKRTIPNHLVPKKKQSFQLGTTNNNNKLN
FT                   SKNKNKNGKNRSNNGNVNGGDSIISNDNDEGQFNLLSFGSKLNRRVTSGSGSGSLLDRN
FT                   TSIASLFDNSVSDLSRIDDSFIVGGDNTVDDINDDGIGGGDGFGNDLPPKNSMYDLSIG
FT                   GGRTTRDKNGINSDSKFESFINKDPKSFDSVFNKFQEFTPILDPNNINTNNTNGTSNSG
FT                   NRYDDDKSNPINSILNGGNSSTRNDLLQNQKHYNSAIIVFGYPEYLSIEIIKFFQSFGR
FT                   ILEKFDTTSITSTNNNNNIKEVLINLANTNNNNNTANKIVPIFSGKHWIKLTFDNPNSA
FT                   LQALQENGNVFNGSIIGVVPYHKSIIEKLENRKIFINDDNDIGLGNLDIPLDKINQIIN
FT                   QQSKLVSNGGAATTPNNFINNNNGSSETVPSATTGGSLYNRLDIKPISKDQIFLKDNIN
FT                   GTTTTNGGDSQKVSNIDGNKTTDNKEKLGVWGNLSKYIFGFHDL"
FT   CDS_pept        complement(829034..830959)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581856"
FT                   /orf_name="CD36_43600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42234.1"
FT                   /db_xref="HOGENOM:HBG448697"
FT                   /db_xref="InterPro:IPR018819"
FT                   /db_xref="UniParc:UPI000192D41B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG64"
FT                   /transl_table=12
FT                   /translation="MSRKHIRRQSLVSQIQSFPFDLYLYIHELHASIDWDEYNYIIALP
FT                   LGIIFITIFSIIQSILNYYHYINKRSQNILFDSDYIHYENLKNDIIYNSGKLQQLQKSA
FT                   NSIGDTEIVDTPFTTTILWGLKLFNWFIIFIGLFNSIKLFTKRKSYGLLYCKLKPKSKN
FT                   VFKSSIERLSYIIEILAFLLKFFQNEQPEEEEEEPENSFNESSIIMDSTNELIDDNEIW
FT                   HLNVWNPSKFSLYLFIGLNPINLYIVYYLIGDNNDNTFTGDSSYSITYPSYFYLNVIIL
FT                   ICLIMIICYKLVENFSQLINDKQILYQEMFQEYNKKFVNPKVNQLKKDAMIDATMGPHY
FT                   SISLNDEKPYAFSKSKVFITHDIKGKPITEYGDIDSQILPQQLELEPATSSCSTAINSR
FT                   LTSRANSVLHYNDNDDGYQDDYDDPRYYDRAFNTSSNWNQNRRYHQQQNPRYSNNNNNR
FT                   NNENLIMNTPSTYLPQPSRYSTQTPSLNSNLSFNRYDRTPSPTRGSTTTIGRRYSNPIN
FT                   NNSLHSPSTIRSTGTIRSRPTSPNKLSPTRQPRLEFDGIGNTATATTMNNNSNIADQDR
FT                   FSPFKSPSPIHRGTYHNQSSPNTINPQQLQQSQYNAFGYPNSYRSPSPTRRRPSDSPER
FT                   PRPGWR"
FT   CDS_pept        831294..832682
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384669"
FT                   /orf_name="CD36_43610"
FT                   /product="Intracellular protein transport protein, putative"
FT                   /protein_id="CAX42235.1"
FT                   /db_xref="HOGENOM:HBG397030"
FT                   /db_xref="UniParc:UPI000192D41C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG65"
FT                   /transl_table=12
FT                   /translation="MSDKQINQFKSMNINFRDKLREAYLNNKHEFDDQDNRIIQPLLND
FT                   VLYSNGSTNNNLRESIKKKWDGLSKDINDINNSQFDIPSGNNASVVKDKSDNDQQLNRE
FT                   EELGGGLNGKYKNGDIQPQNKATTINTNNIKSRIPMIPNDNKSQVRFQQPLNNDEEINQ
FT                   LKKTIESLNNKIKHQIIEKKDIIEEFQTKEIRMMKNNQNEINKLIKKYEIKLKNQQQQQ
FT                   QQDKQTTNDNGGVIIDQLGIQIDKLNNEIDNKNLQIIQLTNQVSNLKDENFNLKRENNR
FT                   LKHSNESPSKETNPSDNSESQELRKLIDNLTKENIELRSQYNQLKNNSASNSFQYGSVQ
FT                   GDDSDDEEQEDQEEVNGIISRYKEEDDVIDRVAKSNNGLEYDTQRILKKEYGKNPRIPS
FT                   PSLSPPKLQAKIDDDSTTSKGMGTAANEAKFESELDSVTTDLLKVKKEEEIDTTQQMLR
FT                   KHWH"
FT   CDS_pept        834876..836948
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581857"
FT                   /orf_name="CD36_43620"
FT                   /product="Tyrosine-protein phosphatase, putative "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAX42236.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG448695"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI000192D41D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG66"
FT                   /transl_table=12
FT                   /translation="MSTIDNSNTTYLHSCYQKQQPQEQQQSSPNKSSTIPKLSIHPPGP
FT                   TSSTNPTSSNNTSFPFISPITPGSFDFSKPCPLSAETINSNNAKFTPSFKSPSPTTLTF
FT                   NQLPNNIHKQTIDTLQPTHYDLIVDIRGYNLYTINRITNAINCCIPTTLLKRNSTGLKT
FT                   ILNQSINLSSDLKSIIFNHLESNSSLSNFKKLNILIYDHNSNYDFISFNLYHTILKFNQ
FT                   FPNHFNISYLEGGFYPLKNDIEKYHHLIDDSDISNNNTNLPTMNNNSKLQHRKAKSLSG
FT                   LTLPTITKTTSISNNPPTSSSINNAFLQSIHKKSNGNNEPISEELRNYQLKIPYNDLQY
FT                   IPNWLNNVHLYENFEKLENSEKTSINNIFTNTTSKLNPINKLGDNNDDIMSPCCMSCQK
FT                   IEFNVPRGIEYGYKNRYKNIWPYDHSRVKLAADAATSAKSNNNNNIITSSTNCQPFIDD
FT                   YFNGNFINTNSIIPNNQFTYIATQKPLTSTICDFWNIINNENIQIIINLDYESINYFNY
FT                   HEFVKLVQPISKYSNNIMKVYLINEKIYYIQYLSWPDFGIPQDYQSFLQLINLKNKLTK
FT                   QFNLNKKILVHCSAGCGRTGVFITLDSLIQGIINNDNLEEEEQQQQQQQQQQDVVVKLS
FT                   DKFIYKSSKDLIYKLIQHQRKQRISMVQNYNQFIACYEIFIKFLINYEKSQSNQD"
FT   CDS_pept        complement(837196..838914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581858"
FT                   /orf_name="CD36_43630"
FT                   /product="Protein farnesyltransferase subunit beta,
FT                   putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX42237.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG736019"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI000192D4CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG67"
FT                   /transl_table=12
FT                   /translation="MSQSQDPNDKINYLLNIINSQRKTPTVSSDSNSSINRVRTKTNTK
FT                   TKTRTRTSPKTKIKTKTMKINNNNNQISTETTELFTNESQIIESFNSNCTINTSFYSNS
FT                   NPNDKLHVYKSPIIDITKYFSPTVESQMDLELIILNEYYSKTHNHQPQNDNDDDDDDDD
FT                   DNDEDELNHFYIDAHLKYILSSLTNPMSSGYQVLDVNHSWMIYWLLNSYYLIQNPTLEI
FT                   NQSILDLIVDKISKCINYPDTSSSGVFDGIGGGINQLGHLASTYAAILTLILTDQYELL
FT                   NSLRELIRDWLLTLKKNVGSGGASFIMHENGEMDARSTYCALIIINLLNLTNYEDDNSI
FT                   ESVDPLIDGVENWLNSCQTYEGGFSNIPNTEAHGGYTYCALASYFLLYNDWKQFSSELS
FT                   TTNIDWGKLLEWSVYRQHELEGGVDGRTNKLVDACYGFWIGGLSPLLQLIVRSQGQVNH
FT                   SVKIFDEEKLQQYLLIIAQEETGGFKDKPGKQVDYYHTNYSLSGLSILEHNYEFSQDKT
FT                   FSLAFQIDINKEEEDNFTNPIHPVFGIPINFVKKCHEYFRLKTISKPKPNSKQRT"
FT   CDS_pept        840459..842117
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581859"
FT                   /orf_name="CD36_43640"
FT                   /product="UBX domain-containing protein, putative "
FT                   /protein_id="CAX42238.1"
FT                   /db_xref="HOGENOM:HBG397029"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="UniParc:UPI000192D4CB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG68"
FT                   /transl_table=12
FT                   /translation="MSSSISDWIGSFFQPSTTYQRVGNNSNTNIPGSFPTEESNSPLPS
FT                   SRINSVFNSQTINSTFRNLSSWLNYLLIQPLIIIILIIFRILSTIINVIYFQNQSTSIV
FT                   NGSGSRDSITNNNNSRYEIVDPVAKASKFIRDLEDNLQPPSILQGNNTNGGSGGNVVND
FT                   THSPVTSATGTATATATATATTISASERLPPFFQGSYTQALYMATKRGKFLFVYLTNPH
FT                   NENANGIFNNIITNEMFLKIFQTNENIIIWGGDLTNPEAYQLANSLAVTKFPFLGLLCL
FT                   TRSSKMTPEGPRKTASKLSLVSKIQGNIINNHNSRQFQTQNGNVDDGDGDDDNNNFVSV
FT                   ANELIKKKFLTKITKYSPELNLIRQELQDKYMSQILLKQQELNYQKSLQADKLKKQQKQ
FT                   YDTLSKQYLIYQLDRFEKYLTKDQTSNDGNNIARIAIKLTNGTRVTGYFPSDNSIEDIF
FT                   IFVELINRGYLNPISTSTTTTTTTPHHSVISTLTESQALIKFKNFKLIYKFKLLSPLPP
FT                   KICLNDELSKDIIMKINQFDIIYPNGLLIVEDIQN"
FT   CDS_pept        complement(842158..842649)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581860"
FT                   /orf_name="CD36_43650"
FT                   /product="Signal recognition particle (SRP) subunit,
FT                   putative"
FT                   /function="7S RNA binding"
FT                   /function="endoplasmic reticulum signal peptide binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="CAX42239.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0030942"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="HOGENOM:HBG397028"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniParc:UPI000192D4CC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG69"
FT                   /transl_table=12
FT                   /translation="MTRLDNSQFLKQVETLTQSNNGKSSIYLTQKRLSSSSSSSITTTE
FT                   EGINDLPTNVITPHPKTTTTNTTTNTINNDSKYPLLIRLSMNSSDNKSKTKTKTKTINK
FT                   EKERVKISTVVEINQLNEFWDQYIQILKTGFMGLKKKKDKKKSHTGGNSSSTTNKIKKK
FT                   "
FT   CDS_pept        complement(843038..846571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080472"
FT                   /orf_name="CD36_43660"
FT                   /product="Pyruvate carboxylase isoform, putative "
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="pyruvate carboxylase activity"
FT                   /biological_process="gluconeogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX42240.1"
FT                   /db_xref="GO:0004736"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG717218"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI000192D4CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG70"
FT                   /transl_table=12
FT                   /translation="MTSLQKATSQDARINQMRRESTVLGPMNKILVANRGEIPIRIFRT
FT                   AHELSMQTVAIYSHEDRLSMHRLKADESYVIGKKGQFSPVGAYLQIDEIIQIALKHNVN
FT                   MIHPGYGFLSENSEFAKKVEENGLIWIGPSYKTIDSVGDKVSARTLALENNVPVVPGTP
FT                   GPIESVDEAKKFVEKYGLPVIIKAAFGGGGRGMRVVREGDDIEDAFKRATSEAKTAFGN
FT                   GTRFIERFLDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEIAPAKNLPKSVRD
FT                   AILTDAVKLAKSANYRNAGTAEFLVDEQNRHYFIEINPRIQVEHTITEEITGVDIVAAQ
FT                   IQIAAGASLQQLGLLQDKITTRGFAIQCRITTEDPTKNFQPDTGKIEVYRSAGGNGVRL
FT                   DGGNGFVGSIISPHYDSMLVKCSCSGSTYEIARRKMLRALIEFRIRGVKTNIPFLLALL
FT                   TNEIFITGDCWTTFIDDTPSLFQMISSQNRATKMLLYLADLVVNGSSIKGQVGYPKLDT
FT                   DAIIPEIHEPKTGITIDVDHTPPPRGWRQVLLEEGPEVFAKKVRQFNGTLITDTTWRDA
FT                   HQSLLATRVRTIDLLNIAPTTAHALKGAFSLECWGGATFDVCMRFLYEDPWARLRKLRA
FT                   LVPNIPFQMLLRGANGVAYSSLPDNAIDQFVKEAKDNGVDIFRVFDALNDLDQLKVGMD
FT                   AVKKAGGVVEATVCYSGDMMKPGKKYNLQYYLNVVDEIVKMGTHFLGIKDMAGTLKPAA
FT                   AKLLIGEIRNRYPDLPIHVHTHDSAGTGVASMTASAIAGADVVDAASNSMSGLTSQPSI
FT                   SAILASLEGSIETGLSESMIRELDNYWAQMRLLYSCFDADLKGPDPEVYQHEIPGGQLT
FT                   NLLFQAQQLGLGTKWVQTKETYKIANQILGDLVKVTPTSKVVGDLAQFMVSNTLTEEDV
FT                   NRLASELDFPDSVLDFFQGLMGTPYGGFPEPLRTNILGNKRQKLDQRPGLTLPPVDFTA
FT                   IKEELTSRYGTQITETDIASYVMYPKVFEQFRKIVDKYGDLSVLPTRYFLKPCNIGEEL
FT                   TVDIEQGKTLIIKLMAVGDVSDKTGTREVFFELNGEMRSVSVEDKTVSVESKTRPKASL
FT                   PNEVGAPMAGVVIEIRAHKHQQIAKGDPIAVLSAMKMEMVISAPCSGEIGDILIHEGDS
FT                   VDANDLITSIH"
FT   CDS_pept        complement(854642..856192)
FT                   /pseudo
FT                   /gene_family="HOG000093772" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(871112..871390,871393..871668)
FT                   /pseudo
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT   mobile_element  complement(877460..877741)
FT                   /mobile_element_type="retrotransposon:solo LTR, upsilon A"
FT   mobile_element  complement(878181..878474)
FT                   /mobile_element_type="retrotransposon:solo LTR, psi H,
FT                   truncated"
FT   mobile_element  complement(878475..878920)
FT                   /mobile_element_type="retrotransposon:solo LTR, kereru A"
FT   mobile_element  complement(879251..879661)
FT                   /mobile_element_type="retrotransposon:solo LTR, zeta I"
FT   CDS_pept        882436..884925
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17581861"
FT                   /orf_name="CD36_43680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42243.1"
FT                   /db_xref="HOGENOM:HBG397008"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D4CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG71"
FT                   /transl_table=12
FT                   /translation="MMSHQQLINPHGYNSGGDGESIISVDKELPTSCTSSSINIIAKFI
FT                   KMISIKFQKIPPFRIKWFISTIAIVIYSTIFNITNLIMFSKFTKNFNSVNPLSVIFLFL
FT                   DVFIFLVVIYEKFYHKNNNEFTNKWSKYTYIIVCKILKKILWLILLIACIFQVVLISIG
FT                   KLSNPLNVNDNQLDILNMSQHEKTGYFIVNLINLVFNGALLGIWWSTNISSVYLLFASI
FT                   NFINILIAISLVQINISYFNLTSGSVRKLHNLFIITGTFMTGQSAIGLSIVLLINEKNR
FT                   LKDFIGKLIFFYDVYVTLLFSLLLGCTIVSGIYFDYKASFPISIFILYLCSIIISVVSF
FT                   LCTRYFRLRGGFTNEYQVEEYDLLSLTVHQKQGWGKLIDINHKYNGGISGDYVISLMEN
FT                   YMEADLPGMSCKVLRVFKKNETTITTTTTQLSQKLKHQSKKNLNTAFEDLDHESLLFQD
FT                   TPTLCDTTSSIKHLEDEYRPLSKNQLKRLAKKNQKDKKLLELKSLENNTEIFYQELMNT
FT                   EALILLTIIEEFDLSERIPGWIGKKLNKWFGKNSKYPFLCIRFGLLGFHWPFKRSTFYC
FT                   SATKKPVARGAAVLYAISQWNSQHEKLTVLLDPTYKDVNFEAGITSSGWYKIKLPNSHI
FT                   IDLRPFQNQTSTDYFKAIKYRTQDNSFKQANGQVIETNIFNYENCQEIINMNQNISQNR
FT                   QSSGQSQQLLQPNWEFIYNLGNYSNEKKYRSLLFLKVDNEIIASCVIFRLGDTMTSDIQ
FT                   GLNHVISKKYKAYFVMMQEVIKIGLREGVKFIDFGPTTEEAKVTIGCNVVPLCGSIYPK
FT                   NKFLGPIIKFAASKVDV"
FT   CDS_pept        885332..886288
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582829"
FT                   /orf_name="CD36_43690"
FT                   /product="Inositol phospholipid biosynthesis protein,
FT                   putative"
FT                   /protein_id="CAX42244.1"
FT                   /db_xref="HOGENOM:HBG397019"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI000192D4CF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG72"
FT                   /transl_table=12
FT                   /translation="MSTTIYDDHYIKMTKVFKSIHSQTKLKVYEVLFASSFILNFLLGR
FT                   LIHFSAPDEEVYNYYNDKRNILNQWFVKRGWGWTTLVIILFYSNIIYKQYVNSTTTTKN
FT                   NKQTLIIKTIRNAIINYIVVTIWWIFFTQWCFGLPIMDKIFVLTGGKCSIDINNTANSF
FT                   TTTSTTVFTPNHHIHPSFVQKLENIWESTGITSYNCRRIKGSQWIGGHDPSGHVFLMIH
FT                   SSLYLFNEMINYWPNWSYIKHNISQLLTSTRPLTINDRLLLLWNTPQLIIIGLIGLWWF
FT                   MLLMTNIYFHSSLEKLVGLIFGYIGVAGLYWIPRWLS"
FT   CDS_pept        888553..891423
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537660"
FT                   /orf_name="CD36_43700"
FT                   /product="Integral plasma membrane protein required for
FT                   axial budding in haploid cells, putative "
FT                   /function="calcium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42245.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397018"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniParc:UPI000192D4D0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG73"
FT                   /transl_table=12
FT                   /translation="MMINLLVLLISMSPLIQASIYMGFPFNEQLPNIGRVNQEYSFTIA
FT                   NTTYKSNSNGEISYQVNNLPSWLSFDSSTRTFTGKPQESDVGQFEITLIGTDSTDQSQL
FT                   SNSYTMMVSNDTGLYLTSTGLLLSELSKSGQTNGNGGLVVKPGDKINIQFEKKLFESYS
FT                   TSDRPIIAYYGRSADRSSLPNWIYFDGDALTFSGTVPYVTSENAPSIDYSFSFIASDYY
FT                   GFAGAEGKFKIIVGGHQLSTSMNQTNIINGTIGSIIDEEIPILSKVFLDGQTITKENIS
FT                   DIYSQNLPNYAIFDKNNFTITGNFPNTSSSDNFTIVVKDIYGNSVELSYSFDIIDSIFT
FT                   IDSLKDVNATKGQYFQYQILKSYFTDVNNTKVNVNFGSGSNSDWLQYHDSNMTLSGITP
FT                   KNFNNLKVEIDAESNSDKESRSFQIKGVDKKIVSSTSSSSLSSSTSSSSSSSVSSSTSD
FT                   SSVVATETSSPITHKKSNKNKALAIGLGVGIPVFLILVAALILLCCCFKRRKNKGKGTD
FT                   DNDEYPNDSRKPIPTNGVATGVAGAGAMAGAGAAVIATSSNESIKDESTMNVLKLEHNY
FT                   SKSSSSLTQVETSSTESFYDTHENTPIVKSWRANTESDNKLARISNGSLATVNTENLFS
FT                   VRLIDDYSARNSETSSKFLSNNSLNALLRRESSSNNNFQRLDSNGNIVGELNNHSKSNR
FT                   SSSSEKYMTQLSSPLPPSSLPQSQANLDIVPEEKSRDLTQTGKDETTGTISNLLLQFND
FT                   NRSIDEYDNSIATRQQYGKQQQQQQQQPQHPLSRENSFSNHYDFDNRLPSPNYALEAKS
FT                   NKYGGTNSNGSTMISPSSDTFLLDESTPVNNHHIISTTAPTTTTTTTTNNNNNNKDGQT
FT                   MEHQNSSAISLGSINSDKFFFDKNHHSNNNNNNNNGHTPPPNNLNIGKSAKLVDFTRKG
FT                   SLRESAYEPDYVYTGQSASIQIDDSD"
FT   CDS_pept        complement(891881..893404)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080721"
FT                   /orf_name="CD36_43710"
FT                   /product="Acyl-coenzyme A thioesterase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42246.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324302"
FT                   /db_xref="UniParc:UPI000192D4D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG74"
FT                   /transl_table=12
FT                   /translation="MIRLIRQSSIQKFVQPQPKLLLLLRYNSQQINFHKPDKAYSNERS
FT                   EAADAAPTILSELHDEKVHPNKATWLDALKQREKFQAEGKTLDSYSYIDPITTAVGEKT
FT                   RSDSFSYLILPFKNDKWLCDAYINAFGRLRVGQLFQDLDALAGRIAYRHCSPAEPVNVT
FT                   ASVDRIYMIKKVDEITNYNFVLAGSVTWTGRSSMEITVKGYAFEEEENFTHIENEESLS
FT                   EENVFLSANFTFVARNPVTHKSFAINRLLPISETDWVDYRRAESHNAKKKLMAKNLSLI
FT                   EPTPEESKLIYDMWKSSKSLQDVEKTNDGIAFMKNTVMKSTLFMQPQYRNRHSYMIFGG
FT                   YLLRQTFELAYCTAATFSSAGPRFVSLDSTTFKNPVPVGSVLTMNSSISYTEHLHELNQ
FT                   IKEEIDNDSPFNFSLPPTNKISKSPDAFLSEPGTLIQVKVDTYIQQLEQNEKKPAGTFI
FT                   YSFFVPKEGGNSNFCSVIPQTYSEMMTYIGGRRRAQDTAHYVETLSISK"
FT   CDS_pept        894948..896087
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232066"
FT                   /orf_name="CD36_43720"
FT                   /product="E1 beta subunit of the pyruvate dehydrogenase
FT                   (PDH) complex, putative"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX42247.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI000192D4D2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG75"
FT                   /transl_table=12
FT                   /translation="MSSFSSVTRTAKLATQSLKYTTRPSLATIGQFQTSKIIYRANSTQ
FT                   STPVQEITVRDALNQALSEELDRDEDVFLMGEEVAQYNGAYKVSRGLLDKFGEKRVIDT
FT                   PITEMGFTGLAVGAALHGLKPVLEFMTWNFAMQGIDHILNSAAKTLYMSGGKQPCNITF
FT                   RGPNGAAAGVAAQHSQCYAAWYGSIPGLKVLSPYSAEDYKGLLKAAIRDPNPVVFLENE
FT                   IAYGETFQVSKEFSSPDFILPIGKAKIEKEGTDLTIVGHSRALKFAIEAAEILEKDFGI
FT                   KAEVLNLRSIKPLDVPAIVDSVKKTNHLVTVENGFPGFGVGSEICAQIMESEAFDYLDA
FT                   PVERVTGCEVPTPYAKELEDFAFPDTEVILRACKKVLSL"
FT   CDS_pept        complement(896339..897427)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000032533" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582830"
FT                   /orf_name="CD36_43730"
FT                   /product="Endonuclease/exonuclease/phosphatase family
FT                   protein, putative"
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /protein_id="CAX42248.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG650771"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000192D4D3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG76"
FT                   /transl_table=12
FT                   /translation="MYPEMTRETDPLLKNKPQPKPKPKPKPQSSVNPLFKKLLTIVIPL
FT                   SLIIISSYYIMTHQHHHQNNSDGPNLNLRLYTNNIRFDNKNYPDKYEQPWEIRKIQSIN
FT                   SMKFNTFQGNGNIICLQEVLHNQLLDILEGLNEIEEWNYYGVGRTDGKTSGEYAPIFYK
FT                   DKDFKIIENSTFWLSPTPNIPSKGWDAALERIVTMVTFESRLNPQIKFNIFNTHYDHRG
FT                   IIARRKSSQLIVDKMKNYNDYPSFLCGDFNTEPNDEPYHILTTAGFKDGKILIDKNSAY
FT                   GFETTFTGFDINNEPISRIDYIWSPAFTHTSLSSENETGNDSDDTYEVTLKQFGILSNW
FT                   FNGHHFSDHRPVVSTYELRKKK"
FT   CDS_pept        complement(897922..898521)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582831"
FT                   /orf_name="CD36_43740"
FT                   /product="Cytochrome c oxidase assembly protein, putative "
FT                   /protein_id="CAX42249.1"
FT                   /db_xref="HOGENOM:HBG397017"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI000192D4D4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG77"
FT                   /transl_table=12
FT                   /translation="MISRQLMGLVPKPAITVRRFFKTTSIIFQKSATTAPESSTSIPHP
FT                   HVTSADYKPPVTIDRELPDPFSKKKTNRRYLFVYAIGVTLSCIAIFNYEKTQSPIITSS
FT                   LYFLRRSQPSIELLGKDIDYSSSWPWIWGKLNTVQGIINIEFSVKGSKGNGVVKLNATR
FT                   ESKAHPFDVHQFVLEVERDGKKEVVDLTKEPNFDLM"
FT   CDS_pept        898734..900752
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080722"
FT                   /orf_name="CD36_43750"
FT                   /product="RNA polymerase II transcription factor B subunit,
FT                   putative"
FT                   /protein_id="CAX42250.1"
FT                   /db_xref="HOGENOM:HBG397016"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI000192D57C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG78"
FT                   /transl_table=12
FT                   /translation="MDIIRGACSVDKVGGMVYIREDLAPSMLEWKPIDEQEEDRAISIP
FT                   LNSLTTLQSTKETSPKMILKIVYKLTSGPSNSEETNNNEEEKSFKLIFTNRPTMNTIKD
FT                   SLQTIVARSRTRVEGTSTPTPALGSMTQADSTRDSTSTPIPASSSSPSGTLNTSSSLLS
FT                   LAASQSLSDANLLKNFELQQKLLLEDRELRDIFTKSVMQFKLSPQIFWSSRLNQLRTFA
FT                   LTISQHKGPYNVLSTIKPVATSDNQVNVNVTRDTINEIFTIYPIIKKAFDDLVPNKFSE
FT                   GEFWSRFFNSKLFRRLRGDKISISNSRGDVVLDKYLYIDQNYQDKLQKSSASEKGETGG
FT                   SENDVAIPETPHVNKFLDLMGNQQDNSQKLGNRPDFTMRYDDEETNLDNNNNKKKPALG
FT                   NENEMIILMKNMNRLSSKMMSMSSAKEVEKPQTTTIDGLSAAEINEYEEELDLHDLNDF
FT                   ENLQYIKLNINPDIAKGTNIDHDSNTNNEISQDELHKYLQSQSFHGQIELTETYTSKSE
FT                   EIEKTSMEIAMLIKQNFRTFKLINKENDITGTNIVPNSLIQEIITYNITIIEFLSHFWK
FT                   IFLHGNNPGQLKKIFTSLKNCQSGLIELENKAINQFKSMDILEKNQKLQDKVLKDFVSC
FT                   LQPMKIALDKACNEYVEAVRKAKPELNENGKRPLPEE"
FT   CDS_pept        901879..902442
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080723"
FT                   /orf_name="CD36_43760"
FT                   /product="Uncharacterized protein, putative "
FT                   /protein_id="CAX42251.1"
FT                   /db_xref="HOGENOM:HBG397015"
FT                   /db_xref="UniParc:UPI000192D57D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG79"
FT                   /transl_table=12
FT                   /translation="MAKKISKHSRAARRGLIDTDTNNEAKSLESIPREKSDVKKSIIRT
FT                   TIKNENLLNKKLELSKIKKSTNKKKTSALKHKLERSDKLSGVLATKIDQSIARAKYVQN
FT                   ARKSGWDKTNQNITLENHLAEELKSASGLGEKKKELTQEELDKIEEDEYVKSIFAKKEE
FT                   QQEKETPNSSLGNNRFALLNDIED"
FT   CDS_pept        902797..904515
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582832"
FT                   /orf_name="CD36_43770"
FT                   /product="Calnexin, putative"
FT                   /function="calcium ion binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAX42252.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG444251"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="UniParc:UPI000192D57E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG80"
FT                   /transl_table=12
FT                   /translation="MKYALVLLLSLVHATVKYVPFDKTQLDPLSFFEQFDYPSLKSSPW
FT                   KLSTAKKFDEGRDEIVRYTGEWKIEPSTSKYPGLEGDLGLVMKSRASHYAISYKLPHEV
FT                   TNSNKNQDLVLQYEVKLQQGLTCGGAYIKLLDSSPSGYKFFNSETPYQIMFGPDVCGSE
FT                   NKIHFIIRKQLPNGTIEEKHLKHKPMARTNELTNLYTLIVKSNQDFEIRVNGQVAKAGN
FT                   LYNNQKLFTPPFEPPKEIPDVNDKKPDDWDDRAYIPDPTVEKPEDYELKHEYPQVRDPN
FT                   AAKPDEWDESAPRYIPDPDAVKPEDWNDNEKEWEPPLIVNPKCATGCGPWEAPLIPNHD
FT                   YIGPWFPPDIKNPNYNGIWTPRLIPNPDYYEVKTPGKLDKPIGGIGFELWSIESDILFD
FT                   NIYLGNSIKEAELIGNTTFTIKYELEADQRRENKPRAKNEPVAPPRNFEDIIRDDSIST
FT                   LQQFLIFIKLFWLRQYVQLKDFYFELMLDPIGLVTANPLKTLVYAFLFLFSFTIFFGFA
FT                   STVMFLLQGGEVFGSTTTDQNNTERVSNAEEIEIPSSNVQKIEILDEQIHVRQRK"
FT   CDS_pept        906164..907039
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537661"
FT                   /orf_name="CD36_43780"
FT                   /product="Uncharacterized cell wall protein, putative "
FT                   /protein_id="CAX42253.1"
FT                   /db_xref="HOGENOM:HBG397014"
FT                   /db_xref="UniParc:UPI000192D57F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG81"
FT                   /transl_table=12
FT                   /translation="MKFLTAASLLTLSSSALAAIKDIQLYAQSSNNEVNDFGISSQHEG
FT                   AALNYLFLAAPGVAQNLKYDDETKSIFAELKTASSTVRQPLNVGSTVLQLGGSGDGVKV
FT                   DIAEDGTLTFDGSDSVGAAKNINDPYNYSEDSYAVVKGVDGAIPIKIVAKFTGDNKESG
FT                   SSSAPEPTASSSESPKETPVYSNSTVTLYTTYCPLSTTITLTVCSDVCTPTVIETSGSV
FT                   TVSSVQVSSGTPAASSEAAPPKTTVDSVSKPAPSGDKPTAAVTSFEGAANALTGGSVAI
FT                   AVAAAIGLVF"
FT   CDS_pept        909281..910114
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080724"
FT                   /orf_name="CD36_43790"
FT                   /product="Uncharacterized cell wall protein, putative "
FT                   /protein_id="CAX42254.1"
FT                   /db_xref="HOGENOM:HBG397014"
FT                   /db_xref="UniParc:UPI000192D580"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG82"
FT                   /transl_table=12
FT                   /translation="MKYFTIATLLTLTSSALAAIRDVQLFAQSSNEEINNNGLISRREG
FT                   AGINYLFLASGGAETLKFDDETYTVFSELQTGSTTARQSLVVSGGVVQLSVTGQPLHVE
FT                   ISEDGTVKFAGSDSVAAAKNINDPYNYSKDSFAVVTNGGEGSIPFTIVAKFVGGEKSSS
FT                   TAKPTEAPTETPVYSNKTVTVFTTYCPESTTITLTICSEVCTPTVIETSGSVTVSSVLP
FT                   SSTEAPPKTSVAAPSTTAEAKTTAPVTSYEGGANEIISGGSMAVALVAAAIGLVI"
FT   CDS_pept        complement(911693..912229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582833"
FT                   /orf_name="CD36_43800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42255.1"
FT                   /db_xref="UniParc:UPI000192D581"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG83"
FT                   /transl_table=12
FT                   /translation="MKCICLQKYNKEESMKIFYRFGIVVSTAMVSISCSSFYLYLFFKK
FT                   KTSISTITTTMVKTINVIICSPPPPNKQLFYILASSLQYTVKYLSVDFIKDPFNQLIDH
FT                   SRAKIQKKPTSSLIEAFYVVTLLDVCTSLIVEKQYQQIFPPLTMKMMYSIYADYCHFIC
FT                   CHRHHRRISTNNRLC"
FT   CDS_pept        912805..913416
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582834"
FT                   /orf_name="CD36_43810"
FT                   /product="Uncharacterized cell wall protein, putative "
FT                   /protein_id="CAX42256.1"
FT                   /db_xref="HOGENOM:HBG396485"
FT                   /db_xref="UniParc:UPI000192D582"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG84"
FT                   /transl_table=12
FT                   /translation="MKFLAILSLSSSALATISSIQLFAKSSDSKVDGLGLYSKHEGAAI
FT                   DYLFLSKNGADLKYDDEKKQIYQELKTASLTVRQSFTLGGDVYELGATDNFIPVTINKD
FT                   GTLSFTGDDKVFASKNVNDPYSYSNSEYAVSNKQTDDSAPITIVAKFTDGNAAASSDVA
FT                   QASSSASSEQATVSNFEGAAGQNKLSYGVGMAAVVAGLVL"
FT   CDS_pept        complement(913928..914353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582835"
FT                   /orf_name="CD36_43820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42257.1"
FT                   /db_xref="HOGENOM:HBG397012"
FT                   /db_xref="UniParc:UPI000192D583"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG85"
FT                   /transl_table=12
FT                   /translation="MIILLTMEFLVLAIIGATYASVLFEPSAQSVRNMRKVNNRSTTYS
FT                   NANTFKRKIKRSSRIKLTKPRVKSGKNRMQWQSDQTMTPFTTTGQRSTGVRPRKTTNAI
FT                   WINETCADEEPPPYSAREKGTRRKKLKLKLRSIFRIN"
FT   CDS_pept        complement(914869..916410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384918"
FT                   /orf_name="CD36_43830"
FT                   /product="Carboxylic acid transporter protein, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42258.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG293363"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D584"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG86"
FT                   /transl_table=12
FT                   /translation="MTAADTHSITSVDVQEHNRHIIRPPKFTWPAIRKYAITRVTSLWV
FT                   GWDELKQYSWHEVLNPFEPLVELNLHQWNFFFLGFWAWTWDALDFFITSLNVSNIAKDL
FT                   DSTVKDVSWGITLVLMLRTVGALIFGAIGDTYGRKWPYIINLSCLMVIQIGTGFVTTFN
FT                   QFLGLRALFGVAMGGLFGICAAEALGDAPKKARGVLSGIFQEGYAFGYLLAVIFQRAIA
FT                   DTTEKTWRSVFWFSAGPPIIFIIWRFINPETDSYQRQKERFDQGALQKNSKTAEFKSQA
FT                   KKALNQYWLIIVYLIFLMAGFNFSSHGSQDLYPTMLTQQYHYGKDKSTVVNVCANLGAL
FT                   AGGIVISHLSTFIGRRTAILIGNIIAGIMIYFWAFHPMWITAFFMQFGIQGSWSVVPIH
FT                   LSELSPPQFRSFVSGVSYQLGNLVSSASSTIEATIEEQIHDYGKTMAIFIGAVLAYLMF
FT                   VVFIGPENRGAELGVERDDEYSAYDSEREDRGDSDLEEGNITQKTLEKPEVEHKE"
FT   CDS_pept        919813..920265
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582836"
FT                   /orf_name="CD36_43840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42259.1"
FT                   /db_xref="HOGENOM:HBG397011"
FT                   /db_xref="UniParc:UPI000192D585"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG87"
FT                   /transl_table=12
FT                   /translation="MGIFINKLLGVFKSSSNNQQQQQQQQQQQQQQSLVETNNAKIIHK
FT                   CPKITLGTTNDNDNNNNNNNNQDTNSITHMNESQLQSVELWQFPQYQPVSDHSYKRSSD
FT                   NRRRSSNDSMMTMSTIISRRRSIELVAQELEIENIKNSLPEGFKVD"
FT   CDS_pept        complement(920562..923297)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094092" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080725"
FT                   /orf_name="CD36_43850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42260.1"
FT                   /db_xref="HOGENOM:HBG397010"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI000192D586"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG88"
FT                   /transl_table=12
FT                   /translation="MVATRRSSGKFIDVELSDNGKELQEVIPIEEQRAAIARASQESEE
FT                   QEEQEQEQEEQEEEEGIQEISPMMVKPIPPSPTPTKKKETRGRKRKNSNITNSTASDSS
FT                   ASSSSSSSSSSSSSSSSSSSSFDPVKKIERRGRKRKNPDNSSPTVIKRTSLQHNLVSPS
FT                   KTQTTTNNVLTSTTNIIPNKHKINHLLTDDAPLHPPLLQNHSNSNATLPTAHPHPQSIP
FT                   TTVSLPTTTTTTTTTTTPPQRPVLPTPAISSTSSASMQYMSAANPLSTNWTAPMTNNIQ
FT                   RTSSKKNNTTTTSTSTSTSTTTKASTPSTTRSTRRGPSSGNSNGRIPITSIISQKIDSR
FT                   DIPLMLDDGSGTENGDKKTKRRYRVDRDNIKINKRIMSQDTEEVIKMFKKFDDEVLTNS
FT                   EARSRLLNLGFETRKRYITTFKHYIRFCCKKKLNNFFVTGELMKEFYQEQFIMSSSNKP
FT                   VIRLRKMDPAFSKLQEINFLVYHLPNKDIPNRHLALEYLVYKEMGQDPPPPPPPPPANG
FT                   SSEGKISPFNQSNAVPVSGPVSGPIPVPGPVSGPIPVPVQVPIPGSGPGSGSGPVLPSI
FT                   ENLDSRQKTSTINSSNKNVLEQSQLSSPPQLQQKENLTPLTRNSSNKRGRKSLKSKLNL
FT                   QSSTSGTDVGDTSSSDSNALKMINMQSRYVPPSPQQQQQQQQQQQQSQKSQKSQKSSSQ
FT                   HASLPPPPPKNSLVSSSTTSNNNKSNGNTPIYTKKVTKKNIEAIRKSFSKMRKDIQESL
FT                   NRDISIDPAFVSKLSDTINFSLDEFELQLNGPSPPPPPPPQMNNNGIPIIDLNNKIYTV
FT                   YDILEEWYKIEPSISSRLEKWGENWIRDSIDHNTFLERKLVVEFVERMSKECNVDIYVI
FT                   ANDCDKYIRDKSILQEFIAELDLDVDDLFKRILRYRQRRG"
FT   CDS_pept        complement(927544..928815)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080726"
FT                   /orf_name="CD36_43860"
FT                   /product="BZIP transcription factor, putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42261.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG397009"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000192D587"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG89"
FT                   /transl_table=12
FT                   /translation="MSDEPTSAALLEQLVYIDNYINGNASTATDSSTATPNLDMDGQLS
FT                   LDLAAFADDSFIFPDEDKKHNHDNNNNDSNWNIQEFDHHEVGHSHSLSHSHHHQHQNHH
FT                   QSHHVEDLNNNNILRQQEFQSHLPSLSHQPHHLSSSLLASQSHGHTNLSLTTHQPIEEL
FT                   NFINPSSSFTNLTDLPKFPVPPGAKSSLIDAGLSQNQIDLLSALVAQHQASLGNPIPSA
FT                   LASVSFSSGKSPNATTTTTTTTTPLSVSPTELPLRNNNNNNNNTTIAPIITTTTTNGNG
FT                   NGNGNHHLHRSSVSSQSSNTTMSFLDPIPSSSSVSPSSITTGGGSGGGSSSSGNNQIQG
FT                   FSSELDKKRRNTAASARFRFKKKLKEKQMENKIQNLENLIINLENQLNNLEMENKLLRN
FT                   MITVKGTQKSNDEVKLLREKAKLN"
FT   CDS_pept        complement(930178..932814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582837"
FT                   /orf_name="CD36_43870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42262.1"
FT                   /db_xref="HOGENOM:HBG397008"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D588"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG90"
FT                   /transl_table=12
FT                   /translation="MPTQQSTDSLDEPESVSKQPQHQHDTSQINHNKEETGKESGKLDN
FT                   FKQYILKTIKKIPTPKLIWIISPIAIVIYSTIFNITSEILYSKFTYNSYGTSFYKIVVL
FT                   FLDVFIFLIIIYEQIYFTNNINHFTNNHNNSNNKNKNNKNNKNKNNKNKWSKYIYIIIC
FT                   KILKKILWLILLIACIFQVIVISTGKLNNPLNIENDDYNYNHNHNDNYNHNYNYGKNFE
FT                   ITPKEKTIYFIINLFSLIFNGAVLTIWWSTNISSVQTLFGLINLMNILIGISISQINIV
FT                   HIHNSYGINRRLHNWFILMGSFMTGQSTIGLIITLLINEKNRLKDFIGKLIFFYDIYVA
FT                   TIFGLLLGCTIVSGIYFNNDTSFPISIFILYLCSIIISVVSFLCTRYFRLRGGGFTNEY
FT                   QVEEYNLLSLTVHQKQGWGKLIDINHKYNGGISGDYVISLMENYVNAKLSGMSCKVLRV
FT                   FKKNETTTTTITTTTSKSLQKLKHQNKKNLNTAFEELDPESLLFQELPTSQSYESPEVK
FT                   HLQEEYRPLSKNQLKRLTKKNQKDKKLLQLKSLENNTEIFYQELMNTEALILLTIIEEF
FT                   DLSERIPGWIGKKLNKWFGKNSKYPFLSIRFGLLGFHWPFKRSTFYCSATKKPVARGAA
FT                   VLYAISQWNSQHEKLTVLLDPTYKDVNFEAGITSSGWYKIKLPNSHIIDLRPFQKIQTS
FT                   IDDYFKAIKYRSQDNSFKQANGQIIETNIFNYENCQEIINMNQNISQNRQLSGQSQQLL
FT                   QPNWQFIYNLGNYSNEKKYRSLLFLKVDNEIIASCVIFRLGDTMTSDIQGLNHVISKKY
FT                   KAYFVMMQEVIKIGLREGVKFIDFGPTTEEAKVTIGCNVVPLCGSIYPKNKFLGPIIKF
FT                   AASKVDV"
FT   CDS_pept        complement(934732..935172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000242147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582838"
FT                   /orf_name="CD36_43880"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex, putative"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX42263.1"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG628910"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="UniParc:UPI000192D589"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG91"
FT                   /transl_table=12
FT                   /translation="MSTQTDQPITDQQKKEQEQYTNLINSLPTRWEIELEFVQSLSNIP
FT                   YVNYLAQNNYFNDENFINYLNYLQYWTQPEYSKFLVYPNCLHILKLLQDENFRKNIINQ
FT                   DFMNLLMNDMVKRWQSNANDQDETKDKEETKEVSEVKINGTS"
FT   CDS_pept        935430..935975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582839"
FT                   /orf_name="CD36_43890"
FT                   /product="DASH complex subunit, putative "
FT                   /protein_id="CAX42264.1"
FT                   /db_xref="HOGENOM:HBG397005"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniParc:UPI000192D58A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG92"
FT                   /transl_table=12
FT                   /translation="MSSTPVTPQTNSSSKVKISTSREVALEQELSQITNINTVLEQFLH
FT                   TIEKVNGDLNQINNGATNTMILMNKWTDIMSQADFTLDVINNSGWIPNDEYDNEFGERH
FT                   QQQDEEVEEEEKDDNDDDDEEEIEAKLRALEQENLEISKKIESHAREKNAKMNRAREID
FT                   NKRKRELGLFNVRKKTTR"
FT   CDS_pept        936384..937925
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582840"
FT                   /orf_name="CD36_43900"
FT                   /product="Transporter protein of the Major Facilitator
FT                   Superfamily, putative"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42265.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D633"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG93"
FT                   /transl_table=12
FT                   /translation="MSEKLSTTITQDASVTDTSELDNVLYFIKQNKEITDSESTIDAAK
FT                   IIWKLDFIILPLLCCVYFLQFLDKSLLNYAAAMGIKKVLHNNGIGNNQFANLSTMFYAS
FT                   YIFGEPIMSYILQRYPLGKSLGVCIVLWGVVVTCHSACSSYASLMIVRTLLGIFESSSA
FT                   VGLITISGMYYNKRQQVARMGIWSIMAGTATIVGGLLSFAFQHIHVQKFKSWQILFLVI
FT                   GLITIVFGFFVMVYLPDNIDTVWFLNNQEKLYILNHTVRPNQTGTKSSKFKWKHIKELL
FT                   IYDKFTWLYFLLTICSQIVTGAIGTFSVTITLSFGFDSYQSALLQLPIGVLIIIIILTA
FT                   TQLVSQFGHITYIIISMFIPTIVGAIILIISPNKIGNIMALYLLYSGSSVITLIYSWTS
FT                   VNTAGTSKKIFRSGMIMIGFSIACIIGPQLFQNYSAPQYHPAKIVILITQCMCIPITWL
FT                   IGWLCKLENSKRDQKINQSNNNNNNNNNNNNNDMPENFEFFDLTDIENTQFRYTY"
FT   CDS_pept        complement(938215..940398)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582841"
FT                   /orf_name="CD36_43910"
FT                   /product="Uncharacterized protein YHR149C homologue,
FT                   putative"
FT                   /protein_id="CAX42266.1"
FT                   /db_xref="HOGENOM:HBG397004"
FT                   /db_xref="InterPro:IPR014805"
FT                   /db_xref="UniParc:UPI000192D634"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG94"
FT                   /transl_table=12
FT                   /translation="MPTFDLVYERTPTLEVRASKSSDDSSETSDYCKTHPNSDQCEKPV
FT                   SDNSVTIALSIILPCLAIVAVLGYFLYRNYRKDKKESLEHDPDFDENGEATALPDYPQM
FT                   KGYQEDPFHNRNSIRYPMDYSNNKPYGNQYERTSRQQQQQQQQQHPQDPYLDSFVLPYQ
FT                   HQTGSKLSLDDYARKLGDSQGYQTPSNVGSRSRSGSMHLDSNLKNTVANGRGHSRKPSS
FT                   VKSPSKKKDGKQYTNIPNDSDPSMVEPNATNSGRGVQEETSDESENYSSPEEKFVVSYE
FT                   NESVPNVNNDVPQIFVSEENEQSTENSHSPFDDQQDQATNTTESTMETIPHTKQATTHN
FT                   YDDGDFTFSTEGETQNTTATEQLTTSKPRSPRISAFNLLKNDSDNEEDEKDEDDEDDEM
FT                   NELSPEQQEELKRMKSVYKVYFDKEIIGENVPARKYDIDENYPPVPNKINDELKMDTEY
FT                   AKRFSNTSSVYQEQDEQQFVQQHQQYYYDQFNQQYQQQYGSPVDPQLYQQIQQQQYYNY
FT                   YEQQQQQRIKESKRPLPALQKIPRPSDIRKSTLQTYTDFKPSMKNQTVTSSPTGKLPFV
FT                   PIENDGVWTSPVNSPSIQSQASFPSQHQNSIPPDGYFSSAQHQHQHQHQHQHQQPSSSS
FT                   SQQRNVSSSSSSSTTNVPSASQMARSSVVMLNPVTEITKQRKFKPAGSIPRINNNARPG
FT                   YQQFGHSDLNGPESDLLPGNRKSDVRRMMNSNF"
FT   CDS_pept        942231..943955
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248010" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537662"
FT                   /orf_name="CD36_43920"
FT                   /product="Transporter protein of the Major Facilitator
FT                   Superfamily, putative"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX42267.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397003"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192D635"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG95"
FT                   /transl_table=12
FT                   /translation="MNNRNNSNSVSSHLPGRLTALIVSILVALASGTPYLYGVYSPQFV
FT                   KQVGLTTSDSATISLATNLGSGVGGLPGGLIIDHFGPQKSILLGSICIFIGYFAMHKIY
FT                   ETKYDNLLIICIAMALAGFGSITSYFATLKASQSNFPKHRGAAGAFPVSAFGFAATVFS
FT                   IISATFFKGNSGGLLEFLSIFCGSMTFLGSFFIHIYLDHHDHRETDPEMSSPESVSSPS
FT                   PNYYSIESDTLRNPRIEEELSLLSEGNSVIEPPATTMSRQDSLQGSISFWGIGQRTPRE
FT                   SISLQESEANNIIESLRNENAPKQQQQQQQQQQQQQVQQQEEQQKDHKKLWFNFIPVPD
FT                   FLHKENGRIFAIHYYIVSLASGIGQMYIYSVGFIVTAQYYYGKNKIENLTKENSKDIHH
FT                   DPNVDDTVQTLQALQVSIISIASFSGRLFSGFLSDYIYKKWHIQRLWIVQVTLVFLAFG
FT                   QYLTIQNVNNLHLVTLASALIGGSYGLIFGTYPAVIADRFGTRSFSTSWGLVCTGPLIT
FT                   LWILNKYFGKLYDANTDGDTGICYLGNGCYQGAFELSLVLCGMTFVVTLLLIYIQRK"
FT   CDS_pept        complement(944114..946738)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232067"
FT                   /orf_name="CD36_43930"
FT                   /product="Transmembrane GTPase, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42268.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG736345"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="UniParc:UPI000192D636"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG96"
FT                   /transl_table=12
FT                   /translation="MGDFPNLEPEKRIDQDSHSDNNSVNDQASSTNASVLSTSPSRLVY
FT                   IPGESSLTRDGPLPIDGEEGSSSQRGFITRSNRQQIDTSLQQVQYNNNKIALDSSINQT
FT                   IDLISELQDENKERPIFYPTEIEDDANVVLNSAKAHLALVRKNSTLKSINKSKIETDTK
FT                   ELPEFKILKISLKSGHGDNSNTMANLDKKSIANLLEKKLLQQVKYLLNLKDRIDDTTSK
FT                   VFVTGDLNAGKSTFCNALLRRKILPEDQQPCTAVFCEVIDASKENNSIEEVHAVPIGKE
FT                   YNIRDESTFEVYPLESLEDLVYDCDRFSLLKIYVLDHRSFQESLLHNGVIDIKLIDAPG
FT                   LNMDSYQTTQVFSRQEEIDLVVFVVSAENHFTLSAKEFIAAAANEKRYVFIVVNRFDHI
FT                   KDKEKCKRRILDQIKSLSPDTYKNAKEFVHFVSSSEVLNENGGGDDGDDGDPDDDDNYN
FT                   NDHPDFDQLEASLRKFLLEKRSISKLLPVKDYLLNILLDLQTLSKINEKIYHDEKVDKL
FT                   QELNNQVAPKYNDIMTKSVRIGDTINGLIESTCTEVYNETNKEIVTTVNNLGDKPIVKY
FT                   PGLQYLFEYAKETQLAMIDIVLESVARSEEVAKRVTSTRVDEIIKYGQQTLNEEFLNDK
FT                   VFNSDLMFTRRRDTIGKSIDDTIEINDFFDPSIESFLVFVGLPEKFVKSAKYQLSYFNP
FT                   VGMLTSIPQNAVTLKEQLPSQLTLHTLYSSSKILTTGALVHKMYQFSHYVTPKMVKKIA
FT                   IPVIIGISGITLYYLLSDIPNALPRNQARKIKKQIGDLDYAHQNSARISRECRQVLNYP
FT                   ARQVMNNFQTSIDKRSNEKAELEKVIKDAEISSGFFKNLLTKVERQQGLLKEIDLESIN
FT                   YVE"
FT   CDS_pept        947099..947740
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256169" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384919"
FT                   /orf_name="CD36_43940"
FT                   /product="Ureidoglycolate hydrolase, putative "
FT                   /function="ureidoglycolate hydrolase activity"
FT                   /biological_process="allantoin catabolic process "
FT                   /protein_id="CAX42269.1"
FT                   /db_xref="GO:0000256"
FT                   /db_xref="GO:0004848"
FT                   /db_xref="HOGENOM:HBG289179"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniParc:UPI000192D637"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG97"
FT                   /transl_table=12
FT                   /translation="MVLKTFKVDGTPPIKAEVLTPESFSEYGGVISADHQLKKVQSSEA
FT                   NYGTAIKIHKVAPIINNYSNCPSGKKATANWNIFRCKSPKHLINHGSSNSTYTSKVLER
FT                   HPFSTQTFLPLGQDLHKVSYLVIVAKTDESTKDKLPDPTSIRAFVCKGNQSVTYGMGTW
FT                   HAPMVVIDEKVPHIDFAVFIHENGVADEDVQECYFEPGYDIMYKQINAKL"
FT   CDS_pept        complement(947774..948601)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080727"
FT                   /gene_name="IRC6"
FT                   /orf_name="CD36_43950"
FT                   /product="Increased recombination centers protein 6 "
FT                   /protein_id="CAX42270.1"
FT                   /db_xref="HOGENOM:HBG397002"
FT                   /db_xref="InterPro:IPR019341"
FT                   /db_xref="UniParc:UPI000192D638"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WG98"
FT                   /transl_table=12
FT                   /translation="MIPNHILILGSPNSGKLRIANLISRNEEIPQLEDAESHSGLIIKT
FT                   SLRTKYYFLKLNILIDEYLESKETPDESKLSELHKWYQEFKSEEFGELREVLDGLMFTI
FT                   NMKTDSISFIGEALEIIEQIKLSLGDEESFHNWGGFIAVVGSCPVNQVVEDDVVLEIED
FT                   MVLSHGLEFINLSTEGENEYKEKQGKDRIVELVESHDWTNLEMVKVDSKQYEANKLAKI
FT                   ESMKHKLINEKEELDLDDIFKKLNLARDHASSLTQNEKDKYANKIIDEIIDFL"
FT   CDS_pept        948781..951462
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232068"
FT                   /orf_name="CD36_43960"
FT                   /product="Exocyst complex component, putative "
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAX42271.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG397001"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="UniParc:UPI000192D639"
FT                   /db_xref="UniProtKB/TrEMBL:B9WG99"
FT                   /transl_table=12
FT                   /translation="MPSTQTRDSKTGTSLNGKYTKQVQNKSNGPVVDSLQLENLLLRDE
FT                   DIFQTTLNSEDYLESLAPIMKDAIKSNGLSELLVKLNEIVKSKDEELNQASMESMDEIN
FT                   TCINTIDNIHKEANELNKQFVQVSSSLNKSAYELMSKKKNYVKYKDVCERINETQVVLN
FT                   ECIQVLELMNKILELIRQTKYFSALKLIDEIINIHIQKVEDFSFAKKIVDSIPHLTKMV
FT                   KDESFENLCKWLSINLERKLQDIASGLYNNLDDLQNNWSNIKKENGPTFLPYKINSPVE
FT                   LALRNPELNYNVFEDASLQINLNAVYDAVLVYQTLQELDTLSSAYHKEWMSKYSRIIYP
FT                   ITTASVSKKDVVFDNNELYEYLRKIAALFVTDKQLNLITKFQLRSNTQADELWLSYMTK
FT                   LKPVLIQLLKHHNFTSIQELGSFKTIVGEFLQIMDNHDYDISELYEVMMMIFKSYYAPL
FT                   TVQTFRKQFVASIQSDRYRPLTVTDEADYTAIMQNVWYKDDATFSPAYVKSFPVTFPFS
FT                   EDYVHYCIQVRRLLKDVLRFIGDYYNYEIGELTNTIVNNIIEVVLSDEKGYGIAYEIEE
FT                   FITKNENNKEITAQTYTNLEYYLFSLYEIGKLVNRELRKHTGMGVHNIDANDTFTLRAV
FT                   ETFNKLKKHAEETVFKMVDNKINELLDMVEYDEYLPVEKNDEANFAIKDFALFLENLFT
FT                   SIFNNLPSQLRTLGLFRAYDFVSEYFLNVLKDANVYNRIFVANFDLDIQYLEASLRNLH
FT                   GFKEEGDDANGNGGNVALESTFTELRQCIDLLKLEDYEEFINDSSFRMRRFDRVKYEDG
FT                   INLIKKMQGNESQQQQPSVSTVSERGTIGGIIPNSSSTRSFVNMLSNLSTDDPGNTSSG
FT                   SIESTSTTSKLAQFTTRFKQNK"
FT   CDS_pept        complement(951497..951832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582842"
FT                   /orf_name="CD36_43970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42272.1"
FT                   /db_xref="HOGENOM:HBG397000"
FT                   /db_xref="UniParc:UPI000192D63A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA0"
FT                   /transl_table=12
FT                   /translation="MINTLIKRSVITPKRFHTIKLPHQINQDPVKPRLSQFSHALYNTL
FT                   MISLSTFFLLNIVYNNLRYQEIEQELKLKSNTLENQIQTIVDEKDKQLKQEQESSSKRW
FT                   IHKLKFW"
FT   CDS_pept        952050..952880
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080728"
FT                   /orf_name="CD36_43980"
FT                   /product="Cytochrome c oxidase assembly protein,
FT                   mitochondrial, putative"
FT                   /function="copper ion binding"
FT                   /protein_id="CAX42273.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="HOGENOM:HBG525908"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="UniParc:UPI000192D63B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA1"
FT                   /transl_table=12
FT                   /translation="MNRLRIYTPILRSTIIKPATPWAYAFVVSRSIHTTGRLSQVQHNH
FT                   HQQGQPVPDQSSIEKQREWVDRLAKEREERQKFRNKTATYYTASLGIFFLALAFSAVPI
FT                   YRAICQRTGWGGIPITDSTKFTPDKLIPVDTNKRIRIQFTCQSSGILPWKFTPLQREVY
FT                   VVPGETALAFYRAKNMSKEDIIGMATYSITPDNVAGYFNKIQCFCFEEQRLSAGEEVDM
FT                   PVFFFIDPDFAKDPAMRNIDDVVLHYSFFKAHYSDGELAAVPIGNMEMKASVVS"
FT   CDS_pept        956142..958262
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080729"
FT                   /orf_name="CD36_43990"
FT                   /product="Ferric reductase transmembrane component,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42274.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396930"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000192D63C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA2"
FT                   /transl_table=12
FT                   /translation="MVAINSLIFAAITLVSSAQATNTLTIYHNNKFAVQACKGLIGKTA
FT                   VLFNETTDKVGYCNVKNQQALGTMAECIELMPHKDSRKEFLKTCKKFNLTEEEYLASWK
FT                   NATEFGYVNVTADPDFKKKKLYYKPVLLKKKKVHAAWDAVATRWYNYNYAQWYGIALFS
FT                   YWFVVMFIAGICNLTYFLFPGFVKSLKGGISNTFRKYITLPALFKKTHAHHKSIFGFFH
FT                   ALLPTRLESILVAGWFIMALIMNLTNYVHVKPNYIWPQKSNELGRKIADRTGQISMWLM
FT                   PPLVLFAGRNNFMQWVSGWPYARFVYIHKWISRVVFMMSIAHAVGMTYNGKGIGKYETR
FT                   NAKPYVRWGYVALVSMSLMIFQGLSYFRRTNYEVFLGVHILLAVFAIAGTWIHTTEQGY
FT                   QMWMYGAVAVWVFDRVVRIARLAAFGLKSATVQLIANETVKVTVSRPSWWKPFPGCHAF
FT                   IHFMRPTCFWQSHPFTIVDSVTEANTITFYIKVKGGMTHGLYQYLVQQPAQTAQIKVSI
FT                   EGPYGNRIAIDRFENTVFIAGGNGIPGIYYEATDLAKGFCDRRNVKLYWVVRHYRSLEW
FT                   FYQELLKLKDLPISTTIYVTQPNVGLAEPITTELTDDEEQQEQDQEKKSDTEENNDYVA
FT                   QVKKDLSFIEFIETKPDFYQIVGEEIKQSTGPIAFASCAHGNMVDDVRKSVVDNLSNSN
FT                   YRVELFEQMQNW"
FT   CDS_pept        complement(958607..959560)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582843"
FT                   /orf_name="CD36_44000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42275.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000192D63D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA3"
FT                   /transl_table=12
FT                   /translation="MSNREPPKLPPGWKAQWDEEYQTFFYINERTGETQWELPTGEATG
FT                   TATHSESKSTIPSRPPVEQGNGDNEQTDRGIGSFVMNQAISSATGSKHHGSSSGGGGGV
FT                   QSFIMNQVVSSVTGSNKHHNGSGSGSGAAGLVGSLLSGGSGHHNNNYNYNNNHQGQSSV
FT                   GSLVGSFLSGGSSHGNGGNGSYNNHGGSYNDRPQQQSGFSGASELIGNFLGGKNNHNNQ
FT                   GGGYNSGHNNNYGGRNDGYGGRNDNYGGRNDNYGGRNDNYGGRNDNYGGRNDNYGGRND
FT                   NYGGRNDNYGNGYNNNQGGFGTDNSFGYGRNDNNRY"
FT   CDS_pept        complement(960356..960889)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582844"
FT                   /orf_name="CD36_44010"
FT                   /product="Frataxin, mitochondrial, putative "
FT                   /protein_id="CAX42276.1"
FT                   /db_xref="HOGENOM:HBG396998"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniParc:UPI000192D63E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA4"
FT                   /transl_table=12
FT                   /translation="MFKRFALNTAKALSKPAYSQQLIYPQVRFITQTLPTVACGLRPLG
FT                   SVRTYSLSTEGEAIDDKIDKITDNEYAKVSNEYLENLSDSLEELNEDFEQVDSELSQGV
FT                   LTLTLPPNGTYVINKQPPNKQIWLSSPISGPKRYDLIGGKWVTLRDGSSLTSLLQEEIS
FT                   SAIGQEFTFENVEQ"
FT   CDS_pept        961215..961733
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582845"
FT                   /orf_name="CD36_44020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42277.1"
FT                   /db_xref="HOGENOM:HBG396997"
FT                   /db_xref="UniParc:UPI000192D63F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA5"
FT                   /transl_table=12
FT                   /translation="MFFTILIIAVILVAIMLILPYASGLTKIEIDRSHHQSSKKSSPLS
FT                   SQEHKPPQQYYGYVPPDEIQDFDDQTNEQHHSLKDRAHLLKEKLQVTADDIPLKIKLNK
FT                   PDSINTADGNSSGLRHRKREKLDLDNNPNTFDYDIDELIAEENDLARKEQQQEFYKDQI
FT                   IGKEKEEMV"
FT   CDS_pept        962083..963882
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537663"
FT                   /orf_name="CD36_44030"
FT                   /product="Phenylacetate hydroxylase, putative "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42278.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396996"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI000192D6E2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA6"
FT                   /transl_table=12
FT                   /translation="MLSSIRWDEALLILLNYLNDYPVTITCFLILLTIVFGIVIDYTIT
FT                   PKEIANIFSIPGELPFIGHLHLILENPALIYLTWSKLYNQSVFQIRIGNKRVVVVNSFD
FT                   DVVGLWINHSCQNNSRPLSYTFHDLVSAIQGFTIGSTPASSTFQKKKKTISQYLNKRQI
FT                   ELKSDIINRQINIMIGELWKRDIEFEDINLLPYFQKFVLQTAIFIGYGIELDCYKEHNQ
FT                   FCQEIIDIENKIIRLRSPISNLQDSIPLLRIMPRWFNNSEIARICGEKRNIYMNKLYQQ
FT                   LQQGLADDLPQYKNSILGDLITKTKNRNDNGESGGMNCISRNNCLNEQEIQSICLTLIS
FT                   AGLDNTPLSLNYLFGILSHPKLGERLQTRAIKDILENSGGNAILAWEKVSSLQASVTTN
FT                   QKNLMNCQYIEALIMETLRHFTVLPLSLPRLTSKEIRYKNFVIPKETHLFMNAYSANHD
FT                   CQIFVNPYKFDPDRWLDPVSNNIKSQFLNYIINNNSNRSNHGRGQFKSHHNHQHFAFGA
FT                   GSRMCSGYNLVIKQMYVMVIKMLLIFEIHPPTNTKKLMELNPFINNSNPKGTSFEPKTN
FT                   QINLKFRKLPNYKSLHELILQQD"
FT   CDS_pept        complement(964085..966412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248694" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537664"
FT                   /orf_name="CD36_44040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42279.1"
FT                   /db_xref="HOGENOM:HBG396995"
FT                   /db_xref="UniParc:UPI000192D6E3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA7"
FT                   /transl_table=12
FT                   /translation="MLHPNNSVVDTSGTGNMSENTDAPPKQQTKKKISKQNSTKTDFFA
FT                   ARLASAVDDIESSDSDETFIYENNDTELDDNASNINNNNNSTNNFVNLDNASVNGSMIA
FT                   SPNAMMTGPPGASLTLGSGLRSPSILEGEQLQYFHDPGRQQPFKLPSTKAPSIANSIGS
FT                   SNNIDSILKRPVHLRETSTYSVNDNDHRNFVPPSSTERFTASPSNNIGNENLPQYQKTN
FT                   SVAHSINEGYNDDTFSYNEVEDNLIDEDSMDDGELAKNTTTNNNNPPTTSNQQPQSQPQ
FT                   SQPQIQQPQLHTSSPLNQISTTMSATPSVSTKNASKRNYKTSSTSSKLRSTTSKLFDKK
FT                   GSQPRRYSTIPDDIDIEDFDDELIYYDNTVRFPANESTSLLNQNQRIPHYRSLNLNFPQ
FT                   VKRQSKRYLSTGQPLESSDRGSNKDGNDNGSSSDNNVNSAMTGNNNNNGDNKKINNNNN
FT                   NNNTANNRAFPFPYQDQQHHYYYDYDDYDQESQINGPNFDLPDLPINRSASRNFNNNNN
FT                   PKRFGDSHFFLPRKTDQYSQRPSFLKSCIYTFVCILIVLTIGFVLGFVLATTKDLTDVG
FT                   ITSIENPIVSKDELVFNVVIEAFNPGWFSVDINEVELDLFARSGYLPDTDDSKILQMGG
FT                   SQKVETVKLGTILNFESVLNFKGGFLSREPTIQKGGIRLLYPGKNVTGEAKLIVNMADI
FT                   KVATSNNMANKITSSDGSHEDDNSKKWEIISSNPFDLIITGVLKYDLPFSRTTRSVVVR
FT                   KTGYIDPTLFVIPQGDNNNLSI"
FT   CDS_pept        join(970159..970170,970849..971214)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537665"
FT                   /orf_name="CD36_44070"
FT                   /product="Ribosomal protein of the large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42280.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG716459"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="UniParc:UPI000192D6E4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA8"
FT                   /transl_table=12
FT                   /translation="MAPITSKKSKSVKKFVVDVAAPVENDVFDQESYVKYLVEHVKVDG
FT                   IVGNLGNDISITAESDNKVVVVVSGNGSFSGKYLKYLTKKYLKKNQIRDWIRFVSVKQN
FT                   QYKLQFYAVAEDDEEEEEDEE"
FT   CDS_pept        complement(977818..979887)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384920"
FT                   /orf_name="CD36_44080"
FT                   /product="Homoaconitase, mitochondrial, putative "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="homoaconitate hydratase activity"
FT                   /biological_process="lysine biosynthetic process "
FT                   /protein_id="CAX42281.1"
FT                   /db_xref="GO:0004409"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG328003"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004418"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI000192D6E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGA9"
FT                   /transl_table=12
FT                   /translation="MLRFRSFSTTTHLFRGQNLTEKIVQKYAVGLQPSSKKVYSGDYVT
FT                   IKPAHCMSHDNSWPVATKFMNLGASKVKDNRQIVCTLDHDVQNKSEQNLTKYKNIEKFA
FT                   KSQGIDFYPAGRGIGHQIMIEEGYAFPLNLTVASDSHSNTYGGIGALGTPIVRTDAASI
FT                   WATGQTWWQIPPVAKVELIGQLPKGVTGKDIIVALCGIFNNDEVLNHAIEFVGDDAISK
FT                   LPIDYRLTIANMTTEWGALSGLFPVDETLIEFYQNRLKKLNKSDHLHPRINNQTIDQLI
FT                   NNKLSSDNDAIYAKHLQIDLSSLSPYISGPNSVKISNSLYDLSQQNIAINKAYLVSCTN
FT                   SRLSDIQAAANIIKGHKVHPNVEFYVAAASSLVQKDAEQSGAWQTILDAGAKPLPAGCG
FT                   PCIGLGTGLLKDGEVGISATNRNFKGRMGSKDALAYLASPEVVAASAVLGKIGGPEELN
FT                   GESVKLAPQIIKSIETESNSSDEVAEVTIGEEGESLGSIDILPGFPQSIEGELILCNAD
FT                   NINTDGIYPGKYTYQDDITKEQMAKVCMENYDSQFYSKTKPGDIIISGYNFGTGSSREQ
FT                   AATCILARGMKLIVAGSFGNIFSRNSINNALLTLEIPDLINKLRQQYQGNDELTIRTGW
FT                   FLKWDVTKAQVTVVDGDNNLILKQKVGELGTNLQDIIVKGGLEGWVKSELKTNQ"
FT   CDS_pept        complement(981139..981588)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582846"
FT                   /orf_name="CD36_44090"
FT                   /product="Non-LTR retrotransposon Zorro 3 orf1-related
FT                   protein, putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42282.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000192D6E6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB0"
FT                   /transl_table=12
FT                   /translation="MFVTSLLISSRDKFRKEESFQKQTDSNNRLIFEKCTTRVLSNCRY
FT                   CEYCRSMNHTKYNCQLIKPCTNCGIKGHKTTSCKKATSVPTTILQRPGSQQYFPAFFFF
FT                   FLFNLWAFKKKKKYSETFCSSISQLLLPCLIVEGSVVWLYSFFFS"
FT   mobile_element  981280..983973
FT                   /mobile_element_type="LINE:4B, Zorro3"
FT                   /note="C-terminal half of ORF2 deleted, but followed by 3'
FT                   end and polyA. First ~50 codons of ORF2 also missing and
FT                   replaced by inverted fragment of ORF1, preceded by polyA."
FT   CDS_pept        join(981628..982098,982098..982454,982456..982644,
FT                   982647..983333)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        984114..985637
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232069"
FT                   /orf_name="CD36_44130"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX42284.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396994"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="UniParc:UPI000192D6E7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB1"
FT                   /transl_table=12
FT                   /translation="MTRLKRIRGPKLLTDKVSIVREMGRKYKNAKILVTIRLDPTQLKN
FT                   ISKVTSVNKEIEKSDETTIEKNSNAETLPPTSSELPEPTAPENLDTGEDISDSDISSMD
FT                   NELTEFLTEHSVLVTPGLPSVPNHPEIAPTTKKTSEKKPSPKPSSSLSKKRQGSSSSDI
FT                   PRVDETYKVLPRNVSPIVRNELHSIEDEFAPVDRMVFSLKDPLGGGRISLPVKSTSCIH
FT                   FQCFDYENFCLFNKITAATKEITRRNLVQSNRAHLARVQQQVNQQPTTNSSLQFSPRNS
FT                   QLPNKGNNPNISNKLPVALPGSNGIHNFLVLPTFHSNFALNNPINNNNIYNSNAGYSQS
FT                   GDITSFHNQLGEPYIRIINDPKPGVGSRFVTPHHKYPMYKCPICDTQFPLSELSISDGF
FT                   NFFIRATPKEIDRVELLIGLDKYRLIDDNRRTPAAAGENDQQSAEVIVLTSDEEDEDDR
FT                   NTPSVQAPEVKTKKRFDFYERAQEILNQTTDNEIHYGDGESWDDPIVLD"
FT   CDS_pept        985909..986520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537666"
FT                   /orf_name="CD36_44140"
FT                   /product="Mitochondrial ribosomal protein, putative "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42285.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG396993"
FT                   /db_xref="InterPro:IPR012917"
FT                   /db_xref="UniParc:UPI000192D6E8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB2"
FT                   /transl_table=12
FT                   /translation="MSDISKLNEAKAKVVELEALVKKQANVMVQARQKLIDVELRNMKN
FT                   QAGQNIQPALDLTDYVNNDDIVQLVTELQTQLDALEARTMRRTYNATVQGDDEKLAPIT
FT                   NKDGDLPDFALPVTLKEFKSLEKIDLIRLGVFYEIILPDGEEIDHALQQTNSKEAILDI
FT                   NKKKDIIELSKNFDEDQVNEIYDELARYFGIKHRRNSDGW"
FT   CDS_pept        986776..987576
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080730"
FT                   /orf_name="CD36_44150"
FT                   /product="Translocation protein Sec66 orthologue, putative "
FT                   /protein_id="CAX42286.1"
FT                   /db_xref="HOGENOM:HBG396992"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI000192D6E9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB3"
FT                   /transl_table=12
FT                   /translation="MAEETVTPEPEIVKISVFTPLIYVGVVLSIFITFSIIYRKKRLQS
FT                   LTKVEPLFKENYTAVLYQQLKDQYTNKDLPKDQRPHEKVMKAALLRRAVEAIRRSMKLK
FT                   ENEPVFNKLYQNGLIGDDIFKQYQIQIKFQELELKDIVAECETYKKGWVQTFFPLAQEI
FT                   CFNEALRRRLKASDDRAEKFSELWEVDADESEKSLESAKKVEPKKKVEPVKIEEKQDKE
FT                   KEIDDKVGEEKEEQEKEADEKHQAGDNDSSKSKKKKKNSKTKKN"
FT   CDS_pept        complement(987703..990201)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582847"
FT                   /orf_name="CD36_44160"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42287.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG324852"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020656"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="UniParc:UPI000192D6EA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB4"
FT                   /transl_table=12
FT                   /translation="MMPKSNQTDQGLLRDTQNTNNVAPNSVATTTLTSSTQSGSSNNNT
FT                   NKKLEYIGVYKIGPEIGKGSFATVYKCIDTTNNKAVAIKSVYRSKLKSKKLLENLEIEI
FT                   QILKSMKHPHIVGLLDYKQTTSYFHLVMDYCSMGDLSYFIRRRNNLVKSHPVISSLLHR
FT                   YPSPEGSHGLNEVLVLHFLRQLSSALRFLRDKSLVHRDIKPQNLLLCPPVHSKQEFIDG
FT                   EFVGMWELPILKIADFGFARFLPSTSMAETLCGSPLYMAPEILRYEKYNAKADLWSVGA
FT                   VLYEMTVGKPPFKAGNHIELLKNIEKAKDKIKFPSAAKVPESLKQLIRSLLKYNPTERI
FT                   SFNEFFNDSLITCDLEDNDQPLETSHMDENLFISEYISPIAPAERSQFFKEEKKNDTAV
FT                   RSPSPTAETIPRQDNTVQPMTKIASPVPDNFALSIAQNSSEFNLKKDDMNLEKDYVVVE
FT                   KRAVEVNALADELAHAGTGVDAISSSRKNSDADQGNRLSSSQQQQQAETTQYRRSSSNG
FT                   SQKRPSFSERRISLSLSPTNALTKAIGLASNRLFGLTTSSSHANVSAIAEDDDSSTSNN
FT                   DSSSFSTVIPSTNNHVILQKLNLATMGEPGTEFDLGSASNLDDQILDKLELIANIANAV
FT                   NLYADVKFSQIIPSPPSSDGIEDDTEMLPPKIVHMISQEGIGLYIKTLSLLGRAMDIAG
FT                   QWWFEKYDAVHGERPSLETTVRINQIVQWIREKYNISLERLEFLKSKSDFTADETLEDS
FT                   ESSNGTARVQQTIFAAALGIARETALKELLRNSTDIECSYITSIYMLLAILEDLEESDR
FT                   QEVKKIVEKINSRLKNFMGK"
FT   CDS_pept        complement(991085..995293)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094099" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080731"
FT                   /orf_name="CD36_44170"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42288.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG396990"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI000192D6EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB5"
FT                   /transl_table=12
FT                   /translation="MSTSLSHQEFSTEKGQSCSPIPHSNHLNLKSSALRTNSNSTNKNS
FT                   HIETIDANGSSNSSISEEPTINGSTYSNTTPTVQPEVFGESHTTTTTHNSANNSTRAER
FT                   NKFPNSHPHQQETKNNGESNSPVNSPKHFPIEDLRHSLLYKAGSAAYHKSATSSKQSST
FT                   TSLKDGLNNLNAHFFQNPSLDNSVMSDLEESPVPNERNSVQDAGTRSHTARFSVQSTTS
FT                   LPATISQSRVPNSNRSSFFPFKSYTTSPVKETKHVFLEYDPITRRKVLNTYEILREIGK
FT                   GEHGKVKLARDLINNELVAIKIVNRRSRKERPSLRMRKNSSAPIVNEYELKVKREIAIM
FT                   KKCRHKHIVALREVLDDLNSLKIYLVLEYMEKGEIKWKKLQSDVAKPTAGKCYDVDDNE
FT                   IPCCGNGRMQQRQPSLLTDEDLLSNEFSPNLTFKQSRKIFRDVLLGLEYLHMQGIVHRD
FT                   IKPANLLVSADNIVKISDFGVSFATSLAENDEGHLVNELDLAKTAGTPAFFAPELCQFD
FT                   DETPTDKLSSNEPMTPPKIDYKIDIWALGVTLYCLLFGKVPFNADTEYDLFQVIVKEPL
FT                   QFPDSIEAFNPPATVTEEEFELAKDLLSKMLDKNNRTRIEIQDIKEHPFTLMDLDTDVD
FT                   GLHELFHLNGDNTSEPITFDLDEHDIVSKDEVDNAVIGVGARIKRSLVRAIRAGGLKDG
FT                   EIRNKFAALQLEHSRSENSEESSSGYSNYSSSTRLLGYQNGQNYSMILSEGLPVSSATP
FT                   PPVAQPFVTQQKRSSLLSPKSGNIPEKNNPHFPSSLAHQIPNPSSPSSSSSSSMAFQNH
FT                   FSFAGIREGGKSLLQDMIESNSNSSSRRGSSAGITVSEAPQIETKRNVGGDLYLKNQSV
FT                   VETFKGIQLQDDKRRRSSIFSLHSQIGTNSNKSSLSHELTPTQTGSGASTQQQHQHYSN
FT                   IAAPIPVPVSAKQSISDKEQGIKAPLLQQEKNAMGKPYLKIGPISIAREDDKPDDNQPD
FT                   SSIISLPLSESFASLDSINDDYLSRKYEEYTSNRKENSKSEGNVPVISLRRKSSLSESD
FT                   LTRRVSLNDPFGKFKPDGSEIAEKFKAFNLGNSMKTGSKFALKDCELSGGQQVKGKKYE
FT                   SSDDGIAPKTVVPTIAYSSSDSYSSCSSSSSDEEDESDDDEENLTLAFQSKVAPISRAN
FT                   FLSLTGRAKSHDSNLPTLRQNREKNKQLNHEFQGPIIFHDGLPEFEDVPDGLIGNNAIG
FT                   SSNVNGNNTFNSGYSYYDNVNPTVVSSNVSTATLTVGMAPSESAETKLEVPAQENAVQV
FT                   SSPSNPQKNISSRSDVLKDLKKKTDVSFGENFCNNQFNNHYKKDPVYSPFPSAKHLDND
FT                   PEKIVKESVNKFHEHRPTYYRSNSVTIGLLHRSKHREEDEDGSQMSNDLGQHHTEEKQG
FT                   "
FT   CDS_pept        997263..998606
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537667"
FT                   /gene_name="SAP10"
FT                   /orf_name="CD36_44180"
FT                   /product="Secretory aspartyl protease, putative "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42289.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192D6EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB6"
FT                   /transl_table=12
FT                   /translation="MYFVFLLYLASVVKCSIKLDFNIVSTPSKYTKRDALPMPLINDKI
FT                   LYTTELEIGSNKDKVSVSIDTGSYDLWVMSNDAICYKVSEFQTEGAPQLPDIFNDIDQE
FT                   YSCTVNGTYNPNTSTTFKNTSEDFSIGYVDGSAAQGVWGYDSVQFGKYGVTDLKIGIAN
FT                   RSSVSDGILGIGIANGYDNFPVLLQKQGLINKIAYSVYLNSSNSTTGTILFGAIDHAKY
FT                   DGALSTVPINSESQLSVNVTNLETKDGKVTSGSHSVLLDTGSTFSIFPDEWIDALGRSL
FT                   NATYDDNESVYAIECDGYDENFFGFSIGNADFSIPIQDLTTEKDGQCYLAIMSNSVIGG
FT                   GGILFGDDILRRIYLVYDLQDMTISVAPVAYTKDEDIEEILNHNEDQNELRTSNSFTQS
FT                   ASSSQSQSSSTSSGDNMKKATSSASGSRQAHSWLTTLCAVLLVYIHII"
FT   CDS_pept        join(complement(999937..1000016),c
FT                   omplement(999029..999581))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207273" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080732"
FT                   /gene_name="EFB1"
FT                   /orf_name="CD36_44190"
FT                   /product="Translation elongation factor 1-beta (EF-1-beta),
FT                   putative"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="CAX42290.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG714747"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="UniParc:UPI000192D6ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB7"
FT                   /transl_table=12
FT                   /translation="MSFSDFSKVESLKSLNEFLADKSYIDGTAATQADVTVYKAFQKEF
FT                   PQFTRWFNHIASFTEEFEDLPAGKAPAASAAAAEEEDDEDVDLFGSDDEVDEEAEKLKQ
FT                   QRLAEYAAKKAAKGPKPAAKSIVTLDVKPWDDETDLDELLANVKAVEMEGLTWGAHQWI
FT                   PVGFGIKKLQINLVVEDALVSLDELQAAIEEDEDHVQSTDIAAMQKL"
FT   CDS_pept        complement(1000419..1001171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000240418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080733"
FT                   /orf_name="CD36_44200"
FT                   /product="DNA methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX42291.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG381854"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="UniParc:UPI000192D7A2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB8"
FT                   /transl_table=12
FT                   /translation="MTSSDDEPIALSAHALAALQEFRSEEKERLEKFESLYQQSEDKFD
FT                   EQKKQEQQKITIDDFKEDWQLSQFWYSDETAKILGKALLEGADESTVVVIASAPSVYAA
FT                   IKQFPPEEIPTEHIYLLEFDPRFKVLAGSEHFSVYDYNKPNDIPEHLRNKCHRLLIDPP
FT                   FLEEECQTKSSEAAKNLLVHNKTEKTKHGDNKYKLITSTGERMFELVTKKNYPDTEMTD
FT                   FFPEHKNGLSNEFRCYANFECSYWKFQK"
FT   CDS_pept        1001462..1005604
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232070"
FT                   /orf_name="CD36_44210"
FT                   /product="TFIIIC subunit, putative (Subunit of the rna
FT                   polymerase iii transcription initiation factor complex "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX42292.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG447844"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="UniParc:UPI000192D7A3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGB9"
FT                   /transl_table=12
FT                   /translation="MSFPCAPYEIVQFTVKKLSFSGKWGLTLDELWTFIQTKFNQQDEL
FT                   DEFQKQLIWQWLFVAEGEDGNPEEAKIYVTYDSSPVKANSDYKAFVASYEDLTKIRVLP
FT                   GQETQVFYLTGISNNKKFLSSLGEKPYELLQEIAKHGSKGIWAPTLTDVTGQDNRSLTG
FT                   RLNKLEEWRLIYREKRFYTEKKVHTNWIVHIKFASTSEKPEDKQTKKKLDHTNEESNDP
FT                   NKDEENEEDSNISGYWTFRENLKNVIVESCKNAPHSVRVFRDLKRELRMHETRSLSNLF
FT                   RAIVNVLHNKGLIEKVNIKDEETDRLIYAIKYLKDPEDSKLNMETEFSEMPSLGDNGED
FT                   QEDGDDDEEDDDEARFVPSFNIMFPLASQLYQYIYDSKSEGISTRQMLSSVFGQPRNRL
FT                   VERFFEIFSSYQLKGSELQPLRLYPDENDKTGVVRIVDAEGKIKFYKYCARDSINSVTV
FT                   KMHKKERPVLKTISDVDFKALNESLFVKDRKKKTVPLFAVPEKLYPAIKMLHDPHHKYG
FT                   EGEHLVDKSMVSPIKDDKLRKTEASKVEKDDAVNVISSSTQKLPLPKRKVSKESPNTTP
FT                   KKRKVETLPANDIVRCLRRSARSARKPAIKIEDDVLMNDSDNDYNEADNQERIESGVKV
FT                   ESEQESDDKIATDGLSTTESVSNETVKLETKSVSLGSNGKRVRKYRRRKGYQTPNFGDD
FT                   AQGELRRDLLVKLVESKGGILIFDAKLSRELDEKLENTTITDKRTIQRDIEKLQKSGMI
FT                   EFELIPSTKSGQPITRLLIYSKEERSRPSNEVIEGYRKSCSEGWNRTQNKRSFTNVNIR
FT                   TIESKYTLFHIESPFDRKNTKRLESLAQSKGKAKPVAANRRKPQTKFVGDISGFHDEDH
FT                   QDVPAGQNVTAPSDVKRDEKLALKSEAISSHKSAKSTKSESSSFAPKRFKRKSAPERRS
FT                   NNGKSSNRGVKKNFAVKFDKTDTITLFRAVCISKAFNISSIDYNAISELFDNVTVDSLR
FT                   KTWSVTRKSIGGGAVVDKGVEEFQLIVMRGIDEGNVSAGDLEDVRIPFFLDLWANYEGA
FT                   DNEFVDKMPLYKNMEDNYRYYKKTTTETYVDTFEQIELLSMRMKEMSLATIPFYVSKDP
FT                   EDTVLPIKPHDEIRTMLKAIFGTSKETSTSSKIDKLLSGFPHKHIQEASEAMIKDRELL
FT                   YFGTDDSQNNFALTDKVYDSLYVRISASFFNEAAQFKDELYNVVSSKKGYPLSQGIDNG
FT                   IMAQLLDLLSSSSISVKRMEKDYTFDGYESRLMDKNDLDCEIVLYKSSTDLRDIDDQDI
FT                   HMIIPVPTGKPCSRVWLDINGQIDAKLWRDIVVAILYHVHFRPGIPMDMIFRKFDSLLS
FT                   VSDFTAVIDWLTKSGCIERGAHNGYFTSNNWLNILGY"
FT   CDS_pept        1005790..1006575
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384921"
FT                   /orf_name="CD36_44220"
FT                   /product="rRNA and snoRNA maturation protein, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42293.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG396989"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI000192D7A4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC0"
FT                   /transl_table=12
FT                   /translation="MGLAGTKIKQRFGNDPRNTNWSNDTSRFGHQYLSKMGWQQGSGLG
FT                   LVSHALTTHVKVSIKDDNLGLGAKLHKRKANGDGGLEEEGTAGLDAFQRILGRLNGKED
FT                   VVNKVLDNVRDDDIINGKWGMRFVKGETLSSTWDKESKKLISYKNQEDDEKKSRKRKAD
FT                   ESGTKEDKKMLKRHKKEKKEKKEKKDKKEKKDKKDKKSKKEKKDKIRTSLEETSVSKES
FT                   STTPPPIATRLSARSKWIKQKRASVMDAKALNEIFMITN"
FT   CDS_pept        complement(1006749..1008401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384922"
FT                   /gene_name="PHR1"
FT                   /orf_name="CD36_44230"
FT                   /product="pH-regulated protein 1"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /function="transferase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX42294.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192D7A5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC1"
FT                   /transl_table=12
FT                   /translation="MYSLIKSLATFVTLFSLTLAKFESSTPPIEVIGNKFYFSNNGSQF
FT                   LIRGIAYQQDAAGSVSSGYDADPNRKYTDPLADADACKRDVKYFKESNTNALRVYAIDP
FT                   EKDHEECMKIFSDAGIYIVADLSEPTVSINRNSPEWNLDLYERYTKVVDNMQEYSNVLG
FT                   FFAGNEVTNNRSNTDASPFVKAAIRDMKKYLKDSNYREIPVGYSSNDDEEIRVAIADYF
FT                   SCGSLDDRADFFGINMYEWCGKSTFESSGYKDRTEEIKNLTIPAFFSEYGCNANRPRLF
FT                   QEIGTLFSDKMTDVWSGGIVYMYYEEANKYGLVSVDGDSVKTLSDYNNYKSEMNKISPS
FT                   LAHTSTLSSSEASKTLECPGTAASTWKAATKLPPTPDKDYCDCVSKSFECVVADSVEKE
FT                   DYGDLFAQVCGYIDCSAISADGNKGDYGVASFCSDKDRLSYVLNEYYIDQDKKSSACDF
FT                   KGSASINSKASSSGSCKAVSGVATGKASASGGSSKSGSGSASSSASGSSSSSTSSGSNS
FT                   SSGNKSTQQMSMVKLVSITTIVTAFVGGMSIIF"
FT   CDS_pept        join(complement(1009602..1009703),
FT                   complement(1009483..1009560))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1010742..1011767)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000266075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582848"
FT                   /orf_name="CD36_44240"
FT                   /product="Mitochondrial metalloendopeptidase, putative "
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42296.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396987"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniParc:UPI000192D7A6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC2"
FT                   /transl_table=12
FT                   /translation="MVTMFGSKIFSRLFFKRTYATYKRFDNSTSSSFTTSYSHLLTSRK
FT                   TLYIGGGLLGFYIYNLHDAPYTHRSRFIWVPYWLETKIGDYSYRQIYQQFQSQILPHSN
FT                   PLYSRVSTIMNKLLAVALNDNINDDLNANFLTHLKSLKWEINIIENNRLPPNAFILPNG
FT                   KIFIFSSILSICQNEDGLATVLSHELSHQLAQHSSEQLSKQPIYMVLSTILYTITGVSW
FT                   FNDLLINGVLTMPASREMESEADHIGCELLARACFNPQESINFWHRMSQAEKKATGIAS
FT                   QEGGYLNTWEFFSTHPATSRRIADIQKWMPQLLQIRESSGCYEYGRFHNFNKSYFNHQN
FT                   R"
FT   CDS_pept        complement(1012705..1013550)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232071"
FT                   /orf_name="CD36_44250"
FT                   /product="Cell wall biogenesis protein, putative "
FT                   /protein_id="CAX42297.1"
FT                   /db_xref="HOGENOM:HBG448091"
FT                   /db_xref="UniParc:UPI000192D7A7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC3"
FT                   /transl_table=12
FT                   /translation="MVNTQGLTVGLAVGIPSFIILVVVGIFWYRNQQKQKHEDMKDNEI
FT                   DIGLRDDHSFNQFQEELHKQYEKNNDEDEAHIREEKLTHDSSENSNDGQQHSTSTASRQ
FT                   TPTPYSQHYNSNNVSQRPQTSYDFYETFIPILPSNQQGSSSAQGSTADIAEAHPNDTDT
FT                   DMETNTNNGTGNNLTTDSSSSLINSHLRTSSNDLNTLAKQLNNPVFFEKLPSKATKYQV
FT                   KSVNNNNHGNTIAVGKNNNSSSDLINNYLIGETHAINDHFTYEAPKVEVTDLTQPEKKK
FT                   "
FT   mobile_element  complement(1015406..1015921)
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon L"
FT   CDS_pept        1015995..1016840
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094102" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080734"
FT                   /orf_name="CD36_44260"
FT                   /product="CAAX prenyl protease, putative "
FT                   /function="peptidase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42298.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396986"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000192D7A8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC4"
FT                   /transl_table=12
FT                   /translation="MGKILSILTACSYVFAIYFAPPPSIKHKDRNNLDVVRHRISRIII
FT                   LCTLLMIIIPNLVLIQGKNHNETYLDKIRQLGIIPGFTNSTSLAVDLFNIGFTIYFILI
FT                   LYSSSIYQIYIEEIEFFDWKHQINSISNTSVLYPIRDYVLAPISEELIYRGLIFLINND
FT                   TNTDSNHKNRHVFTPFLFGVAHIHHGIQLYQQNVPVMTIVITTGFQLIYTSLFGKLSEI
FT                   VYSGTNQNLWSCIVLHMICNVFGLPSFTLDSSKLIHQVMFYSLIVLGIVHSMVVLLYYM
FT                   "
FT   CDS_pept        1018953..1023884
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232072"
FT                   /orf_name="CD36_44270"
FT                   /product="Zds1 orthologue, putative "
FT                   /protein_id="CAX42299.1"
FT                   /db_xref="HOGENOM:HBG396985"
FT                   /db_xref="InterPro:IPR013941"
FT                   /db_xref="UniParc:UPI000192D7A9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC5"
FT                   /transl_table=12
FT                   /translation="MSSPNTSFHSDSNFESAVQDLEQEKKMVAALKRLSIGHMMQYDPD
FT                   LPPGSMDDIDPFANNNNTTTTSSNNNHHNPHTRDHTNNNTHNHSPNSKLNNHRGQSPYD
FT                   EDLIPQNIHRSHSTRSRSKSHSTSPSTSPQHKHQQQQQQQSFPHEPQTPPYNKSPSPVK
FT                   RRSFYDNSSVLTSESHDIFFDAEDEVYDSSSPLLWVPANSHPQVNPESFKSLIKTQVEE
FT                   ILERKLSRKSTISRRSTLSRSSSTSTKETLAPEPEISPESEHDVSPPSPVRKSSLSSSS
FT                   QQNPNEDISRKSSSSVSSTSPQKDPTKRESWYFNNPKRYSNPSLRELTSELEQLSKMAG
FT                   MDKNDAVTLARTLSAQSLGYTDVEKLAFDELDGSQTTATATTPNSSGSSGGYDSASSPR
FT                   TTTLHLQQRLQQQFQQAQMKAEREAERTTRHQQRQQQWPISNESSHKSSSQFSTNDGSS
FT                   TPNIFTSSGSGTDFALKRSRRTDYRKKETDSKQKTSNNSPPTRKYNVRNSQLLFNYKRP
FT                   VDSPSSSPSPSPSPSSSQSMTGHRVKHKKSQKSLEAALANPIVDGSDMSHNPYPTASTT
FT                   IDFSRMGVKKSNKQPLSPENAMDGRSRTKPENKPHRGYPYQERSHPYHQQPQPQVQPQT
FT                   QRQSTRQAHNHQGIGAEKQHRQDNKRIMSSATNTDINDFMVQSNQFQTNGSRHHRYDNL
FT                   HKKDKTALFANEDPQRKSHSTRNSNMRNMSSSPQQHLHQPYSTTSAAPKSRQLHQNLDK
FT                   LRSEINEFKESLNKSDSPGEDSKRAHRSHHDQYQQQHQHQHQRQQAPSQQQLEPRSYNH
FT                   NDRYRSQQPHERLQPQQVQPLQSDTSFDISYQDLSVEDQLGIEQEALRELGKEKGNSHE
FT                   IDIDDAFDEDLEVSPINDGTRSQFTLDHDILGSFDLMDNQLVGSADEEIQNLNGKTEVH
FT                   VTRQQQEPQQPRNISPPSSQQYVAHDDLRLPPGKDTDRKSGPGLSIDLLQSKPIHPEET
FT                   AIGFGMNALPSPTLHLDESQNSTPGHSRKTSNSASYDDYYNIADKSSTAGTPKTKKETK
FT                   VKTKLFNKDPNLEIIDSDNYKEKMGIETSNNKKLKKKKSFGLLSTTSSVGGNNASESEG
FT                   PKKLKKKKSWGWLRERSASTSSADINNLPPLPLDKLPTRSFSNPETSTDQHHKQDLANG
FT                   SDLEQELEHEPQLELELESDLEFDYEHQRKHQDASLINDSSFAVDSTSMKSTDKENVLS
FT                   KLFKKKTKVPGSSSQSVFSFESRGSGASVDYESDNDAKSMKKKTNNSSKLFKKKSKAKL
FT                   SEQENSVNKEKLRPLNLVSKESQTIEEKENLRQSNGTRKSERIENQEQHEEQLPVTSSP
FT                   IHQFNIEHLKDDFISFGEKDDVLDSGAQDFVEGVQSRNIQSTIVIVDEDEEASTGNNAA
FT                   NNDLETLRVDELSKKKSVSKKKHNRVQKKNPSTELADTNKEMVEEVPAADQSIKPSPED
FT                   EVASKNEDKEKLDIQEKLKKSIKRTSRANQPIEFTDSAFGFPLPPPSQSTLVMLDYRFP
FT                   VHVERAIYRLSHLKLANPKRSLREQVLLSNFMYAYLNLVDHTLHLEQQNMSSEDGDQME
FT                   RDEEEEEEMTDTDEKDMIFGESSIADEDDIMPEEANGDSIGINLDMAGMDVLHRKQHHH
FT                   SGIEV"
FT   CDS_pept        1024507..1025643
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000023981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582849"
FT                   /orf_name="CD36_44280"
FT                   /product="Inositolphosphorylceramide-B C-26 hydroxylase,
FT                   putative"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sphingolipid metabolic process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42300.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0006665"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG329706"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR014430"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000192D7AA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC6"
FT                   /transl_table=12
FT                   /translation="MSKNLPLLSIQEVSKHNHVKDCWVTLYQRKIYNVTGFLEEHPGGA
FT                   EIVLPYAGKDITGIMAEASSHEHSESAYEILDDGMLVGYLATEDEEKGLLRNKNNTPVE
FT                   VKLVNNDGKDFDMYEFHDHLPAEEKLSIQTDFEEDTKKHRFLDLNKPLLMQLLTSDFSK
FT                   DFYLDQVHRPRHYGKGSAPLFGNFLEPISLTPWWVIPMVWLPPNLYIFYIGFVNQSPIT
FT                   ALSLWVMGLFVWTLVEYCLHRFLFHLDYFLPNHPYAFTVHFLLHGVHHYLPMDGYRLVL
FT                   PPAMFLVLAFPFYKLIFSIFPFYMACSGFAGGTLGYIMYDVTHYVLHHTKLPKYFQTVK
FT                   RLHLEHHYKNYELGFGVTSPFWDVVFGTELTNTFEKRK"
FT   CDS_pept        complement(1025948..1027126)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582850"
FT                   /orf_name="CD36_44290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42301.1"
FT                   /db_xref="HOGENOM:HBG396984"
FT                   /db_xref="InterPro:IPR019622"
FT                   /db_xref="UniParc:UPI000192D7AB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC7"
FT                   /transl_table=12
FT                   /translation="MSTKSDRQQVLNVLEDNYTSDLSLHLYSTFLLRRVNPNFPRHTWS
FT                   YWPLKFADVPIPQDNFEDDIVDGYEKDIDYVSVLKRKVSNRKSRTEEMTSLEDNTKEDE
FT                   DNPIYNAEVESEDEQEAEDSEGDNEDENLKKLLSRPINEITYLERTPNSKKLLINSLSS
FT                   IIQHKIHARVKDLNISKTNLAITDDMASNPALLPLTIQVANRFNSLIDTLTKKRTSKKT
FT                   INWKDILCTAVRNEINPHTIINTKTYKDLYNKCEKLFSKMHYNYEFESEPECEGQIRTE
FT                   EGGFNVHEYLKTLSNSVQASGQITYKDLVARYLNDFSQRGREEARFKHNFFELLRIQDQ
FT                   SSDISWSKTNGERERKRRKVSIAEPKVEDLNDVKEDILGSAELDENSYMLNL"
FT   mobile_element  1027685..1028182
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon K"
FT   CDS_pept        1028253..1028951
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582851"
FT                   /orf_name="CD36_44300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42302.2"
FT                   /db_xref="UniParc:UPI000192D7AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC8"
FT                   /transl_table=12
FT                   /translation="MQPNSASQNSLMTPEPILTSLMSSPLILLSIFVAWVKMVFRYFFP
FT                   NHFLLAIANNRFTTSVEDTLEYFISTTTSKVQSVMNYVNDSTDFAIPWMANIQSFWTAI
FT                   SPFVSFVLGCISSLFQFVINHFQISPLATISWFVVWNFTCRLFIRTTFPFPYFKPRKPT
FT                   SKPAASVYVLPCVTPDAWTKDSSAFHPTPRPISKVHIPFHQNIFNAVHTFYRSFQAISS
FT                   SCNSHYYDFI"
FT   mobile_element  complement(1031868..1034116)
FT                   /mobile_element_type="transposon:Mutator transposon J"
FT   CDS_pept        complement(1036396..1037226)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582852"
FT                   /orf_name="CD36_44310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42303.1"
FT                   /db_xref="HOGENOM:HBG396982"
FT                   /db_xref="UniParc:UPI000192D7AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGC9"
FT                   /transl_table=12
FT                   /translation="MLRSQVTCIQKRTLFQKYNNPPRLSYVANKSYFSLIWNNLIPQPL
FT                   KLTGLVASGIITFVNVHPRYYITLGPPIGLLGFFGYQKYRHWQYHKAVTKLDVTEWQDN
FT                   ETIRTAKYDEKSLDNVIMGIDNQYDSLRRQIIQLVEQRIIEYISENGIDDEVTGSFISD
FT                   DNQFNVRLPESEIESWITTNVKLEKNNNAVSEFIKLSVPYYDSKNVHTRKRLGVVSIYL
FT                   LQIPQQEESSFIDYKIGIEVTRLKWFNPQSLFFTRLENKALMQSEIYKALNKQN"
FT   CDS_pept        1037764..1038480
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384923"
FT                   /orf_name="CD36_44320"
FT                   /product="Zinc finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42304.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG717067"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000192D873"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD0"
FT                   /transl_table=12
FT                   /translation="MAKAEFGTAKYQSKKLRAAGLQKLKFYCQLCSKQCRDSNGFKNHL
FT                   SSPSHIKKVSEIHESGDSSKLIETYSNKFEDEFIKLLRINHGTKFINANKFYQEYIRER
FT                   DHIHMNSTKWRSLTSFIKHLGKNGIVKVQTSDENNEEEEGFNLEIKLVDRMQTLNSYQT
FT                   NSNISVLEDNDEMNDDKLLQKQIKRGQEMERDKDTEKPTLQQQVPISGPVKLTLKKKKV
FT                   CATKKLVNAFDDSESE"
FT   CDS_pept        complement(1038603..1041422)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537668"
FT                   /orf_name="CD36_44330"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase, putative "
FT                   /function="peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAX42305.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG448093"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000192D874"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD1"
FT                   /transl_table=12
FT                   /translation="MERIKHKTRLPTANVNKSLPETPEAPSKSPPPNDMPTSQPQVFTS
FT                   STVGSSTVQHQFHENSTPPTAVMQPLITEDDIQAYYSRLINYEFRNLQLDSEVKSKSLF
FT                   DLIDYCEFQYETSNVQLQMGATDPNATLKGIKTYIKGYLVFNYFINSFIIVHFKGFDMF
FT                   IENNEQDFIIYLNIFAFYNSNEYFRNGNYSIQSEDLREYVKKYLVDKNLLSFNIEELYS
FT                   WLNEYIAYLKEKDKSAEEQASVSSSSSSFSFVEEAYATPDLRQSTHSRNSSITSENEFK
FT                   QKFPSIKRVDSPPSEFIPKQIPPPIPTQLPPSLLESMPDLQSVSPNASPPSPTPTPPSP
FT                   PPHRVSTAEYPISRNAFMTKENNQSTYPVQDKVLGTAVSPEEQVYFQPKSYSRPKNEVP
FT                   DGYLRPTDYTKTKMYHKSNNLVSSNGYVNGYDQRLAQSHQIDPQVVQGGNAHFPTQAPP
FT                   PPQPIYRQPMQPIPYQQYPYYQQPNQPIHHVQNTQPQMYPPPAHYNNTYSHVPAHVVQQ
FT                   QEQIKHQKHSLLKEYSVCGLRNFGSSCYINSTIQLLFGVYPFKSIFNHGYQKYVKDPKY
FT                   LRILAKPNSHTKESVLLSEAIAGLLRTFQQNGGVSVSPTKFIRVTSLLKPDFNIPHEQQ
FT                   DAQEFLLFVLERLHEELADKRQDNYDPELSVQKWKININMENKDKYMEWCKSLHKHEGS
FT                   SPITDLFQGHLQNKLKCNKCGYESVSYSPFSILSLPIPNNYKNEVNLSDCLRYYIQDEV
FT                   LSGENAWHCPKCNGEVQTLENHPVFENKRSGIFKLGGKKKHTKSQQASNNSINTISTKS
FT                   INFVKLPTILFIHLSRFSMYNLTDKLDTMIRYPLLLKFNNQGHEIVYKLSGLINHFGNL
FT                   KSGHYTSLVNKSTVHEKLQNSDNLKRPCWCLFDDEHVRSNLVHGALNPPHDELVSRDVY
FT                   VLCYERIDV"
FT   mobile_element  1041786..1042189
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon C"
FT   mobile_element  complement(1042190..1042508)
FT                   /mobile_element_type="retrotransposon:solo LTR, psi I,
FT                   truncated"
FT   CDS_pept        complement(1042955..1044367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232073"
FT                   /orf_name="CD36_44340"
FT                   /product="Endonuclease/exonuclease/phosphatase family
FT                   protein, putative"
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /protein_id="CAX42306.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG650771"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000192D875"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD2"
FT                   /transl_table=12
FT                   /translation="MRMTRSQRTKHVRLTFISIVVISVFALVYTLSRSAAVSTYSDVSK
FT                   MITDFGQKYNPATLVNDHSSNIPMDDTQNSKDKSFGNKGNNNKNDVSGNLQSDMLGEET
FT                   SQNPGNYLGEIERMSPEEVERAKSIMEEPKKGDEATNKLGVPDPGNPKFSRVTKNKPEL
FT                   PKIPSIGTSDKLKRFKFRIYSHNVKNGGYHSLVPGEQSWSDRLIPLVASIKFNTFADNS
FT                   IVTLQEVYKFQMLDILKELNRHEPDKWEYYGKGRIDGEEIGEFVPIIWQPAEWELMYSD
FT                   TMWLNDKDPRTSFEGWDAIYARIVSYVTLRHRATDNYINVFNTHFDHVGQEAQVGSAKL
FT                   IIDTMKVLNSWPSFLSGDLNIEPNSEPYKVLNEHLQNTADLATPFNKFGHFKSTVTGFE
FT                   GEVLLDGGQNIDYIFAPKYTLKMGNDEQDEASGQTTTKINLKLYQLGMLHSKFNGKYIS
FT                   DHRPLVADFIMN"
FT   tRNA            complement(1044603..1044688)
FT                   /gene_name="tRNA-Gln (TTG)"
FT   tRNA            complement(1044699..1044781)
FT                   /gene_name="tRNA-Gln (TTG)"
FT   CDS_pept        1045493..1047115
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582853"
FT                   /orf_name="CD36_44350"
FT                   /product="HSP70-family chaperone protein, putative "
FT                   /function="ATP binding"
FT                   /protein_id="CAX42307.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG332783"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniParc:UPI000192D876"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD3"
FT                   /transl_table=12
FT                   /translation="MSVIGITFGNTSSSIAVASADGKVDVIANPDGDRSIPSALSYIGA
FT                   DEYHGSQAEARLIRNPENTIVNFRDYIGKKFSEINPNAATGAKPKEINGEISYEITNDG
FT                   KTEVLTVHEVAKRHFKQLKLAAEDFIGKNIEGVVLTVPTDFTEVQRQEIAKISEDAGLK
FT                   VLQLINEPSAALLAHLSNDEDRLSQDKIYVVADFGGIRTDGAVIAVRGGVLTILATAHE
FT                   YGLGGDNLDAALSEYFAKEFEKKYKANPRNNARSLAKLKAESIVVKKTLSNVQTSTCSI
FT                   ESLADGFDFHTSINRLRYELTARDPLSKMTAFVEKVIAKADLDPLDIDEVLLVGGAAHT
FT                   PKLASNISFLFPETTNIIAPSLDSKALNPSELVALGAALQASLVESFDESEIKESLQPI
FT                   VVNTQHLTKPIGVKDADGNFQPILVAETAYPIKKSISVTNGDSSSVIVELYEGKRTVKE
FT                   TVIEAEPVEDSEDEDSEEEEPEIKREVVYECGDKLAELSLKDLKPNANLEVIVNITQNG
FT                   VLHLSGRELKQGSTAVKGEITSQ"
FT   CDS_pept        1047480..1049174
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582854"
FT                   /orf_name="CD36_44360"
FT                   /product="GTPase-activating protein, putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42308.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG714500"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000192D877"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD4"
FT                   /transl_table=12
FT                   /translation="MGKKKQEMSQVYNGSKNEFIFGEQGGKGRNLSSFLKNLSLTGSSA
FT                   SVDSHRDSYEEVNSNIYGSLSYSKNNRSAANLSSGSIFQPRPASGGNRTVSLGHIGRHQ
FT                   SPKTQHRRSHSNTRYTDLDDDWDAGLDEVVVKPNPPPMLDSLYPDLTVQLPSEVPEKKQ
FT                   HKESMDDVDLQAKAEINKLNQLNSKYSKFRKILASDTIINLQDLRKLSWNGIPNELRAL
FT                   SWLLLLGYLPTNKSRQSSTLKRKRQEYLDGLGSVTIEFHEDPPDNNSNLSLSNVNRDKQ
FT                   LYHQIKIDVKRTNPTLKLYSYSATQVSLRKILYLWAVRHPASGYVQGINDLSTPFYQIF
FT                   LNNYIWQLQRKQQGELEDEDLFIPGYMAGTDEEDPEEQKLLNDPQLMQYNLENFNTEWL
FT                   SARVTSIIEADTYWCLSRLLENITDNYIHQQPGIIRQVNELKNLISKIDVELLNHFEQE
FT                   GIEFIQFSFRWMNCLLMRELPMQLIIRMWDTYLSETPLGFNTFHTYVCAAFLIKFSSDL
FT                   KEKDFQEIILFLQNPPTSSWTEKDVELMLSEAYIWQSLYKNASAHLR"
FT   CDS_pept        1049641..1050612
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158212" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582855"
FT                   /orf_name="CD36_44370"
FT                   /product="NAD-dependent methylenetetrahydrofolate
FT                   dehydrogenase, putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAX42309.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG328751"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="UniParc:UPI000192D878"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD5"
FT                   /transl_table=12
FT                   /translation="MSKPAGRTILASTIAKPFQEEVTKAVKQLSFTPKLVGLLSNEDPA
FT                   AKMYANWTGKTCESLGFKYELLEVNKNDLETALIKANKDDSVNGIMVYFPVFGDKQDQY
FT                   LQQLISPEKDVEGLNFLYYHNLYHNVRFLDPPQNQQKSILPCTPLAMVKILEYLGVYNT
FT                   ILHYGNRLYGKKVLIVNRSEIVGRPLAALLANDGATVYSVDINNIQQFTRGDDLSEQRH
FT                   KVVDLSPEEYTLEKLAPQCDVIITGVPSENYKFPSDLVSHGTVVINFSSAKNFNDDVKL
FT                   RAGLYVPSIGKVTIAILLRNLMRLIHNKQVRQGEVSDAASSG"
FT   CDS_pept        1050990..1053197
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074518" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080735"
FT                   /orf_name="CD36_44380"
FT                   /product="Myb-like DNA-binding protein, putative "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42310.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396980"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000192D879"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD6"
FT                   /transl_table=12
FT                   /translation="MSSSPKEASDTSNSSVRKRVVHIDPLEITQSLGFQTFRKGARKPW
FT                   TKEEDSRLSSLVETEYPKPIDVEKVNWDYIAETLFPDGFRKGKECRKRWCNSLNPSLRR
FT                   GKWSKEEDEKLVRAFEKYGASWLKVSQEIEGRTDDQCAKRYMEVLDPNTKNRLKPWSME
FT                   EDLRLIQQIKIHGTKWRTISNGFEGRPSLTCRNRWRKLVTDVVRGKADPLIKSQVENVT
FT                   QKSIDDESNKDNILEVLSKKQQELTESNKENGPKSGKRFKRVKRDPDLPLNSPRSASAS
FT                   TPTSEQSRVEVEWRYALTPDSSKQTRNAEDGYFSRSNVFGEENGGVIKNQQMVQQLVSY
FT                   AKKRHLNITVHQHIHHHYGSSAQQDTNNRTQPNRFNIEPEDQQARFQHFNYLPPLVEVP
FT                   KLNSSQSSPNNSSYEGASGTTPTTTQFHHHHHHHHHHHNNHEKDQRIKPTRNNESAVRS
FT                   TTPAELDGTRESDLIKLLNNTDELNKRETTPISNPLTPLAQAVEYVEAEENQKVKRRKL
FT                   GASIESSTDMVNRAQHPNNDKNHDIPSEDEELDFWETMRNLTELPNSTLNNATGKPTVS
FT                   NNKNNISHDTAYHNNATSSTNSKILTSTQFSQKPVSQHHPLHYYNSNTRENTPKPVLSQ
FT                   SQVRKQTENGQHNNDEEQEEGLDEEDKLLAREVSEVGVDQETLNSYGLFYNVYTREGST
FT                   FPEVQPQQSSQQQQQQQQQQQKYSVYDQWGGGFGIIPFNPS"
FT   tRNA            1053414..1053508
FT                   /gene_name="tRNA-Ile (AAT)"
FT   CDS_pept        1054022..1055536
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232074"
FT                   /orf_name="CD36_44390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42311.1"
FT                   /db_xref="HOGENOM:HBG396979"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniParc:UPI000192D87A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD7"
FT                   /transl_table=12
FT                   /translation="MTNNSAGSELPIAIEMIKPPNATRNDKFDELILDYFIHEGYEDAA
FT                   IRYSRCGKEQDAEMDLEIKNRDDNSDSISGGQPTFQGDKKDQILQPPNSLFIDNMNRLS
FT                   NDKEFSDMVISYFNNTSSKHNNNNDESGSASFPDINDIEATSNCDKKIESGFATIRQRQ
FT                   EIKHLILNGDISQAIKQISQYYPMILDLNNLLHFKLLRLNLVEMIRNHKFNTKSSKSSI
FT                   DDSMDADQDEREFLATILNFVRENLINKVFNSFKLLKELEITMSLLCFKFDPTIENLQD
FT                   QTDLPVELRKLFDLSLRYQCYRLVNNAILKLYNNEYANSITTITNKGMHQSKSPFNDSY
FT                   YLTNDETVQELLENQEESNKRKMTKTYHGPKFAEFDLSNYDNYRKHKTRQQQEINYNGS
FT                   ELVESEEQQRQDEQEELEAVDEDEEDEEEEEIGYHINPDVNLYSNGHADKDTKDSSIDN
FT                   MGTENEDEMNKIINLSLDSRLERVIKLWLLTEQRIKDSNIVITNRT"
FT   CDS_pept        complement(1055742..1056515)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582856"
FT                   /orf_name="CD36_44400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42312.1"
FT                   /db_xref="HOGENOM:HBG396978"
FT                   /db_xref="UniParc:UPI000192D87B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD8"
FT                   /transl_table=12
FT                   /translation="MIVSAIIELVYQYDQLLTSFLQSNSFTSNLLATPISKLITEFLII
FT                   VFIVLLSYETIYWSGIYLNLWDYHAKDIFTEVPIHCSHVYIRLNFVDSDNIELLDQYYQ
FT                   LKSNSTILLSKFHDHFNFNVDFDLVGDFNNWKKLNSLSREVFKLQKFIKYYFEFSPEDF
FT                   EMNEEPEFGSTIVHLRGKVLNLINDSEYLRQFNQSNGKKSDKSIDDDNDKNELTVDNVK
FT                   IYNNKNIEVGSHENDNYLSKCNIETGNTIDVVVVI"
FT   CDS_pept        complement(1056998..1058770)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384924"
FT                   /orf_name="CD36_44410"
FT                   /product="Alpha-1,2-mannosyltransferase, putative "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX42313.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG395707"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI000192D87C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGD9"
FT                   /transl_table=12
FT                   /translation="MSSIFKERRRALLKPKPIIICLCLLSIFFTQLTKYQYQSLADDSQ
FT                   PTIAPHHSSLKSPQHNSTRSSSPIAPPKSLNKLTSQEFWEHIFNIFENNKFDDGLKPLI
FT                   KYTPQEQQLTTKIKTREWLLSKAKIFHKDTIMQYHESVVHNLPSKLPKSIYTPNTYGIV
FT                   TIGGNFYSWMAYIQLLQLRKLGSKLPVEILIPSIEDYYKESHFCDHVLPQHNARCILVP
FT                   EKLGFNVAKHWKFSSYQFKALALCLSSFQHVLILDSDNVVLSKPENVFDSPVYRDNGMV
FT                   LWPDYWERTISPEWYDIIGRPVVGNKQVRSGRFPVNIHNLLTHELEFEETRFHDLEGAL
FT                   PDLSTESGQVMFNKKTHGKVMLMVLYYNIFGPEIYYKLFSLGALGEGDKDTFAAAALAC
FT                   GEKYYQVASSIRTLGYFDSTPGGGFQGMAMAQKNPQLDYQLFQKTKKNFKDIHLDWDNE
FT                   AKDQFSANNKIPIFTMHCNMKKINPAAYMKNEKIANINEKRMNVRFYSNFKFKLNDDDI
FT                   YNPKKEQEKEKEESKKDKTKNDPNEVDFELSRWKIVSEILCDQKITFEFLKDDNMEEVC
FT                   QFVKNTIAWLEKEK"
FT   CDS_pept        1060807..1063326
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232075"
FT                   /gene_name="PMT6"
FT                   /orf_name="CD36_44420"
FT                   /product="Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase, putative"
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42314.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG332413"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI000192D87D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE0"
FT                   /transl_table=12
FT                   /translation="MATGYSTGASPFGLDDNSHNDSIHHRHQKQHNQSPDSLDVYEQDD
FT                   IEIEDIIQKTSQLHINTPTSTRIKNFFFPSSRRHNANSSSHSPQLREVFIKTINPLILT
FT                   AISSFVRLYRIDVANSVVWDEAHFGKFGSQYLKRQFYFDVHPPLGKLLIGLSGYLADYD
FT                   GSFEFESSNVYSDNVNYVFMRIFNCFFGILVTPLAYKTAVLLGYNQFTCWLIAFMVIFE
FT                   QLSLTLSKFILLDSMLLFFTVLTMYCLIKVHTLAMARGGSNTRPPLTKLEIKWFILAGI
FT                   SIGCVCSVKWVGLFVTALVGFYTIFDLWLKFYQTFAIDDKSPKKMSVGSYLIHWAVRIV
FT                   TLIIIPITIYVATFKVHFMVLNHTGPDDGTLSTLLQGSLIGNDLQSGPRSVAFGSLVTI
FT                   RSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHATLENGN
FT                   STASGGEDDDDDYYHVIIHDGDTVRINHKNTGCYLRANAVGAPVTSSSYEVSCFGDVES
FT                   NDWADEWVIEIQTQDQSPDPIFQDEDRSEIHSVSTSFRLKHKQLGCYLATTGKSYPAWG
FT                   YQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPPTEYVPPKPKFWKEFILLNYAMMAS
FT                   NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWLSTMALIAC
FT                   PVYLLIVGIKYQRQWISLSATDASNTNSVNKQTLSLLSARALLPLAGWVLHYVPFILMG
FT                   RVKYLHHYVPALYFAIFIAGFIVDAIVNLDFSYHNNKFQYIFKVVIYSTLYLVICISFW
FT                   YFKDLSFGMEGSSVAFRHLRLLGSWMI"
FT   mobile_element  complement(1063556..1063629)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon F,
FT                   truncated"
FT   CDS_pept        1066123..1068687
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582857"
FT                   /orf_name="CD36_44430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42315.1"
FT                   /db_xref="HOGENOM:HBG396977"
FT                   /db_xref="UniParc:UPI000192D92A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE1"
FT                   /transl_table=12
FT                   /translation="MNVDLTQYKNRPNTKSNNNFDDNNFTDDEDDINSNTTISTSISTS
FT                   TKEVKNTGQNQRQLYTTTNNPGVSLESTTCPSLATTSSDNTTNSDYNYLSAPESTSVPP
FT                   NTTTSDNNPPSNWIKANPPPKLASLPIDIPLQIKEVAPGDASFSSSDSEEYRNSYPNNS
FT                   TYNQPANFAMVYNNAQLRRQQQNILLNQQQHQQQQQQLQQQQQQQQQQQRQAMLLSPAR
FT                   DYNTLRYLANKKVDSPMSDEFFFQDNLASDVKFQYQQSIIEFLNYIIGKYKEMEQGINS
FT                   YTDWWNVYTFKRQTLDNLIHIAQGFKAMIISILKQLSLNSGIIGNGSQSKNKAFTQNSL
FT                   DPSYINTNMTTTNDDDDDLINYNVFQFVYNCSIENVNVGNLINCSLFTNTFKFNLLSYY
FT                   YKLNYLLINVKDQKNWLVIPMEIWYKLPSFIKIINDNLTKINKPMTRDLEITLVKLNSI
FT                   TCKFPTVDNLKKTDPIGSWHDFEKINRLLTEKFPDYTEHGHIQEFPDYMPRPLSSSNDI
FT                   KIIHMKRVAAPPRRIESGSLTIKNIANNNNNNNSNNNSNSNNNSQPEKLGRATSLKRSI
FT                   SKIVKRSLSTNDANNKEREDIPDQSPAAKLETNTPKHPPQRHQSLQEHLKNQQSVKTPK
FT                   REDLVLSKSPNKPCPLPPQPSIKPTIARYRSINGKKASIKKVDNSAIQYQLDCLVQFRK
FT                   RLFQIGPQLLEFLNLQLNYCKSWESLIDEQQQQYQQNGNMHVNNDPYIKSIYQSFHEKL
FT                   LNQIEFTKSTIILHIADRLIIPIDECLKLCDQGKGDPVNVNKFMELIVSQYNKLYRQWL
FT                   EGIIGSNSIKEYQDLCNKIGKPNGEDIIQYYNQLTKLKSLVM"
FT   CDS_pept        1071892..1072956
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232076"
FT                   /orf_name="CD36_44440"
FT                   /product="Reticulon-like protein, putative "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAX42316.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="HOGENOM:HBG396976"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniParc:UPI000192D92B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE2"
FT                   /transl_table=12
FT                   /translation="MSASIPTESPITTTTNTNTADITTSGTTPLAHEVPTPAVSSSSST
FT                   SIAGAHHPSCSTTDFLTWKNPIKTGKVFGSLVFGLIILKTVNLFNIFFHLAYIGLLVSA
FT                   AAEYSGKLITGKGFLANFKPTGKLYAKRFNDEVLPELANFNVHLEESFNKIVYSHDIET
FT                   TLKAAGISYVLYKLTSWFSLYTLIFIFVVLIFTVPVIYKTYKKEIDAAVADVTKIIKSK
FT                   TAEFTEKAHKAAGPHIDTLIKKTGPIGSFIQSKLPVRTAGSTVGDSKATSYGTDADKNI
FT                   AAGNSTTVPVSVPAASASAEPISTGHSTGASQFPNAPTSGLHPSTVEDVIKQTSEEADE
FT                   FADTTQESFKQTLH"
FT   CDS_pept        complement(1073448..1074395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000260965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080736"
FT                   /orf_name="CD36_44450"
FT                   /product="tRNA (Guanine-N(7)-)-methyltransferase subunit,
FT                   putative"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="CAX42317.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG324627"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI000192D92C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE3"
FT                   /transl_table=12
FT                   /translation="MSESTEKQEQVSAEPHLAKDSKSKQQSIAATKRKQYREDKSQIRK
FT                   QARFEVSTTPELEQSDSSTTTTTITELPKKRYYRQRAHSNPFSDHRLEYPKSPESMDWS
FT                   KLYPKQYDISKVEIADIGCGYGGLMIKLGPQFPKSLILGLEIRVQVTQYVEDRIIALRK
FT                   NQEIINSNKKESGDYSYQNIAVLRGNAMKFLPNFFVKGQLSKMFFCFPDPHFKQRKHKA
FT                   RIITNTLLSEYAYVLREGGVVYTITDVEDLHNWMVKHLDEHPLFERLSKEWEDQDKCVE
FT                   IMYNATEEGQKVTRNKGSKWVACYKRLPNPDDCE"
FT   CDS_pept        complement(1074811..1075584)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582858"
FT                   /orf_name="CD36_44460"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42318.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG396975"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI000192D92D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE4"
FT                   /transl_table=12
FT                   /translation="MLSHKLINTGILRNTSRISVNQWSKSFSTSIISSNQYADFIPANA
FT                   EQEQFLSRQTEKPLFSRKTYLIDFYKHLYDSNEILLFVHHNNLNKSDNNKYRQELIKSG
FT                   ATLHVIKSSVFKLLLRSINEPDPAQKGLAAKNKDKVHDLDPLLAGPTAIITIPKSDPQV
FT                   VASVMKVLKSANERLLLIGAKIEKNVMNLDEINQFKTLPTKESLQGQLVGLLTMAGGAG
FT                   LVRTLETPANALYLNLDQRKKDMEGPKQEETENKE"
FT   CDS_pept        1076055..1077890
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582859"
FT                   /orf_name="CD36_44470"
FT                   /product="RNAse III, putative"
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42319.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG447642"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI000192D92E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE5"
FT                   /transl_table=12
FT                   /translation="MSSFSQKNLAAQNIAETANKGFMSYIHNWTSTSQQEDNKVISSNL
FT                   DDLLSVSDIDSDTSMSTNNSSKNHHSSKRSSPAPIPSTATKKAKITDAYLKELSAYHEP
FT                   VFDRPPPTTIGILDMNQLEHSTKTMQKCVSSILEKAPNCNQLQYLIESNEIDNSTRIEL
FT                   QDNPLISTATKLKSLHEIGKLPILDQIINDEVEISENDLKNLKKVPVKSNSVKVNSHRD
FT                   TVPEIESTGVDHDMPPLPPIKDPKLFERVFVHRSTVNNKQYLEANQLLHSHNERLEFYG
FT                   DSILNNLVTLIIFKEFPDSAEGDLSKIRSRLVNNKTLVKFAFQYGFDKKLRTRISENVL
FT                   KTGDQKIFADVFEAYIGALALEKGLEVEDVKEWLAKLYAPLIHELKIEYIEDPIDREAK
FT                   SKLYALIGQDDLHPIYNTIQMGDGINHKFIVQCTINGEELGRGSANSLKEAGLRAAMAG
FT                   LNNTEILKKYFVARQQIERPIKLQRLERENAKKREIAERLEQEKNNLPSTPSSPIRTSM
FT                   FPIPVNENEPLDIDAKNKLYGILGRKIGDKPIYLTSQVNGNLFRVVLNVRSILICEATD
FT                   PSKKKAMARVAQTLLENESAMREICKDFRTRDSPE"
FT   CDS_pept        complement(1078188..1079729)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582860"
FT                   /orf_name="CD36_44480"
FT                   /product="General amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42320.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D92F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE6"
FT                   /transl_table=12
FT                   /translation="MSIPTKNLESIRSQELDSDQSISYDSTTGLKHGLKDRHLSLIALA
FT                   GIIGPGIMIGASLALASGPAALLLGFGIIGIVAFCMMQSLGEIATMYPTGATFSTLGAK
FT                   FVDYSWGGAVGWNYVIIWIAVLANEYNTTASVLQFWGPQVPLYGYVLILWAVFTAFQFL
FT                   GVSVWGEFEFWLALIKIVGLVTFYIFSIVYCAGGVKGTKAFGFHYWNDPGAFANGFKSF
FT                   VSTLTFASTFYSGCEVTAIAASEAKNPSRALPKAIRQTFWRILIVYIGIAISYGLTVPY
FT                   DDPRLSKGSKTLKSPMTIAIQRAGWDGGAHLINAFIIVVCISAISSSIYTGSRSMVNLA
FT                   NEGCAPSILKRVNGQGVPYAAVILMSTLGLISLMNQSTGAANAYQYIVNLSGVAVFIVW
FT                   GNVCFYHIRFRQAMKLQGRSLDEIPFKGLLYPYLPILGLVLNVFLALIQGWSYFKPFDA
FT                   GNWVDAYVLLPFFFVLYFGFKLWHKSKWVNLREVDLDEGRREDDEKGVDSNKWMI"
FT   CDS_pept        complement(1080665..1082755)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384925"
FT                   /gene_name="SUR1 (CSR1, ZAP1)"
FT                   /orf_name="CD36_44490"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42321.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG396974"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D930"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE7"
FT                   /transl_table=12
FT                   /translation="MLPIAGGPQNTNHEMGDANEVQVEFSRNKIPETLIKNLPVDGKVI
FT                   THGYVHGHIHKHKDHTHIHGHIHNHDHSTDLNTQINDRSIQPISKEYNQPNFNFSCPEL
FT                   DDLDFCKDVFCNDLDDCFYLSCGDSKNSNTCDVNCCDSRVDEICCTNDQCVEPNSVQPS
FT                   SCEKSDHLECCADPRCESYDICHSNLGDQSSVCTDPNCSEIDTCCSSLPQPTLPSHSEN
FT                   NLCQPQLSKRPIFEDLITNVHLSCKQTQSQKTNNVYPPKKKIKCESDFDIHFPHECHQD
FT                   YKKPSTTTTTNHQLHQSCFHTTIPDRKNTSLEYDEKLMSDFDFVIQFNNFNQLLNTAPK
FT                   HEPQQEQPNQFSKTTDFNEESTTRPMSYSCQWENCFKRLNNNTFLNHVIEDHLEKEEIV
FT                   KTENSNYQCEWNECNFTDNDFNSLINHLKSHQPSNQIETSSGSSLLNHVTNNYALTPLS
FT                   CSISNDASPVVALQSPQAPDLNITSVKIVPKSKKSCKPKVKKEEKDVDLEFTCNWQVGT
FT                   DDNGDPLYCNIKHQSPGELHSHLLDVHIGSGKHEYYCCWRGCERHNGKVFTQKQKLIRH
FT                   IHIHTNFKPCKCDICGASFAVESVLQQHYRVHSGEKPFKCPICDKTFATSSSLSIHTRV
FT                   HTGERPLACKWPGCNKRFSESSNLAKHMKIHTKKFNCEICGQSFDKKASFNRHVLEHST
FT                   EK"
FT   CDS_pept        1086517..1087767
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582861"
FT                   /orf_name="CD36_44500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42322.1"
FT                   /db_xref="HOGENOM:HBG396973"
FT                   /db_xref="UniParc:UPI000192D931"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE8"
FT                   /transl_table=12
FT                   /translation="MFFKKRSKNYQQSPMTPAPVTIKKSKSARDFFLKLASPLSYKSQP
FT                   SEIDQTPITPISQVFQTADLAEIKSPPTPAQYNLIADDIPQLLSPPRISSLMHPKILEF
FT                   EIDSFEQTSTPIKGETRLTTRKRRNVDEPESVKRRSDDSVDSIFDNAYHSDGEDLGYYL
FT                   KKASGSVSRPGSFFDKESSIFITQADIEIFTKYDTSNPNPQSNTFMESFLDVYDDQIND
FT                   HTTNQQQLVDLEELQSEQHQQQQQQQENNLSLNNQAGLEINDEIYQLELMLIKEKHNYI
FT                   MKKQQRQINHLQKLLSYQNQINQQLVNQMSANNTDDNSSNNKLLPPFSMNYPHKRTNTN
FT                   TDTHIDIDMDIYVDDNKSTVSSADSIMSRNLDIHNPNYQRIHNNNSDGNNTVETRNYSS
FT                   TSSLRSHFVNDYCKINC"
FT   CDS_pept        complement(1088052..1090379)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582862"
FT                   /orf_name="CD36_44510"
FT                   /product="Topoisomerase II-associated deadenylation-
FT                   dependent mRNA-decapping factor, putative "
FT                   /function="isomerase activity"
FT                   /protein_id="CAX42323.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG396972"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="UniParc:UPI000192D932"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGE9"
FT                   /transl_table=12
FT                   /translation="MSFFGFDPAAPPQGANQKDDVYDFENTYDGLGELQEDDAFNQETF
FT                   GTSTSEIRKDFEFSQGESQQSESYAKASAPPAQTISYAQAATVPVNDDEFMQELWGSSN
FT                   APSKNHTDSTEEKTAGGQSEKKILSLEEIEAQLTAIDPSQQPPLPQQQFPPQPYGVPGM
FT                   MPPPPQFGYMMAPGFMPPQYPYPGMIPQQMPPMQQGQFPPPQPQQQQQQQQQQPQPQQQ
FT                   QQTAGPVDKQVSEGPARSPASKKTQKVDLSNFPVLGSKEAQSHQQSTPQQQVQSQQQRH
FT                   HHHYNQHYQHGHQREPSQELTPEQQEKAARRQEKVSRIMKYSGIMNPKDKDFVTRFQLS
FT                   QIVTEDPYNEDFYAQVFKVIHPKTINGAQQSTQQNNSIAQAYLDHSGHRLGGRYKRADV
FT                   ALQRMQQQVQKAVTVAKERPKLTQYAKEGALGKISFGSGKKPRQQLEIISKAAERQKQE
FT                   NQIGKKEGVKHYSKKDILSILENIIGELMNVESESRTRADVDTSKLWESLKVLEQSSSS
FT                   GDEESEVNPFIQCLNYNKMLKILLRLFKFLTREQILTIVTLIMSNLENLLVIKNGSYTT
FT                   YPNKKVPENIVKLVEAYTLTFSKVLMNAVLDFKFNEIIGLLVILIEHNNVSFVSTTKIG
FT                   LSILTTLLSRAELIIGEGSISATDLSEWSSCYDELFTSLESRIAAIFPPNPEDVDDGSS
FT                   GENYIWQFLATLSLGGKLSHQRIIVDEVRDEIFCVMNRAKAIANTDMANLYKKQNLLNN
FT                   LNMYLVVMGLVADETEIKELQQ"
FT   CDS_pept        1091144..1092091
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248014" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080737"
FT                   /orf_name="CD36_44520"
FT                   /product="L-asparaginase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42324.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="UniParc:UPI000192D933"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF0"
FT                   /transl_table=12
FT                   /translation="MNDILIIHIGAGKHDPNKSENYKTLLRNALTRPSITEASDVIESS
FT                   SLTNTGHGSSLNLLGKVECDASYISNDKVGAIVNMTCEKPTKELFRIFQYLDTLYDSDE
FT                   TDLTPPVMLVYPSLKNLIPNIMDGNLVSAKSRKIYDTYKDKIFQGKHLDHYTIPNEVSD
FT                   TIGITHISDTETTIVTSSGGNFFKLPGRIGCAGVIGAAIARKKLSDCEICCMCSGNGEQ
FT                   IIKSKLAWEIANSIANVAGDEYGGYLEKMIYELNPRFYVGFIIVLNYGSQTQLLYGHTT
FT                   ETFYFGFRSPNQTRIVLSSSDKLGYFTFGEYSLH"
FT   CDS_pept        complement(1092278..1092745)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384926"
FT                   /orf_name="CD36_44530"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42325.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniParc:UPI000192D934"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF1"
FT                   /transl_table=12
FT                   /translation="MKIEVDSFSGSKIYPGRGTLFVRGDSKIFRFQSSKSASLFQQRKN
FT                   PRRISWTVLYRRHHKKGISEEAAKKRTRKTVKHQRAIVGASLELIKERRSQKPADRKAA
FT                   RDSKLAKDKEAKKAAKAARKAEKAKAVASGASVVSKQQAKGSFQKVKATSR"
FT   CDS_pept        join(1093046..1093048,1093731..1094048)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000055224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582863"
FT                   /orf_name="CD36_44540"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42326.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG553631"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="UniParc:UPI000192D935"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF2"
FT                   /transl_table=12
FT                   /translation="MAPKSNKNQENINSKLALTIKSGKYTLGYKSVVKSLRTGKAKLVI
FT                   IAANTPVLRKSELEYYAMLSKTPVYYFQGGNNELGTVCGKLFRVGTLSILDAGDSDILS
FT                   SI"
FT   CDS_pept        complement(1094167..1094907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582864"
FT                   /orf_name="CD36_44550"
FT                   /product="DASH complex subunit, putative "
FT                   /protein_id="CAX42327.1"
FT                   /db_xref="HOGENOM:HBG448306"
FT                   /db_xref="InterPro:IPR013966"
FT                   /db_xref="UniParc:UPI000192D936"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF3"
FT                   /transl_table=12
FT                   /translation="MTVSEPLEKLQQSFRSIQSINFDDAQMFTNSIVNAPAITTLLKDP
FT                   THDESLLYKIVKPKTNKGPSKLVSTIVESASMDSKPERVDGKILYTLEGIISDKPEDED
FT                   SEEDERNPVVKFPKLGPRNAYSRPFIHLENSEDFKETFYQISQVLSKYPNLIDDYPTLI
FT                   NKLNTYEDTYRKLQRDIENLEEEIKVSKAFLEDNYNVSYSPKVKSSASFGSDDPDAQID
FT                   IDEAIRREEEEIAQLELQFNKRGY"
FT   CDS_pept        1095011..1096291
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000109569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582865"
FT                   /orf_name="CD36_44560"
FT                   /product="Glycoprotein endopeptidase, putative "
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX42328.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniParc:UPI000192D937"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF4"
FT                   /transl_table=12
FT                   /translation="MLNANCVSRSLASRCDIFFQSSRVEKNNFFFFFKEEGDNYIFLIL
FT                   HSRSPYYTIMTVDLDKYLKPGKDHYLALGLEGSANKLGVGVIKHNRGPLSSTNRAEVLS
FT                   NIRDTYITPPGEGFLPRDTARHHRNWVVRIIKQALATAKVAGKDIDVICFTQGPGMGAP
FT                   LQSVVIAARTLAQLWEIPMVGVNHCVGHIEMGREITGAQNPVVLYVSGGNTQVIAYSKQ
FT                   RYRIFGETLDIAIGNCLDRFARTLKIPNEPAPGYNIEQMAKKGKHLVALPYTVKGMDLS
FT                   MSGILASIDSIAKEMFGKQQKKLIDEESGEPITAEDLCFSLQETLFSMLVEITERALAH
FT                   VDSNQVLIVGGVGSNQRLQEMMKLMIQDRKNGQIYATDERFCIDNGIMIAHAGLLSYRT
FT                   GQTNQLNNTVCTQRFRTDEVFVKWRDD"
FT   CDS_pept        complement(1096454..1097290)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232077"
FT                   /orf_name="CD36_44570"
FT                   /product="DnaJ domain-containing protein "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX42329.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG448305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000192D9F3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF5"
FT                   /transl_table=12
FT                   /translation="MDQTISQIINDDINLYDVLGVSLDSTPQDIRRAYRQKALQFHPDK
FT                   YDGDTTKFNLILKSYEILSDNSLKLKYDELCQIKLTKLENRAQLDDLTRKFQDELIASE
FT                   SKRQKHRHPNIELMKQEGLKKRRIQEQKLFDEKKPCTTIYDIPLNNNVSVSSKYANTTV
FT                   SLKYKFKKELENLIDGNVISKIMSIFGEVTKVTMNGHDNRYAYAYIEFATIDGCNQALR
FT                   HNYSESARKWDGTEVRKLASLLRECKKADLAISDFTNNDKVNQILRDYLKSVNSRI"
FT   CDS_pept        <1097831..1098595
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080738"
FT                   /orf_name="CD36_44580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42330.1"
FT                   /db_xref="HOGENOM:HBG397489"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000192D9F4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF6"
FT                   /transl_table=12
FT                   /translation="GVIIDHSTGTVTKDGVPYDYLHKNLELQPPPPNLNNLTKGIFILP
FT                   DEIIDKILSYVNQIDIIHFALIHRSFREICKKKLMENIYVYLHTKDRPLFPKNFYIPAF
FT                   TNYTLIGEFSFEELFHGDDTNPKYVENIFFQRTNDETSLMVKNKQIQKLRGSVNFGIIY
FT                   LNEDASWLSDYQLKTKPTKPILSDDINLELKNHPLNRIKQLTLYCSDSAKIQTRFTFIK
FT                   QMPNLEKLMLIDLPYFQLPEPVDILDLHIHNS"
FT   CDS_pept        1098667..1099080
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582866"
FT                   /orf_name="CD36_44590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42331.1"
FT                   /db_xref="HOGENOM:HBG396969"
FT                   /db_xref="UniParc:UPI000192D9F5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF7"
FT                   /transl_table=12
FT                   /translation="MNLFNIPLVDHAEKFTSLESLNVNLDETVFVSIVRTLRQNSLKEI
FT                   GVPESLNSFETIYPALLHHKDSLKVIFENEVYLKNNFLDWKYVSESSFNVDLNLDEFPK
FT                   LEYVVRKKSISLVDRNGPVLQFVPVEYHPREEI"
FT   CDS_pept        complement(1099865..1100128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080739"
FT                   /orf_name="CD36_44600"
FT                   /product="Uncharacterized protein YCL057C homologue,
FT                   putative"
FT                   /protein_id="CAX42332.1"
FT                   /db_xref="HOGENOM:HBG323822"
FT                   /db_xref="InterPro:IPR007512"
FT                   /db_xref="UniParc:UPI000192D9F6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF8"
FT                   /transl_table=12
FT                   /translation="MSTEIKPQELVPSTASQNLLNDKWDVVLSNTLIKTGLGFGGGVLA
FT                   SILFFKRRAFPVWLGVGFGLGRGYAEGDAIFRSNHGLRTVKA"
FT   CDS_pept        1101003..1102658
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537669"
FT                   /orf_name="CD36_44610"
FT                   /product="Acetyl-coenzyme A transporter, putative "
FT                   /protein_id="CAX42333.1"
FT                   /db_xref="HOGENOM:HBG627011"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192D9F7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGF9"
FT                   /transl_table=12
FT                   /translation="MSENQQFSVSDSTENKLNYRHAAFDEENNGLLPLANKNLKPKHTT
FT                   TTNNTSGHHTHTKSSHLAPQDRKAFIILVLLYVLQGVPVGLAFGSIPFILKSKLTYSQV
FT                   GIFSLAAYPYSLKLIWSPFVDSIYSKKWGRRRSWIIPIQTISGIMLIFLGSQINDLMEN
FT                   PKNYLSLITFVFFILILCCATQDIAVDGWALTCLSPESLSYASTAQTIGINTGYFSSFT
FT                   IFLALSSPDFANKYLRSTPLNVGLFSLGGYLKFWGWMYLIVTGVICLVPEDPPHLVNIN
FT                   KDRLAKEKGLYNTTSWQDLTNVYKSMYEVLKLPNVQTFVIILLIAKLGFQVNEAGTNLK
FT                   LLEKGLSKEDLSITVLIDFPFEMIFGYYAGRWSTGKAPLRPWLWGFMGRLVAASLAQLI
FT                   VYFFPKDGKVSTTYFIIIILQHLLGSFMSTIQFVSLCAFHTKIADPAIGGTYMTTLNTL
FT                   SNYGGTWPRIFIYYLIDKITINKCITDKGYIMLTSEEAKEQCTYSGGKVETIRDGYFYT
FT                   NALCITLGIIIFFWVKKKATYLQSLPNSAWRVSK"
FT   CDS_pept        complement(1102779..1104158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232078"
FT                   /orf_name="CD36_44620"
FT                   /product="Uncharacterized membrane protein YOL092W
FT                   homologue, putative"
FT                   /protein_id="CAX42334.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000192D9F8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG0"
FT                   /transl_table=12
FT                   /translation="MTDSLRLTHSLKLLDNFMFNISKTSSIISLTIWLFTQIPQIILNY
FT                   KRRDVSLSISFVGLTFLADIINLTYQISIKDSAYCILLVYMIILDLIIISQYYYYSRYF
FT                   KKSVSSPPQQQPTLVNRILGAAFVTDLASAMNIKVQQQQQQTFPLYIDWVQVLPISCCF
FT                   LYIISRIPQIRRNYVRKSTTGLSLYMVLFTVLGTIFNLLSIVTDTNLYKVLSIKIFLIG
FT                   SFVIVIMDGVLLYQFWLYRKPISPYENDIVDIDEQPQWYVKNQPLVFYQSFEQDRPLQQ
FT                   QQLASSSVPSTTSSPHFSNSIHPIKSNQSRGRKLVKSPGEQTSLLDESLIASTAVSMAT
FT                   PPPPQHYIVSSSSRSRYQSIHRFNSQQNQNQSTQPKIIPQSLTSSSVGSATSLIPSIIG
FT                   NISSVNKKLMDGSKIPFSPIDFLTDDYYNGNKNVNSSREGVNNGNVVVGSSNVYYGSID
FT                   T"
FT   CDS_pept        1105246..1106520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582867"
FT                   /orf_name="CD36_44630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42335.1"
FT                   /db_xref="HOGENOM:HBG396968"
FT                   /db_xref="UniParc:UPI000192D9F9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG1"
FT                   /transl_table=12
FT                   /translation="MVLLGDIIQSQQNFSNLTTSIPSLDNLIFQTQVKNKIYDVQSAPS
FT                   CNGMYMVLCALVASHLRENKSIVLIDTMNKFPLQFLKSQPHFEQSWLDNITYYRCDTFA
FT                   KLYSTLIDTTIPSDTILIINEFHQLLQVYRLELSSIYEDVILKHHIEINDTFINNKKTQ
FT                   EKDPLPELPNNSDLLKSSPILKYESHVNSLITNLKNKCINLNSMVFLLGYLDTKYRPYK
FT                   ATKNQDLLESLNSISPTPSSSSFSSFSEKGRVVLSPFKTHKSLDVKLIIYHDWYHNSPH
FT                   FRNQYCKTTNSEKNTVINQDQLKLVYAAQIVIFKMNSLSTTTSSNPIFFDIDSEFYNTY
FT                   DELFDKHSNNQQSHFTMIDLNQQFTVPDISSSPNVEDLTMLHATNAESSFIIDKSRTPT
FT                   IIDTHDIIEDSEDELPIISTSSMIT"
FT   CDS_pept        1106728..1108290
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582868"
FT                   /orf_name="CD36_44640"
FT                   /product="WD repeat-containing protein, putative "
FT                   /protein_id="CAX42336.1"
FT                   /db_xref="HOGENOM:HBG330076"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D9FA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG2"
FT                   /transl_table=12
FT                   /translation="MATVIPPPSKKQKKEAQKVRDLDLIPKDLPNVLIKFQASDTGEST
FT                   GGSIRVPGGITEKQLEELLNNLQGESDDPVPYTFSLLNADEKDSSTTANNKLIDIKDNL
FT                   YHSVLKPGIKTTEDFLTLVYTPRAIFKVKPITRSNAAIAGHGSTILCCAFAPNDSSRMC
FT                   SGAGDSTARIWDCNTQTPLHTLSGHSNWVLCVTYSPDGKLIATGSMDNTIRLWDATTGK
FT                   PVGKPLLGHSKWVSSLSWEPLHLVKANDNPRLVSGSKDGTVKIWDTTARTCTMTLSSHT
FT                   GAVSCVKWSGSNIVYSASHDKTIKAWDISANGKCIQTLKSHAHWVNHLSLSTDYVLRKG
FT                   GFDHTSTKITHYSPEELRTRALQQYEKVAKLNGSINERLVTASDDFTMYFWEPLKSSKP
FT                   ICRMTGHQKLVNHVNFSPDGRFVVSSSFDNSIKLWDGIRGTFISTLRGHVAPVYQTAWS
FT                   ADNRLLVSCSKDTTLKVWDIRTKKLSVDLPGHSDEVYAVDWSLDGKRVASGGKDKMIRL
FT                   WSH"
FT   CDS_pept        1108474..1108848
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582869"
FT                   /orf_name="CD36_44650"
FT                   /product="Mitochondrial ribosomal protein of the small
FT                   subunit, putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX42337.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG396967"
FT                   /db_xref="InterPro:IPR007740"
FT                   /db_xref="UniParc:UPI000192D9FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG3"
FT                   /transl_table=12
FT                   /translation="MRPSSILSKIHIKTPKPELQLFQFPKLSEISYKDLPNNGFGINNY
FT                   FIPKTKFNHWPVYIKIQNTKITTEIKRIQGDLLKLREDLLNFNPNYKLTINSTAGIVNI
FT                   KGNVVEEIKNYLDKNSTSTQ"
FT   CDS_pept        complement(1109015..1113502)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582870"
FT                   /orf_name="CD36_44660"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX42338.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG398769"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015747"
FT                   /db_xref="InterPro:IPR017240"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D9FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG4"
FT                   /transl_table=12
FT                   /translation="MSDIPSSNESHSDSIPINHNNNNNNNNNNNSKEIGKDINSTHTPH
FT                   HRVSFTEQQSMSTSSRKSSLLRKHSSNNSSLENDKRPSIISRNSNPDIHRESLPPLSRG
FT                   PSYNSNYTRSHSSKNVNANNSINAGITSDNNNNNNSHANLNTPVSSPVTSSVSSPSANG
FT                   KQFNLTLPAGKSREKSPGRHSKEGGHTRSRSFTKQQYGAGSTSSQSSTSYLAQEKAYLR
FT                   KMRNQSIDDYYSKGIPGAHEFSKADDNDDEDDEDEEHSSFDAGDNANLLAAIDDDKYQI
FT                   DYSMALSLMKNSNVNLRKIANLNSDDTDDPAIIERLEWQSMLTSVLTGDVVRSEKTKII
FT                   NINNPDSTQESYLHATFKENLWFGIRAKIFNRTEDEQRKIVAYRRTLVDQLIDDVMKFE
FT                   IDYENSTENPIRGQVKTILDRYDQACSLWKTLEDMYSDKPACRSEEFQNRIDALTAWLT
FT                   ITDAISRETKSLRLWIGNDELDITKSPVEVSSSNTVTSNSKIVKKIFDEDNKSLAERLM
FT                   KEKDVQTIFRKRIFKPIAPWMIKSKDTYIRLGVMFENMKLPDYLHDLLQICIIPVRLIK
FT                   EIVIVRLGYAMKLQNPTLMMIDQMLDDFKSYITVALEVKSGISEYKEPDEDRKWLISDL
FT                   FDSELEDFDNVILRCVRYFLVLLNRKLLDSSRSPTTFRTFKEPEELEEAWNFLKPLGHY
FT                   VDGGSVVVAEEITMLASRLIHRLMAYFNHQIRDPTYNGSSQDLIRWYSSTSENFGQLRR
FT                   KLARFMGEISRDFKNSVVFDIPSQSNSTKTLLDILRTTNHFLVYTGTVETQGTYFFASP
FT                   ELLGNEQEILKILTGSYVGLDPSTDNSHFTDLLHLIRSGSEEQIRYNDDNDDDDLESYD
FT                   DSNSAYAYVLALCPMKPIVWDGLVVNVDIDSVPITDMKNGELLLVSKLSYYDLHIVRNR
FT                   FLEVASEVSLGNAGLKQMEYRCSLAKVNQELKKMNRVVFKMCSSVLESVEIIKTRIAEL
FT                   DPVGEYQALINSYFIYARDYGKNSVRMLDPQRKSTIIMKMIQLSIDWVSFICDDCIPTD
FT                   RKTFRWCVLALEFAMEMIRGINIFLLTEEQFTKLKVKVARCMSLLISHFDIMGARSSEA
FT                   EKNKLLKWTLQRHNIASSQNDDEYLNKVYHEEVMGQIKKIEEERRDLQEELQSIGRVLD
FT                   VTDSEYQFVTLLASSFSSVSIRWQKGACIGRGTFGQVFSAVNLDTGGVMAVKEITFHDS
FT                   QSIKNIVPSIKEEMTVLEMLNHPNVVQYFGVEVHRDKVYIFMEFCEGGSLAGLLTHGRI
FT                   EDEMVIQVYTLQMLEGLAYLHQSGVVHRDIKPENVLLDHNGVIKFVDFGAAKVIASSGR
FT                   TLSGMTNASLRKSVKRDGHDNLNSMTGTPMYMSPEAITGTSTDRSGVVDIWSLGCCVLE
FT                   MATGRRPWANLDNEWAIMYHIAAGHKPQLPSPEQLSESGRNFLARCLEHDPDKRPSAVE
FT                   LLADPWMVDIRQIAFGNSDVTTTPSSEISGPISE"
FT   CDS_pept        complement(1114592..1115839)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582871"
FT                   /orf_name="CD36_44670"
FT                   /product="Serine/threonine-protein phosphatase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX42339.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI000192D9FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG5"
FT                   /transl_table=12
FT                   /translation="MTVPFKIPISDLDYCLEQLLDHKPPKILPPETIQQLCHTLKTQLL
FT                   QVPNIISLQSPISVVGDIHGQYHDLLEIFQIGGSPPQTNYLFLGDYVDRGYYSVETISL
FT                   LLVLKLRYPERVFLIRGNHESRTITTNYGFYTEVLNKYQGSADVWTFITDLFDYLPLGA
FT                   TIDGKIFACHGGLSPSCQQLDQIRAVDRFREIPHDGIMADLVWSDPDVAISDFKLSPRG
FT                   AGYLFGNDVIDKFCHDNSLVQMIRAHQLCNEGYTSYWKGKCLTVWSAPNYCYRCGNKAS
FT                   VLEILHSNYDSKDPTDVPDGEQDKAVNSINGEFIGSIDYDNGYNDYRNRFNNSSWLHKQ
FT                   QGVLPGQFFNVFEASKENDEDTLQGKSVNGINFEDELSTSDDDSNSNSSNNNNKSDFFA
FT                   SFFQDRPKRQQVEYFL"
FT   CDS_pept        1117125..1119125
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582872"
FT                   /orf_name="CD36_44680"
FT                   /product="RNase III, putative"
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX42340.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG396963"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI000192D9FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG6"
FT                   /transl_table=12
FT                   /translation="MSFDKTESLLTVCDDLTQVKGNVSQFQAMVNNIISKAPTREEYEK
FT                   LLKIIRLGEAPGETVQTIERLEQLMTASQTKVAVRLKELYLGGYLPLLTSLSKINFKSN
FT                   VEDQFVSYFLDYNPVLPSNVVQDLRVLQGKKPDTLTAPIDIISYPPTLPAISSTILLIR
FT                   IMTDRSYRQPSDFIESSSSDYNKSHNGRLVLRGRAIMQLCLVEVLEESYPRLLDEDIQF
FT                   ISHKLMTPIILTKFAFGYNLVDHLKYNFSVDADYEEKLQIIGNIFLAYMGGLKTEGYDL
FT                   NDLKLFVKRLYEPVIADYMNKNDVLSKVALVELDLLFKSVTNMLYLPRENIRYEIIQVE
FT                   SDPHVARILVDNEELGSGVSSVSFEEAKCRAAQDILNDQGRIMKIWEILKNNHMKNNTT
FT                   KSVIKTENPETVMQIPIQQAPPTMSSHVGTPVVEHATESPSIQNLTTTPISPSSANANT
FT                   RQTPPQFAMQPPPSQQSFAFAQQHYPGVAYQTPFLQPQQYGGGAPIGYFHPMQQQHLHS
FT                   QAAAAAAVTASPQLLQQHAQAQTQTQAQAQAPARSQVQPPSSGPLYDQNATSKNGEQIY
FT                   VDQYGIPHLGTGCKKVDTNAKNDLYSKLGKAKISTPQYEDKISPEKVYHVLVSVKGIYL
FT                   GGGFDLNKKLAAQKAAMCALVNTPKLAEIGL"
FT   CDS_pept        complement(1119208..1120578)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582873"
FT                   /orf_name="CD36_44690"
FT                   /product="Acetylornithine aminotransferase, mitochondrial,
FT                   putative"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="arginine metabolic process "
FT                   /protein_id="CAX42341.1"
FT                   /db_xref="GO:0006525"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192D9FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG7"
FT                   /transl_table=12
FT                   /translation="MLRTYTKSLLKTSTVIKKSLLLNPATLSLLTKKYSTTTSIPDAND
FT                   ESHTGKFINSISKPYSVTTYARPNLVLTHGKGSYIYDLEDRKYIDFTSGIAVTCLGHSY
FT                   EPITELIKQQSEKLIHCSNLYYNLPAGELSNKLINKTKEFEGMKDASRVFLCNSGTEAN
FT                   EAALKFARKYGKTINKEKYEFITFENSFHGRSMGALSVTPNPKYQEPFSPLIPGVKIAK
FT                   PNDIESVKQVINKDKTCAVIIEPLQGEGGVNLIDESFLIELRKLCDENNVLLIYDEIQC
FT                   GLGRTGKLWAHSWLSPQAHPDIVTIAKALGNGFPIGATMITEKVESSLNVGDHGTTYGG
FT                   NPLASSVGSFIVDHIADKEFLTQVGNKSKIFLEGLNKISNEYPNLIEKVKGKGLLLGLQ
FT                   FKQNVDIGEIVAKCRQHGLLIITAGMNTIRLVPALNIPDQTIKDGLEILTQSIKEVN"
FT   CDS_pept        complement(1120873..1122963)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582874"
FT                   /orf_name="CD36_44700"
FT                   /product="Zinc ion transmembrane transporter, putative "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX42342.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396962"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI000192DAB8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG8"
FT                   /transl_table=12
FT                   /translation="MTDKDLSPSPALNDPFETESAVSDTSDTPMTNNFEIPQIQTPQDS
FT                   QINPMSPSIHIEESFIPNDTSSTSNFGLLSSANFSTDSLNNDTMTEPFNDYYNNNNNSN
FT                   FSNSNNGSPRRYSNSSLTNSPRMGRANSNSATSRSRPLSAFLMDSSNAISEDGQPIQPV
FT                   FNNTPRSRNSLTFGIKTPISSTFSNNYTPPPLAAPTGPYRSSSPTRQSSPSRINKHYRS
FT                   TSPVRRGSSPTKANNNNNNNNNSNPFNFQSQDLMYQTNLNVSNGSNLSLPLKPAHRKGH
FT                   KYKHSSISMNLFQEPPPVDIGMTQLSAIPDSYPIPNFNETLNSITPNQKLRFMWSGFHV
FT                   SLSLIIFTIGFKYKLSSLSTLAHLVFYDSLGSLLIVFVDTMSNFDVWNKSSLAYPFGLG
FT                   RIEVLVGFALSTSLVMVGFDLFSHFIEEFIILWVSPDNHVDHEHSSHNVHAEPGKNNTD
FT                   SNWLIYISVLIITMVVSLISSNYILTYDRITEMINGQDDSGLKGNFSTKGNINNGSLLI
FT                   DVDINNTAGEKLKKIVSAWKKNPTHLITLSYTLFLLVGPLIPQSLTSDLAIDINEAATI
FT                   TVALLLCYNGWKLVKTLGGILLCSFPYSDYDYHVLKSRIVDQILSKDFFKQTYRIEKFF
FT                   ITKFNYRLFVIGMKINMKGANSDEEVRMRFEINRIIYNELEKLDNSSKLVKPEITIDID
FT                   RF"
FT   CDS_pept        complement(1123510..1128777)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384927"
FT                   /orf_name="CD36_44710"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex, putative"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX42343.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG396961"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniParc:UPI000192DAB9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGG9"
FT                   /transl_table=12
FT                   /translation="MSNKNRNRNSLLSSHNRSSHTNSTSKDELLKLKYSMESPNLSIYP
FT                   LNDSSSMINCKTNDNLKNSPYQKSKSQPQTQPQPQQQGSLVYPDFMPWKDHTQLPQDET
FT                   EIEHQKLSNVSYLNKGYFEPPQVANEYYSARNLIQATVFLSTDNCTNVINELSIHLSNA
FT                   YKSRNEIINKIKFDSNKFKLPTRVTLTSSKKEIWLNELSNPNVSMTKLGEKIPHGIRNK
FT                   ILIDCICNKKIPMNRSIWFTKCVLYGELLALRRKHQNRLSTIPNNNNNNNNNNIGSSLT
FT                   GTMDHNTAEKFEIHWLQEWTQQITDYIYKFSREMNNVVNLDGKNQYMGKLSYLLNYIQS
FT                   LYIESLLDKSLFLSLILKFLKEGLCLQPKYINGLIYASMEENLDDYNDDNDDDNEEEGQ
FT                   EDQEDKGIIVDDNSENNNKTKIKSKKRNLAWVDEIDMNYGQRLVSLTLIKMFWNDILKF
FT                   DYLSKELSELLLLNHFFINKLLLINNNDKEKNDVTVVISDGLQSKILKLISDCIRYLFE
FT                   YNCNIFIIPNHWTLIEQSLMKILLSDSKATSEKEQEEIQKQLELIKYRNESLILNLKSE
FT                   FNNSNNNNNNNNNNNTSSSNLVTTTTATSKRFVRSGSFSNYTPKSISNTTMEQDYSFIN
FT                   RSSDDVLNIVEKLDNLKLNEEFATFLKPTKKSNINWKLNLKVLLYWCVLPWRNPINSNE
FT                   DILFVCNFLKNTVVKSLTKSLRTEFDNELLEIIYHIAEDNNNLQFTSSRLYVLINELYQ
FT                   LKLITIAAYLRKLIASGIFYLEPGSTIDQSLNNLPRIMEIHLKILENLPVLNNRQCDSI
FT                   LKRWTPMGFDFKGKFSQGQSLLQDSIIMKICDNQLTDEIDGKCIEYIDSLSVGLQFLLI
FT                   NWLTNELKSKIKSTNKLIHFTPTVITKLYQFYTENSGLTVFFKVVIQTILKNDGGMIIF
FT                   YLDSLYLISKLVIRHYKLIKSIAGTHELSTAYDLFKLIIQVYKDLNTREYDCFKFNSVW
FT                   NFINAVIEKSSTKTAASMSISSLSSTSGGNRDSKLKSVQGLHSKQTMDSPMYINTVDDS
FT                   HTHETRFGTKRYTSTDFRNDLNFLITLQPRTLTLEEQQEVFDLIEIELKDVDSILEFWY
FT                   NNFETLDEEKEINLMKILKSLIVNKFSDHSSQFNEKLKQFIISKAGQSQSINYFKVNNF
FT                   LKKLVIFDLVRINDIVKLIQSMQRDDINIIDDPILFIYDLIWGEVEETYFSCCQLILLQ
FT                   IARRMYQEKSSYQCTILMQQGLLKNHETQLQNNSFFIKYKQDVLTFFHKAIITNTKAIQ
FT                   SQFFDKLSHSDSLQLLNMLLQRQEHEYIATIEDFSLFIKHINEFNMPLCQILLNILFKI
FT                   FLPIDNKLEIKHQLEIFVDNLLQEIKFEFSNENSFFGELFNLMPWNQKNYILEILETKF
FT                   LLQTNLNNDQIELIINDKNLLPPLNDFFKKFSSSSSSSSSGQIIDTDSSFFLNLFNFIG
FT                   NLVNVANCQELIIKQSNSINDTISIFLRILIIHKSYLCSMISRNTNEENVISFVTKLID
FT                   LLNSDYLTNHNDKLRILLYDLLLLMKSSVSEEVNSNRELNDNIQGNGNGNRSGSGSAGG
FT                   GSNATSPNQDTIPEDQNNNTTKDSKSQIGVTNNNDMLDVITPAVSSIQVLFDLPEPNAT
FT                   NPFKEFIDDKLIKCSIMLEEEELKYGGDYHVFNNTGLYLKSTKNFESVSLPPFVNGLNK
FT                   NTGDYDNSSTKMVNTQSFKMKSFEILEDVNSNTNKNSVNDGCINLRLFDAYTTNENPR"
FT   CDS_pept        complement(1129254..1133252)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000260265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232079"
FT                   /orf_name="CD36_44720"
FT                   /product="Myosin, putative"
FT                   /function="ATP binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAX42344.2"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="UniParc:UPI000192DABA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH0"
FT                   /transl_table=12
FT                   /translation="MAIVKRGGRTKTKQQQVPAKSSGGASGGGGIKKAEFDITKKKEVG
FT                   VSDLTLLSKITDEAINENLHKRFMNDTIYTYIGHVLISVNPFRDLGIYTLENLNKYKGR
FT                   NRLEVPPHVFAIAESMYYNLKSYGENQCVIISGESGAGKTEAAKQIMQYIANVSVDQDN
FT                   IEISKIKNMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNENNYQPIAAHITNYLL
FT                   EKQRVVSQITNERNFHIFYQFTKNCPPQYQQMFGIQSPETYVYTSAAKCINVDGIDDAQ
FT                   DFQDTLNAMKIIGLTQQEQDNIFRMLAVILWIGNISFIEDENGNATIRDDSVTNFVAYL
FT                   LDVNSEILKKAIIERTIETSHGMRRGSTYHSPLNIVQATAVRDALAKGIYNNLFEWIVE
FT                   RVNVSLSSHQQQSCKTIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQD
FT                   EYVQEQIKWTPIDYFNNKVVCDLIEATRPQPGLFAALNDSIKTAHADSEAADQVFAQRL
FT                   SMVGASNRHFEDRRGKFIIKHYAGDVTYDVAGMTDKNKDAMLRDLLELVSTSKNTFINQ
FT                   ILFPPDLLSILTDSRKKPETASDKIKKSANILVDTLSQCTPSYIRTIKPNQTKKPHDYD
FT                   NQQVLHQIKYLGLKENVRIRRAGFAYRSTFERFVQRFYLLSSTTGYAGDYIWRGDDISA
FT                   VKEILKSCHIPSSEYQLGTTKVFIKTPETLFALEDMRDKYWHNMAARIQRAWRRYVKRK
FT                   EDAAKTIQNAWRIKKHGNQFEQFRDYGNDLLQGRKERRRMSMLGSRAFMGDYLGCNYKS
FT                   GGYGRFIINQVGINESVIFSSKGEILLSKFGRSSKRLPRIFIVTKTSIYIIAEVLMEKR
FT                   LQLQKEFIIPINNINYLGLSTFQDNWIAISLHSPTPIIPDVFINLDFKTELMAQLKKLN
FT                   PGIIIKIGPTIEYQKKPGKFHTVKFIIGSGPEIPINGDHYKSGTVSVKQGLPASSKNPK
FT                   RPRGVSSKVDYSKYYNRGAARKTTTTTTTTAAAAAVATPTYNHPTPIVNSGYSAPQPAY
FT                   PIPQQQQQQQQYQPQPQQQQHQTPYPIQSTIPSVNHNQPQQPQRKAPPPAPSLQVSAAQ
FT                   AAIGKSPTQQRQTPAHNPIASPNRPTTTTTTTSHTGKPVKKIAPAPPMKKTAPPPPPPP
FT                   PPTLVKPKFPTYKAMFDYDGSVAGSIPLVKDTIYYVTQINGKWGLVKTMDETKEGWSPI
FT                   DYLKECSPNEVQKTVPPPAPPASTFTGGNVISTNTNTSSSTNTTSSHTTNTTSNGSLGN
FT                   GLADALKAKKQEETSLAGSLADALKKRQGVTRDSDDEEAEEDDDDDDW"
FT   CDS_pept        complement(1134501..1135928)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094114" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384928"
FT                   /orf_name="CD36_44730"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX42345.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG396960"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniParc:UPI000192DABB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH1"
FT                   /transl_table=12
FT                   /translation="MYTNIILAATSSSSTLTTPPPTTTTTTTTVPQINHIEPKSDHNLE
FT                   SKTISINDSFSISQTITSSTQPSLIIKASKDWVLPPRPKPGRKQKENIISISNKDLLKP
FT                   KKKYVKKSQKKKELLKQQQQQQQQQEEKEKEEDLSTNINDLPSLMKNISIIDGENIELK
FT                   SHLLSLIHEYKHLKDIVFKQPIDMFSHNVSSITTPETVPETVTIPATVTTTTTTPPPPP
FT                   LAAKSTTTTTSSTTTSTTTTPPPPTEISAISLQHSISSLSSINNNNNNNNDNNNNIQDD
FT                   PFHQYTSSIPSPSSPMSSISTPLPSISTTTTTNSTSNSTTNDSLLAIGTQKSSSLSLSS
FT                   SSLLSSSLSSSIFTNPLTIFNGNNHGNNHGNNNNFHNTIHIPSILSLDSNVHKRSFDEL
FT                   SEFIDYSEGCSGSGSDEEGERDRERERRERKRDRERERKRRDGEGDGEGDGEGDGEFIS
FT                   DLSRTTSSYSDQYLMNV"
FT   CDS_pept        complement(1144156..1145832)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232080"
FT                   /orf_name="CD36_44770"
FT                   /product="Mitochondrial aldehyde dehydrogenase, putative "
FT                   /function="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating) activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="valine metabolic process"
FT                   /protein_id="CAX42346.1"
FT                   /db_xref="GO:0004491"
FT                   /db_xref="GO:0006573"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000192DABC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH2"
FT                   /transl_table=12
FT                   /translation="MLSRVILKNKSTINKNMTNIVVSTKISIRNKSIITLSSTTTDYPK
FT                   GHTTVNDEPYLTPSFVNNEFIKSESNIWFDIHDPATNNIVSKVPQSTPEELEDAIESAH
FT                   KSFPSWKDTSIIKRQGIAFKFVQLLRENMDRIASMIVLEQGKTFIDAKGDVLRGLQVAE
FT                   AACNITNDLKGESLEVATDMETKMIREPLGVIGSICPFNFPAMVPLWSLPLILVTGNTA
FT                   VIKPSERVPGAAMIICELVKKAGIPPGVLNIVHGKHDTVNKLIDDPRIKALTFVGGDKA
FT                   GKYIYERGSKLGKRVQANLGAKNHLVVLPDANKQSFINAVNGAAFGAAGQRCMAISVLV
FT                   TVGKTTKEWIKDVVDDAKLLKTGSGFDPTSDLGPVINPESLIRAEEIIEDSIQNGAILE
FT                   LDGRGYKPKNDQDQKFIKGNFLAPTILTNIKPGMRAYDEEIFAPVLSVVNVDTIDEAIE
FT                   LINNNKYGNGVSLFTNSGGSAQYFTKRIDVGQVGINVPIPVPLPMFSFTGSRGSFLGDL
FT                   NFYGKAGITFLTKPKTITSAWKLNSVDEEILKPSTSMPIQQ"
FT   CDS_pept        complement(1148119..1152723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537670"
FT                   /orf_name="CD36_44790"
FT                   /product="Putative uncharacterized protein "
FT                   /function="4-alpha-glucanotransferase activity "
FT                   /function="amylo-alpha-1,6-glucosidase activity "
FT                   /function="cation binding"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="CAX42347.1"
FT                   /db_xref="GO:0004134"
FT                   /db_xref="GO:0004135"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG447348"
FT                   /db_xref="InterPro:IPR006421"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192DABD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH3"
FT                   /transl_table=12
FT                   /translation="MSEARTVLFRLSNLGEPVNNENISNGVLILPVVELPTNYQPGDVL
FT                   FQLRFQLNAASKVSRNGVLYTNVPPKYEQEFDRNTHYQYPIKSSFHQDIQIIVPIYKPG
FT                   SYNYYIEYDDEEDNKKTTEKYYFNVPPNLTINGKFVPFNNINVETVVSKWIGPYENWDK
FT                   FFKIVAQKGYNMIHFTPLQERGESDSPYSIYDQLKFDPKIFPGSDQDSIQKIHKVLNDN
FT                   QLLSLTDVVWNHTANNSEWLREHPDSGYNATTAPHLIPAIELDETLLEYSHNLQELGLP
FT                   TVLESEADLQKVMDGIQTHVLEKLKLWEYYVFHKRQTIIDLEKSFKANKNNINRIQIPN
FT                   DVDPQNLKQLSDYVLKVANINPTPIIADRFANKLNVDKLLEVLFTVFDGNVEFETIADK
FT                   AEEIIDVINSDLYALFDDDTSSIKQQIADRIKYLRLADNGPKLGEITDKSPLTEPYFTR
FT                   FTDVNGKKQALANNGWIWGGNPLVDFASNKSRAYIRREVIVWGDCVKLRYGEKFEDSPE
FT                   TWKRMIEYTQLSAKTFNGFRIDNCHSTPLHVGERLLDEARKVNPNLYVIAELFSGSAEM
FT                   DKIFVERLGINSLIREAMQAWSVGELSRLVHKHGGRPIGSLTWLPLDDFTYPAINEPIK
FT                   DKYIDGYTELEIPKVLTCQAPHAIFMDCTHDNETPAQKRTVEDTLPNAALVAFCSSAVG
FT                   SVFGYDECYPKLLNVVSETRHYDLDSDNGIGEIKGKLNKIRDNLVQESEDVTRDHEMYI
FT                   HHEGQYITIQRYNARTGNGWFLIARSKFSEHEPTQGLSPSILGGTKVKHEFSYTLKKQP
FT                   GDYEPQSDKLTGIPVKVESIEDPSIEYTEDGDSIITIDENIFIPGSIAVFSTEIPGVDV
FT                   KLDNFVKQGAIEASIGLDLYDLNALLYRASTEELDASHGKDDVYDIPGYGKLTYAGLEG
FT                   WNTALKHVIWQNNLGHPICDHLRNGDWAFDYVINRLDKYVVKSENLLKFQDWLRSRFDA
FT                   VKNSKAPYFLRPHYFALIMGIAYEAARFRVIRQMSEEIKEATNFVQSLALTSVQMVGYM
FT                   QNTSLVPDKQVPCMAAGLPHFSNDYMRCWGRDVFIAFRGLLIVTGRYDDAKQHILGFAK
FT                   TLKHGLIPNLLDAGRNPRYNARDAVWFFLQAIQEYVTYVPNGINILDEKVTRRFPLDDT
FT                   YIPYDDPQAFSYESSIREIIYEILARHAKGIKYREANAGPNLDSQMKDEGFNVEIGVDW
FT                   NNGLIYGGNQFNCGTWMDKMGESEKAHNKGIPGTPRDGSAIEIQGLLKSALRFVNKLHK
FT                   QGKFDYTKVIKPDGTTISLKDWESLLGENFEKYYYIPKDQQQDDQYIIDPSIVNRRGIY
FT                   KDLYNSGKPFEDYQLRPNFAIAMCVAPELFTPEKALEAIIIADKSIRGPIGMKTLDPLD
FT                   WNYRPYYENSIDNDDFATSKGRNYHQGPEWVWNTGYFLRAFLLFHHLHESKTKSFSFTS
FT                   SSSLLSPSIKILTLLNDRLQGHIKWIKESPWNGLTELTNKDGSYCQDSSPTQAWSGSCL
FT                   LDLYYDLWNDKHFQ"
FT   CDS_pept        1154853..1156562
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384929"
FT                   /gene_name="VAC8"
FT                   /orf_name="CD36_44810"
FT                   /product="Vacuolar inheritance protein, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42348.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG327627"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DB63"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH4"
FT                   /transl_table=12
FT                   /translation="MGACCSCLGNRGGDGSHTQLLLAENEREAISALLQYLENRSDVDF
FT                   FSNGPLRALSTLVYSENIDLQRSAALAFAEITEKDVREVNRDVLEPILILLQSADSEVQ
FT                   RAACGALGNLAVNTENKILIVEMGGLEPLIRQMMSTNIEVQCNAVGCITNLATQDDNKS
FT                   KIAKSGALIPLTKLAKSKDIRVQRNATGALLNMTHSGENRQELVNAGAVPVLVSLLSNE
FT                   DADVQYYCTTALSNIAVDEVNRKKLASTEPKLVGQLVHLMDSPSPRVQCQATLALRNLA
FT                   SDSGYQVEIVRAGGLPHLVQLLTCNHQPLVLAAVACIRNISIHPLNEALIIEAGFLKPL
FT                   VGLLDYTDSEEIQCHAVSTLRNLAASSEKNRTALLAAGAVDKCKELVLKVPLTVQSEIS
FT                   ACFAILALADDLKPKLYESHIIDVLIPLTFSENGEVCGNSAAALANLCSRVSNEHKQYI
FT                   LNNWAQPNEGIYGFLIRFLESGSPTFEHIALWTILQLLESNNTEINALIKENETILAGI
FT                   KNLSASQQQIQQSQISQTTTTTTAAAATNEDQFEDPKVELFNLTQQILQILG"
FT   CDS_pept        complement(1156828..1158336)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080740"
FT                   /orf_name="CD36_44820"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAX42349.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG447881"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000192DB64"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH5"
FT                   /transl_table=12
FT                   /translation="MSDIETFIKSIPEFKESRLASLYSNFEKNKILNPEGYEANIYAWQ
FT                   TLLLKLITSSKFPDSDISFVTNTANRTLGGSSSSGGGGGGDEFNLSSFLSISKYGSPQN
FT                   LGPIINELVVHRKVFIPYSLFINGENDSEWVNKGTSIIDYISPKSWIKWGINSIFSKQY
FT                   SVIDPKTGNLKHDRFIAWEQLTKLSNQYLEIIRKEISKQGTYSSKLFNNHTLYQFLKTK
FT                   SINNNNNNNNSGHELKKIDFEILLKYWSIYKSVCTIRQPTTISGNDDTIYIKFDNNLEI
FT                   TDDDIGIINIQQNLINLQNRNDYLQMKLNEIDYKSTLLTLPKSEWKFRLKKLMNRKMVL
FT                   TKSLMNSLNLYDELNNILVKINDSDLNYQMYHQLLISSKILQNMNNKVNLNDIDDLKID
FT                   IDEQIAKENEINHALTNDYKQNDEQEEVEDEELEKELNDLYKEINGETSNDETEYQQLE
FT                   NATKGEENVDNVDDKLLDKLTQLKVSESTIREPTKEKQTEPLAN"
FT   CDS_pept        complement(1158656..1159651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537671"
FT                   /orf_name="CD36_44830"
FT                   /product="Cytosolic Fe-S cluster assembling factor,
FT                   putative"
FT                   /protein_id="CAX42350.1"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI000192DB65"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH6"
FT                   /transl_table=12
FT                   /translation="MSPSQTQIEKSQLAAPEPEHCPGPESELAGKGDACKGCANQEICS
FT                   SSTLKGPDPDLPIITERLSAIDHKILVLSGKGGVGKSTFTSMLAWAIAADEEIEVGAMD
FT                   LDICGPSLPRMLGAEGESVHQSNSGWSPVYVADNLGLMSISFMLPDPDSAIIWRGAKKN
FT                   GLIKQFLKDVNWGEKLDYLVVDTPPGTSDEHLSVTTYMKEVGIDGALIVTTPQEVALLD
FT                   VRKEIDFCRKANIKILGLVENMSGFVCPNCKGESQIFKATTGGGKKLCQELGIPFLGSV
FT                   PLDPRIGKACDMGECFFDSYPDSPAATAILDVVDALRDQVELNFENLAIK"
FT   CDS_pept        complement(1159991..1163995)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21080741"
FT                   /orf_name="CD36_44840"
FT                   /product="Nucleoporin, putative"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAX42351.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG396958"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="UniParc:UPI000192DB66"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH7"
FT                   /transl_table=12
FT                   /translation="MSFNFGSGSGSINTGNANGNSWGSSSGFGRRASIGGPTTTANTFG
FT                   NTSNTSGGGLFGNSNTNTTSGSGLFGNSSNNATNSTGGLFGNSANNTTSNATGSNLFGN
FT                   SNNQANTGTTNLFGSTAKPSGTTNLFGNNNATSTTSNLFGTSTSNTNANGAALGNSSTQ
FT                   GGLFNNNTLGSSSGGLFGNSGTSNGSLFGNSQQNNNLQAPSNQLTVNNNNPYSYSQVIS
FT                   NLQANTSNMPESITTSLFTGIGKESSDKKRRFSYLEKSESHKPKSSLLSKLGQTFKFIR
FT                   NGNTSATFESLKGLFTSNDVLKPKEKRIMLSAAAASSSSTPFVTPKAISRPSYKAIDAR
FT                   RVGSMKRLIIKSKPMKYHMIDVNKVFNTKRRKVIDNKVTADRLLTASYPSDDDSDDEND
FT                   DNEEIVSEKTFARYSYKTGNTFEESETKSTTRIVEKEPPITKSEEKPSVELHDGYWSSP
FT                   TIQQLSEMNVEQLSNLDNFIIGRVGCGQIAYDFPVDLSQIYFNAQKQGISLEKELFGKV
FT                   IEINPKVVLAYQNYPSKPQIGFGLNVPATITLEGIEPRANLSVTEHINFLRQQIGMEFV
FT                   TYDPITYVWVFKVKHFSIWGLIDEDNNSQKDWIVMKRKQDAQELEALREYSQIYENEKY
FT                   KQELKKQKLNEKTKVVPGGWEYTIPPSDEPLNIKRRLVSDEISQQLIKYQQEHNTEELS
FT                   AQVSDITIDSDRESAPTPKLVTYMDQLANFIPPGVDLNEIIDEKVYEPTVSNEVVFDSI
FT                   QIRPNLPTSEDWLLQLELANQLTSALAPYVAEPKKKSDKLNIERVDDILFSDFNKNVLK
FT                   VSTPTKKLSVVEDMDESQDIYIDNISTIFHKLLSKTVVGHRHGNVNDFPIIEKTTGFEF
FT                   KDVITTPQEREEKDVFVLCSALFDKLTINQSNPEISAALMDNTRKKLLGDWLKNYNLSS
FT                   VEKLLAENKNDPLEKTFIYMCSGDMIKAIETAIQTNNSHLSVVITLSDSNDAVVKSIAQ
FT                   NQLKNWKQLQVISSIPSAVVKIYQILAGDFEPILEILPWNLGLALKLFYGDYNDIKKLI
FT                   NKFSSSIPIGDPVGDVLLAYVKGVDLESITSSSLNIKLKWLFCKILADFNYDAITKEFG
FT                   DYLSSIDYWKESALVFAHLTNDNDAADAISKLVNSKISYIKSSTIDKEQYAIEVLKIPR
FT                   PVIYKAVAIEKNNNEDFWGECEALIEVSLWEEAHVTIVNELGPRTVISNSNQDKSQLQN
FT                   VLSKFPENGLIISDWNKGAGIYEKYLVVLQNDNDLSVIQFLLDNLPLSNIDSFHKRIAL
FT                   DIISKFIGNLIIENDKFNATDKSKILNLPLDDVNKKYFELRLADLKKNIE"
FT   CDS_pept        complement(1164247..1165785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19384930"
FT                   /orf_name="CD36_44850"
FT                   /product="Enhancer of mRNA-decapping protein, putative "
FT                   /protein_id="CAX42352.1"
FT                   /db_xref="HOGENOM:HBG396957"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="UniParc:UPI000192DB67"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH8"
FT                   /transl_table=12
FT                   /translation="MTEFLNYKVDLTLKDGTKSTGLISQVDSQQIRLSNAIQSIQPKQT
FT                   IPYLDIKSSEISDLKVIQLPPDFKQQQKKKSKPRNGELIDDAIVFASKPGTPRVHTPKL
FT                   KTSKPHAVSAGSEQADWDNSSDVQDIKSSNDFDFQANLAMFDKKSVFADFQKRDHTNIS
FT                   DRLVGHNKVENVNKLKKEKYDNDEMVLDQNRTDNWDNIGTATTSKTGTPVIHQNGYKDT
FT                   QHQHLKLINANNLSNVALASPVQLLEIERLATDSFGITQAMMAEVCAINLSQLIMESIL
FT                   GGASRLSNKKNHNLPPLVLLLIGSGRGGSRAFATGRHLTNHGVRVLAFMINTIDVDADL
FT                   EQQWKLFELAGGKVMISNIVELLDIVNNQLDTPVEIIIDALQGYDDHLEDIFYQDEDQA
FT                   TLKKLMKWCNEPQQQNKIMSLDIPSGIDGGSGTLSDDSLKLNCRWCISMGLPLSGIILA
FT                   YKNGNMSLIDGDIIHYLVDVGIPNKVYSSKGNLRKFDKFWYSSEASIKLEVSEK"
FT   CDS_pept        complement(1166113..1166586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582875"
FT                   /orf_name="CD36_44860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42353.1"
FT                   /db_xref="HOGENOM:HBG396956"
FT                   /db_xref="UniParc:UPI000192DB68"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGH9"
FT                   /transl_table=12
FT                   /translation="MKFTTAFAILSGLLVAKANAESASTTINPASLASALADAKVSVSA
FT                   SPSGSSADINIKGNGGATLGNIDFSCNDHCHLAIKAVKDNCNGKDFDCIDNLSDDQLWN
FT                   HVKECNCINPFGLLDTNTLKTGIIKAGKANINIQGSGSIDFGNTLSTSTTTSS"
FT   CDS_pept        1167688..1168377
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582876"
FT                   /orf_name="CD36_44870"
FT                   /product="CDP-diacylglycerol-inositol 3-
FT                   phosphatidyltransferase, putative "
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX42354.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG523037"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniParc:UPI000192DB69"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI0"
FT                   /transl_table=12
FT                   /translation="MTSKTPDLSSTKTNLESIKQQKVSVQDIFFYIPNLIGYLRIITAI
FT                   ISFLCMANHPVATLIFYGISGFLDAFDGYAARKFNQGTRFGAVLDMVTDRCATSSLIVY
FT                   LGVLYPQYTVIWQILVSLDLSSHYMHMYAMLSAGSTSHKNVDETQSKLLSLYYNNRLVL
FT                   FFVCLVNELFYMAVYLHYYKFFWLGTVMLVASTPIWLFKQIANIIQLKNASLILARMDA
FT                   HDHSKRD"
FT   CDS_pept        complement(1168525..1170822)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246502" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582877"
FT                   /orf_name="CD36_44880"
FT                   /product="Anaphase Promoting Complex subunit, putative "
FT                   /function="binding"
FT                   /protein_id="CAX42355.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG398524"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192DB6A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI1"
FT                   /transl_table=12
FT                   /translation="MSRDDIKLLLSEDLSPYKLTLLILIHLYLCNKLPIPQLITLTQLI
FT                   ENKQPPTSNLLSTNNINIIHSLERLCEIFNDLNVTKQLLKCIWNIHSLEQLENEYINSL
FT                   IKQVKPADLITLNITPGSTNNKVLSSKSLFGSFILKICTSFNSLKFDESLLLFQAFQEF
FT                   REPTRQKYIIEFGGSDMINDSNPDSDSDPDKELFTKLNNNLIELGMKSHSSTHIIPVPK
FT                   YDFQQLLDRQISLLENYGTPTPQYLKDIMTMMISPNSNVGRIQNIHFNNLPSYYYLRYL
FT                   ECLQTSNYNEAFSALHQYFDYMVSNNSKYFYHFALISRASLHQYFGEDNKAMDAIEEAI
FT                   SVARENKDNSTLTYILSWLFNFMKNKPELWNRQIFHNNSNNSNNNHSEAHLLDFLIKKS
FT                   KQVSFSLYSMSYNFETLHLLHNGDRSCMNSLIKSMFIAINDVKPTFIKSAELAAIVWSK
FT                   IGEPILSEVYNEIAVELTDKTTDKISLVIRSNFLKFLQGNNINESYNELLKLKDNVTSD
FT                   HSLYNAIQMRLLIISVKINLQKGKYNVSKEIINVLLDTDLKDLELKYEVLILQVELEMY
FT                   LQNYSHALELLANIHATNSNEVYLTIRLNLLKCKIFISSGNPYRIFTLLIQQIKISSKC
FT                   GFGMIVIEAKLLLWKLLNDLQSYSDAKNLGQEIMPQIFSLNQSDFIAKAYFELSRSWND
FT                   ESKSIEYIKIAIDKFKKNSDLVMLNMALQYQVHLMNKHDSYPQQEKEKELANHILHEMT
FT                   QELQNEIEKGYI"
FT   CDS_pept        complement(1170981..1173296)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232081"
FT                   /orf_name="CD36_44890"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="CAX42356.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG396955"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DB6B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI2"
FT                   /transl_table=12
FT                   /translation="MVWYGKNFSTLLSFSTHRIALKDDEKKKLSIINLHFLIQNTTIMS
FT                   INIVLEEIKGTPSSIIPILSFLHNDKQILSCITKVELNHLISRTLNLIRSPEPYKKWCG
FT                   INLIRVIIEEYSILASEGNNLMNSLLQVLENYNETIDLKILTSCIDTINYMGNLIRGKP
FT                   TLTREILTPKLNSIIGYYFEYLHFAPLLILNSLQTILKFHPTTFRPFGNKLKAKLITLI
FT                   DHDEFINYPQNLQMAIYDTLAMLPIIEKIEPETKWYNDVINIIGEINELIQVYQEFINF
FT                   KDDQDLFNLIHKISKPSTKILTDLSIDFNKPQTILTISNHLNILVGILKSYITMETSFT
FT                   VKLPIGIILIICELVCSINIKFLSFKGDIRDETIKKLIKTSLIENYRSIIGLLIELINY
FT                   YQGALIPHLNTIWSFLETLIPFQNKRIVNEEIIDEERLFVEILQFMKESLSLLGNVSEN
FT                   TQLLRFVDMALVLVEPRMNSSSSLANNNKQTNHHQPQNRKQKKKKNTSAVALSDILSHE
FT                   HLFMISIPENTIKSVRSFINQIIQKVILPPTQHYKIMRYLIIESIHAKYYNLQHNVPIE
FT                   LKNLLINAVLYPGYDKISILPIVSSILSDDQLLGVFNNPKFPPLPKYINLVNNIEDGQE
FT                   DEEEEEPEEENEVDVIVEDESSAIPMKKRKLDIESKQETENNEIIPVEDQSKIFTATKV
FT                   EQLTLTPATTIENNPVVIEELTSTKEVVVDAPTKVDNIIPTTTNTAPTNDGDEDAEDDE
FT                   SSDFEMPEINLDQDSDDE"
FT   CDS_pept        complement(1173471..1175921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232082"
FT                   /orf_name="CD36_44900"
FT                   /product="Vacuolar ATP synthase subunit, putative "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, proton-transporting domain"
FT                   /protein_id="CAX42357.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033177"
FT                   /db_xref="HOGENOM:HBG629705"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniParc:UPI000192DB6C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI3"
FT                   /transl_table=12
FT                   /translation="MPEKEEAVFRSADMSLVQLYVPTEVARDIIYKVGQLDIIQFRDLN
FT                   SKVNEFQRSFVKELRKLDNVERQFNLFKRELDVRDIPIKLFPYDLDNVPPQTEIDELIE
FT                   GSDLLEERVIQLRDSVETLYDKEKYLKQFKYTIQAVNNFFAVQGETTIENEEETALLSQ
FT                   LESGRGGSGGDARSGSSFISGVINRDKVGVLQQILWRVLRGNLYYHHEDLPEEIYDFKN
FT                   NAYIAKSSFIIFSHGSLIRERIRKICESLDADLYNVDSTSAARREQLDDVNTKTTDLST
FT                   VLAESENALNSELIAISRDLAKWWEIIAREKAVYKAMNSCDYDNSRKTLIAEGWTPTDS
FT                   ITELTTAIQEYDASQSVPTIINVLDTNKTPPTYTRTNKFTYAFQAICDAYGVPKYKEIN
FT                   PGLPTIVTFPFMFAIMFGDLGHGFIVTLAAAALVLNEKKLNAMKKDEIFDMAYTGRYVL
FT                   LLMGVFSMYTGFIYNDVFSRSMSLFKSGWEWPDKFKVGETIYAKYVGTYSIGLDPAWHG
FT                   TENALLFSNSYKMKLSILMGYIHMSYSYFFSLFNYTYFHSMIDIIGNFIPGLLFMQGIF
FT                   GYLSLCIVYKWSVDWFATGRQPPGLLNMLINMFLQPGEVPEPLYSGQSTIQVFLLLIAL
FT                   ICVPWLLLVKPLYMKRQLEKHANYTQLANDEETGEQEHNNNNNDNDNDDEEEDHEEHNF
FT                   GDIMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHAQLSTVLWSMTIGNAFGPTGIVGT
FT                   FMVVFLFAMWFVLSVCILVVMEGTSAMLHSLRLHWVESMSKYFEGGGSAFEPFTFKGLL
FT                   DTIL"
FT   CDS_pept        1177506..1178195
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582878"
FT                   /orf_name="CD36_44910"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="CAX42358.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG398525"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192DB6D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI4"
FT                   /transl_table=12
FT                   /translation="MLSHFKTVFISSSSTEPKLAPKGKKVTGNHKDLIPYVKNDISITK
FT                   SQLKKYSTKKQSVSKILQPMDNYYNTEKQKLQQKYNYNNSNEFYDELFNLYKKQLDECS
FT                   ELLELAQNNYTHSLYQNSLENRKLSNASRSNSVFSRNSLPSTSSSASTSSEEIPDHLLD
FT                   PISFEMFTNPVITPSGITYEKAHILEHLKRRGKFDPITRQELTEDQLYPNLTIKEAVDS
FT                   YRATNSS"
FT   CDS_pept        1178446..1182432
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537672"
FT                   /orf_name="CD36_44920"
FT                   /product="Subunit of Elongator complex,putative "
FT                   /protein_id="CAX42359.1"
FT                   /db_xref="HOGENOM:HBG396953"
FT                   /db_xref="InterPro:IPR006849"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="UniParc:UPI000192DC08"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI5"
FT                   /transl_table=12
FT                   /translation="MRNLIVLNRGLVSPESRTYPDLHIIDSVFDVISDSITFVLSSEES
FT                   QIIEVQQFHKTGNISVLASFPVNSKLINFIHFVDATQLIFVFANGDIVTANYNTSTNEI
FT                   DDTIIEIVGSIDVGISAASWSIDEETLTIVTNENKLLLLSRVFEPICEKLLDSSDIKIT
FT                   DSKHVSVGWGKKETQFKGKGFKALEREREREALKHAGLDDNVTQLRDPTVNEIEKGTLS
FT                   TFDDQSVQISWRGDCEYFSVSTVEPVIVEDTGEMYERRVIRVFNREGELDSVNEAVDGL
FT                   EHTLSWKPQGALIASTQRHIDDEDGEQVLDLVFYERNGLRHGQFNTRLNPETEIIQNLT
FT                   WSSDSEILLFQLQDRVQLWTTKNYHWYLKQELFANDIIFAKFHPEKPLNFMIGTSTGIQ
FT                   IVDLTHKIVTGPTHLGNDSGMTLVTDGSTVKITPLSMANVPPPISFRELDINGNINDLA
FT                   VSKSNEKYAVLSSEGDIYFSELSLADMKQGKHPKVNHQISRDKYITDSNEVAKQIAFIK
FT                   DSFVAVAIDSPLGSRIALFEVDDINNPFMNESVNITTKIVLLKSRADFNTVIIELVDNR
FT                   VVELDSTLDSKEIVKFPQLCRDIEVSFKEDTQQYEAFGISRNGKLFCNENHVVSGVTSL
FT                   KITESHLLFTTVQSKLCFIHLNSSQENYEIFSNLTNENIIDERIRQVERGSILVNVMPT
FT                   KYSAVLEAPRGNLETICPRIMVLSAIRKFIKQKNYKDAFITCRTHRIDLDILHDYDPEL
FT                   FFNNVETFITQISKVEYLDLFVSCLHEEDATVTKYRETINDAGITQEEIKRDGDTLQPA
FT                   FRKKFHHKKEKVFANFNDSKVNRICEAILNVLLKPEYFTKYLQTILTAYACEKPANLTE
FT                   ALTLIGNMDNQEQKETAVTHLCFLQDVNKLYRTCLGLYDVKLTLVIAQQSQMDPKEYLP
FT                   FLQNLHVQPELQRKFLIDDYLKNYELALKWLHEQGETAHEEFDDYVVLHELYKPALKIY
FT                   TYDKTRTNTVMGLFAEHLREKKEYGEAGVIFEYLADLENALQCYVMAKKWKQALSLVEK
FT                   ASDLSEKLIETAEKLVESLTDDHKYSDAAEIEYQFLGNVEASIKLYCKQYWYDHAILLA
FT                   EKSKKPELIESIVDVQINEGFGVIAELLADCKGQMNSQLKRLRELRTKKQEDPFSFYGT
FT                   PDDLDTPDNVSVAASETSTTPSFFTRYTGKTAGTAKTGASRRTAKNKKREERKRAKGRK
FT                   GTIYEEEYLIKSVGRLLERLDQTQPDALKLIEGLLRRHMKEQAYQIQKNWCELIDFIKE
FT                   NIDEIHNMSEKDRERIDDNGEIYLIDEIPKPKVPEFPKFNILDY"
FT   CDS_pept        complement(1182497..1183108)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094117" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537673"
FT                   /orf_name="CD36_44930"
FT                   /product="DNA repair and recombination protein, putative "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX42360.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG396952"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="UniParc:UPI000192DC09"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI6"
FT                   /transl_table=12
FT                   /translation="MPLYEDPKYDIDEETAALPSTVKFFPKMTDLLDGEECQDNADSDN
FT                   NNNTMINEWALKRFGALQMKLEKMQHSRDTYKSFGSRDNLTNFSRSILYNLANEVFGFD
FT                   GWSTTILDCNLTKCENQDQSKFSAICIVKIRLTLKDGTFREQLGQAESTNMPYQYMCYA
FT                   TARKKAVTDAIKNAIIGLRDLYLEYEQEQIMKEFALDCVT"
FT   CDS_pept        1183318..1189737
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18537674"
FT                   /orf_name="CD36_44940"
FT                   /product="ER to Golgi vesicle transport protein, putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle fusion with Golgi apparatus "
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="CAX42361.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0048280"
FT                   /db_xref="HOGENOM:HBG396951"
FT                   /db_xref="InterPro:IPR006953"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DC0A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI7"
FT                   /transl_table=12
FT                   /translation="MEYINNILGSSNQVQSVEEAIPTLCNRLQHATMSSDRRSAVLGLK
FT                   SFSRQYRETVVEHGLRPLISTFKKDIDNPQIVKAILEALLILFIRGENDEDLTRGWISQ
FT                   QSRLQNGKYPSPLLMEDISLDQLSLWIADALIQDEEILRLLIENLSETNDYHAKLYTIQ
FT                   LLESLASSRGSRTKDCLLNIPTSMSVLCSLLQDSNEPVRNEAILLLMAVANDNFNIQKL
FT                   VAFENTFETLFDIIAEEGGIRGSILVQDCLTLITNLLQFNASNQKFFLETQCVPRLASL
FT                   LGEPVDETGDPDMLDENGFPDIPPPIVWTEQRIQNMIIALEICRLLVSEDTEYVAQNQD
FT                   KLFQSGIHYILLKLVFSPLTENSVRSVALLTTGDAICGNPYIQFEFSKVDVPYMDPSLP
FT                   TQIQPYDRPISVPLSLLNWCLYINSVHAFDIRVASAFCLNAYFKDNKDSKFAFLDDQIK
FT                   SYTDPTYYTSLHKDEEQNENAINGNSVPTPFGNIFTTLMDYDADLKLNPYTAWFASLIM
FT                   VNLFLDEPENKEIARNVKTGDEEAGEEVMNSIQAMSGLLVTTLEYKDQRIAMGYLMLLT
FT                   IWLYEDFDAVNDFLSDQSIVKSILAFLSNNSSDQNVLVHGMATILLGVCYEFSSKDSPL
FT                   PRSDLHALLVKGLGKDNYSLKVKQFRSNPVFADFEEASTLTFSQDETGLPTVYFTDVYV
FT                   NLVKDNFLRIKRSLFHDPSSEPRGKISYELFEELDMKVLNLSKELQTEKDNAESNDKEL
FT                   NDKIEKLTDLSSKLETKLEEKEKELTKIHEDHKLLNEKFLATTNSLSAVKASKKEFETA
FT                   SQKYQKELQEALKKGNTSEGILKQLKEKLDSTEQAKKKLEDGINNMTRDLFHLKKSKSE
FT                   AESQIKQREREFKVLSSEYENAKKDYELQISNLNKSNNEFKQKINELSKKIESLNEDNK
FT                   SNTRQLEEKLRDTEENNEHLMDKLRSESVAYNELKKAKSVSEEETTKAKEELEALTTKI
FT                   DNLEKELKEQESKKVELEGQLKNATDSTNEKIKGLEDELETIKKSNKEISMQNSELIQK
FT                   LEKTEKDLDTKDKEIDKLRAETKSNIDSLNSEISNLQAKLKETEDSHANTKNEHSLLSE
FT                   SLEKLRKEYESTKTSLTAKLSAKIDEHKKVTDEIETKTKHISDLQQEHAKQKSQYESEK
FT                   NDIKSNLENATRELSENKEKLSSLEIEKNKLQTKLKTQEEKIDDLETSVAISEDKSKSL
FT                   KRDIEDLKQEKGKLEKTLAENEKTISEKKEQLQVVNNKYKELEASLKKLSETKEKEVSD
FT                   LNSQLDAAKSDHDSERKKLSQLIEETKSESEKNTVQLKEQIEKLEGEKKRKVGEVQSQL
FT                   ESKTADLEKIKTTLDKVLKEKSDNEKENQESVDTLKTEIESLKKEISLLEEQKKDNTTK
FT                   CKELADKLETQTSKLDSATKELKKTELELKQVREELTNTSLELTQIQDRNQSLTEEHEK
FT                   TKTNLAKSSKALEVCEKEKLELEDSLKSVKSNLKNFESKYTQETNSLKDEVEEKQKEIV
FT                   NLQNELKDRISEVEKERAMLSENSETVIKEYSDKIKSLENKINAIKETHSKEITNHNEQ
FT                   KSSLKKDIAKLSQDHESVQTQLEDKENQLKELKASLEKHHTESVTSIEEKNNQIKGLSD
FT                   TIKSLKGELKTSGDALQQSQKDCKALESKNTNAEQKLEKQLGELEKLKSDLQTANEKLA
FT                   EITQRESKLKSELETVKNSGLSTTSELAALTETVKSLEKENEELKSLSGNKTKELENYT
FT                   KNYNDISGKLKSLTDELKEKSKELDDSKQKLTELENDLSTTKKELETERSKTSKFKDLE
FT                   EGKNKEIVKFSKELELLKNDDNDAKKELSEKVAKLESEIKTLSKELEDKKSIVKQYDDL
FT                   KEQIKEKDEELQKVTNEQSAAKLKLDELKKDLSGALAFKDKFETTSSKLTQSTSDLEAA
FT                   NNKVNTLVNEKEKAEQELEKLTKQYTELSKSVDDKNADSNKINSDFEKANKKIGELETQ
FT                   LAELTKELETNKLELKDREKLTSEFTSLSKSHEEFKIKLDNIENEKNDLAKSHEKLNIE
FT                   HVETSKKLQQVEEENEKITTKYESEIKKLQDKLKNYVPKSDLDDLMLLMSDLDEKNKAY
FT                   KIRLKKLGDDEVSSDEESEEESEDEDEDE"
FT   CDS_pept        1190104..1192452
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000025143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232083"
FT                   /orf_name="CD36_44950"
FT                   /product="Para-aminobenzoate (PABA) synthase, putative "
FT                   /function="anthranilate synthase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX42362.1"
FT                   /db_xref="GO:0004049"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG396950"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010117"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniParc:UPI000192DC0B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI8"
FT                   /transl_table=12
FT                   /translation="MILLIDSYDSFTNNLAHLLKESTGQEVITIHNDSFTPNEYETFYS
FT                   QYLPLFQFIVIGPGPGHPAIKSDIGIISWLIKKFQQQDQKEGVDNVVVPILGICLGFQS
FT                   LCYEFGNEVSRLQKVKHGQIYDIYPVSKNELFPDGESFGSVRYHSLFVEENINGEIIPL
FT                   AYCYEPLGNDKGNNGDNKILMAMKHKKFPFYGVQYHPESICSSKGSDLIKNFSNIAKQY
FT                   NETYRRNAFKQNKISNWLDNHAVHEDYLIKDGKFISNDLHNIHFEKLQLDKEILPIDVC
FT                   DYFYHQKNNDNCDFILLNSASIPGEWSIIGLPTMGKSEIITHSVDDENHIYLSQFGSKT
FT                   IEKQKLDDSQTVWNFIANRMQNAYISRETIKSRIGNDYGDRELPFWGGYMGLVSYEEGQ
FT                   HVIINKVSNICRSETTTPDLKMIFISRFIAFDHVTKNWFVVAINDSDNSSWGQEIIIDL
FT                   HKVGKINLANIPDSVNKLAAEGDSDLIDFELPSRDIYKKQFNQCQEYLHSGDSYELCLT
FT                   TQSKIHLPRYIKPWDIYKVLTLHKNPSPFSCFMDFDDCCLISSSPERFLSWKDDDTQGT
FT                   GGGGGNKIVQLRPIKGTVKNTDEVTHEMATKILKTPKEMGENLMIVDLIRHDLYQFTDD
FT                   VEVSQLMAVEEYKTVFQLVSVIQGKLYKQGYHGIDLLHRSLPPGSMTGAPKKRSVELLQ
FT                   DIEAMQKNFVGGRRGIYSGVVGYWSITDDSDWSVIIRSVFHYYNDKENNSTTKLWRIGA
FT                   GGAITVLSDVDDEWEEMMLKLTSALQAFK"
FT   CDS_pept        1192886..1194760
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20232084"
FT                   /orf_name="CD36_44960"
FT                   /product="Xylulokinase, putative"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX42363.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG737866"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000192DC0C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGI9"
FT                   /transl_table=12
FT                   /translation="MTDYSNSKPLFLGFDLSTQQLKIIITNENLTPLNTYNVEFDSQFK
FT                   SKYKDINKGVITGDDGEVISPVAMWLDAINYVFDEMKKDKFPFNKVSGISGSCQQHGSV
FT                   YWSEKANELLNDLNPSQELSTQLQDAFSWGYSPNWQDHSTVKEAEEFHKAIGKEHLAEI
FT                   TGSRAHLRFTGLQIRKFVTRSHSKEYKSTSRISLVSSFVTSILLGEIAQLEESDACGMN
FT                   LYDIQKSQYDEELLALAAGVHPEIDNVSKEDPKYKKSIDQLKQKLGEISPITYKSSGKI
FT                   SKYFVDTYGFNSNCKIYSFTGDNLATILSLPLQHNDCLISLGTSTTVLIITSNYEPSSQ
FT                   YHLFKHPTLPDHYMGMLCYCNGSLAREKARDQVNAKHNISDKKSWDKFNEILDNNKDFN
FT                   GKLGIYFPLGEIIPQAPAQTIRAVLEDNGEITPCELDSHGFTVDDDASAIVDSQTLSCR
FT                   LRAGPMLSKSSSSNTTSSKKNGNEKTNTSKELKQLYDNLVNKFGELSTDGKKQSFESLI
FT                   ARPNRCYYVGGASNNTSIIKKMGSIFGPINGNYKVEIPNACALGGAYKASWSYKCELEN
FT                   KMISYDEYIGKLFDTNDELESFKVDDKWEEYFTGVGMLAKMEETLLKQ"
FT   CDS_pept        1194992..1196467
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582879"
FT                   /orf_name="CD36_44970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX42364.1"
FT                   /db_xref="HOGENOM:HBG396949"
FT                   /db_xref="UniParc:UPI000192DC0D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGJ0"
FT                   /transl_table=12
FT                   /translation="MLRSQRTLLKRSSFYSNRRFSTLLTTKPIEKLTIEDLSQPSINQH
FT                   DVIGRLKLIESIQNTPTLSTNNRNQLLEFLIPNFSFYFKLPQHIIKQEVLHRLIQLNPG
FT                   RVHSTLDLYNNHRNEIQDYMINDILNKLIHGEKKNITTEEEKGTDNIDLNNIIQIVNDY
FT                   QHLQFDQLLIELFYKLIDNNDNELIVELINSGILNGEIILKEMISQGNIKTSSISTKFA
FT                   FITIFNQLFINNPKSIDYQIYTIVLNLLNFGDSHKQLLDVISKYTTTRTISTSNEILQF
FT                   VIDSKLDEIPEAINLRQTLLEIYGIKQQDNDKALKKYFYYETHVKTNIEHIRFIMVKIF
FT                   SYLAIKQNNEIWNQVAQSMINPELTIKTLQLLIIGKSFFNIDSGLSIYNDYIQNVSSQI
FT                   NPETKKSSKGLLTESIILGFLINNDREFASLIFEKAIENQIIVDELEISQIKKLFKTYS
FT                   DCFIDNEVWEDNAQLKMINVALEYIENIDSIKY"
FT   CDS_pept        1197085..1198206
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000143704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17582880"
FT                   /orf_name="CD36_44980"
FT                   /product="Saccharopine dehydrogenase, [NAD+, L-lysine-
FT                   forming], putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX42365.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG331053"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="UniParc:UPI000192DC0E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGJ1"
FT                   /transl_table=12
FT                   /translation="MSKSPVILHLRAETKPLEARAALTPSTTKQLLDAGFEIYVEESSQ
FT                   STFDIKEYEAVGAKIVPEGSWKTAPKERIIFGLKELPENETFPLIHEHIQFAHCYKDQA
FT                   GWQDVLKRFPQGNGTLYDLEFLENDQGRRVAAFGFYAGFAGAAIGVLDWSFKQLGNIEG
FT                   ELPGVTPYPNEDELIKDVKIELEKALTKNGGKYPKCLVIGALGRCGSGAIDLFKKIGIP
FT                   EDNIAKWDMAETAKGGPFQEIVDSDIFINCIYLSKPIPPFINKEILNNDNRKLTTIVDV
FT                   SADTTNPHNPIPVYEIATVFNKPTVDVKLDKGPKLSVCSIDHLPSLLPREASEFFAKDL
FT                   MPSLLELPNRDTSPVWVRAKQLFDKHVARLDKE"
FT