(data stored in ACNUC8465 zone)

HOGENOMDNA: CANDC_5

ID   CANDC_5; SV 1; linear; genomic DNA; GRV; FUN; 1245899 BP.
XX
AC   FM992692_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
DE   chromosome 5, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; mitosporic Saccharomycetales; Candida.
XX
RN   [1]
RX   PUBMED; 19745113.
RA   Jackson A.P., Gamble J.A., Yeomans T., Moran G.P., Saunders D., Harris
RA   D., Aslett M., Barrell J.F., Butler G., Citiulo F., Coleman D.C., de
RA   Groot P.W.J., Goodwin T.J., Quail M.A., McQuillan J., Munro C.A., Pain
RA   A., Poulter R.T., Rajandream M.A., Renauld H., Spiering M.J., Tivey A.,
RA   Gow N.A.R., Barrell B., Sullivan D.J., Berriman M.
RT   "Comparative genomics of the fungal pathogens Candida dubliniensis and
RT   Candida albicans.";
RL   Genome Res. 19:2231-2244(2009).
XX
CC   This Genome Reviews entry was created from entry FM992692.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1245899
FT                   /organism="Candida dubliniensis"
FT                   /strain="CD36 = CBS 7987 = NCPF 3949 = NRRL Y-17841"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 5"
FT                   /db_xref="taxon:573826"
FT   CDS_pept        join(complement(5200..5271),complement(4664..5200),
FT                   complement(3640..4656))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(6168..6452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568340"
FT                   /orf_name="CD36_50020"
FT                   /product="Retrotransposon Tca4 polyprotein, putative "
FT                   /protein_id="CAX41384.1"
FT                   /db_xref="UniParc:UPI000192DC19"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGU6"
FT                   /transl_table=12
FT                   /translation="MSHMSESNSITYDDTFLSPLDNPNIHTIIHERREDIEHVINENRP
FT                   NTIFETHVEPPRTISSSGIIDHTNFRHRADPTWQVIPDAVNHLPLPAHF"
FT   mobile_element  complement(6191..7985)
FT                   /mobile_element_type="retrotransposon:san A, partial Tcd4,
FT                   LTR"
FT                   /note="(subtelomeric)"
FT   CDS_pept        complement(6480..7421)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381236"
FT                   /orf_name="CD36_50040"
FT                   /product="Retrotransposon Tca4 gag-like protein, putative "
FT                   /protein_id="CAX41385.1"
FT                   /db_xref="HOGENOM:HBG398347"
FT                   /db_xref="UniParc:UPI000192DC1A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGU7"
FT                   /transl_table=12
FT                   /translation="MAGFSDDDLRQMMGTLSILVADSKREIGQLHEKLEHNGETKYQSL
FT                   ETYINSKYATTIKSFENLKYLDIDDPDLVNSWIICFNQVKRSHPQVFDAFMNAKSEDEI
FT                   GIEKLQYTPYAGKQLNDMMRVFYMRISELLERKVDPNVSREVDNGETQFVPNLFKKVYE
FT                   MIIAKPDVSAAERIGQALFKLQTKSSELEVDSTYLLCQHLSTQEHQHDDLIYKFLIGGV
FT                   SPWYLHSQIYVSSYKLGTSDLFLEVYARHYELYKTDPNYKLPDIMTLLNEIRSNRDYSK
FT                   VVNAAKKGSTSQECFREEQQKVTPSLLDQLVD"
FT   CDS_pept        join(complement(13186..13701),complement(12906..13184),
FT                   complement(12110..12877))
FT                   /pseudo
FT                   /gene_family="HOG000094271" [ FAMILY / ALN / TREE ]
FT   CDS_pept        15330..17006
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568341"
FT                   /orf_name="CD36_74020"
FT                   /product="Non-LTR retrotransposon Zorro-like polyprotein,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41387.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398534"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000192DCD0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGU9"
FT                   /transl_table=12
FT                   /translation="MNNNPSHNFHSQSQPGRLDTSSNSQMGYPVVPSSPNFVSSNLNSQ
FT                   NKSSQQTISPVHDPASTPSQQSTQPEPNHAKVVDYAAFPKLIHAENAKHPKYRELKRLE
FT                   SVQCPIDLYDLANRNNNINVPQTQLTADISHMYECATSEQVLNTIYFTLNQARDIYQDK
FT                   LTDLPDSFMDEIANYEKDPQLYLQDHESIPKWSDDYTLDNFYESRAMSEMLHACTYFEV
FT                   DNDHRLYLEAFDLTYIKKAEFEHLKQLLIGEIERLNFVIGDNSFQIQVDDKVEHMYVAS
FT                   FRLPSISLRSCEQYFREFLDPKDEIVHARIPVFSHEVMSTNPANVNAFFILDKVPPKRK
FT                   VILQRNYSVRILTNLSHCVYCHSKSHTRLQCPEAGECNICGKLGHRAMNCESRKRRSPE
FT                   AVPMNGPVKILTKPSVETSQKVSGNGQSKEHNDSAPSDFVDTIFDSDGKEIFHIDPNKS
FT                   WTFHISQLRLKKTVPSNYLVAPSEPVAWKRYKDGSILVDVVAIVAHRKVGRGFRLAARH
FT                   APTTTHPDGEIVEYIASALSRTAPDLVKTYVSAHGLPVTLK"
FT   mobile_element  15342..16707
FT                   /mobile_element_type="LINE:5A, Zorro4"
FT                   /note="partial ORF1 (subtelomeric)"
FT   mobile_element  16708..17137
FT                   /mobile_element_type="retrotransposon:partial Tcd16, LTR"
FT                   /note="(subtelomeric)"
FT   mobile_element  complement(17139..17517)
FT                   /mobile_element_type="LINE:5B, Zorro1-like"
FT                   /note="partial ORF1 (subtelomeric)"
FT   CDS_pept        18869..19669
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228425"
FT                   /orf_name="CD36_50070"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41388.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG626811"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000192DCD1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV0"
FT                   /transl_table=12
FT                   /translation="MFKYVPTRSIPAYTSSIRTAVTLRSNLQKEKDQAKKRKLRQELKF
FT                   NALDNPIDHPLHMPIAKALNILRSLEVGKPADKTTISCNIYVRQEQGAAPIQTKVDIPF
FT                   PVQRKTKAVVFTTQQPVIEELKKAGIETFGGRDLLDKFLNQELTPDLFTHAFATQEMEP
FT                   HLKAVARILGPAGLQPTAKKGTVTDDINTILDVIRSFQIKQKDNHISFPVGNCTFSDAQ
FT                   IMSNIKAISDKIYSKIDPNATKKTRLGYCYIGTANSPGLVIDFK"
FT   CDS_pept        complement(19685..21337)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568342"
FT                   /orf_name="CD36_50080"
FT                   /product="Subunit of the GPI
FT                   (Glycosylphosphatidylinositol):protein transamidase
FT                   complex, putative"
FT                   /cellular_component="GPI-anchor transamidase complex "
FT                   /protein_id="CAX41389.1"
FT                   /db_xref="GO:0042765"
FT                   /db_xref="HOGENOM:HBG398560"
FT                   /db_xref="InterPro:IPR007246"
FT                   /db_xref="UniParc:UPI000192DCD2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV1"
FT                   /transl_table=12
FT                   /translation="MALAEVVIRKVKKLGLVPKAIGMLPRLSFLVAVLSCLWLITLPQE
FT                   GNYRNVYISENALMPAQANSYFRESEWNIVRGYREEISKMEKQSVGERNKVVASWLRDS
FT                   GLQVSYHENGFANNTMYAIMHAPRGENTEAMALVVPWINSDGEYNEGAMSLAVALARYF
FT                   TKMSIWSKNIVFVFPETGHKPLRSWVEAYHTSLDDTAGSIEAAIIMEYGKNGDFFEYYD
FT                   MFYEGLNGQLPNLDLLNTANVMTYHEQIPCAMQGISDRVINYGTRLRTLFRGILKLTLT
FT                   GLTDEVHGCEAFSGWQIQAFTIKARGTEGKDVTQFGRIVDSTFRSVNNLLEKFHQSFFF
FT                   YLMLSPKHFVSIGTYLPSAVMLAVSYALSAISALVVGFDFQKVPLVLVVVTGVEIACVV
FT                   LAFVPVHQAILSGLGVAAFFPTQRVFSQQVAFSLIGIALLGVALLITALLIVHFALAFS
FT                   IGVLAIPLTFVPTLMRNRSRLTPVCLAVSNPFFVITVAGHVLGHPELFGRLVSSWDDLQ
FT                   CWTWFIVVLGWFPAWVIITLSYCGYKPVKEKSE"
FT   CDS_pept        21424..22092
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568343"
FT                   /orf_name="CD36_50090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41390.1"
FT                   /db_xref="UniParc:UPI000192DCD3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV2"
FT                   /transl_table=12
FT                   /translation="MNKHLQRQLKGLPQQIITDGLHALQHNPARFTSFHDIPQLLDYIY
FT                   KPNKPAWWIRFMKCPYYNLKGKWPTIHLIDELGVDTSGYYNHQNLLSGSTPRPTLPLIK
FT                   SYANQKDTTTTMIKEVEKLYKFILSKRGLFGVTNHPMEVIYTPSKLGKIHTPAVLDKEL
FT                   KNKVKLIKRVFNDVQPIEKPTLDKLQSIVVSQPHDSILQQYMARQFYLQNGKYILNSNY
FT                   "
FT   CDS_pept        complement(22075..23652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534080"
FT                   /orf_name="CD36_50100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41391.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000192DCD4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV3"
FT                   /transl_table=12
FT                   /translation="MKHFMATTLYNGKLPSLVLADPSGLFTWCPHLNLIFIGMNRTSVW
FT                   CYRMNGERIYSINNKSAVRHIAFHGEYFCLSGSDNLIKIYNANNGQLVKVLPQEFDGVE
FT                   FVQWNGSEEKLNYLVVSDGKRLVVTFNQVLGVDMECELSISQQLSTDFFDQVYLSGDKL
FT                   VRVGFKIENRKLYTQQIVQVCQLVSLLEYSGEHIEKLKSLVAPYLQAMDRYMSNLESEC
FT                   GDLARYLSDLVVSNIIPECTKDYWLNQYGERGYKKMVKLAGVYEAAIKVTYQHLVTTME
FT                   RVISVVGELIGISKWEQGLLATKELEDLLVEAKSQLKFYYRFIWDMQSERQQTQQFLVW
FT                   TKSIIDMLNDQECEVCYSTAEVLCFINDALTKSVMMKYFDIELEVIHHPEKTPMRNVCM
FT                   DLTTIDEYHRSRLEVEVLRGVSLPEVYTNLKIVQWAEPILTYLQGTDLAIANMDAVIST
FT                   IPDVYAYQHRERDLVALTKKSLLIIDSSSCIPIPLPETSFQPTNIILNKEYGVLLDSTR
FT                   QHYSIVRI"
FT   CDS_pept        23827..25035
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381237"
FT                   /gene_name="CDC11"
FT                   /orf_name="CD36_50110"
FT                   /product="Septin, putative"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAX41392.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI000192DCD5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV4"
FT                   /transl_table=12
FT                   /translation="MNYSTENVSSAALRKRKTLKKSINFSIMIIGESGSGRSTLINTLC
FT                   GGNSIVPTSSTATQDPFTKKLTLRHENVELEDNEGHKISLNIIDTPNFANSINCDDDFK
FT                   IIVDFIRHQFDEVLLEESRVKRNPRFKDGRIHVLIYMINPTGHGLSDIDVKFLQHVNNL
FT                   VNIIPIISKADSLTPKELKLNKELILEDLNNYGINFYKFNEYDYEQDYIDEEIIEYNKY
FT                   LNSLIPFAIIGANEYRSNPNGSEDEDDVLKLRILNKEFKPIDIDNAEINDFTILKNVLL
FT                   VTHLNEFKDITHDSIYENYRTEALSGKQFQYVNKDSAKQEISESDYLMKEEQIKLEEER
FT                   LRKFEERVHQDLINKRKELLERENELKEIEKRLLAEGLKFDENGDVVKVHEEESSETEV
FT                   KVI"
FT   CDS_pept        complement(25032..25967)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534081"
FT                   /orf_name="CD36_50120"
FT                   /product="Coatomer subunit epsilon, putative "
FT                   /function="binding"
FT                   /protein_id="CAX41393.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397376"
FT                   /db_xref="InterPro:IPR006822"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192DCD6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV5"
FT                   /transl_table=12
FT                   /translation="MDAFSDSGELYTIRNQFYTNQHNKVKAYSLDEFSPENQLKVLEFQ
FT                   IRSTIALEQDASKMIEDGKTKFPENEPLFQLLSAWNDLKDFGVDDSTYFEDVKQASFEL
FT                   QAVLTALYLVKFDKDIDQAILFLNNYIDNVNSLAKYNELEPFLVLVQLYLVKGNLSGAA
FT                   KVLESLNHFPESARDNIIYQVLESWILSVTGGSDNINNSYYFYDEILSSDFDQDIQGKF
FT                   KILNVLFALTLQLKHFPEAQELVAQIKSLGVVDANFIANQITFDQLQNDGAHAEELMTE
FT                   LKRLDASHELLKEQDLKTSIFDDIVTKYSI"
FT   CDS_pept        complement(26054..26671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568344"
FT                   /orf_name="CD36_50130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41394.1"
FT                   /db_xref="HOGENOM:HBG397430"
FT                   /db_xref="InterPro:IPR012470"
FT                   /db_xref="UniParc:UPI000192DCD7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV6"
FT                   /transl_table=12
FT                   /translation="MSDNILRDRLGPEKFAKALEFYDADQELTQEDRVQIRDDLKEVLV
FT                   GDNLASYGSGLIGFLMPTLYMRFFRKGSVNGKSFFQKPVLSGAIGLANMMVTHRVYSQK
FT                   LFNEKMNSGLPQRQLNVWKAMEQRSLGVYMFYYAKTAQDPKFKLEDPREYTEENRLKVR
FT                   FDPEKYREGHPQELSTWDRIRLSNGYDITEEKKTAWDDIRSK"
FT   CDS_pept        complement(26751..27353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094141" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077028"
FT                   /orf_name="CD36_50140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41395.1"
FT                   /db_xref="HOGENOM:HBG397487"
FT                   /db_xref="InterPro:IPR012470"
FT                   /db_xref="UniParc:UPI000192DCD8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV7"
FT                   /transl_table=12
FT                   /translation="MSGNPLQDILTPSQFQQCVRFYEADQKLDHGERVALATQLQTLAM
FT                   KTSLAGYTSGMLGFFAPTMYYRAVGRFPTPLFLVQRPFFSLVLGFGTLLVGNNVTAKYL
FT                   YEKNRKQSFADKNIGDVWQTMDFPYLNFFTLYYSRTSVFPNFIMRDPRTCSYQPLKKEN
FT                   PHFTEATKLGHLDNTGKEHVLSVWDKVRLNHGGGVSK"
FT   CDS_pept        complement(27493..29613)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077029"
FT                   /orf_name="CD36_50150"
FT                   /product="Threonyl-tRNA synthetase, cytoplasmic, putative "
FT                   /EC_number="6.1.1.3"
FT                   /function="ATP binding"
FT                   /function="threonine-tRNA ligase activity"
FT                   /biological_process="threonyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41396.1"
FT                   /db_xref="GO:0004829"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006435"
FT                   /db_xref="HOGENOM:HBG352811"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniParc:UPI000192DCD9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV8"
FT                   /transl_table=12
FT                   /translation="MSDVADKVKDLSFKDKKKKPANSLYLDPQPAFIEERIKLFEELKA
FT                   QYDEEISNKEKTPIKITLRDGTVKEGTAFETSPMDIANSIGKSFAERQVIAKVDGKLWD
FT                   MPRPLEGDVKLEFLDFEHPEGKAVFWHSSAHILGEACECHYGCHLSHGPPTEDGFFYDM
FT                   SINNGETFVTQGDFGNLEQVATKAIKEKQKFERLEMTKEQLLKMFHYNKYKVKFISDKI
FT                   PDGTSTTVYRCGPLIDLCVGPHIPHSGRIKAFKVLKNSSSYFLGDASNDSLQRVYGISF
FT                   PDKKLMTEHLKFLAEAAERDHRKIGREQELFIFNEMSPGSAMWLPHGARIYNTLVDTLR
FT                   TEYRKRGYEEVITPNMYSTKLWETSGHWQNYKENMFSFEVEKETFGLKPMNCPGHCILF
FT                   KSRERSYRELPWRVADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTTDQIGTEIAGV
FT                   FDFLKKMYGIFGFEFKMELSTRPEKYVGDLETWNSAEKKLEQALNDFLGEGKWELNPGD
FT                   GAFYGPKIDIMISDALKRWFQCATIQLDFQLPQRFELEYKSDKGPNTRPVMIHRAILGS
FT                   VERMTAILTEHYKGKWPFWLSPRQVLIVPVGPKYYDYAQKLQKKLNDDYFFYCDVDVSG
FT                   NTLPKKIRTGQLYKYNFIFIVGEDEENSESVNVRNRDIPEEQGKNAMVKFDDVVKQMVA
FT                   LRESKRSDNKLQ"
FT   CDS_pept        complement(30040..30438)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381238"
FT                   /orf_name="CD36_50160"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAX41397.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI000192DCDA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGV9"
FT                   /transl_table=12
FT                   /translation="MIYLKSLLNVIDNSGAQVVECIKVLRHKPKSCAQIGDRITCVVKQ
FT                   ARPLQQELTGQTSTNRVKRRDICQAVVVRTRAPLKRKDGSVVRFDDNACVLINKNGEPL
FT                   GTRISSVVAKELKDLNYNKIVALAPKTF"
FT   CDS_pept        complement(30589..31281)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248478" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568345"
FT                   /orf_name="CD36_50170"
FT                   /product="Uncharacterized integral membrane protein,
FT                   putative"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41398.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398538"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniParc:UPI000192DCDB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW0"
FT                   /transl_table=12
FT                   /translation="MSRRVVGNQVILGINAVSIAIGVYGASRIFSLELSDDLKGAGHYQ
FT                   FLTNLSLIYSLGVFGLGFFAHLTRSESLYDLKNLLHPIGLALETIVAMVYWPLRLFCLH
FT                   LLTPDPENFKIPLKLDLSVHLMPVVSLLIDYLVFMPRWTIKSNTVLLLITALSTGYWCL
FT                   LKYLVDTENGGRYPYAFMDMEDDGLRALVFVAVGLVAFLQFHFMRSIYDFVVKKTENVD
FT                   VEIDRKLD"
FT   CDS_pept        complement(31433..33064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568346"
FT                   /orf_name="CD36_50180"
FT                   /product="Importin subunit alpha, putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein import into nucleus "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAX41399.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006606"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG590318"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DCDC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW1"
FT                   /transl_table=12
FT                   /translation="MDSDATNRFVPEYRRTNFKNKGRFQSDELRRRRETHQVDLRKQKR
FT                   EEVLAKRRNYANQGNESEDEEEYNPTANSDENQFYNKLKQDLPKMLEMIQAPDFDSQLA
FT                   ATVKFRQILSREHNPPIDLVIQSGVIPTLVEFMKEDHPDMLQLEAAWALTNIASGDSAQ
FT                   TRVVVEANAVPLFVQLLYSQSLEVKEQAIWALGNVAGDSSDNRDYVLSCNAMEPVLQLF
FT                   NCTKMSLIRTATWTLSNLCRGKSPQPDWNIVSQAIPTLGKLIYSVDAETLVDACWAVSY
FT                   LSDGTSEAIQAVIDARIPHRLVELLGHDSTLVQTPALRAIGNIVTGSDYQTQIVINAGV
FT                   LPALAPLLNSTKDTIRKEACWTISNITAGTTDQIQAVIDANLIPQVIRLLIHGDYKTKK
FT                   EACWAISNASSGGLTKPDQIRYLVSQGCIKPLCDLLSVADSKIIEVTLDSLENILKMGE
FT                   MDKEARGASVNEYALFIEEAGGMEKIFECQNNPNEKIYQKAFSIIEKYFSDDDGQIDDE
FT                   NIVPESYGNSFGFGMDANQQQQNFQF"
FT   CDS_pept        33217..33939
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228426"
FT                   /orf_name="CD36_50190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41400.1"
FT                   /db_xref="HOGENOM:HBG397255"
FT                   /db_xref="UniParc:UPI000192DCDD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW2"
FT                   /transl_table=12
FT                   /translation="MLSRTIYHRSFSILSRSKAKRSFTPSDSSVESDEILSENNPWSPT
FT                   LEDDPVYVQERNKFRKTKLPQQYRLAYSPLYEAPASKYVSMLKRLTLSVGVLGIYGAKL
FT                   FYESSQFDDLYAYATLAATFTPLALVQYKTKDYVTRIFRLYDKTKPQTLENLVSDEKLI
FT                   LEKLNFTGGSTYNELLTITDNKDLKLSPPAKPYLPYSTWRDNTRDFYVMDNIGGIRMDR
FT                   IWGLIEKNSQVNNGRSNW"
FT   CDS_pept        33980..35152
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568347"
FT                   /orf_name="CD36_50200"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX41401.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG397261"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192DCDE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW3"
FT                   /transl_table=12
FT                   /translation="MPHWFFWASIFLRRFFRFPIFFLSSFQPLMEAVKQLKKTPAAPSR
FT                   LLATGDLDDETLRNTQLNAELYHTSNDSVELYRQENNSSDLLGRLYYDDYDSDSMTSPS
FT                   ITPMPLSPIISPSESSDQLSNKSRPPFLRMKSMERGISFDTSPHGHQKSYTVKAKHPLF
FT                   KFRRTNKTFLVGYNDDVESTKAIEWLFDEMIINGDTIVVLQVLDEKQHVAIDKSKVQKN
FT                   LAKIEQINHHFKKVCIIYEAAIGKAKRAIKSAIDEYRPSMMAIGTHHYDGKEHHRSFTK
FT                   SSLSKHILECSLVPIILVKPTYRYVEFLREEVDGPQYFENWIKNIDHIDNRVIRKKVPL
FT                   ISPSISRNSSYTSLVNEDRGRGGGLSDQVLNESRSRSTSKNRVFARFFKK"
FT   CDS_pept        35291..38608
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568348"
FT                   /orf_name="CD36_50210"
FT                   /product="Inositol hexakisphosphate (IP6) and inositol
FT                   heptakisphosphate (IP7) kinase, putative "
FT                   /function="ATP binding"
FT                   /function="acid phosphatase activity"
FT                   /function="kinase activity"
FT                   /protein_id="CAX41402.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG398541"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniParc:UPI000192DD8D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW4"
FT                   /transl_table=12
FT                   /translation="MTSNSESLPIPVPKKEDSKPTSLNIPKSISQPLSPLSAPIDQSNG
FT                   TPKPIPTPITEKAMASIAPMLEGFSPKTHAEDSVSRLNSISSSAGQVSDDDLVQPITAE
FT                   NLSNIKSYSNSFVDGSRISRTVSNTSNASRKSYADTFKLPKIGTIGVCAMDAKALSKPC
FT                   RRILNRLIETGEFETVIFGDKVILDEAIENWPTCDFLISFFSTGFPLDKAIDYVNYRKP
FT                   YMINDLVFQKALWDRRVVLAILNHANVPSPERLEISRDGGPHLDSQLLDRLKEIGMSEE
FT                   KLEKLTNQSEPDWEMVDEDTLRVGDKTLSKPFVEKPVDGEDHNVYIYYPRATGGGGRRL
FT                   FRKIGNKSSEFDANLSSPRTDGSFIYEKFMDTDNFEDVKAYTVGPNFCHAETRKSPVVD
FT                   GIVRRNTHGKEIRYVTELTDEEKTMAKNVSSAFKQTICGFDLLRVNGKSFVIDVNGFSF
FT                   VKDNNDYYDSCASILRGLFIDAKKSRDLLTRKIPKMLQTSQFEQKAQKWVFKGMVTVIR
FT                   HADRTPKQKFKYSFRSPVFISLLKGHREEVIIRAVPDLQVVLETVKIAESKGLEDLNKL
FT                   KQLRIALEKKMDFPGTKIQLKPTLNGDNPEIVDKVQLILKWGGEPTHSAKHQATDVGEQ
FT                   MRQNLQLLNREALDDVKVYTSSERRVIASAQYFSASLLSFDEPLVDDFLIVRKDLLDDS
FT                   NAAKDLMDKVKKKLKPLLREGAEAPPQFTWPPKMPQPFEVIKRVCELMNFYHQIMNYNF
FT                   ETKNVQEFQINWCCGEDPFLFKERWDKLFQEFISVEKTHPSKISELYDTMKYDALHNRQ
FT                   FLQKVFSYDPNDKVLLSRLTETCGSTVNSSGLVSEYPINILAMNNFKLPESASTSTNNS
FT                   SANLNSSSAAGSLGWVLSGAATTMKCESKDKTASPQTPFDHPTFARLRELYRLSKVLFD
FT                   FICPQEYGIKDEEKLDIGLLTSLPLAKQILSDIYDMKKNDQPALVNYFTKESHIYTLLN
FT                   IIYGSQLPMKIARNALPELDYLSQIVFELYEAEDPSSPTGKKHSIRLSLSPGCHTQDPL
FT                   DVQLDDDHYIGCIPRINLTRHLDMDLVTQRLKSRFSRVSLPKKFTPVNITGPLNSNK"
FT   CDS_pept        complement(38663..44776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381239"
FT                   /gene_name="FAS1"
FT                   /orf_name="CD36_50220"
FT                   /product="Putative uncharacterized protein "
FT                   /function="fatty acid synthase activity"
FT                   /function="hydrolase activity"
FT                   /function="lyase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /protein_id="CAX41403.1"
FT                   /db_xref="GO:0004312"
FT                   /db_xref="GO:0005835"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG736477"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016452"
FT                   /db_xref="UniParc:UPI000192DD8E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW5"
FT                   /transl_table=12
FT                   /translation="MSTHRPFQLNHGSIEHTLLVPNDLFFNYSQLKDEFIKTLPEPTEG
FT                   FAGDDEPSSPAELYGKFIGFISNAQFPQIVELSLKDFESRFLDNNNDNIHSFAVKLLDD
FT                   ETYPTTIAKVKENIVKNYYKAVKSINKVESNLLYHCKHDAKLAAIFGGQGNTDDYFEEL
FT                   RELYTLYQGLIEDLLVCIAEKLNQLHPSFDKIYTQGLNILSWLKHPETTPDQDYLLSVP
FT                   VSCPVICVIQLCHYTITCKVLGLTPGEFRNSLRWSTGHSQGLVTAVTIAASDSWDSFLK
FT                   NSLTAVSLLLFIGSRCLSTYPRTSLPPTMLQDSLDNGEGRPSPMLSVRDLSIKQVEKFI
FT                   EQTNSHLPKEKHIAISLINGARNLVLSGPPESLYGFNLNLRNQKAPMGLDQSRVPFSER
FT                   KLKCSNRFLPIFAPFHSHLLADATELILDDVKEHGLVFEGLKIPVYDTFDGSDFQGIKE
FT                   PIIDRVVKLITELPVHWEEATNHKATHILDFGPGGVSGLGVLTHRNKEGTGARIILAGT
FT                   LDSNPIDDEYGFKHEIFQTSADKAIKWAPDWLKELRPTLVKNSEGKIYVKTKFSQLLGR
FT                   APLMVAGMTPTTVNTDIVSAALNAGYHIELAGGGYFSPVMMTKAIDEIVSRIKPGYGLG
FT                   INLIYVNPFMLQWGIPLIKDLREKGYPIQSLTIGAGVPSIEVATEYIEDLGLTHLGLKP
FT                   GSVDAISQVIAIAKAHPTFPIVMQWTGGRGGGHHSFEDFHQPIIQMYSKIRRCSNIILV
FT                   AGSGFGSDEDTYPYLSGYWSEKFNYPPMPFDGVLFGSRVMTSKESHTSLAAKKLIVECK
FT                   GVPDQQWEQTYKKPTGGIITVRSEMGEPIHKIATRGVMFWKELDDTIFNLPKNKLLEAL
FT                   NKKRDHIIKKLNNDFQKPWFGINANGVCDLQEMTYKEVANRLVELMYVKKSHRWIDVSL
FT                   RNLYGDFLRRVEERFTSSTGTVSLLQNFNQLNEPEQFTVDFFAKFPQAGKQLISEEDCD
FT                   HFLMLAARPAQKPVPFVPVLDERFEFFFKKDSLWQSEDLESVVDEDVQRTCILHGPVAS
FT                   QFTTKVDEPIGDILNSIHEGHIARLIKEEYSGDESKIPVVEYFGGKKAASASSGCVNVA
FT                   KGKEVVYEIDSQLPGKQEWLDLLAGTELNWLQAFISTDRIVQGSKHVSNPLHNILTPVK
FT                   HSKVTIDKETKKLTAFENIKGDLLPVVEIELIKPNTIQLSLIEHRTADSNPVALPFLYK
FT                   YNPADGFAPILEIMEDRNERIKEFYWKLWFGSSVPYSNDINVEKAILGDEITISSKTIS
FT                   EFTHAIGNKCDAFVDRPGKATLAPMDFAIVIGWKAIIKAIFPKSVDGDLLKLVHLSNGY
FT                   KMIPGAAPLKKGDVVSTKAEIKAVLNQPSGKLVEVVGTIYRENKPVMEVTSQFLYRGEY
FT                   NDYCNTFQKVTETPVQVAFKSPKDLAVLRSKEWFHLEKDIEFDVLTFRCESTYKFKSAN
FT                   VYSSIKTTGQVLLELPTKEVIQVGSVDYEAGTSYGNPVTDYLSRNGKTIEESVIFENAI
FT                   PLSSGEELTSKAPGTNEPYAIVSGDYNPIHVSRVFAAYAKLPGTITHGMYSSASIRALV
FT                   EEWAANNVASRVRAFKCDFVGMVLPNDTLQTTMEHVGMINGRKIIKVETRNVETELPVL
FT                   IGEAEIEQPTTTYVFTGQGSQEQGMGMELYNSSEVAREVWDKADRHFVNNYGFSILDIV
FT                   QNNPNELTIHFGGAKGRAIRDNYIGMMFETIGEDGALKSEKIFKDIDETTTSYTFVSPT
FT                   GLLSATQFTQPALTLMEKAAYEDIKSKGLIPSDIMFAGHSLGEYSALSSLANVMPIESL
FT                   VDVVFYRGMTMQVAVPRDELGRSNYGMVAVNPSRVSATFDDSALRFVVDEVANKTKWLL
FT                   EIVNYNVENQQYVAAGDLRALDTLTNVLNVLKINKIDIVKLQEQMSIDKVKEHLYEIVD
FT                   EVAAKSLAKPQPIELERGFAVIPLKGISVPFHSSYLMSGVKPFQRFLCKKIPKSSVKPQ
FT                   DLIGKYIPNLTAKPFELTKEYFQSVYELTKSEKIKNILDNWEQYE"
FT   CDS_pept        complement(45886..48051)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381240"
FT                   /orf_name="CD36_50230"
FT                   /product="Bromodomain-containing transcription factor,
FT                   putative"
FT                   /protein_id="CAX41404.1"
FT                   /db_xref="HOGENOM:HBG397276"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI000192DD8F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW6"
FT                   /transl_table=12
FT                   /translation="MSETFPETNTPVQTPSTESFVNKMNADDKTIGNNVFSQDSDSNQQ
FT                   SSHQEPLSPPNPSPTPEKRQLDDEIDSNTEPESKKQKVEEESNVGQTALESGSPINEDQ
FT                   EIATNNGISEDAAQEKPQEEAPQEKPQEDAPQEKPQDAPQETPQDVPQENPHESEEPDI
FT                   KEIDPPKPPVFTEPAPKPPQEPDMNNLPEHPLPPHQAKFVLNTIKAVKRNREAVPFLHP
FT                   VDTVKLNVPFYYNYIPRPMDLSTIERKINLKAYENVSQVVDDFNLMVKNCKKFNGEAAG
FT                   ISKMAMNIQAQFEKLMVKVPPKELPVGTNAAEAASAATSPNTNKRKATTESSSSHHHQH
FT                   RDSVAAARPKRTIHPPKSKELPYETKPKNKKVAAELRFCNQTIKELMSKKHYNYNFPFL
FT                   APVDTVALNIPNYNEIVKHPMDLGTIQSKLANNEYENADDFEKDVRLVFKNCYLFNPEG
FT                   TDVNMMGHRLEAVFDKKWASKPVPEPTPQNSDVSDRDYSSEEEDNVEISEAMLSEIPAI
FT                   QVMENQIIRMRKELDELKKEHLKRLREQQAARKKKKQQKGKRRASKAKHAKDSHHHHQV
FT                   QAPPEPPKLTPPQPVVTYEMKKQVSEMVPNLSDKKLNALIKIIQDDVQISNDDEVELDM
FT                   DQLEDRTVLKLYDFLFGDKALKNSAGKKKKPIANNNLDELAHLRSQLALFDEGVNGQQG
FT                   SGNGFMNVVNQEESSEDEASSESSEEE"
FT   CDS_pept        complement(49007..51052)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077030"
FT                   /orf_name="CD36_50240"
FT                   /product="E3 ubiquitin-protein ligase, putative "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41405.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397280"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013956"
FT                   /db_xref="UniParc:UPI000192DD90"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW7"
FT                   /transl_table=12
FT                   /translation="MGVDNEKKRSTSDSSASPRAKRSKPMQELSESGPLTQADVVYFQK
FT                   EAIWRQMIQYKQQMMSMRSELIRLQRESDASKHIVCVLTGWYEQILALFDELNSEETSD
FT                   LLLAITKNDDERLELIRKKLSNLISSKVTFDSDKYEKVCGELALLSRQNEQILEEKRSL
FT                   CAKIDELESKIIELNKEYERAQSKTLRRLDSQRHIKTEEDEKSNTKEENPQPNGHHKEN
FT                   DKNAQVDSEELDHLKCELDKLKTANQLLVQQVEELTKENQSLIQKSLNLDNKLHNLEES
FT                   DLEDNIYYKKIVKNNQSLQEQIGKLTKLNSSNVSRLNDLERQQNDLKSVIEGEIIEENE
FT                   KLKSQLHESENNLVRIRTTRDELLSKNNILTSQLQDQKTNESLVELNNVLSNRVELLTE
FT                   ERLEAIVGTPGDAKLEDLSQQELIHKIGQLNNEIKEVELAFKQTREITLKKLTSSIDQE
FT                   NLTKKLTIEKNKADQKYFSAMRVKDSLTNENKLLKIQIAKSQDLIKNLNDLEKKYLNKI
FT                   DLLSNQLVDFRIIKENSLAENSKLHDELKTLTIAQGALQQEVERVNNKLESTLKENTDL
FT                   QDSNKKRDLELVKLQKQLQSTENILQKYKTNNTNSLLQEDEQQLEALRSIAKCSVCSKN
FT                   WKDTAITVCGHVFCSKCTQERLAARLRRCPSCNRGFSANDLLSIHL"
FT   CDS_pept        51821..54424
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568349"
FT                   /orf_name="CD36_50250"
FT                   /product="Alpha-glucosidase II, catalytic subunit, putative"
FT                   /EC_number="3.2.1.84"
FT                   /function="carbohydrate binding"
FT                   /function="glucan 1,3-alpha-glucosidase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41406.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0033919"
FT                   /db_xref="HOGENOM:HBG315035"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192DD91"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGW8"
FT                   /transl_table=12
FT                   /translation="MKLFLCIIFIIASANAVKEYLFKSCSQSGFCHRNRHYATEVSNSK
FT                   NFQSPYSIDSIQVDNDTITGIVFKHLPQLEHPIQLPFEISIIEDNFRFKLTEKQNIVTK
FT                   NVNPVRYNETEKLAFKQGVKKSKGFDVSLRDNEASIIYGEHEVLIQYHPIVFVFKYAGK
FT                   EQLRINDKQFLNIEHRRLKDENETNMLPQESDFNMFSDSFQDSKFDSLPLGPESIGLDF
FT                   TLRGFSNLYGIPEHADSLLLKDTTSGEPYRLYNVDIFEYEPNSRLPMYGSIPLVVAAKP
FT                   DVSIGIFWLNSADTYVDIHKSKSSTVHWMSENGILDFIVIIEKSPAMVNQQYGKVTGNT
FT                   QLPPLFSLGYHQCRWNYNDEKDVLEVHAKFDEYEIPYDTIWLDIEYTDEKKYFTWHKEN
FT                   FATPEKMLRELDRTGRNLVAIIDPHIKTGYEVSDEIIKKGLTMKDSNNETYYGHCWPGE
FT                   SVWIDTLNPNSQNFWDKKHKEFMTPAPNLHLWNDMNEPSVFNGPETSAPKDNLHFGQWE
FT                   HRSVHNVFGLSYHEATFDSLLNRSPERRPFILTRSYFAGSQRTAAMWTGDNMSKWEYLK
FT                   ISIPMVLTSNVVGMPFAGADVGGFFGNPSNELLTRWYQTGIWYPFFRAHAHIDSRRREP
FT                   WLAGEPYTQYIRDAIRLRYALLPLFYTSFYEASKTGTPVLKPVFYESTHKSDSYAIDDE
FT                   FFIGDSGLLVKPVTDEGAKDIEFYLPDDKVYYDFTNGILQGVYKGGKKPVQLSDIPMLL
FT                   KGGSIIPMKNRYRRSSKLMKSDPYTLIIALDKKGSASGTLYVDDGETFAQGTEVAFTVN
FT                   NNIISAKKIGPTASIPIEKIIVASEGKTTTLKNPKLDIYSDWSLRFSFGIDHDEL"
FT   CDS_pept        complement(54419..55279)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568350"
FT                   /gene_name="SLX1"
FT                   /orf_name="CD36_50260"
FT                   /product="Structure-specific endonuclease subunit SLX1 "
FT                   /EC_number="3.6.1.-"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41407.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG397296"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192DD92"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WGW9"
FT                   /transl_table=12
FT                   /translation="MSQTNDKPALHLVPSFYGVYILKSIPKPRRTYIGSTPDPKRRLRQ
FT                   HNGDLKVGGAYRTKKDGSRPWTMVVLVHGFPSRIAALQFEHSLQHAYQTRHINNDARIT
FT                   SSSRQSSMHSKLANIRLLTTSFDKMSLKIAIFDEEVYRMWVENKHKIECNVPCTLFKFD
FT                   EFCNSIQEIDIEDAKNILLGKQLDCMVCKASIDYFKDSTPNISSREELSNYLAKGNYPL
FT                   IGICGDHAFHLSCIARQRGPAMVPKSVTCTTCGQKLDWSDIIKVSTRLRHYVVQDSLHL
FT                   AITQL"
FT   CDS_pept        56086..57777
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228427"
FT                   /gene_name="SKN7"
FT                   /orf_name="CD36_50270"
FT                   /product="Transcription factor Skn7 homologue, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41408.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397302"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="UniParc:UPI000192DD93"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX0"
FT                   /transl_table=12
FT                   /translation="MSSLQQPIPPNSTLATTASSNQSGSNDFVKKLFLMLQEDSYKEVV
FT                   RWTAKGDSFVVLNTNEFTKDILPKHFKHSNFASFVRQLNKYDFHKVKISNEAKATYPYG
FT                   EDAWEFKHPEFRINDADALENIKRKGPTSKKAASSNVTIKTEANNNGTQPTCNHNYSQL
FT                   VSTTNHLKEQVESLKKDKHSLYQEISVLERKYKTVVENIVAINTFNERYYSSMNVLMNS
FT                   LVQNGMKLPPLDFPPPVQLGPDSGIGSNLGPLSSDTSLPSISHHLQSPLSHHQQLLNRT
FT                   IRPISNPIDGIPLGKPQVQQQQSPLGQNLPAPIATPSAVPFSEGSSSSIQAPTPGQLPH
FT                   PVAQPPPPPPAPLPQQQPLAPAPPPTATAASTSQIPTAPAPPTQQQVGTSSSSIPTISP
FT                   KSQGIVVSNSASPNASSQINTISVPNPKFHVLLVEDDNVCIQLCRKFLVKYGCSVTVVT
FT                   DGLNAISTVEHTKYDLVLMDIVMPNLDGATATSVIRSFDTKTPIIAMTGNIEDNDLVTY
FT                   LQNGMSDILAKPFTKDDLYAMLSKHLLDPKENKQDNEPTVKKQKLN"
FT   CDS_pept        complement(57774..58454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568351"
FT                   /orf_name="CD36_50280"
FT                   /product="Srr1-like protein, putative "
FT                   /protein_id="CAX41409.1"
FT                   /db_xref="HOGENOM:HBG397309"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="UniParc:UPI000192DD94"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX1"
FT                   /transl_table=12
FT                   /translation="MIIIIIIHNTILQNPTTRNMDYRQIIKTSKLFQDISLSLENLQIS
FT                   TIRCLALGSPSESKNARFQLALLIELQHLFDAEVSLYDPVFNEKDCEILKDFTIEKEFS
FT                   SDSSKTLYFLPHASLELTEEVLNTHQPKHFLANDVIAHTDRLTKKKLADNYPTLSIIVH
FT                   LLGENKVDDGFTRVSRKRFKEPVIAYDIDSVYFDKVQISRYLHTNKNDAWGTSFSDLAY
FT                   HHIC"
FT   CDS_pept        58639..59853
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381241"
FT                   /orf_name="CD36_50290"
FT                   /product="Ribose-phosphate pyrophosphokinase, putative "
FT                   /EC_number="2.7.6.1"
FT                   /function="kinase activity"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAX41410.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI000192D2C8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX2"
FT                   /transl_table=12
FT                   /translation="MRKCKIFVGSSHPELGQLVCDRLGVEPAPCTLKKFSNGETSVQIG
FT                   VSVRDEDVYIIQSGSPHINDHIMELLILISACRGGSANKITAVIPQFPYSKQSKMKKHR
FT                   GAITARMLANLLVMAGADHVVSMDLHASQMQGFFSKPVDNLFGAPTLARWIRHHIPDWE
FT                   NAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRTQDEYAKKKELKQAQIIEEGEDNI
FT                   VSELQTARVVQGHVVDDDYQANGTTEHLTKEAILDSDVLGGTYDATGSDDEDETTTSSE
FT                   EKLITLVGDVKDKVAIILDDMIDKPNSFIAAAEHLRLNCGAKAVYVVGTHGVFNDKCLK
FT                   DLTDSKCIDKIVVTNTYPISKEQIEKHKDKLVVIDVSPIFAECIRRDHFGESISVLFDS
FT                   LSSIE"
FT   CDS_pept        60801..61196
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568352"
FT                   /orf_name="CD36_50300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41411.1"
FT                   /db_xref="HOGENOM:HBG397321"
FT                   /db_xref="UniParc:UPI000192D2C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX3"
FT                   /transl_table=12
FT                   /translation="MKFSTVATVFAISTLAAAKGGDKDHNKPSTITEYVTETTHKYGRF
FT                   DKTKRPEEPKETGTHKYGKFNKTPRPVTKTVLVQDGDIPKKREAVVARDSKNSSSNSTT
FT                   SSGNNGVSTGVSLGLAGVLAVGAALVI"
FT   CDS_pept        complement(61385..62347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568353"
FT                   /orf_name="CD36_50310"
FT                   /product="Mitochondrial nuclease, putative "
FT                   /EC_number="3.1.30.-"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41412.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG713373"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="UniParc:UPI000192D2CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX4"
FT                   /transl_table=12
FT                   /translation="MSKLLVNTLSLGTIGGTALYFWGKSSTPTTPVQSPNLPAPITSPS
FT                   GTVFDPSSINPQGFFKFGFPGPIHDLANRTEFVSCYDRSTRNPYWVIEHITKASLAKAE
FT                   SNGDRKRSVFKEDEAIPLKFRNRLRDYFRSGFDRGHQAPAADAKFNQLAMDETFYLTNM
FT                   CPQVGDGFNRDYWSHFEDFVRRLTNKYDDVRVMTGPLYLPKLGADGKYRVTYEVIGSPP
FT                   NIAVPTHFFKLVVGETSGSEKISCAAFVLPNDVIDNSTPLTSFQVPVEALERSSGLDLL
FT                   QKVPYYNKQDLCKQVKCEIIVREFPKQVDKVLGLPAGKT"
FT   CDS_pept        62827..63849
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534082"
FT                   /orf_name="CD36_50320"
FT                   /product="tRNA-dihydrouridine synthase "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAX41413.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG738405"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000192D2CB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX5"
FT                   /transl_table=12
FT                   /translation="MPSKLLRDPKYRPTEVIKQCQEKGRPAYIAGPMVRYSKLPFRELC
FT                   RFYDVDIVYTPMILAREFVRNEVARSTDFTTNDSDKCVIVQVGVNNVEDFMKFIEMIHP
FT                   FVDGIGINCGCPIKEQVREGIGAALMSDPDLVAELIKTAKCKYGDSICIDTKIRIHRDI
FT                   NQTIDFVNKVVEAGTDMLTVHGRTKNTRSSVPVNLDAIKIIRDNVSSIPVIANGDCFTL
FT                   TDFQKIVAYTGVDGVMSARGVLANPALFTGLNKTPWSAVEMFLHLVTAYGLPYKLAQYH
FT                   LAKLVEDVIPRKYVKAINEKRNMVDIIDYLDEHFDLKRKGDKGFATRIEPPWKIDLATL
FT                   "
FT   CDS_pept        complement(63888..67994)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568354"
FT                   /orf_name="CD36_50330"
FT                   /product="Condensin complex subunit, putative "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAX41414.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG315927"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI000192D2CC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX6"
FT                   /transl_table=12
FT                   /translation="MKRKRNTLPESEDDASFVNNSDYSVLDKSHTQQTLDGPFDVHKSE
FT                   LDHSIEETNETKMISHNARETSTNIQLVSPKDTNDLKSQSVQSETGQSAGDESDPVLPK
FT                   NLEAPTTSEAKMYSSPLSLSAHDSIIQDNKAMQEKRNEPRLIIDRLVLTDFKSYAGKKV
FT                   IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQGKLSELIHNSGDQRPNYCQV
FT                   DIHFQMVVDDLVVPQKADIVPDSELIISRKAFRNNQSSYYINGKTSSYSEVTTLLKNKG
FT                   IDLDHKRFLILQGEVESIAQMKPKAEKENDDGLLEYLEDIVGTSKYKKLIEDSIVRIDE
FT                   LNDICLEKANRFDLVEKDKDLLEEKKVEALRFLELEKKLINCKSVQFQIEISAHQKRIS
FT                   VKQAEADAIQKELEENKESNKEILEGIENELNAQKEIEHDIKVLSGEIDSLGKNRKDIS
FT                   KKNVSLEEKSKNNANKLKKIQKSLDHSKHTVSSSNQKLSNYAVTTEKFKSDIDRLNNEL
FT                   ETEEARLNDIRSSLTEKTSDFTKEIQSLQKSLDPWDSKLKEKENEIKLAESAIEILRSQ
FT                   LNNTTNQLEEHKERLIQIKKLGKDKEIEYRENESKLAKIEEQIALGEEQCHTAKSALDN
FT                   FKSQLMSFRQKTQDSAAVVHNNQNKNKVLTALLRLANSGRIQGFYGRLGDLGTIDQKYD
FT                   VAISTAAPGLDSMVVETVETAQGCIEYLRKNKLGYANFICLNKLRKFNLAPIQTPGDPS
FT                   SIKRLFDLIQPSSSKFAPAFYSKVYNTLVAPNLNEAKKVAYGAKRWKVVTLDGKVVDTS
FT                   GTMSGGGNYVSRGAMRLSDSSNSSDQVITADELDKMNTKLQEMENEFEQMNSDYNEKIA
FT                   MLNKLKALKPETEFAISRLKLDIQSLVSEKKEVTQICKNLIAEQQKLEENNPFEQQLVE
FT                   KEKELEKLVNAKTQIKEQMSGFEQRISVLEQKIMDVGGVELKVQSSKVDSIKQQISIIH
FT                   EKTSGDRMTVKKLENEINRHTKLIESLTIEQEEAEADLEKINEQQRSLLSKLEEVNSKL
FT                   KELEDERNDKEDKLEKMKHDLEEKQEQINKFKSVEIELLNKLEKCKGILKGLNQAIEQN
FT                   KEDLDALVIRDVEPYISWLDETEQKKYNGALIDTLSEEDIADVDLEAVTSEIEELENYM
FT                   ANVKVDIEILKEYGAKIVEYNDKKSDLNQAVAERDSKKNYCDDLKRKRLDEFMVGFNTI
FT                   SMTLKDMYRMITMGGNAELELVDSLDPFSEGILFSVMPPKKSWKNISNLSGGEKTLSSL
FT                   ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ
FT                   QLVGIYKVNNKTSSVSLANIEMHLV"
FT   CDS_pept        complement(68235..68777)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381242"
FT                   /orf_name="CD36_50340"
FT                   /product="DNA-directed RNA polymerase I subunit, putative "
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="CAX41415.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG626810"
FT                   /db_xref="InterPro:IPR013239"
FT                   /db_xref="UniParc:UPI000192D2CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX7"
FT                   /transl_table=12
FT                   /translation="MSTYRSRRAIPSAINTPITVRVHKVNSTTGSEAERILTSFIDASE
FT                   INISGKGTAETNATGISGGNESPAIVSQLKRIQRSLRGLPPLMSEEQFSKSNASLEDAE
FT                   RPNKKIKFDESDDSLSSEKVTEAGVEEEDKSNEGIEEVVSEDEKVEHKKEKKSKKDKSS
FT                   KEKDEKKHKKKHKHKEE"
FT   CDS_pept        69010..69303
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381243"
FT                   /orf_name="CD36_50350"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41416.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG398786"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniParc:UPI000192D2CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX8"
FT                   /transl_table=12
FT                   /translation="MFSNILRQSSRGLINFTSVSTRPLGAHIHGVNPLITVSPLQSVVG
FT                   LMQQRFKSRGNTYQPSTRKRKRKLGFLARLKSIGGRKILERRRAKGRWFLTH"
FT   CDS_pept        complement(69401..78313)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534083"
FT                   /orf_name="CD36_50360"
FT                   /product="Cold Sensitive for Fermentation protein 1
FT                   homologue, putative"
FT                   /protein_id="CAX41417.1"
FT                   /db_xref="HOGENOM:HBG397354"
FT                   /db_xref="UniParc:UPI000192D2CF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGX9"
FT                   /transl_table=12
FT                   /translation="MAFESSYISVASESTIKLSSWIYWADWILTLILSLGFVFYFHRLL
FT                   GFVVSFVFKIVLWRQYRINVNIRSFKVSPLGGRLFMKNLTISTSDMTISIINLTFTWRY
FT                   WIFKLNRLSNFYFEIDNETPEISQKRNDKSPSRFLLVIEGLEVFIYNRTVAYDNIMDML
FT                   QKNNDVSSSEEKTDQESSLYSDDIKNGNLRFRNKKRTSNTSSSDEGSNNDQTAKDSSSL
FT                   FFLLQVLPIAVKIKRGAIVIGNVSTPSILVASYKAASGTIDVAKSPNILDPYRLLYDCV
FT                   FNNFQLWMRPNIGYEKYRYGLEAHQEYSQPTRNDTQKLTYMKKYRTWFKYQRATEKLRK
FT                   LYYKVFRQEEPENMGYEPNFNWRGLKRYIGDNQDDSEVFAFLNSDVQYAKYSLILDSVT
FT                   TRLIYFYDNPGIQPQQTNLKTQMPPESGIEVEISNGTIHYGPWTDRERVPIQNMLFPPV
FT                   ARDSSPTRGFLKPGSQREYGGFKVTVIVKDEVIIRIPTREPSKDKELIKSNAANNGPTK
FT                   NSRPFGWLEVKLSEGSNVSTFTSYVAKEDGWPNIMKVIFNSPEIRSSVNHDVLFMADSH
FT                   EIDAKIGFPLQWNGKCTWEFDQVSLNPQIFFLREHTMLFSDLFTDFGSGDPQPYEYFRL
FT                   FIYNIKWKLLNYKFYLNVNDLNIVNNPLDFEKNKYLSLQGEELDCDINLPLNGLLTKST
FT                   TVSFNITTPHFDLVLDTPPWHTVNAFWKESNVVGRSNHFSVDGLYKFFSGIEVNTSDYV
FT                   EIRCMGDEVSLKFYGFVIRYLFTVRENYFGDNIHFKTFEEYTNQESQDQESRDGTSSQE
FT                   PNYWKLIKTENDMDVFFTFQVRSGLVMLPYHTYSCQSHIGLNFDMLDIDIRFCNYYMDM
FT                   QVDFSPISAVFVEDYYSVQDPLLSVNEYVERYFNRRADMHVDGFSVHTHRMFGVPPEEL
FT                   TFYCKWDFCAGDWLVDSTPMFMRAVAGGISNFGVGFMDSENALDVAFPPAFDAANFTFK
FT                   CPNFTFRLRPDSSSCLEIQLVDFLLSYNDMSNNRYSNKLVVSIPTICLKVFKNDVIAAF
FT                   LNTSLIFTNICQKRDMLGHRETQQLHVRNSDAPFHRSPFILLEEYRDDFYESSKGCLFT
FT                   PVSLPNASIPLTELTFNMSKKLNIDIDTSSISSDSEYAFTNRMPPTNDYLDEDFTPSYK
FT                   VDPDTEYDSFIVELGDVEAFVSPKCIEIIVSTLQAMEDYSADTIMDQLNVSTIKFLGSL
FT                   INSIKTVKNCRVVNHDLSIKFGEFLLADTKELTQKAKKHPTITLQISDLSLALSEKASK
FT                   TVNEGNITSNEEISLALHIKDILISVAQPFVFNAAVIFTIQEVEYWMELTPDDFVASGN
FT                   VETISLNIDDTQTTWLVDGITKTIETIEEMNSILKKHTRKINASACLVHALTLASIEYY
FT                   VDYDPDVLTKPAYILRAKKEHIRFFDSWKVIARLRHILQSLPADWLHEVNGILRDKRYI
FT                   LPQDSLDEVTEIFSKWRAWEANQEERSRLLNRIFSGDTANSDKRQMHLQFLFGNISLKL
FT                   VSSNQTDYIVLQQFSTTLDLDTTKDRKPVDVVVGLGAYQSSITVLLLDKLKLLQSIKEN
FT                   KKSNDMEQKEEEVQGELKNVLQDIDLSISIYIEAFRQQISLLTLVLELQGNNMASISTI
FT                   KEEMKSISNSFTLKNAVCNLWGSSNPVYSQAMENISWVVARTSAFDKDLYKVDLELDKV
FT                   DIHMANKNDKILTVLQSILEADVPYVEKLLSESESKSTSTLNISDLLGYISLKLSIQEF
FT                   NWRIDILSPVVLEGNSIGCTVSACMIDDNFIFDADFLKGKFNMNIDEHNVIEIENSKFV
FT                   NVVEVGIWENLILFSVQSSMGYAKLLSPNLISAIGLSDITLPKLEKKIHDFKSLLANNK
FT                   SVKHNETDAPEREFAFKVQFSNDYMGVSSFVNKTKLLFEVESFALGVYNVNQVESEDPI
FT                   RSQQLVPIYGSISVPAVRISILDRKIPIGLSNMLDVNFGIRLLSVDSLGVLQTLQFESQ
FT                   YCRICLSEPIVFKLIKISDEILKALPKPTTQETQQKPKESIAETENGDLEKFIFSRIST
FT                   VQFLSYNFCVGWLFNDSSKDYPGIIMGAERFFAATEFKLGKFTLMEAYFSVANGNRSSN
FT                   FYSTSSEKSNLNRAFLPNLQLSFFIDNNRKGKNLSLSMHGDELDVKFLSTSVAIIEKAV
FT                   NSASNVQSYLDKRSKPFYQDIERESSTSHKESLFTSSFDAIEFITTFAGSNVLIHRLDN
FT                   HDDSESPASLYLHAPAIKTAIKYLNKKNQGKNKLMGEILTTSSDNTLYSKCMPVVMDII
FT                   NGTKGLLGKSKKVSSNDLLVEEQPQSSDFITTILDDTDIHFGVRIENQSLSLSCEPTAK
FT                   VAAIVGLEGIFIQLNSSDFRTSGFNVSMMVDSVSVSLQHIYSRDISASAGIKNILLTNT
FT                   FEFSEVTRLFLSGSISDADAYINVKQYQDVDLFKDIWFPKEYFESYSGQAYPEEDQEES
FT                   PIDDTFEELALAKNRNISSRFREVSTTYAFPWIVAFVISNVNVRVDFGQSLGNFNLRIE
FT                   NFWAVSKKSVDWSQDLKTGVNEVSLSSIGRLGGILSIKNINLHTAISWKLDSEITLDVP
FT                   LILVSGGVEELHLKMSFDHHVIAIANFEEFSMDIYNKKSEVSIAKDHLFMTTTFKTAEI
FT                   YITSLTASNFLDIQNTISRMIQENQRSYKETLRDSSKGKSLEEKKRRRYSQNAILETVK
FT                   KLETRIHVSAGKVLMHIYPSSMDNSKVLVIKLDQSRAKFQQNEYSSGISNELDLKFNDL
FT                   KVSLSSVSPVSEEFVNEASVSELTQHAHKASGGTIFVFPSFRISMRTFQKYNSNLIEYM
FT                   FQSTFNGTVDIRWNLGSINFIREMYTIHSKSLESRMEYRKKMQPFDEGAGAIAKAILEH
FT                   QITEEDTTQKIDDAIKETIEKVEKSSKFKYSALAPPIIEEPQLKELGNATPPLEWFGLH
FT                   REKLPHVTHQLAIVSLQKLIHEIELEYSKMLGKA"
FT   CDS_pept        78648..79619
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094148" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568355"
FT                   /orf_name="CD36_50370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41418.1"
FT                   /db_xref="HOGENOM:HBG397362"
FT                   /db_xref="UniParc:UPI000192D2D0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY0"
FT                   /transl_table=12
FT                   /translation="MSSHIFKDIQDKENELKISGIRRKGIISNENSGPLLSKDSNSKQV
FT                   QQQPQPQQQQSKFTNKRIPLGGKNHNSNNLLLNRSHSSLNTKPTTQGVTNAKPPSLTKS
FT                   NSSLGFSVASDQQTEQPKQFPQSFVVHNEQVLPVKRKLLSDTKDELSQNNKRVKLEKKE
FT                   SAANTFTDSLTKTIQNALAPVEDLQTTISPKTDQLNSSNLTYNDVNRNNVDPMKRESRM
FT                   KAIDDLVELHWQDPIENIPETRGCENNGGDQLDELDIKLFSTPTESVDAVDMNQNHISN
FT                   NEQNSSLELEFGDESNVGEIPIIDGIDEEIGLTSDDLDNLLG"
FT   CDS_pept        complement(79709..81031)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568356"
FT                   /orf_name="CD36_50380"
FT                   /product="DnaJ-like chaperone, putative "
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41419.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000192D375"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY1"
FT                   /transl_table=12
FT                   /translation="MLETDLYDVLEIDRSATNAEIKKAYRKLALKYHPDKVAEEEREYS
FT                   ETKFKEISFAYEILIDEVKRNEYDRYGTTDGLNGMPDFEFAGNPFDQFYGAGAGAHFNE
FT                   YGGDDFYNFFNNMNGGGGPRHHSSRANRTEDANIEVDLTLEDLYKGKVIKTTSTRNIIC
FT                   TQCKGLGVKSSSVVSKQCSTCKGEGQVRKIKRVGPGMVAQTYVDCSTCQGIGRIYRSKD
FT                   KCKLCHGARVIEETKILEFEIPKGSPAHGVIYKNGESDQFPGKVTGDVILEYKCKPHKV
FT                   FTRKDDDLYMKVKIPLVDSICGFSKLVAVHLDGRGIKISTPKGKVIRPGEYLKLSGEGM
FT                   PKSTPKKSWFNSADSSRGDLYLKVEIEFPPDNWYIEKNDLAKIRNLLPTKHAREEKEID
FT                   VPDPSIELFTDFSIIDSNQLPKYSQDRKHNEQGYEQSCAQQ"
FT   tRNA            complement(87678..87762)
FT                   /gene_name="tRNA-Ser (CAG)"
FT   CDS_pept        join(88900..88902,89031..89041,89148..89559)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077031"
FT                   /orf_name="CD36_50390"
FT                   /product="Cofilin, putative"
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41420.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG628477"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI000192D376"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY2"
FT                   /transl_table=12
FT                   /translation="MSRSGVAVADESLTAFNDLKLGRKYKFVIYTLNDEKTQIVVEQTS
FT                   TEQDYDAFLEKLPENECRYAVYDFEYDIGGGEGKRSKIVFFTWSPDTAPVRAKMVYASS
FT                   KDSLRRALNGVAADVQGTDFSEVAYDAVHEKVSRGTH"
FT   CDS_pept        90294..92639
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381244"
FT                   /orf_name="CD36_50400"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAX41421.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG397383"
FT                   /db_xref="InterPro:IPR004906"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000192D377"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY3"
FT                   /transl_table=12
FT                   /translation="MTSKLPRATLAQKLQILDYYHKSDRPQSETVDKFKNEVSISTSSF
FT                   SEWLKNEPELRKRYNQADFKFSKNSKRKVKFKYEEINKAMDKLVIGRLERNEPITEPIL
FT                   REHWSVYAHQYGVDDPKRLHSFSHGWLSQFKKRHGINKKSNNGSQKNAKNGTSKNAVEV
FT                   DSDSIHIQSNDEEENVENGFEPLDGPEVEVSGVEDQNYDPKFSTISHEHNIRNPTENSN
FT                   EPRTKKARLDGRNNASQLEANSNFDLLAQQRQHSQPSSLLTSPSPNSDHSQQQLERRRR
FT                   KRHQSPQEQQHIDHQQQQDQQQQQARLQGDKHSENSNRNNQEHYIQHGQANVRNEAQLL
FT                   QEQQKQLQKSKQQPTGTDTVPRNQFRPQQGLSFSHSNSPIMSFGMDKHNMQLQNQYQKS
FT                   HRHGANQSNTVPEDIQNPSPDQDFRNSLMNNNGNKNTINYSPNQLYKEQRQLLNDDYSS
FT                   GITKSNDSRNSRVISNNDDTETEVSTNQALLTGRMTEEETKAASELNNITNPITATDME
FT                   RFIYMFADRFFHLHQYEYPQTVKVFQEFKSSFFNERIMNNRTSKQQQQQQQQQQQQQQQ
FT                   TSLPQQSQVQPQLQQQQQPSPSMQSTQQIQQPMIYHHNGRQQQQQQQQQQQQLNRNTIS
FT                   SQLPALVAATASLVNNNQSNMSLKNANSTMVLNPQSNPHQRQQQQQHEHQQPPTLPTPL
FT                   QKIDSSKSHHLVMSPSPMDTLVQLQLRQQGAQSSLQQQQQQQQQISNFDDYLRSMNAQT
FT                   LLNSQPSATRNNGLTEMNLDRNSRMTKS"
FT   CDS_pept        complement(92861..93313)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568357"
FT                   /orf_name="CD36_50410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41422.1"
FT                   /db_xref="HOGENOM:HBG397390"
FT                   /db_xref="UniParc:UPI000192D378"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY4"
FT                   /transl_table=12
FT                   /translation="MALRNYLYAKHNHDTSIDIKINKDTSLMSDITEKVSSDPSNPEKG
FT                   RSPMRIEQSRRRIIRIVHKKSSNQLKPTINHIEKLTNNIENVHIDKIKKENCLNDCNLC
FT                   DCKNETNNKEKDTPLIQVEVDNGINGGSGEHNEIGNKNEIDFTSSL"
FT   CDS_pept        complement(95111..97543)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381245"
FT                   /orf_name="CD36_50420"
FT                   /product="Uncharacterized protein Sgm1 homologue, putative "
FT                   /protein_id="CAX41423.1"
FT                   /db_xref="HOGENOM:HBG397396"
FT                   /db_xref="UniParc:UPI000192D379"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY5"
FT                   /transl_table=12
FT                   /translation="MNGSSNNDNEVIVLTQDITYPPVTPSKQQPLSNNNSPTPSFKSPK
FT                   RNNTLSPLRKKQQQQQQPKPAALSSSSSSSSSREHISRSNTSSNSALSQSHQVSEEEFK
FT                   SLQRSFADSLLNFNNLENENQRLQHDLTIKTTQLENQLERIHYLEQSIKEAEMDNLHNQ
FT                   DILNKQVEMYKEMIDKLQTKIVELNDELERKPPLETIDASLFKKYEKLVRDYKILDSQF
FT                   EVERNSKLVLIDQIEFLSRKNEDLIKQIGAPIEESDNESDANVDYLADLTDNVTHTMNE
FT                   LTDDEHEQEQKASVISPGLNIYHGIAYQSSPIKSYDDSNSSVKVSPNFQFPPPPPPPPT
FT                   SHLPCLSEQQQRQQQQQSSTFPPSPEPECKDKKRSSLPTHLKQKHTGEEDDDEGIDFVL
FT                   SPFKLTPSQALYANDDSSVFPDDNGNAGVIKRYSATKPTHSRYNSHDLVPIKVEFEKLE
FT                   SGIRSTSVPEKSLKESSTCETIDENTGNGNIKMSKYRNGTLFALNGYTHNNNNNDDDDE
FT                   GDNDYDDRPTNISKNFSEMDISSKRSSYLNSDEKTKQEIMKLKFELRSLKLHNEKLLSF
FT                   IGFELQKQRNNLKKLSRKQSARLLAGSKNIEYSDAKLIEKSRDLLINKKRVLRSVSINT
FT                   GFKDRFPIKNIGIIAPNSEPAYVNHYDEDDFIDDSHDFLDMNSLSHNDKMIKKFASQVF
FT                   SNTKALYEYDSDSDFENTSHWVLEEGEEGNEHDDEDNLTPNTSGSSSEEEQIGVFRQIK
FT                   HMVIGGEAVNKSKKKRSKKDDQHLVDDGLKFKFLTIALGIVIIGLKLTPHNNQNITR"
FT   CDS_pept        join(98221..98322,98358..98507)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(98969..99328)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568358"
FT                   /orf_name="CD36_50430"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41425.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG756716"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniParc:UPI000042CD39"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY6"
FT                   /transl_table=12
FT                   /translation="MYYELFAIARITDPLNTAKEATKIASTVGKLILNNRGIIRDITSL
FT                   GAKPLPQIISKEQERHFQGYHFIIGFDSSPNVQTQLLRTLRRDPRILRSSIMKHDLTHN
FT                   LNPGTTIEQALRATK"
FT   CDS_pept        100068..100670
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228428"
FT                   /orf_name="CD36_50440"
FT                   /product="Adenylyl-sulphate kinase, putative "
FT                   /EC_number="2.7.1.25"
FT                   /function="ATP binding"
FT                   /function="adenylylsulfate kinase activity"
FT                   /biological_process="sulfate assimilation"
FT                   /protein_id="CAX41426.1"
FT                   /db_xref="GO:0000103"
FT                   /db_xref="GO:0004020"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG309946"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="UniParc:UPI000192D37A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY7"
FT                   /transl_table=12
FT                   /translation="MASNITWHPNLTHQERAELRKQKGVTVWLTGLSASGKSTIACALE
FT                   QSILARGLNSYRLDGDNIRFGLNKDLGFSEADRNENIRRISEVAKLFSDSCCITVTSFI
FT                   SPYRADRRLARELHEKDNLPFVEVYVDVPLEVAEQRDPKGLYKKAREGIIKEFTGISAP
FT                   YEAPEKAEIHVKNHSGLSVEQAAEQIIDYLLEKGYIN"
FT   CDS_pept        complement(100742..101449)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077032"
FT                   /orf_name="CD36_50450"
FT                   /product="Class E vacuolar protein-sorting and endocytosis
FT                   factor, putative"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAX41427.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG464741"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000192D37B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY8"
FT                   /transl_table=12
FT                   /translation="MSQLFEWAFGKKLTPQERLRKNQRALEKTQRELSREITKLQQQEK
FT                   KLISDIKKSAKSGQISSAKIQAKDLIRTKSYVSKFTSMKTQLQAISLRIQSVRSNQQMA
FT                   MSMRDATRVLGGMNRSMNLPQLSRIAQEFAKESDMMDQKQEFMDDAIDDAMAMDEDELG
FT                   EEEQVDEILSKVLDEIGVDLNTILKDTPTGINAGGIEQADKARVAEAVGANGASFHDAD
FT                   EDDLQARLDSLKK"
FT   CDS_pept        join(complement(102815..102837),complement(101719..102748))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381246"
FT                   /orf_name="CD36_50460"
FT                   /product="D-amino acid oxidase, putative "
FT                   /EC_number="1.4.3.3"
FT                   /function="D-amino-acid oxidase activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41428.1"
FT                   /db_xref="GO:0003884"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG735740"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniParc:UPI000192D37C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGY9"
FT                   /transl_table=12
FT                   /translation="MTKYVIVGAGVVGLYTGFSLLEKGVPAVEITVIAEYLPGDESINY
FT                   TSPYAGGNFSCITGDDPQTLQYDKYTYLNLHKIQKAIGGKTQGLDRYPSTEYWDQKPSQ
FT                   TKIESLESYLDDYKVIDKTSSSSLPSGSEFGIKFLAWNFNCPKFLFNLQQFLESQGIIF
FT                   IRKKLTHIVQAYFSESTKIVFNCTGIGARSIGGVEDKNVYPGRGQVVVIKAPHIMENVL
FT                   SWGDREPTYIIKRPYSNDQLILGGYFQKDDWTAATLKEQTQDILQRTTSLFPKILKENP
FT                   NGNRIEDLEILRVAAGLRPCRYGGARIEKEVVESGKILIHNYGASGYGYQAGYGMANKA
FT                   TDLALGRSKL"
FT   CDS_pept        complement(103367..105229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568359"
FT                   /orf_name="CD36_50470"
FT                   /product="Iron transport multicopper oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41429.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000192D37D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ0"
FT                   /transl_table=12
FT                   /translation="MLFNQFILWLISIPLILASGTIHRFDWNVSYVMANPDGIHPRRMI
FT                   GINNQWPNPTIRIKKNDRVIINLTNELPDKNVSLHFHGLFQRGYNDQDGPAFVTQCPIA
FT                   PGVTFIYDFNVTDQYGTYWYHSHMGSQYGDGLRGLFIIEYDNDDEYNKEFPYEYDEDVT
FT                   LTVGDHYHLESPEIVKNFKTRFNPTGAEPIPQNGLFNETKNVTWKVNPDTTYLLRIVNV
FT                   GLFPSHYVYIEDHTFTIVEVDGVVVEPYETDSLYIAVAQRYVVLMKTKKTTNKNFRFIN
FT                   VLDQDMLDFLPSDLQIVSTNWIVYDKSLDLPPALPFNEFHKTIKALKGFDDFDLRPLRK
FT                   VNLLDEPDYTIQVNLTMEVLGDGVTYAMFNGKTFRPPKVPSLYTVLSTSGGDTNLTTNE
FT                   LIYGSNTNSFVLQGDEVVEIVLNNMDPGKHPFHMHGHNFQVISRFDTDDEDNQLVFDPK
FT                   NETYTNYPEFPMVRDTVEVGPNGFIVLRFKANNPGVWFFHCHVDWHLEQGLALLLVEDP
FT                   IELLSSNTTISSNHIDACKAVGMPIKGNAAGNNIDLLDLQGENIQPEPLPAGFTNKGYF
FT                   AIACCTLIAIYGLWSIYNYGMEDVSKDNAEDVIEKLYKILNDYD"
FT   CDS_pept        complement(105450..107249)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094151" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077033"
FT                   /orf_name="CD36_50480"
FT                   /product="Beta-glucan synthesis-associated protein,
FT                   putative"
FT                   /protein_id="CAX41430.1"
FT                   /db_xref="HOGENOM:HBG397431"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000192D37E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ1"
FT                   /transl_table=12
FT                   /translation="MSDSSNLSGLISSSSTSNDITPVVNEESESTISGLQQQQNFKIKS
FT                   HSRYFSPQSNITTKKFNYLDNPFYYMDKDFDSNHHHHHQQENRDHEGFRNGHSHTNSTS
FT                   SDGNNNINKKRKRIGKWNWRFKRIDLKKSFRFIIAIVSILVIFVLAIIFAIMSSFIINN
FT                   PIRNGHKIEKLTNINYAQLKSIRTNLIDPDTPIEFYNLNKTNHQEGDWTLVFSDEFELD
FT                   GRTFHEGDDQFFTAVELYYAATHDLEYYLPQMITTNNSNLEILFDKFNYSGLNYVSGML
FT                   QTWNKLCFNKHVKIEIKAKLPYEIKNGLWPAIWSLGNLARPGFLATTDGIWPYTYNECD
FT                   FGILPNQSTLNEEMSYLPGQRLSKCVCTGEDHPNHGIGRGAPEIDIIEGLFQYDKFWGV
FT                   QTLQVAPFDEWWRPDYDYVDIINDNITIIREDIGTVYQESISLGTLIDNEFPFQKFTME
FT                   YKSDSQNNINSYLKFSIDDITTSVINGSALHPNEFIGWREITKEPMSIILNMGLSYMWN
FT                   PRVNIDELKLPAKFLIDYIRIYQPNNIIEMTCDPIDYPTDDYIQSHSIAYENPNLTSWF
FT                   QAGFEFPKNSLSHQCKVPPPIVT"
FT   CDS_pept        complement(108336..109241)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568360"
FT                   /gene_name="SEC14"
FT                   /orf_name="CD36_50490"
FT                   /product="Phosphatidylinositol/phosphatidylcholine transfer
FT                   protein, putative"
FT                   /function="transporter activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41431.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG328476"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000192D37F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ2"
FT                   /transl_table=12
FT                   /translation="MTTMTTEEILASYPQITAPTDQTGYTSNLTPEQKTSLEIFRQQLT
FT                   ELGYKDRLDDASLLRFLRARKFDIQKAIDMFVACEKWRNDFGVNTILQDFHYEEKPIVA
FT                   KMYPTYYHKTDKDGRPVYFEELGKVDLVKMLKITTQERMLKNLVWEYEAMCQYRLPACS
FT                   RKAGYLVETSCTVLDLSGISVTSAYNVIGYVREASKIGQDYYPERMGKFYLINAPFGFS
FT                   TAFKLFKPFLDPVTVSKIHILGYSYKKELLKQIPPQNLPVKFGGMSDVSDDDLLLKDVG
FT                   PWRDPEFIGPEGECPRSYNI"
FT   CDS_pept        complement(110946..114626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534084"
FT                   /orf_name="CD36_50500"
FT                   /product="GTPase activating protein involved in bud site
FT                   selection, putative"
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41432.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG397444"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI000192D380"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ3"
FT                   /transl_table=12
FT                   /translation="MPPTYQSAFHKIISRDKGVFEGHNFLVSVDTINWIHVNTLTITEQ
FT                   GQLFSSDSDDNHYLLLQSLQSCFIQIYPDSNISGSGKNSISQPPPTTSTRRNLLRKTSN
FT                   LNSSDQSHSRSSEDNDHQPPAILIKTFDNDKLYIRIPSKSNFGNLLSCLIVWQNLKPQG
FT                   LAKKWYSENKVIDGFNPNAPIYELLVCRFKIYGPLPNKYKNLNIVPGPKAPVYQQKIDD
FT                   FKTNFDNSYIITPQISSDNHNSINEGWFYAMGALNSHGILNFISELDGTLLYSIDIKSV
FT                   LSSEIREVHNSIFNSSNILFIGQLKELRYNNVIRTLSTLTPDQLLTPFLTRDGKIIPNN
FT                   QRILIEFPLHIDLEDWFVGLNYFAKREYIGSFDNESKLIHNVEHPQLHDFSKANFRVSK
FT                   KMSIDIIEAKFENTETNKSGKIYAEVRMWGFPWSRTAIVNHTNNPFWKEEFSTDLPIST
FT                   QMVHILIKKCVFNDSSYSTGDKLIGTVYVTPDILTKQMKTTSTIMTSSESSQAIQMNTV
FT                   PLSSMASTSNAGLDIVRLTINDPNNIPIGKLLLEVHLQEYHILSPSVFKPLEKMLVNAP
FT                   MKDLIRFCNENVPSSDFERVSLVLLDIFQSLEVEDDWFKSLMEVELVNVDMMTRKNYHQ
FT                   RNSQDQAISNSKTQHQSSHNNVFNTLFRGSSIFSKSLEKYNLRIGQEYLEKVFGDFFAK
FT                   ISNEKKNCEVDPRYVRIQERALRKGKSIHDTTGLDGNGYSQDASDDDDDDDDDDDNSSD
FT                   DADYNAERERERNERIKKMVEENFQNLYGYVEEIWNKIYITSNDLPDQIKLQLKNFRTK
FT                   VELVCDPEDKVTSLNCLSAFIFLRFFCPAILNPKLFYLAKNHQTGSTQRTLTLIAKVLL
FT                   NLANRQEFSPHKEPHLVRMNVFLRKHTPEIYDYFDKLTGRKNDFNEKILELSHEVKRFD
FT                   LNLDKTSNELPTTPYLIDKYLRLTEIVHLLDYNKYAKNNPNGSMSNLGTPVNSPSRDID
FT                   RDRSQSGTPDLDPILNLSDLKLNYENKYQIGSLEFEKSEFLELSGDNETEGFIKSLCKG
FT                   NEEIFSFINSNITLKDIQKQSTKIMNRIQELEIYLENYEFPNNYKDQFIWDSFTDDIMN
FT                   KCWLDTSRNCLIYSDHVPSTNQYKKLIDHALSGLKLKFNDHQKLNGNSTMNSLMNNSSG
FT                   KRNGHDINGGPGGNDGNYGDGYNEMDRNQRLSLTFSTISIGSAIKPNTSKNPFKKWLRK
FT                   N"
FT   CDS_pept        116077..119127
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534085"
FT                   /orf_name="CD36_50510"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nuclear-transcribed mRNA catabolic
FT                   process, nonsense-mediated decay"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41433.1"
FT                   /db_xref="GO:0000184"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG333519"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="UniParc:UPI000192D427"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ4"
FT                   /transl_table=12
FT                   /translation="MSNLLFHNFDKNSEDIEDFNSTASNIISIRDNGSIKDGNGSETDT
FT                   INQYNEQELLNQLKDEHYTSDSPIEHVTQSYGDQEGDIDQDSEQHYEHACAYCGIHNPN
FT                   SVIKCNTCNKWFCNAKTNSSSSHIVTHLIMSRHNQVSLHEESELGDTTLECYNCGNKNV
FT                   FILGFVSAKQESVVVILCRLPCARSKDVNWDTSEWQALIEDRQFLSWLAPPPTEDDLIE
FT                   AKLITPQQISKLEAQWRLNRAATINDIENNDETEQEVLPILMRYNDAFQYQRSFGPLVK
FT                   LEGDYDKNLKESQALEHIQVKWALGLNNRHLASFTLSTFETSDLKVAVGDEIILRYSGN
FT                   QGEPWEGHGYILRLPNAYQEEFTLELNPSKIIPPTNLTTDFTAEFVWKGTSYTRMQQAM
FT                   KDFATDEESVSSFIYHKLLGHEVLPIEFDIDLPKKFSHPKLTELNVSQTNAVRTVLQRP
FT                   LSLIQGPPGTGKTVTSATIIYHLSKLNKQKILVCAPSNVAVDHLAAKLDLLGLKVVRLT
FT                   AKSREDVESSVSHLALHNLVNNNAKGELKKLIKLKNQVGELSVGDTNNYLKLSRSSELK
FT                   ILNKSEVVCCTCVGAADRRLSQFKFKTVLIDESTQASEPEVLIPIVKGAKQVILVGDHQ
FT                   QLGPVILDKKAADAGLKQSLFERLVFLGHVPIRLEVQYRMHPCLSEFPSNMFYEGSLQN
FT                   GVTSDDRLIEESTFPWPVIDTPMMFWANYGREELSASGNSYLNRVEAMNVEKIITKLFK
FT                   DGIKPEQIGVITPYEGQRAYLVQFMSVNSTLLDKRDQYLNVEITSVDAFQGREKDFIIL
FT                   SCVRANDSQSIGFLSDPRRLNVALTRAKYGLVILGNPRSLCRNRLWNHLLIHFREKGCL
FT                   VDGPLDNLQLSMVQLNTNNMRSTTSSNNNNYYNGRQRKGKFGAASTVDSVTDFDSASIL
FT                   SYDNSAIVHKSGHNGNSNVNLKEEMWPALNGKQQVFDGDNNLTANFYNKLNKIDKNYGG
FT                   GRYNTGGNNIEDDIKSITSTFAAGLNF"
FT   CDS_pept        125174..126664
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568361"
FT                   /orf_name="CD36_50520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41434.1"
FT                   /db_xref="HOGENOM:HBG398559"
FT                   /db_xref="UniParc:UPI000192D428"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ5"
FT                   /transl_table=12
FT                   /translation="MNQLPDQNNTENSNDNTTNTTTQDATDNSTNNQRNITEVTMEEVA
FT                   NHVRNPQRIKLSNDDIKLVLFLIVRVKPFKYIGYRKATQSQRWTRIQREFYVLKSKAVK
FT                   NKNFVVPTVRTLQRQLDTANKKTAFKLRTLTKNGVTTRKHHEIPNTLEEINQDEHYQYK
FT                   HINSNSTIEELETAVFELQELSDRIRHLIIQTNNVILPDQQPEESLVEPSVEQDQTVQS
FT                   LPQEISNTTTSTSTSTFYPTIQNMIHMNNDEEPNSTPTPATTNTTTTTPATNTTSNTSS
FT                   SSTTTTASATASTTTTTSESAITNNHISHMTSPIPSSSSMIVTNTNTNDNQAHGNTSTS
FT                   TSTSTSTTTTSINQIYETITNQLTNLKEELTMNINNEPLTQQTNQVITLKKSLDQRIKK
FT                   FETTVTKINNQFRKKFEKLITDHFNKITNINNDFIKEQKDLIKEQIDLLINIENEKNEN
FT                   EKNENEKNNENIQSIINKFEELIEELLNQRNQRNQNQN"
FT   CDS_pept        127891..130353
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381247"
FT                   /orf_name="CD36_50530"
FT                   /product="Acid sphingomyelin phosphodiesterase, putative "
FT                   /protein_id="CAX41435.1"
FT                   /db_xref="HOGENOM:HBG756508"
FT                   /db_xref="UniParc:UPI000192D429"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ6"
FT                   /transl_table=12
FT                   /translation="MCGGRKNKNNQTNKKKKEEGKIQNFTKSVAKLQKMIQSIIIILFS
FT                   IYQFIYSYNEHIINYYPPTELAISDEEIVNRAIQELHNIDAANDLNECMTCKTRLQVAK
FT                   FISLTRPDLVPQIFSTWCVESGYDEIQCHMNYGYPSEDYCTMGNDFTKMVSLMNPSGLD
FT                   GDYFCYYHDNNCGILPETPLVDMSRLWPSKPRNYLPPDNSGETFHVLHISDINLQSDYK
FT                   MFAEANCTQSLCCSPHCRNLQNSAPNFNENLEGGYFDSSYSRNHFEKGSYMDITKIKKP
FT                   TWRPARQFGEYSCDSPTLLLNSTMQGIRDLHQNHLSFEFALFTGGTVDHSDRSFMSKNK
FT                   NIMSQDISYRILKHYLDTVDVIPTFGTRDIFPMNQLPQKNLTENSNSYQWQFDFLADLW
FT                   SELGWIDHESSKQIRYSQIGYSLITSRGLKIICLNSNVWNVKNLYTFWEVLSIDSFGIW
FT                   KFLIEELIESERIHQRVWIVAHLPTNHQSLPLPTKVFAQIMERFSPQVIAAIFFGHIQV
FT                   DTFMIQYGGDGTDNKELEKAINHAIVGPSISPYSGVNPAWRYYAIDSKSFSVVNAFTYY
FT                   TKLDNTFINDGAEPVWEFGYSARDVYDPEQMWPMEWCLNTEWWHHVSEKIKKVPEMDLM
FT                   YQRLETRWFSQNEFDSNSYCKVTSFTMEAKKQCMLTGDQDDYVEPKQPNDYVPFIHVGS
FT                   KIEYIDKQVAYPPEVEEEVEVDVEEEEEEFESEEVDEDYQPGKKLGTKGNNTNVDQGLN
FT                   DGGGGEGGGGGDKKNKGKGGLIGKEIEEQNYTVANDNSLISRFQRKPQGKSLGLKIKNR
FT                   HRVPIAQL"
FT   CDS_pept        complement(132600..133754)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381248"
FT                   /orf_name="CD36_50540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41436.1"
FT                   /db_xref="HOGENOM:HBG397473"
FT                   /db_xref="UniParc:UPI000192D42A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ7"
FT                   /transl_table=12
FT                   /translation="MVSASTIKVLPPANGKKLWRVRKSTPNTHQRSNSLPGNKSSTTLP
FT                   ISSKSSNRSCSTSSIASTTATTPTTTTTNNNNNNNSSPMQSSSIECLNNSLKIVAAASK
FT                   FTIKRPPLRRPKNKPGKPKDFVFVDLSPVQSDNSSESEPNGGITTTVSKSRRSSNSGNS
FT                   ATATATGNKIAAINVPVLPTNVVAPATPMTTSNSMNSINDFNTYGKPPPPVKDANTYIG
FT                   ATNMEPSLSSNDGFGLPSPVESLDDFLISEFDLWENEVNWQSMIPNTQQQQQQQQQSTS
FT                   SVVSPIIRTENNQQQQQQGQYEQYFDIVSIVQQQQEQIQKLQQQLQQITKSNNNNNNNG
FT                   NGNTLPQIDMINSIINNNIANSIPIPTSSATTTTTNNGFMDFVF"
FT   CDS_pept        complement(144704..145027)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568362"
FT                   /orf_name="CD36_50550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41437.1"
FT                   /db_xref="HOGENOM:HBG397479"
FT                   /db_xref="UniParc:UPI000192D42B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ8"
FT                   /transl_table=12
FT                   /translation="MPPKLSPSAAASSAQGAPMSHKIIVGTIAILLGGYVTYKTGSDFQ
FT                   FVKYTPHSPEEIERRKRENQTGISMKMTDELTLDLKPEAKQRIQKLLEEKNKSLEANQN
FT                   DKK"
FT   CDS_pept        145501..146010
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077034"
FT                   /orf_name="CD36_50560"
FT                   /product="Ubiquitin-conjugating enzyme, putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAX41438.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000192D42C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WGZ9"
FT                   /transl_table=12
FT                   /translation="MAALPKRIIKETERLVSDPVPGIIATPSEDNLRYFEVTIIGPNQS
FT                   PYAKGKFKLELYLPDDYPMCAPKVRFLTKIYHPNIDKLGRICLDVLKDNWSPALQIRTI
FT                   LLSIQALLGAPNPDDPLANDVAQDWKSDEKKAIEVAKEWTAKYAIDETEKENNDKDASA
FT                   NKESNQ"
FT   CDS_pept        148402..153552
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568363"
FT                   /orf_name="CD36_50570"
FT                   /product="Probable phospholipid-transporting ATPase,
FT                   putative (Aminophospholipid translocase "
FT                   /EC_number="3.6.3.1"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41439.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG745019"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D42D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH00"
FT                   /transl_table=12
FT                   /translation="MTKNKHNFTLNNSSDGANNNDDPSDHHDYSDDSMPPTPTISTFNK
FT                   FPRQSSLRFKTPLPNDTPRSSSSGSTSNNNNSNSHSHNPRSPFLDENESSFDRKFGYNY
FT                   DKDKLVEEEDENEDEATYVVGEEDENENDNINEMEPSNLKTKRHRWGTTRHKHGRPKNE
FT                   NINRSKTLKKILAPHKSKGKSHSNNSHSLNKRLLSIRKPNTHRVNFPHDNQPPPQDLDF
FT                   EEQNDPKNRKSEKRTITFNRPLPPHLVDPETNKPITSYPRNKIRTTKYTPLSFFPKNIW
FT                   NQFMHNVANIYFLVLIILGAFEIFGVPSPVLAAVPLIVIVIITAIKDAIEDSRRTVTDL
FT                   EVNNQITHILTQVNEDNANGYHYENVNVDDEQVSLWRQFKKWNTRLLIRFWGASKRNLT
FT                   KEGRANKIRERYNRENNIDGDGDQQQGRKSFDSDIMSTRTSFEQTENPFNDTLRQSFQQ
FT                   QRQQQQRQSSSYRHKTMKFAKKYWKNVKVGDVLRIYNNDEIPADLVILATSDEDNCCYV
FT                   ETKNLDGETNLKVKQALKYSSINEKIQKADDLINHDFEIDSEGPHANLYSYQGNLKYTN
FT                   RMNNLQPHDNREDSQEAITINNLLLRGCTLRNTKWAIGIVVFTGDDTKIMLNAGVTPTK
FT                   QSRMSRELNYYVLLNFILLFVICFISGLVNGIYYRSTNTSRDYFEFGTIASTPALNGLV
FT                   GFFVSLILYQSLVPISLYITIEIIKTAQAFFIYSDVGMYYSKLDFPCTPKSWSISDDLG
FT                   QIEYIFSDKTGTLTQNLMEFKKCTINGVSYGKAYTEALAGLRKRMGIDVEIEAVQEREL
FT                   ISRDKEVMIEKLHTINKNKTYDDEITFVSSEFINDLTDSSNNNEQQRESNHHFMLALAL
FT                   CHSVMTEPDPKQPNKLLLKAQSPDEAALVGTARSLGFNFKGTTKTGVIVDIHGVTKEYQ
FT                   VLNTLEFNSTRKRMSSIIKIPGDGPNDEPRALLICKGADSIIYERLSASENDPAMLEKT
FT                   SKHLEEYATEGLRTLCIAERELSWKQYVEWNKRHQAAASSLDDREAKMEAVADSIEREL
FT                   TLLGGTAIEDRLQDGVPDAISLLADAGIKLWVLTGDKVETAINIGFSCNLLGNDMQLLV
FT                   IKTAYNDDENGNNEDNSSDDKNSLQGLKFGHNASEPEIVDTVISYYLRKHFDMTGSFEE
FT                   KEAAVGDHSPPDERFGVVIDGDALKLVLLSPEVKRKFLLLCKKCRAVLCCRVSPAQKAA
FT                   VVKLVKDTLNVMTLAIGDGSNDVAMIQAADVGVGIAGEEGRQAVMSSDYAIGQFRYLAR
FT                   LLLTHGRWSYKRFSEMIPSFFYKNIIFNIALFWYGIYCEFDGTYLFEFTYLMFYNLAFT
FT                   SLPVIFLGIFDQDVEAKVSLLVPQIYRTGITRTEMSDAKFYLYCLDGIYQSAISYFFPY
FT                   LLYMVAFPNMNGKPVDHRFWMGVLVTCIACISCNCYILFHQFRWDWLSSLIVAISILII
FT                   FIWTGLWTVNYQSSGEFYKAAPEIFGMTAFWACMFVGILCCLIPRFFYDFVMRIFWPKD
FT                   IDIIRECVARGDFEAYPFDYDPTDPNRPKISTYSSDVVHRMSMNYPSPPQTQTASTDSN
FT                   GKSPSSSSLDNGHQNRHPNNPNSNGYYEQDNSSGSNMTYDRSIIFERVNDSPINAHHQQ
FT                   PPTPPPGIIASPIRKRKGFVPSMFRNSSDSYIHHSNGHANGSSPGVATEEIPLEDFDDE
FT                   QKRASRISYENQKRVSSMT"
FT   CDS_pept        join(154098..154280,154313..155032,155028..155390,
FT                   155390..155698,155703..156194)
FT                   /pseudo
FT                   /gene_family="HOG000093309" [ FAMILY / ALN / TREE ]
FT   CDS_pept        158005..158910
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568364"
FT                   /orf_name="CD36_50590"
FT                   /product="Major ADP/ATP carrier protein of the
FT                   mitochondrial inner membrane, putative "
FT                   /function="binding"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX41441.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG610399"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D42E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH01"
FT                   /transl_table=12
FT                   /translation="MVDSNFFVDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGR
FT                   LAKRYTGIVDCFKRTAADEGVISFWRGNTANVIRYFPTQALNFAFKDKFKAMFGFKKDE
FT                   NYWKWFAGNLASGGLAGATSLAFVYSLDYARTRLANDAKSSKGDGKREFNGLVDVYKKT
FT                   LASDGIAGLYRGFGPSVIGIVVYRGLYFGLYDSLKPVVLVGPLEGSFLASFLLGWAVTT
FT                   GASTASYPLDTVRRRMMMTSGQAVKYDGALDCFRKVVAAEGVGSLFKGCGANILRGVAG
FT                   AGVISLYDQLQVILFGKKFK"
FT   CDS_pept        join(complement(161369..162301),complement(161194..161367))
FT                   /pseudo
FT                   /gene_family="HOG000200786" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(162796..164586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568365"
FT                   /orf_name="CD36_50610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41443.1"
FT                   /db_xref="HOGENOM:HBG397490"
FT                   /db_xref="UniParc:UPI000192D42F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH02"
FT                   /transl_table=12
FT                   /translation="MATEDINNTSRSKEDDKDDDQVDPLKVINALFNDYDYDPKDTESS
FT                   TDHIYPELMLQESEHGNKYYSCFQSYNRQFINETTTTNSTNSINQHSDIVRWTGSTIEL
FT                   TASIILDNWLNQSSGNGTRSNISNTTATSKRHISRPNALFVWASTDEYIEERKKELRRL
FT                   QKLKDIDQIHAQDKPPQIQNGNNSSKSVDDNKNKNNNATGKSKQDIIKQNLKKKLEIKF
FT                   SNVAINNKLNKIIEIESNKFIHARIQRIKAHYSEQMEKQISERKRKDHELYLKKLKLKE
FT                   EEYEQESSLRSKHSTNSGGTFLGNLFGFNSNTVGGVNNLETTYNNRSSAESSRTMDSTN
FT                   NASITTPSVMTPSSKQKRFPLFSVAGLFGGSSKKNSSKTVLFESNEVNEEEKTETASST
FT                   PPIENDRSVDDPQNDTQPKVVIKQDLESKPLPPQPTDTRSTPDFDQANTNNQHSSQSQT
FT                   TINNFFSIDELEQHIKNSAEPSPSKSNKFNDSMNEGKPTEKGTTNTIEDNNYDEDDEEF
FT                   DDFTSAQPVHNNDITIFQDPPKLNRNFFSIDKAKGSTISKSDNNQINNDLLEIFSPTTT
FT                   SAPVSKSPSPALNELSLLDL"
FT   CDS_pept        164835..165434
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568366"
FT                   /orf_name="CD36_50620"
FT                   /product="Component of the KEOPS telomere regulatory
FT                   complex"
FT                   /protein_id="CAX41444.1"
FT                   /db_xref="HOGENOM:HBG397491"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniParc:UPI000192D430"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH03"
FT                   /transl_table=12
FT                   /translation="MTSEVIKFPQFAEFTIHISLFINISSENITTIKSNLISSTDNHNK
FT                   YDYCFLNTKYIISKEHLFQSIYKSLLNYTSKSGLSTRNLNSEIIYNLSPINNIGDALKR
FT                   FGISEDCPNCIVIKIINNKEEEITKALDRANTDLKEIIDGELIELNDQYIFENFIDLAK
FT                   FRKLYKLNDVADLNKEDNLQGRLTRLAIGACILRGY"
FT   CDS_pept        complement(165476..167623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568367"
FT                   /orf_name="CD36_50630"
FT                   /product="Exodeoxyribonuclease, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX41445.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG397492"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI000192D4DD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH04"
FT                   /transl_table=12
FT                   /translation="MGVNGLLQVLKEIQDPCSLERYRGQTLAIDTYGWLHRALVSCAEE
FT                   LCLGKPTRKYVTAILNKIQMLNHFGITPYFVFDGASLPTKQETNRERQLKRQEAKELAE
FT                   KYIAANNQKLAYKQYMKAAYVTSQMAKSVMCELDNLSIKYIVAPYEADPQMVYLEKMGV
FT                   VDGILSEDSDLLIFGCKKLITKLKDDGTCVEINRDKFDKVKEIPYLNQYNMEQLRLVAM
FT                   LSGCDYTKGVPGIGLRTAFQLVRKYNNFTKVLIALRSMGKKIPDNFIDEVKLANLAFQF
FT                   QKVFDPTNQKLTTLNEYPQNNREVDDYDDETLLENCCGKTFTDEIYQKLCNGKIHPNTH
FT                   EILVSREQSLTVLKSESVYSPNSQQIEKNYNQASNATIAHRSRSEGAICQAGNGKSILD
FT                   LLSISKKVTITNTTTTTANGSQLESCNNDKQMKTPERKLLKRSVKFEEIKLSPTSKKLR
FT                   KLVATATTTTTNDTSAATPSPNVTTSKFFTPKSHPIDKIQPANPTTKENSIKPDWDSSL
FT                   IDDSEITDYDQAHHHESSDKPVDTKNILDDLTDNDNDHEEEEEETNFNKIKLDPIVDLK
FT                   QSPQSDNGFDICSNDDEIEESPIKNRVGTVVGGQEQVRTRLIALKESFSYQSTTTKSTH
FT                   QFLKPDKPNNERKRIPLQPKNINQIQQKSPTKSIKLNRKVDHRHQGYRNNNNVDISKAV
FT                   STVNSRSTIDIRQFAYKKQQT"
FT   CDS_pept        complement(168021..169553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248739" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381249"
FT                   /orf_name="CD36_50640"
FT                   /product="Sorting assembly machinery subunit, putative "
FT                   /protein_id="CAX41446.1"
FT                   /db_xref="HOGENOM:HBG397493"
FT                   /db_xref="UniParc:UPI000192D4DE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH05"
FT                   /transl_table=12
FT                   /translation="MVELQVNTNPDLKSKLIEEQYLQESTNLPIYLTKIEVVGGESFSN
FT                   QFFQNLLSPILQTGDLTFLQLINKIKSSQSKLIETGIFNKVAIQILPDNYYSLSSNKIK
FT                   SYNKEPSLITKILIDLSAINLSNNQGFLNFNNEEYLNLKLNHINHNFNGNGELISIGVD
FT                   YNPYKPLDHLIANGKFISYLKNPKFKFLIDFQLNQENNEVWQDTKQEIIGGKLGLLYGG
FT                   NKATTTTNDLNFFTGFQLLKRNLINLDDGNFDSIKFFNGQFLKSSILNQLKFQKIEFLH
FT                   EQSKNFPKNGYELLFNGEISSNQEQLNVNNRNEFIKTDFSINLYKSLFNEFFTTKFQAQ
FT                   LGGIYSFNNNNNSKVTPIHPSDKFYLGGYNSFPGFTKNSVELQGGDQYYKFQATLYSKI
FT                   PCLLYAPPPPPPPKSASTISLDNEQDLNPLRVYATGIIGNVVNSSKANLLEDENGAVSY
FT                   GFGLKYFNNWANFDIGYYFSKRLGFTNDGNTNTAGIKDGLHFSISIGGSNNN"
FT   CDS_pept        complement(170001..171074)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077035"
FT                   /orf_name="CD36_50650"
FT                   /product="Homoserine kinase, putative "
FT                   /EC_number="2.7.1.39"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41447.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="HOGENOM:HBG646290"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000192D4DF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH06"
FT                   /transl_table=12
FT                   /translation="MSISSFKIKVPASSANIGPGFDVLGIGLELYLTITVTIDPNIDTS
FT                   SDPHHALLSYEGDGKVPFESNENLITQTALYVMRCNGIKDFPRGTHIHVNNPIPLGRGL
FT                   GSSASAIVAGVYLGNEIGNLKLDKYRLLDYCLMIERHPDNIAAAMLGGFIGSYLNELSS
FT                   KDSQLTTVPLEYILPKINQGQIITPQDKIICQPPPVNIGQYVRYNWNKKIKCLTIIPNF
FT                   ELSTDLSRSVLPKNYQLQDIVYNLQRIAILTTALTQDPPSHKLIYQSMKDKLHQPYRFG
FT                   LIPGLNNVLMKITPENYPGLCGICLSGAGPTILCLATDGFEKIANDVIEIFKQEGIECN
FT                   SKLLDLAYDGATVEYRS"
FT   CDS_pept        complement(171449..173035)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000042780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568368"
FT                   /gene_name="ERG11"
FT                   /orf_name="CD36_50660"
FT                   /product="Lanosterol 14-alpha demethylase "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="methyltransferase activity"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAX41448.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG566517"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000069C6D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH07"
FT                   /transl_table=12
FT                   /translation="MAIVETAIDGINYFLSLSVTQQITILLGVPFVYNLIWQYLYSLRK
FT                   DRAPLVFYWIPWFGSAASFGQKPYEFFESCRQKHGDIFSFMLLGKIMTVYLGPKGHEFI
FT                   FNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTESFKRYVPKIR
FT                   EEILDYFVNDESFKLKEKNHGVANIMKTQPEITIFTASRSLFGDDVRKLFDRSFAQLYS
FT                   DLDKGFTPINFVFPNLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPSRDLIDSLL
FT                   THSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFLLHLGEKPHLQDAIYQEVVEL
FT                   LKEKGGDLNDLTYEDLQKLPSVTNTIKETLRMHMPLHSIFRKVKNPLRIPETNYVVPRG
FT                   HYVLVSPGYAHTSERYFDNPNNFDPTRWDTAAAKANSVSFNSSDEVDYGFGKISKGVSS
FT                   PYLPFGGGRHRCIGEQFAYVQLGTILTTFVYNLRWTVEGNRVPDPDYSSMVVLPTEPAR
FT                   IIWEKRETCMF"
FT   CDS_pept        complement(174552..176735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381250"
FT                   /orf_name="CD36_50670"
FT                   /product="Helix-loop-helix DNA binding protein, putative "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41449.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG397494"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000192D4E0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH08"
FT                   /transl_table=12
FT                   /translation="MIFKLNDYNAFLTSLFDKNNEQLQRHQLQNYNQSQNSDTIMTFPN
FT                   SNNNNNNNSNSNMNSNIVDDENNNNNSSSSYHQNGGFPVDFDFGLAPPPFVTDLPHNNN
FT                   SNTNGNSKYFNLPSNGTTTTTNGFQNIDYELPSNTEFIAEIGAYVKDTKSNNNNNNNGR
FT                   NKTDNFSSKNLNNNNSNQRNTTTTTPTKQNNNSNNNDGVVVNDIDQFSRFNAFETNLGD
FT                   PMILEQDEQMNSSNSPMIFNLNDQMGNNFNNEVTRNSQYSNYQQQQQQQQQQQQQQQQQ
FT                   QQQVPQGSVFQDQVSPHSRMGNIPQSMSNHQRIKSNQEFNSNLQSPMSMETSLTSIKSN
FT                   INKNIGSKGSKKSRNSNSIKRSSSSSGSSSVLDYQNSKSLTEQASQITFGTTTTTGTSS
FT                   SSSAVSQGRPTNTPITTTTTTTTTSSSNSNSMLPGSSPISPLNVHTSPLTTTPSTSNAP
FT                   TKSRGRKIKIEPSSSSSTTSTIINEPTNMINHNPHPGRPRIKSAHNVIEQRYRNKINDK
FT                   FNALQNSVPTLRILAQKKQREKLLMQQHQHQQQQHRRNSSIATTSGKNPEYDSSDDEMI
FT                   NINKGLIMNNGGTTSYINTGTIGFNNNNNCGSGGGGNYNDDQLGILQNSSNRLKQSEDY
FT                   DDEFDGLMEIEEQEHEPNDDEEEGQEEEEEEEEEVIDLEGLEPARKLNKGTILAKSIEY
FT                   IKFLEMKNERMKQEHDELVLKARMLGLVIDEDM"
FT   CDS_pept        180491..181798
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568369"
FT                   /orf_name="CD36_50680"
FT                   /product="Arginine N-methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX41450.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG676888"
FT                   /db_xref="InterPro:IPR017408"
FT                   /db_xref="UniParc:UPI000192D4E1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH09"
FT                   /transl_table=12
FT                   /translation="MSELHDLCKFPIRPIDQSYIEKLTQYLKDGIPATYTIEEAYNYIN
FT                   NINIEPTTTTTPLHLICQNAPIDITNDEQKIISQMVEKLFEYGAGWSFTDINNQTPGCI
FT                   LISRRQKIGNEKWMNDVYQQIIDAGVRAELLLRKVNEFEEVEFIDEEEEEEEEEIPQLV
FT                   EDQQETKEEQQLQQQSGDIDDAPDAPSQNQQSYLNTKLEYINDALITKNDKDGVMMAWE
FT                   NDIMKLASDTITSNLDSDDNHDSELNILNIGFGMGIIDNMIQSKLKDHPNAKHYICEAH
FT                   PDVLEKMKLDGWYNKSNVIILEGRWQDKLNELLSSSEQKVPVFFDGIYYDTFSEHYQDM
FT                   LELFDIIVGLLKPNGIFSFFNGLGADRQIIYQVYKNLLIIDLENYGLNCQFKEIEIPIE
FT                   KFWNESKDKSIWDDVKRSYWSCPIYYHPIIKFIDDI"
FT   CDS_pept        complement(181809..182906)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534086"
FT                   /orf_name="CD36_50690"
FT                   /product="RNA polymerase II transcription factor B subunit,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41451.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397495"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000192D4E2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH10"
FT                   /transl_table=12
FT                   /translation="MKYTSITSYNNANANYHIIDDQLKDMCPICKTDKYLSPNMKFLIN
FT                   PECYHKICESCVDRIFSLGPAPCPYPKCGKILRKNKFKQQIFEDLIIEKEIDIRKKVSA
FT                   IYNKTEEDFPEDLSGYNRYLENIEDIIFKLSYSNDKQEIELIESELNKYEQEHKLEILE
FT                   RNMRESQRNDDLMKYKEARERLKQEKLRIQKQMELEDLQYQQEQQQELLDKLTNSSSNS
FT                   EELIKQQQNQMLKRSNLRRKQLQTINNQLDQQFNKSNPFANHDSDDEFNDGSSSSIIPF
FT                   TPFQGDRDLNKGYTMLPVPTDVESIMNIEQNISDSYYDPFINKLAKNKQYLGGGWRLQN
FT                   VFQQALDEAFIGLGCNIELEKANAT"
FT   CDS_pept        complement(183212..184363)
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000159915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568370"
FT                   /orf_name="CD36_50700"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme "
FT                   /EC_number="4.1.1.50"
FT                   /function="adenosylmethionine decarboxylase activity "
FT                   /biological_process="spermidine biosynthetic process "
FT                   /biological_process="spermine biosynthetic process "
FT                   /protein_id="CAX41452.1"
FT                   /db_xref="GO:0004014"
FT                   /db_xref="GO:0006597"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG610629"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="InterPro:IPR018167"
FT                   /db_xref="UniParc:UPI000192D4E3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH11"
FT                   /transl_table=12
FT                   /translation="MVAPALIYSNHELSTAIDSTHAFEGPEKLLEIWFYPSKELSPINL
FT                   RNIKFDTWIKILNLVHCEVLSKVSSTLCDAFLLSESSLFVFPHKIILKTCGTTTTLACL
FT                   DLLFETVTKELQKIYSGDEVVVFSSKEIYQIFYSRRSFMFPDRQIHVHGNWQEEVKLLN
FT                   QYFNNGKSYIVGNNTNWHLYVGGSGKNGKPNGVAPGDAIPAVNDCTLEIIMTQLSLEAS
FT                   QQFYTTRKPGDTAIDENHDLGHDLGQQVLKQTGLNELFKLKEQSPITSNSSPIKEIHDG
FT                   FAFTPCGFSSNSINESDYYTIHVTPEPGWSYASFETNMIGADYKAIVDKCINVFQPGQF
FT                   MVTFLTNTDMQRFECCLDNYKVNHREELDVEDYKLYFVEFIRQ"
FT   CDS_pept        187922..189871
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534087"
FT                   /orf_name="CD36_50710"
FT                   /product="Cell wall protein, putative "
FT                   /protein_id="CAX41453.1"
FT                   /db_xref="HOGENOM:HBG397496"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniParc:UPI000192D4E4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH12"
FT                   /transl_table=12
FT                   /translation="MLFTLSILFPLLFNSIFAIEITQNRVDQGTINTKIGDITIDSGAY
FT                   WSIIDNSISSFIGDLNIKTNAGLYISSTISDLPLLVLLNSGSASITNNGIISLDSRSST
FT                   QGSSQYNLVGESFLNNGEFYLAASGVIPMTMGITGKSWNNNGLIVAYQNQRKSGSVRFG
FT                   VIGQTIINKGQICLINQVLQQTSKIDGSGCITTKENSSIYISNVLDPQSVSSEQNYYLA
FT                   DDKSSIIVEAVGFNSQNFNVFGFGNGNKIGLTLSLKFGAGSGNSGSAYSYDSNTGILSL
FT                   TSGLFGQKFNIGPGYNSSLFSIVTDDSDGIPSVDNGAVTYSGPVPNQKSLPSACNVECK
FT                   QIPDVPDNGPSSSSSSSSGVITTTTSTSTDTTIDTASVSSTSNEESSASESPNNSASNE
FT                   LSTTFEVSQTIGTSEPSASESSEIDISGTTDPDTATSSGNDNSNSLSTFSSNTNSDTIS
FT                   SETGSVSSYSTPSSGDSSEVSSLATGTLPDTITGSQESSTSGFTSGVIESSGVSDNSNS
FT                   VATTATTPNSVDVNTQSNTDNTVTSAITTDTGVNTPITTGTGSGSDNNGVLPTDSNVNS
FT                   NETDNISTLTTSSTTLISVVSSSQPIAEESTLPSSFASGIPGEVIPNANGSSKLSINLS
FT                   FIISGCAIILGLFM"
FT   CDS_pept        190454..190942
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190820" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077036"
FT                   /orf_name="CD36_50720"
FT                   /product="Chromosome transmission fidelity protein,
FT                   putative"
FT                   /protein_id="CAX41454.1"
FT                   /db_xref="HOGENOM:HBG397498"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniParc:UPI000192D4E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH13"
FT                   /transl_table=12
FT                   /translation="MPTATIDCSSVPDILNNNSSAQDDNNNLIFTPYGLMLLEIQGELN
FT                   LPIEFPQGQPKTDEDREYLNNFITINEIHHAVKFGNLVFDEKDNSKVTLYVGKSQRLLG
FT                   NVVKLSTPLAVLKIPLKNEDEMMIDNDDNANQQEEELIKLMDIVKAKVIFKQRPLPIM"
FT   CDS_pept        complement(191077..193080)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228429"
FT                   /orf_name="CD36_50730"
FT                   /product="Putative uncharacterized protein ydl057w
FT                   homologue, putative"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="CAX41455.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG397499"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI000192D4E6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH14"
FT                   /transl_table=12
FT                   /translation="MTASKYHPPTPREVEVTLGKGVTGTLAIPLAFDSDNPFEEGLVPV
FT                   THKAALILHGQGGHRNYCYQKTLAHRLANELGIFSLRIDFRGCGNSADNANELEGRTLT
FT                   QDVEDIQSSVEFICDGKLNGTGIDLTLSSIISHSRGGVAMFLWAQIQDKLGRAGDPNAI
FT                   IVPNLVNCSARFTSPTVLDRYAGLEGLDFVPVTTYRHGSYQQVNLSAREVISLSKPDLS
FT                   KLTELSRDWSVLSVYGTEDEIIPKYDSANFANALNRGPLSHTLKLIPDADHNFYGHKEI
FT                   NADDDELNELNPYNLPLKNGKRVNYNYLVTDYIIDFLTPEMELQRFIATSRDIGRVARW
FT                   KNVDGVSNFRDVGGWRVHAPTFKLLDTKNNNNNNNNNNNKTNQDHLVYYVKPHYAFRCA
FT                   NIAGLTETGLETLQILGIKAIFDLRSDGEVKNDGYPENLSKYGIKRIHAPVFSNDDYSP
FT                   QAIAVRYTNLMTCWSTYVNVYEDMLEFGINAYKTIFEYIRDINQPFVFHCTAGKDRTGM
FT                   LGMLILLLAGVDKNTIAKEYELTTVGLKPDHPVLKGKFEETVKKLREKLGDDGSGGIEQ
FT                   IISQGRKNWSIEEDGFRNLVSSRYEAMLATIGLFHEKYGGIIPYLKDKLGFSSQDILKI
FT                   YQNIVVADPQNMGFETSAQINWDHRTTERAKF"
FT   CDS_pept        193881..194618
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077037"
FT                   /orf_name="CD36_50740"
FT                   /product="Vacuolar-sorting protein, putative "
FT                   /protein_id="CAX41456.1"
FT                   /db_xref="HOGENOM:HBG397278"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="UniParc:UPI000192D4E7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH15"
FT                   /transl_table=12
FT                   /translation="MNHSTTDRDAYLQLGKSLNEQHSNQLSTQLQVFQSALINFANDHG
FT                   DEISSNLEFKNKFTQIVQSIGIDPLDLLLYTSQNNNNSTNKRSNVVTTNFGVALAVKII
FT                   EICQQTRDLNGGLISLKELISTLQSSCETEGISLIISEEDIETSLNNLNSLGKGYEILI
FT                   INGKKWLKFSSTENLSNDQLKIYELCEFMGGYVTYRLLRDNYGWDKVRCKTVIDEMIMN
FT                   GFLWVDSQDNGEWQYWEPSWISN"
FT   CDS_pept        complement(194644..195978)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228430"
FT                   /orf_name="CD36_50750"
FT                   /product="tRNA pseudouridine synthase, putative "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="CAX41457.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG594279"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000192D4E8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH16"
FT                   /transl_table=12
FT                   /translation="MLKGVFFLRQLMLKRSFSKVATSNRPITTNMSTDYSNWSKEDLIA
FT                   KINQLENNPLPISNGEDVSHLRIKPPKKQKKKEFDWSKQNMRFVAFKFAYLGWNYNGLA
FT                   LQGEPTPLPTVEEMFLKALAKVKLIKEPIEEVKFSRCGRTDKGVSAMNQVISIDVRSNL
FT                   SLENQANPEFDDQEIDYISVLNANLPSDIKVHSICLRPPPEFDARFSCLSCHYRYIFRK
FT                   QDLNIDLMNQGANLYQGIHDFRNFCKLDGSKQITNFVREIYQAQILHLHQDYYCFDLKG
FT                   SAFLWHQVRCMVAILFSIGQELESPSIITDLMDMTKYPTKPQYEMAHDIPLVLYDCEFP
FT                   PMEWKSTNDEYRLHRVIQSFTRMQYDLQLKTQMSQIMENTLLFKNQDSATTKILKTMNN
FT                   GDGVGRSYNKYMPISERERTESYEVLNLRWMEKKGYKREQEKLNK"
FT   CDS_pept        196158..198065
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568371"
FT                   /orf_name="CD36_50760"
FT                   /product="ATP-dependent rRNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41458.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D591"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH17"
FT                   /transl_table=12
FT                   /translation="MKSNTESLAWENLRYDLHPWIKEAIASMGYPTMTPVQASTIPLLS
FT                   GNKDVVVEAVTGSGKTLSFVIPVLQKISDRLYKPDSDGDLPEPVKRGHMLSIVLSPTRE
FT                   LANQIQTVFNQVLQYLPEDDNYNNKSRRIGTQLLVGSIGNVRDDLNQFLQNQPHILIGT
FT                   PGRILEFLGSSQSIKTSSLEIVILDEADKLLDFSFEKDVINILKKLPKQRRTGLFSATI
FT                   SSAGNTIFRTGMNNPVKVQVKSKNYLGEQSNSPKSLQLSYMLINPELKITNLLTILSKY
FT                   QYKKAIVYFPTCTSVKHFYQIFNKIYQNHPPATDGEEPLKFFSLHGQLNTKSRLKTLDN
FT                   FTQGDINLYKHILMTTDVAARGIDIPDVDLVIQIDPPTDPNVFLHRCGRTGRANKVGRA
FT                   IVMLNDNSQEEDYIEFMEVKGILLSKQDSIPAVKNFHSDFQKKLRKYMLEDRARHELAV
FT                   KSYVGFIRYYSKHIASSIFRLATLDYLAIAKMYGLLRLPKMPETKYIDNTLMPTDGWLG
FT                   DVIDMDKYSYADKVQEQIRLENLEKDKLQKIQNAKRRKELKIKNEAWSSKLERKENKLD
FT                   RKEKLKRKREAIEKQIMEEALSGDDEGEEEVVEDWKDMVRKNKKKQKNDSSIQGSFDDL
FT                   "
FT   CDS_pept        complement(198127..199737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228431"
FT                   /orf_name="CD36_50770"
FT                   /product="NEDD8-activating enzyme E1 regulatory subunit,
FT                   putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX41459.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG736236"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D592"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH18"
FT                   /transl_table=12
FT                   /translation="MSIDKSAKYDRQLRLWASTGQSNLENSHICLINATSTGSEILKNL
FT                   ILPGIGQFTIIDERKVSKQDLSSNFFLKNQDLHENLAVAVQKNLNELNNDVNGHAIVES
FT                   LSTILAQESNLFWDQFNAVIVSDYTPNLEPLINLLWSKQIPLFIVNTIGFYGSLNIIAN
FT                   ETTVIETHDPSKLYDLRIDHPWPELQEFADSFDLDKLNDIEHAHVPYIIIFIKALDHWR
FT                   LEHDGQVPITYADKKKFRLYVQSLSRNFESETNFIDADTAHLRPHQKTEIPESINQLIS
FT                   ISDSKDLDESTSIFWIFIAALKKFLIINDQLLPLPGTLPDMASDTENYITLQKIYRDRA
FT                   LKDQKLFTEQVYQILDSLGRSRNEVTSESIASFCKNARLLFATVGSKDLINDKLINQYN
FT                   YNPIRDSHHHHRGGGGSGSNITILDDEEKHKLGIYLGILIFNLFIDKYRYKPTIDDFED
FT                   FSNLYHNEFSPKIKLNKDGETIFKEILTHNTTNYHNLNSLMGGIVSQEVLKSTTAQYIP
FT                   LDNLFVFDGVHSKSEKFKI"
FT   CDS_pept        201917..205069
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534088"
FT                   /gene_name="TEF3"
FT                   /orf_name="CD36_50780"
FT                   /product="Translation elongation factor 3 (EF-3), putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="CAX41460.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG325362"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000192D593"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH19"
FT                   /transl_table=12
FT                   /translation="MSAASESKYSTEVLSELLSKLQIADNKDEAASNISTFLNSSIVEH
FT                   DVPVEFFEDLKKQIQSKDAKVAVAALDAYKHIASTNGLSPSVEPYVVDLVGEVASKAGD
FT                   KNKDVQTAASGALLAIASAITPTAVKAILPKLIDNLTNTNKWTEKVAILKAISQLVDTA
FT                   KAQIALRMPELIPVLSESMWDTKKEVKEAATATMTKSTETIDNKDIEKFIPQLISCIAK
FT                   PTEVPETVHLLGATTFVSEVTMATLSIMAPLLSRGLAERDTAIKRKAAVIVDNMCKLVE
FT                   DPQIVAPFMDKLLPGLKNNFANMADPEAREVTQRALNTLRRVGAVGENDSIPEVSTAGD
FT                   IDVTLNEFNKLVADKKIAKRFDAALNYIAAIAGDLVDEREIQPEAWLQNVLPFATIFLH
FT                   EKEAKEIIEEFRKRAIDNIPQPPSFEDEEDEGEDLCNCEFSLAYGAKILLNKTQFRLKR
FT                   NRRYGLCGPNGAGKSTLMRAIANGQVEGFPTQDECKTVYVEHDIDGTHAETTVVEFVIE
FT                   DGEVGLTKDVVVNKLREFAFTDEMINMPIQSLSGGWKMKLALARAVLKNADILLLDEPT
FT                   NHLDTVNVAWLVNYLNTCGITSIIVSHDSGFLDKVTQYIIHYEGFKLRKYKGNLSEFVK
FT                   KCPSAQSYYELGASDLEFRFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTSKPQIQDINF
FT                   QCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYVHENCRIAYIKQHAFAHIDNHL
FT                   DKTPSEYIQWRFQTGEDRETMDRASRQINEEDEQNMNKIFKVEGTPRRIAGIHARRKFK
FT                   NSYEYEISWMLGENVGMKNERWVPMMSVDNTWLPRGELMETHAKLVAEVDMKEALASGQ
FT                   FRPLTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTN
FT                   YLDRDSLGALSKALKAFEGGIVIITHSAEFTKDLTEEVWAVLDGRMTPSGHNWVQGQGS
FT                   GPRLEKKDDDEEDKFDAMGNKIAAAKKKKKLSSAELRKKKKERMKKKKELGDAYVSSDE
FT                   EF"
FT   CDS_pept        join(205385..205580,205657..207689)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568372"
FT                   /orf_name="CD36_50790"
FT                   /product="Meiosis-specific phospholipase, putative "
FT                   /EC_number="3.1.1.-"
FT                   /function="phospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAX41461.1"
FT                   /db_xref="GO:0004620"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG397277"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000192D594"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH20"
FT                   /transl_table=12
FT                   /translation="MLFLLLILPFGFSFNPFKNKNMAQDRLLCKNCSSYFPNQPPWNLS
FT                   YAPFTVICPPGELIRDANNASLCQEESNYITHRNAKTEISLKSLFHRNKIPNFDIETFW
FT                   SIKTKPIQIAISISGGGYRSMLTGAGVVLALDNRYPNSLLCLNGLLQSTSYIAGISGGS
FT                   WLVMSNFINDFEPIHKLKDLISEKWDLEESLLQGVPNFDTSELQKDQQQQQQQNLESKN
FT                   KYKNKKQGMFSSILELFISVKSSSAGNTNGNSQPGFSGWIGSLFNSPQEQPLTKPNQTQ
FT                   TQTTDGYRLIKKYLHFYKELLIEVRDKKKAGFHTSFTDYWGRALVRRIFKSTARTPGAT
FT                   ISAATHVLTSFKEYDQPFPIIGTIEKDPSNPEFSTNLESHCFELTPFEFGSWDSYLHAF
FT                   IPIKYLGTSLKSNVPTKKSTTGNYSYCVSGFDNVGFITGTSSSIFNHVFFSVYKLLESY
FT                   ESDAVSLIETTLKSLGLSSEWKTLKNPKLHADYALYSPNPFFQYGKNNTSIWESPDLYL
FT                   VDGGDDGQNIPFHPFLTAARNVDIILAYDMSNEKDNYPNGTVLARTSQRYKQTNNTKIE
FT                   IPYFRLPDGITTKSLIKSIFPKVPTPKQITTSGLNKHPIFLGCDIVEDYEALEFHDMVP
FT                   RETQIRPQNYLPPLIVYHANNNYSYRSNTSTFQLSYNKTEVYGMINNGYNLATYMNSTL
FT                   FSVCLNCAIIKREFDRLSLRINPKWHDNKFSIPKICKMCYKTFCWRDN"
FT   CDS_pept        208102..208791
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568373"
FT                   /orf_name="CD36_50800"
FT                   /product="Glutaredoxin-like protein, putative "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX41462.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG448201"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000192D595"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH21"
FT                   /transl_table=12
FT                   /translation="MTGVRQLRIIALTAFILGLIFTLHKVGSNAASLVHAQASDQQPNK
FT                   HNTKTSTYTATNEDLVANLIDSKNDAETDDKINQKISKDQDEAINGNKNSNKETTKVKS
FT                   DNGEYDPISDLIKIRSLSPMTIFSKSYCPFSKKIKQLLLEKYDITPAPNVVELDRYEYG
FT                   AELQSYLAEKSGRRTVPNVLVGKSFESRGGCDEFEKLHKDNDLIKLLVEWGSGRLQVAK
FT                   KNTPSNA"
FT   CDS_pept        join(complement(209917..209961),complement(209120..209542))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077038"
FT                   /orf_name="CD36_50810"
FT                   /product="Ribosomal protein, small subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41463.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG750455"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="UniParc:UPI000192D596"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH22"
FT                   /transl_table=12
FT                   /translation="MATELTVQSERAFQKQPHIFTNPKAKANKKTKRWYKDVGLGFKTP
FT                   KAAIDGSYIDKKCPFAGTVSIRGKILTGTVVSTKMHRTIIIRRDYLHYVPKYNRYEKRH
FT                   KNVAAHVSPAFRVEEGDVVTVGQCRPISKTVRFNVLKVAASASKSKKFSKF"
FT   CDS_pept        210619..212064
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247890" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228432"
FT                   /orf_name="CD36_50820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41464.1"
FT                   /db_xref="HOGENOM:HBG448200"
FT                   /db_xref="UniParc:UPI000192D597"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH23"
FT                   /transl_table=12
FT                   /translation="MNLSENYISASRNSSSSTATTSMSNKYSSLPKFNHSHSNQSRVAS
FT                   NNDISTSSIFPYNRTVSSSSSIMSTPSNNIRKFQRQRQQEKRNNEHLPPPSQHQRQTGN
FT                   SKNDPTRTSKNGRLIKNKLLNLQQSSKQQLINRISDKDPGHLHSNNSQSNTKKVTPPVF
FT                   GLQKVASSPYDFSVFTKVITNEKHHDQVLFPAIKQSQIKAWESAEKICRGIIFDNDDEY
FT                   DDEESTEDESEDKKNPIISIPGYTDGELKELFKYPNLSSQEEKKLLTEYKRKVLSLQEQ
FT                   SLSNNNLISFRRQLQIDQKKEILSKLFNNQNKLNLDYITDNDNNNNNIDSYTNRNQYNV
FT                   VDNNLISMDLHSLINNDMEEVNYLLEEDGNFKILQEEVKQNAFHKKIVTDNQHHNDENG
FT                   HGQFDYERFQNLTSKKLDKIYDVHAIRYTGTNVDDDEYKEPSFYSDDVSNLELEEELLQ
FT                   FTTGHLRQRIHESIDEDEITEKS"
FT   CDS_pept        212509..214056
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568374"
FT                   /gene_name="GLR1"
FT                   /orf_name="CD36_50830"
FT                   /product="Glutathione reductase, putative "
FT                   /EC_number="1.8.1.7"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="glutathione-disulfide reductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glutathione metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41465.1"
FT                   /db_xref="GO:0004362"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006749"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000192D598"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH24"
FT                   /transl_table=12
FT                   /translation="MFTKSIISKSTTRLTQLTRQLSTTMAPTLTKNSLKHFDYLVIGGG
FT                   SGGVASARRAAKYGAKVLLIETKFKKLGGTCVNVGCVPKKVMWYTADLAHKKHDLYAYG
FT                   LDKDQESIKYGDFDWAKLKHKRDAYVSRLNGIYENNLKREKVDFAYGFAKFINSDGEVE
FT                   VTLSGDQTLPFLDDGKTYKEGEKLVFSADKTLIATGGTAIVPPSVPGAELGTTSDGFFA
FT                   LEKQPKKVAIVGAGYIGVELSGVFSSLGSETHFFIRGDTVLRNFDEVIQNTVTDYYIDN
FT                   LGINIHKQSTITKIEGSKDSKKVVHLKDGTSVEVDELIWTIGRKSLIDIGLDKVGVKLN
FT                   DKLQIVADEYQVTNNPKIYSLGDVVGKVELTPVAIAAGRRLSNRLFGGPEFAKDKLDYN
FT                   NIPSVIFSHPEAGSIGLSTKEAIEKYGEENLKIYQSKFTAMYYAMMDDQKDKSPTVYKI
FT                   ICAGPEEKVVGLHIVGDSSAEILQGFGVAIKMGATKKDFDNCVAIHPTSAEELVTMT"
FT   CDS_pept        complement(214207..214527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17568375"
FT                   /orf_name="CD36_50840"
FT                   /product="Small nuclear ribonucleoprotein, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX41466.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000192D599"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH25"
FT                   /transl_table=12
FT                   /translation="MSAGIPVRLLNEAQGHIISIELVNGDTYRGKLLENEDNMNLSLYE
FT                   ATITQGKSGKVSHMDQVFIRGSMIRFISVPDILKNAPMFFMKPGDKPKPPIRGPPPKRK
FT                   RV"
FT   CDS_pept        216370..219642
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228433"
FT                   /orf_name="CD36_50850"
FT                   /product="Zinc finger transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41467.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397274"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D59A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH26"
FT                   /transl_table=12
FT                   /translation="MGPIAVKMENSNSFSKQINSPNKVQKPKRQRNRVPVSCLACKKRK
FT                   VKCDKGKPACGGCVRNGVGHLCQYINPPWIDKDVSGEGSSPSSSCHSLSSPVKIETTSE
FT                   YKQLKAQNEKTISNQKKEIENLKRQLQVLQQLSPRNSQSPNGEGQDESALYLAKEITIL
FT                   SKLSPFAVFPRVPMEILSEYTVLNSRVLSFPVCLDIYSWVNTIKLDPQLTTLWFKITNL
FT                   QKMYHMYKINKLKNDSTAKKLASVPLKKTPSKINEIDFTCSFSSSDSQTVEHQAVPLAT
FT                   STSNSHKCPVIECDFNFMGDEAQSQTPSPKKNLTSSTFTPIAQNQDDSEKLQCPMIKSD
FT                   IHNKSKSLQQKLQNLWESILNLTRGSTLNYRQLVFLLDFYFKSEIFESKTLLLFYKTDI
FT                   LNVIQKGLDGELILNLPKGLDEDIYYQLKISGIYVSMIAIIVEETLTYLRNVLKCEVVD
FT                   EITQNFNIVFPQEYTYLGLGAKQTNILYIIEDFLTCDDENINLVSFVALYITVLNKIIY
FT                   EYKKPGGLIVDPKTLFTKLFSKFIENILSSNTDMEIWKDPELIEFQSYQRKRAKHLKLH
FT                   FSLLWTEVIRICNLVSFSFVPIIKQSSELDHLMQKMYAKIAIIDSLQCHLKYLTSVGES
FT                   NLIIALHVHYLIASITSSFHYGILNIGIPKLTVSKLDSLIKQCSTWLQDSGLEGIIEIK
FT                   RMEVVYMLSYLRLFMIYILLLQGEELNDEGLLEMFVFPGIVSRLSQFVEILKNGNHQSQ
FT                   YIYSALIELFTRSIQIAIGLLLRVKNQSGFLKSHQSLLEDQINKITKDVSSTLKFLQTV
FT                   IVNNKEKLIKLSKLWKFYLTFVNNSNSKQVNYAALHKGVPEFSQPKSCPVIHDSDAKST
FT                   AMTSSSSSSVSIKSEGAKCPISHITTSMNENEESTRLQEVGSNVILPPIVSYGNSLVEN
FT                   GVSSNGSGSGVSNQKRRKCPFDHTAMMKRKSIYNNPIESNMREYRSYTPSPLGSSIPIT
FT                   TPMMRQHQQDNDEEMLKPVPSYTPPSNQQIDSAASATSSPSLFAFDDLDVFKEFNDFDL
FT                   DFLHNEHLLNHIENNNTINVKNNVNSNTDSNESKNIENHFQG"
FT   CDS_pept        220059..221852
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077039"
FT                   /orf_name="CD36_50860"
FT                   /product="ABC1 family protein, putative "
FT                   /protein_id="CAX41468.1"
FT                   /db_xref="HOGENOM:HBG324320"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000192D59B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH27"
FT                   /transl_table=12
FT                   /translation="MFRLGPSSGMLRRQINHIPNRSFSIFKNVKSSLGSRIPIIYYKSN
FT                   KLYSISTVSTINSSSKKTKSSSSSSRYGKFFKFGLAIGLGTTILYYTNDSFKHTVLTID
FT                   RVNTVTVAMIRCFALYKETLGASYDNDSDRHKALSKTHKKAAEITLKALEKNGGIYIKL
FT                   GQHITALTYLLPPEWTNTMLPLQDKCPQSSLEEIEKLFENDLGKKMSDIFIDFNPTPVG
FT                   VASLAQVHIATLKNGEKVAVKIQHPSLKEFVPLDVALTKMVFDLMYKVFPEYPLTWLGD
FT                   EMQNSIYVELDFTKEAENARETAEYFKDYQRETALRIPKIVEAQSRILMMEYVSGERLD
FT                   NLKYMEQNNIDPSEVSSCLSHIFNNMIFTPDVSLHCDPHGGNLAIRSVSKSEHNKSGHN
FT                   FEIILYDHGLYRKIPLQMKRDYSHFWLAVLDNDVPNMKKYAMKIANFGEDDQKFRIFMS
FT                   AITGRAPDKALNYDISSRRSNEEIQKIQGQINNDNGVLEDLMDILSNMPRMVLLILKTN
FT                   DLTRNLDENLESSLGPERTFLIMANYCAKCVYDESKEEINQKYRGWSWLTHSISNWWHY
FT                   QKRLSTLYLYDFVLMIRKLTF"
FT   CDS_pept        complement(221949..222377)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569369"
FT                   /orf_name="CD36_50870"
FT                   /product="rRNA processing protein, putative "
FT                   /protein_id="CAX41469.1"
FT                   /db_xref="HOGENOM:HBG397273"
FT                   /db_xref="InterPro:IPR013730"
FT                   /db_xref="UniParc:UPI000192D59C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH28"
FT                   /transl_table=12
FT                   /translation="MPPNTNNSFKSKKKFIDRREAKSQDIKRALTHRARLRKNYFKLLE
FT                   KEGLQEEKKVEDDKDIKPIKKKGINFEERAAIVKQRKDEKRKFQLARVQEKLEKIESNS
FT                   KERALKREQLKKSTTKGQPLMGPRINNLLDKIKKNEMS"
FT   CDS_pept        223045..224556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188354" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381502"
FT                   /orf_name="CD36_50880"
FT                   /product="Vacuolar amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41470.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG447161"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000192D646"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH29"
FT                   /transl_table=12
FT                   /translation="MSVPKTKTASNGYTSVPQGESQTDNLANTESLTNNNQERSIDEYE
FT                   LQTLNSLDYEVENGFEEQLREEEQTGSSTMKMAFMNMANSILGAGIIGQPYAFRNSGLI
FT                   GGILIMILLTVLIDWTLRLIIKNSILSQTKSYQDTVNYCFGVWGKIVLLASICSFAYGG
FT                   CMAFCVIIGDTIPHVLKAFIPESITRSDGPLGWLFARNTIIVLFTTCISYPLSLNRDIS
FT                   KLAKASGFALVGMFIIVVLTIFRAPFVPPNIKGELTVKEWTVNANIFQGISVISFALVC
FT                   HHNTMFIYQSMKNPSLAKFSKLTHISCLVSMIFCMIMAINGLINFGDITKGNILNNFKS
FT                   NDNWINIARFCFGLNMLTTFPLEIFVVRDVLKEIILAKKASIDGSTADLELSSKQHFFI
FT                   TSFLVFSSMSVSLFTCNLGMILELVGATSASLMSYIIPPLCYLKLSWNQVEYKSAMPKE
FT                   KKKFIIFKAIPSIACVLFGFAVMFISSFMTIKNTSSDGGDHCVID"
FT   CDS_pept        complement(224633..228424)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094158" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569370"
FT                   /orf_name="CD36_50890"
FT                   /product="Topoisomerase 1-associated factor, putative "
FT                   /function="isomerase activity"
FT                   /protein_id="CAX41471.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG397272"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="UniParc:UPI000192D647"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH30"
FT                   /transl_table=12
FT                   /translation="MSDFESGSDIDNYYEADEFDDFIEYSDNELEQENSKPATGQSEVE
FT                   EIEEPEEDRIRTLTTTLKPNETQAQKLLKAHISVLVSALGGPDHTSDIQPPPYKLGHDA
FT                   LACLKDIKRWIRAVDEKKNNYEVALACAESGLVSNDLIVILCQWDDKMQKKETIKNKTT
FT                   TEKTMLACLELLVLLTWPVEFGKDLSESQKLLYSEIKKVHVSYKKQILMFNNGQLLKAA
FT                   IRLVLPTIAKSRIDREPRDNQILKLVLFLIRNLLAIEPANMSISNKSRKGANVTASDLP
FT                   LGVTQDDISINNVLSVFKKNKVLMLLLTISGSIGSEFDRDMFGEICLESIYLIIKGLSA
FT                   SDVLVKKNLDSAPVGAPSSTQNRVPDAINASQPLQSVTTTVGMQLQDLLATESKKKKIQ
FT                   TQNIASRHGRFGSLLSIRSADSNSFVVSGQEALINTDSSLAKLDKSKKWKDRTYFKYDS
FT                   DEYVNTTTPVYLNLTGQDILYNFVEQFLSGGCFNNLIECMGSRLTSQTDLNMVDELTLA
FT                   SYFFTIAWFLSYQRERIGLNPQDRELNYGSVGAALSEVNFILIIGYFRDSFSLKKWNSL
FT                   HVAMICFKELLQISNSVFGKEITHQTGEDNGEISQHEIDRELAEGIIRKLFSFNDFLSI
FT                   IVQIPQTAAKHSPNYLRVSVSVVHILLKAFETFANEDVHLYIQSKRKQSKRNRKRVNNL
FT                   DKSTEDRLRDVIYASDEELDQSSAKEITQERKLDFKKTEARFFHQTIVSTYINYLSRYE
FT                   DLSSQEIKTCLSYFHRLFVVRKDFTGLYRLDFMQLLQKLRNHLQRGSSLRLQVEEFIYY
FT                   YMKKFKTAFERFPMPIEVLFPRFEDNECKVYLATGEVYEKQETTSTSRSPRLAKDLEFV
FT                   RDFGLDDQIKILVSQLHVQEKQSLLKWLIQEMERIINDRILNADSIAELNASDQYRRLF
FT                   INNGYLRFLLRIIGFDLPYTVEEVPELATTVDMEHLTKVTELIKKWDSSQPVIFEDDKV
FT                   PSYFVRTREAGYDDDQYNENDQEYDFDDDSIAFETEANPNSNRNHVSELDHLEELERQL
FT                   SSNGSRVNSKEHHGIKGKARKKSKEKKLSTPKNVRGLKRRRIPKDLLEDDSQHVIKSAE
FT                   FVHDSDDESDDEKDKAFFEREERMRSLLNDMGGIATSEQLKEIQEVWKNLETGGTNKVA
FT                   STVAKAVKEVGLFVEESDDDDNAEEINSVPINEETNRAIFEPAETDTQQDLSEDTSNTS
FT                   EMESDTETAKRSFVEDGEEIPHVQSKKKRLVISDDEEE"
FT   CDS_pept        complement(228629..230125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569371"
FT                   /orf_name="CD36_50900"
FT                   /product="Carboxypeptidase Y, putative "
FT                   /EC_number="3.4.16.5"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41472.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG588032"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI000192D648"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH31"
FT                   /transl_table=12
FT                   /translation="MKALLLLYTVITVVLALPSQTPFSLSPLQQLKDELAGKLSQKQIL
FT                   DMEKIWVDYERQYGFDTLLKKFNKFKSRFQYGITSQDKSESVYSISVSKSTPKLLGFDI
FT                   VKQYTGYFNVNDKDENYFFWFFESRNDPKNDPLIIWLNGGPGCSSLCGLALELGPSIIN
FT                   ATLQPEYNPHAWNSNASVLFLDQPANVGFSYGGNIPITSDQASKDFVEFLKLFYERFPE
FT                   YVALDLHISGESYAGHYVPSFANAVHKAGIPLNSILIGNGVTDPVVQLGEVSNMGCGQG
FT                   GIGKIYTDEECTEYPEKYEKFVPYGELCYRNPNVLTCFIAALAAPKTPDMGDLNPYDSR
FT                   VKCGNNSLCYDQIDYLNDYFNLQSVQEALGVEKSYTMCSSNVGSRFVSDFMRPYHTYVA
FT                   DLLDDGIPVLIYVGDKDLVCDWLGNLAWVNKLNYTGHDQFEKAEFKPWYTVDGKLAGEV
FT                   KNHDHFTYLRIYESGHMVPMDQPENSLDMVNRWVRGDFGL"
FT   CDS_pept        230598..231815
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569372"
FT                   /orf_name="CD36_50910"
FT                   /product="Palmitoyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41473.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG397271"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI000192D649"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH32"
FT                   /transl_table=12
FT                   /translation="MIWSKAYLTKNYIKLLVPIGVILVLAYLNYAINYAVGYKLVYLHH
FT                   SHAAAIVLWVLLGFFQLELFVYWGLIFVVGPGKSPVFPPIDLYSENNPNLIPLPDLFFC
FT                   DEKGFPYYCSNSNSIKLERSFFSKDVGYNVVKFDHYCIWIGQPIGQDNYLFFMKFTMSF
FT                   LSFFIIVLVYSARFTRDSIEQGEIDHNLIVLYIMSGFWIIMIGCLFGIHLRYVSINMTT
FT                   LDEITINQRKRYNRWKDAKKNPNMPTWMKPKNTPRKETGRRYVNVKHKNGRAIVKYHIE
FT                   ERPFDMGFRRNWINLVFNGNRNHGRDDEFYTLWRLISALVVFIIPFVDVPFCYRTKLQV
FT                   KNDVEQKLNEQENLLAKYTMYSSVVNDKFINMIDQKLKENNFCALGYLVEATPQNNQSI
FT                   IDKDSI"
FT   CDS_pept        231985..233379
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077280"
FT                   /orf_name="CD36_50920"
FT                   /product="RNA polymerase II-associated protein, putative "
FT                   /protein_id="CAX41474.1"
FT                   /db_xref="HOGENOM:HBG397270"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="UniParc:UPI000192D64A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH33"
FT                   /transl_table=12
FT                   /translation="MMDFIGEIIEHETETPKEPTPKPTLGGFPELKKLKEKKVSRWKQK
FT                   QQQEQQQKTASHKPTETRSEASKIHQENIEKMAQMSEEEILQEREELLKGLDPKLIESL
FT                   IGRSKKREGTGHGHNGHTHEHAEGYHGWIGSMKTSEGLTDLSQLDKEDVDRALGISSLS
FT                   LNESDGNNNSTKKVTFDDNIKTVKFEDLDEGIELDPNGWEDVTDVNELVPNSDHIAPDD
FT                   YQINPDSDDEGLNNTVHFTKPKQPELDINDPDFFDKLHEKYYPDLPKETDKLSWMTQPM
FT                   PKQVSTVYESISDMRFDFKGDLIELSAEGEESKGSSSDIPTYMGLHHHSENPHMAGYTL
FT                   GELAHLARSTLAGQRCLSIQTLGRILHKLGLHKYSILPTTDSGDPSFTDEIKQLSNSFE
FT                   DMMWDLIDQLRIIETITEAADEKKTRNLSVRNYAIEALWLYRTGGGRPETTKQTEEDLI
FT                   AQAVQK"
FT   CDS_pept        join(complement(234484..234526),complement(234208..234416))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569373"
FT                   /orf_name="CD36_50930"
FT                   /product="Protein Sna2 homologue, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41475.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI000192D64B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH34"
FT                   /transl_table=12
FT                   /translation="MDGHDWFLVFVGFFLPPVPVLIKRGFFSADFWINILLCLLGFLPG
FT                   LLHSYYIISIYPYRATYAALGGDGHNNRTDDYGATTST"
FT   CDS_pept        234921..237506
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569374"
FT                   /orf_name="CD36_50940"
FT                   /product="Uncharacterized endoplasmic reticulum membrane
FT                   protein, putative"
FT                   /protein_id="CAX41476.1"
FT                   /db_xref="HOGENOM:HBG397269"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="UniParc:UPI000192D64C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH35"
FT                   /transl_table=12
FT                   /translation="MLSILWLLVSFFLCFSNAVLIDDAFGSRESINYLYGGSLNNIRLL
FT                   KNNILVATNSHDQVLGIDVLNHDLIKWKIEINELEKSNVISTDTHIYVYGSCQDIYQID
FT                   NLGNLEIIELASIPKKLEDAKYGLLIIDSDNSLKYYNGEFHTIGDNASSIRVDQNKGYM
FT                   YLLVNDKNLIKLSKTGQVVFTTEVEVGSIKEFKKGIILTGNDQIFKFDERDKTFKRIEN
FT                   DSFKNLVIVDNDLLYAKLNDVVQLIHITKNQKTELLEVIKLKPEAKVELLTTPLNAFLV
FT                   VSNKNLKQVHDLTDLIDTKDAKSIRQFTFKSTLDFPHEFVSINKDQLNILLINENLVGE
FT                   VYSLFDGSKVESIQPQIHQYSSKASKYIIIDEPESESIKHELESILHEGDGVYVLTNWI
FT                   RRVTRHLSELGKFVSSFNFKNLFASNESIGFVKLIVFYDEEYKKFVAVKSNNFAIAWEL
FT                   PIQDDFITLRQIRNGNIIGIFKSTILEINTADGSIVNETANDSGFFDVFNVEDVLGFEN
FT                   KYGFQLSAAVDTNTFFKKVINDNEVAGFVIPVGSLDSKKTWSFKLDEQIISCQNIPADS
FT                   TTSSLGIPLADKSVLYKYLNPNIISLLTFGKSLKFHLIDGITGNLLYSYTHDPSEIVDL
FT                   QSINLVMDDNWIIYSYFISEPRLEQRINVIDLFDDQFSSNTSTVASLKTIDKISTKSFI
FT                   YPERIVQLQSTRSLYGITLKSIVALTESGSLIEIPKFILNSRRPEHEVKAADYGNDFNM
FT                   VPYDPIVAKTTFQVLNHKYQLNSGSDAGGKGSILVKPTLFESTSVICYFNNENQFCSVI
FT                   QPSSSFDLLNKGFDKIKLLITIVVLFAGFIISKPFVFNKKLNAQWIDRK"
FT   CDS_pept        complement(237540..239546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534332"
FT                   /orf_name="CD36_50950"
FT                   /product="Zinc cluster transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41477.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397268"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D64D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH36"
FT                   /transl_table=12
FT                   /translation="MIMATIPVKNRLKLIIPQPPKGGRILKTCTRCRRHKTKCDAQVTN
FT                   PYPCSHCFKRNLDCTLETISKTGGKITSLDVIEKLSIQVTDLKEVLDNIINRRNQMVEL
FT                   LIQRGKQLESFEDIDSTTTLIQEPEPSKIESPKVYTPPVAEIQSCISTPTLSPEVFPCK
FT                   TDFESPASSSKFIISCNKQFKAITLTHKQALKHFTNYENNFNHYLPIFPHEFFTSLDLV
FT                   AFHKENELLFWCIMLTSLLNQKESYHEYQCLAEHIKYLVVKKCWLNTPRSVYVISSLLI
FT                   LTTWPLPNYKNNIEDNISVKFISTMKSLSYQFGLHKLEFINEFSHKTKMNLSQEINSNN
FT                   LIRERIYKFVNIVSNYWLINLGISNNNYNGFTQDYIINKASNIDIYKMDQFDEPDQYIN
FT                   CMLKISMIQSKLNENMNNLIGDSNESILLLPNQANTSKLINFNMFEIIINDLNKLKLEN
FT                   IDSIHKDLIDISIYYSKLQLFIYSMSHSEISFTEYQIYLSKLLKVCFQIIELINSIPNF
FT                   NLQQMPIFYKFPIELTILTLLRIFKSPMLNTIEDYKIIKYNGFDKLFKLLFNDDNWKFI
FT                   NIKIWKIIEKFNQLDNVFILENQGDSFFLIDKMKNYLVGSLNYELIWLIYKNQKNPTQT
FT                   SHQGKDINLSFYNPHVIDYLKSNESIYISKIAI"
FT   CDS_pept        241171..241797
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534333"
FT                   /orf_name="CD36_50960"
FT                   /product="RNase MRP complex component, putative "
FT                   /protein_id="CAX41478.1"
FT                   /db_xref="HOGENOM:HBG397267"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniParc:UPI000192D64E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH37"
FT                   /transl_table=12
FT                   /translation="MQQAKNSLEKSLPDISSTITSSQPPMQDQSELKATKVSVPKKPLN
FT                   QSESKLIHLFNLAHSKIDSPFSKLYSLLYHKQEEQQTQTLPDPILKKFCLNCGGLLIPG
FT                   LTVSIRVVYTKQKIRKLRTRCLACRYSIFDDGLIQKQEKVEPVVKPVVVQSTKEDNNHN
FT                   ITNLKSKERRKKRKMNNLSNLLQDKKKKKTEESKLNSLNLMEFLK"
FT   CDS_pept        complement(242019..244151)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077281"
FT                   /orf_name="CD36_50970"
FT                   /product="Ferric reductase transmembrane component,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41479.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396930"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000192D64F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH38"
FT                   /transl_table=12
FT                   /translation="MKFIIAYLLVGFLFATTTNAAKPRKYERYGQLKPFYACNYQIGQS
FT                   VSFCQSPKNTTCLCSNENALATFAGCFAFDNRNITQVVDYLVEYCEERGNVTVDKDWYE
FT                   KSYQNFVKNGKTAEEIPNFNKTIPINVPFKLDDTQMQFYQEGYNHFMGNYDDSLYYGVG
FT                   ALGYWLLVMLFGAIFHWSKFLFPNLTKKLTFKPVNLWREYVSMPATFRKKKAEEFRFLK
FT                   IFDSLIPSRFESIVIFFYYVYTIVTHAVNMEALDNDPVFYTKYKAQIRYCADRTGITAT
FT                   IVMPLVFLYAGRNNFLQWLTGWQYQTFVAYHRHTARVMFFLIVIHAVLFTIALADYYST
FT                   DVKETYLIWGIIATVAGGIILVQAMLFFRRRWYEIFLFIHIVLAALWVAGAWIHVEELG
FT                   YIWFVYPTVAVWCFDRAVRIGRLIVFGFPKAQVTLMANETLKVVIPKPRHWKSVPGGHA
FT                   FIHFIRPTCFWQNHPFTFVEAPDGKNILVYCKVKGGITHSLYRYLSNNPGRTASIRVGV
FT                   EGPYGEPTPARYADTAVFVAGGNGIPGIYSEVTDMASRMPKETKTTIKLYWIIREYKSL
FT                   EWFHDELIELENTNIETTIYITKPELCCSSTDDGSDDAGSKKEYVAHEKNAEGDESSQG
FT                   PESIRSRLSHVTFKEGRPCIQDLVETNLHESNGSVAFVSCGHPAMVDELRYFCSKNVDN
FT                   PEKKRVDFYEQVQVWT"
FT   CDS_pept        complement(247103..249235)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381503"
FT                   /orf_name="CD36_50980"
FT                   /product="Ferric reductase transmembrane component,
FT                   putative"
FT                   /EC_number="1.16.1.7"
FT                   /function="electron carrier activity"
FT                   /function="ferric-chelate reductase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41480.1"
FT                   /db_xref="GO:0000293"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG396930"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000192D6FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH39"
FT                   /transl_table=12
FT                   /translation="MNLVITYFFSWIVFGTNVQAAKGAKFQFYGDITNYYACNYQISQT
FT                   VSFCESPTNVTCLCSNKNALATYAGCFAFDNRNKTKALNFLIEYCEEYGNVTVEKDWYE
FT                   KSYQYYLAKAKTEEEIPNFNATIPIDVPFKLDEAETKLYEKAYKQFLGNYDDSLYYGAA
FT                   ALGYWLLIMCIGAIVNWGKVIFPGLTKKLTSKPINIWRQYVSMPATFQKRKAEAAPIFK
FT                   FFDSLIPSRLESIVIFLFYILILIIHAINMHYVDGDPVFNNDKYQSQVRNVADRTGITG
FT                   TIMMPLVFLFASRNNFLQWLTGWNYSTFVTYHRHIARVMFILIALHSILFTILLRTDMS
FT                   EFAETYMIWGVLATVTGGIILFQAMLFFRRRWYEIFLLIHILFAALYVAGTWIHVDELG
FT                   YVWFVYPSVAVWCVDRVVRIARLVVFGFPKAQVTLLADETIKVEIPKPSYWKTIPGGHA
FT                   FIHFLKPTYFWQSHPFTFVESPTDTHIILYCKVKGGITHSLYQLLGRSPGQTTSMRVGV
FT                   EGPYGESTAARYADTAVFIAGGNGIPGIYSEVMDMARRMPSETKKAMKLYWIIRDYKSL
FT                   EWFNDELAVLQRTNIETTIYVTKPDLFSVSTEDGSDDTSSKKESDSQDMNVESKEPLQG
FT                   VDVVKSRFSHITFKEGRPSIENIVDSEIKESNGSIAFVACGHPAMVDETRYFCSRNVDN
FT                   PQKKRVDFYEQVQVWT"
FT   CDS_pept        complement(251228..253093)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569375"
FT                   /orf_name="CD36_50990"
FT                   /product="Peroxisomal integral membrane protein, putative "
FT                   /protein_id="CAX41481.1"
FT                   /db_xref="HOGENOM:HBG397266"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI000192D6FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH40"
FT                   /transl_table=12
FT                   /translation="MEQVSSILGNILSVEEGTTQPHSQSKTSSNRSSIDESSETLSKKP
FT                   QRRSKDFDFSSFWKTSDKEQHDINTANSEGGGEGDSRIVGDKTSKKVPSNLLDPESNAT
FT                   TTPLPAPSSSSSAQYMADKLMEKVISMMISNEVVDEQTSKILQDRIQMQKQRPPLSIAL
FT                   MQNNSNELHRRNSDMYIFIDHVEKFFSWQDPFYTVGWLLIITHLILNPYLFSVLPLIQL
FT                   ITSTMVPHYLMIYPPDGVTNQEYLEVNPKPSDKPLNLYKVPKPVPLFSREFFMNFTDTQ
FT                   NFMTLNIKLFDFTVWLTSDYLYFKNEQITSGIYIICVALIFGNLYLMPYIVPFLLNHFI
FT                   IVQLSFIFNIWAITAILHPYPRGLLLEWIYKEDTRLNFQHFVNKIEDKLTKFIVKTPTL
FT                   EQSITNTNLQHATKDIGSSGDETLEDNDTKYVEIYELQKLNTKNKIWEAVGFTPNFYTT
FT                   NDVTRRYNSVMQELEQNDKSHSHSNEDHHQELHKLPLHKRDTLSEISPPQNYKFIPSEK
FT                   WKIDYDISTWVENNLIQDLVIVDDDEKWAYDVITEVNQDHDEMNGKQLDKAINEMTMDE
FT                   IEKLTDLTKSTEFFRRRRWIRKVTRMNYKDFKEASVPLSSISAWV"
FT   CDS_pept        complement(253569..255017)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569376"
FT                   /orf_name="CD36_51000"
FT                   /product="NAD-dependent histone deacetylase, puytative
FT                   (Member of the sirtuin"
FT                   /EC_number="3.5.1.-"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="CAX41482.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG397265"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000192D6FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH41"
FT                   /transl_table=12
FT                   /translation="MISIDLVDTAGINMPAETSIKLHEVIKFISKSKKMTVLTGAGISC
FT                   NAGIPDFRSSDGLYNMVKAKHPKAVVRGQDLFDISLFRDEISLSVFCTFMESLYKSTLN
FT                   AKPTETHKFIKILKDKNKLLRCYTQNIDCIEKHINLKLGINLQEFDNDKFKKVWNQLDV
FT                   VQLHGNLHKLSCTNCFSQFNWNEEFQTLLANGLNPECSKCMDKYQQRLYSGKRLTGQTI
FT                   GLLRPDIVLYGEHHPQMEILTQGLNSDLKSKPDCLIIMGTSLKVAGVKSLVKSLSKIIH
FT                   NKGGKVIYINKTKLSASSWKNYIDYEVVSDCDEFVRMLKTEIPDLFLTQEQLDSEKLNQ
FT                   VAVKGSGLNNPITTDAVKQEVKVKIEPGVKQETILEHSPETEPTVKQEPMVKQEVENIN
FT                   VKKEPIPTPPTTPHKPKNAAKLKRKSHEEINTDELHSRIKRLRPRNDQLSSPASSMNGS
FT                   EEEEEDELVAKVLLENAKKGITLD"
FT   CDS_pept        complement(256086..257951)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569377"
FT                   /gene_name="SNF1"
FT                   /orf_name="CD36_51010"
FT                   /product="Carbon catabolite derepressing protein kinase,
FT                   putative"
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41483.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000192D6FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH42"
FT                   /transl_table=12
FT                   /translation="MSEQTQPQASNDQQQESQQQQHHHHHHHHHHHHNNENQPQQPVPI
FT                   DPAANPANRIGRYQILKTLGEGSFGKVKLAQHIGTGQKVALKIINRKTLAKSDMQGRVE
FT                   REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEFAGKELFDYIVQRGKMPEDEARRFFQQ
FT                   IIAAVEYCHRHKIVHRDLKPENLLLDDQLNVKIADFGLSNIMTDGNFLKTSCGSPNYAA
FT                   PEVISGKLYAGPEVDVWSAGVILYVMLCGRLPFDDEFIPALFKKISNGVYTLPNYLSAG
FT                   AKHLLTRMLVVNPLNRITIHEIMEDEWFKQDMPDYLLPPDLSKNKNSKIDIDEDVIRAL
FT                   SVTMGYDRDEIINVIEKANKQVATGNSSSQQSKSSNEILDAYLLMKENHALVKDLKKSK
FT                   SENIESFLSQSPPPSPFPNAGSTSSAPGVQQSLTYQTLATVPDLSTLPNSTIAILPTSL
FT                   PSIHRAYMAETKQNGEQVAAPPPTKKSKTRWHFGIRSRSYPLDVMGEIYRALKNLGAEW
FT                   AKPTEEELWTIRVRWKYDTSAQFECGSAPNLMKMQIQLFQLEPNNYLVDFKFDGWESAH
FT                   GSEGTDSPHSHRQQDLDEVGSFSAYPFLHLATRLIMELAVNSQSG"
FT   CDS_pept        complement(258241..258873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248733" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569378"
FT                   /orf_name="CD36_51020"
FT                   /product="PWI domain mRNA processing protein, putative "
FT                   /biological_process="mRNA processing"
FT                   /protein_id="CAX41484.1"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG397264"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="UniParc:UPI000192D6FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH43"
FT                   /transl_table=12
FT                   /translation="MAYRLNPVDEDYVQAKVNKDKQNTTTKLPKIFNKNPNNYSNIKLE
FT                   KFKPWITEEINKQLPDDDIIIDYIYELLQDYGNETGKEFPDILNINLQLTDFLGEKESR
FT                   VFCKQLWSLILEASNEPDGIPTVLKEKKEKPTIVQKEECKSTQKTKTKKTNYNRSSSLV
FT                   SDSNRRPRTIVNREYEHRYTTTAPDYQHRYRSRTERDRDESIYRRRH"
FT   CDS_pept        260098..261186
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248732" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569379"
FT                   /orf_name="CD36_51030"
FT                   /product="Uncharacterized YTH domain-containing protein,
FT                   putative"
FT                   /protein_id="CAX41485.1"
FT                   /db_xref="HOGENOM:HBG448219"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="UniParc:UPI000192D700"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH44"
FT                   /transl_table=12
FT                   /translation="MFDTADSSRHYLVIETPSADYKQEERYNDDNDIIHNSKNYYIPSL
FT                   DDISSISTSASSHGTTFFSNNHSSLNRYGTPRSLSRLRSIESEIDNLPLVFKTNIWSNE
FT                   YSVNHNKTANLFANFTLESGNFACNLTTTACDKSQLSCNDSSYATTSSQVSPVNNIPVI
FT                   AADTNSRSFGSTTPSINTNAVVSGTPYSPPPSCLTFRTYTGAIFTVPKTSKFFVIKSYN
FT                   ILDVNASFIHNIWTSTELGNRRLDKAYTELAKTNNSDVDGKIFLFFSVNSSGKFCGIAE
FT                   MKSAIDFTTASNIWCEQTRWKGIFPVEWLLIKDVPNKFFQHLKIPANDYKPVTNSRDTQ
FT                   EIPFDIGISMLKIVSSFKSNEC"
FT   CDS_pept        261475..262215
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534334"
FT                   /orf_name="CD36_51040"
FT                   /product="Ubiquinone (Coenzyme Q) biosynthesis protein,
FT                   putative"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAX41486.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG656570"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniParc:UPI000192D701"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH45"
FT                   /transl_table=12
FT                   /translation="MLSRSTISSVRQLSSTSALLNKPTKPKSKSPKKKLQKEVTYGPLS
FT                   DAQKAYLDRVIRVDQAGELGANYIYMGQYTVLASKYPHLKPVLHHMWEQEIHHHNTFNE
FT                   LQTKRRVRPSLLTPLWKLGAIGMGMGTALIGKEAAMACTVAVETVIGGHYNQQLRVLSN
FT                   QYGVPIYDKKSGVLLNPDEVEKPAQTSEELTELKNQISEFRDDELEHLNTALDHDAEKA
FT                   VPYMLITEGIKLICRGAIWTAERI"
FT   CDS_pept        262521..263927
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228665"
FT                   /orf_name="CD36_51050"
FT                   /product="Kinetochore protein, putative "
FT                   /biological_process="mitosis"
FT                   /cellular_component="chromosome, centromeric region "
FT                   /protein_id="CAX41487.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="HOGENOM:HBG448218"
FT                   /db_xref="InterPro:IPR005549"
FT                   /db_xref="UniParc:UPI000192D702"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH46"
FT                   /transl_table=12
FT                   /translation="MKYRKDLFPLLDTREITACLLECEFNVTQELIVKPTADFVTNLFE
FT                   QFLDTFMGIPLGTIRKKASKMSWINPLESDQANGKSQQSTEDHNDTPDNDKTKDTFSAL
FT                   QLLTLHRYLAIFFSTCGINDFVLTDIARPDGYRIRRILSAVINFIRFREDQSPKFDHLA
FT                   NECEATADKVSEVQAENTATMQKINAIKEKLEIDSESDESNRKNLQYINSYNRKLENKL
FT                   RELKVMQESLTKEHDDYKQEKALLAKKLYDINFLYNETQEQVANLTKYAETDLSILVKI
FT                   TEDLSNDLTSMQTNYKNLEKNYQNMGITIDSIQVNEINLKDLLKLAEDITRNVEKRQIE
FT                   AKILKDNQDNLDELTRKQMELEGQILIVQNQLNKSNKKYQDLIVQAEKKESAVKLKLEE
FT                   TKREFNDILSEKEKHNEEHKRIMDQIVKIQQETTAIQDAFVKESKEVEIKLINLMSIIK
FT                   RYMSDLRNNI"
FT   CDS_pept        complement(264015..265898)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077282"
FT                   /orf_name="CD36_51060"
FT                   /product="Azole resistance protein, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41488.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG395756"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D703"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH47"
FT                   /transl_table=12
FT                   /translation="MGQRMLCSSSSHTTKLWKTPEQTASLSHDQDEITSPETNTYSPDF
FT                   SSYADNGITNRHVDKEICSYPPFENQTLSESNHEEANSQQYIEADAGDGTKAHEQYLTG
FT                   FPLFLTISSCIISLFLVALDQTIVSTILTTVGNKFNAFEKIGWLTSGFMLPMACLVPSY
FT                   GNISIAFGRKWTLVAGIIIFEIGSLISGISNSMSLLIGGRVIQGIGGGSIQAIVMVILT
FT                   EVVPMNRRSLVFASISVVYSTSSVLGPIIGGALEKITWRWCFYINLPLGGAALAILMFG
FT                   FHPPRPQGNIREKLSKIDFIGFVLLTSGLVLVLLALTFGGTNYSWNSGSIIALFTVGGG
FT                   MLLLFIVWNFRYSANPIILTALIVDWRVLSACLSGMFNFAFFISNLTYLAVYFQVIFNA
FT                   GSLQSGIDLLPMVISVTLASLANSFFIDFTKNVKITMLASGVLSPLGCGLFLLLNEDSS
FT                   IGIRIGLLIISGISIGLQFQSSLLSAQLAVSKDIPGATILVTVFSDFVKNFASTISVTL
FT                   AQLIYQTTGQKYVSEMMTNLSEDSQDYKDLNKYTTAKFISNPEVVQELPNSAKSLVLRQ
FT                   LMKALKNVFYLGLGLAILCFITSLFTTNKRIPKNVEIKKNEDQESNKNEPN"
FT   CDS_pept        complement(266432..268813)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094161" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381504"
FT                   /orf_name="CD36_51070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41489.1"
FT                   /db_xref="HOGENOM:HBG397263"
FT                   /db_xref="UniParc:UPI000192D704"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH48"
FT                   /transl_table=12
FT                   /translation="MQELSFIIHLPSEIIYQILQYLSQNILLELITVPFLNQYVTSYLY
FT                   PICLIDSRATDFKPNPKIKLFKTITAFMKFQKLHNYSPQRLILNNNRGINKVVENNHWC
FT                   SPYKLELVDNLELINTRNVVKVTFSSSFSQPIQEIPYQITELNILGDKLNLVHSNIQIL
FT                   EINQFDLRYMELLPESIKDLKLLEFKLPSSIPSSGVKFPINLTHLTIVEGQRSLRSVNF
FT                   QSLLFLKSLNYKGNLKLSTSQLTSMQDLQLPESIEKVCLRCLNIVSLQNISNLKCLTHL
FT                   EIIDFPKLFTFFDTRFPSGLKKLIYKFDTVVPNLSYFQNQMVLNFDSSRLVRETTTANM
FT                   IFLKIDERFQIPDNLKVLILENIPYVKISKSIKIPDTLNELIIRKLPGVVPSSNFNMTL
FT                   PNLTLYRLTLSNMMLDSLEGMKFPEKLSFLDLSRNQLQHIHGTNLYNLKYLRDLNLSRN
FT                   RFERFIDIENDIPSGLEILHLQSNLINQFEIKDNNIRLMQLNLMLVKNGRYSNELFKFP
FT                   TKLRYLQLSIQVDKLSDNFQLPANLQSLQIHHPYYGKIVTFRNFFQNVSNLQLTQLSLL
FT                   NLTFTKDCLIKIPSTIERLTIAGNFNQHIINNLNLQNCKSLTSLSLSGGSVNYFNLNNI
FT                   PSQNLEQLELKNMKLKYINGNFNEFRHLEYLNLEQNQITNESNNTITTTTTATNCGGKT
FT                   KNSLNLPSSINTLILNKNDLNDLSNVFLDNCRYLRKIYLEMNPNLDSRVILKIAKLLMQ
FT                   ISDNFVGIYLSSNLIFSSNLFLENYEVYSKIIFNTDFIDG"
FT   CDS_pept        complement(269385..271838)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228666"
FT                   /gene_name="GPR1"
FT                   /orf_name="CD36_51080"
FT                   /product="Plasma membrane G-protein coupled receptor
FT                   (GPCR), putative"
FT                   /function="receptor activity"
FT                   /protein_id="CAX41490.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="HOGENOM:HBG448216"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniParc:UPI000192D705"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH49"
FT                   /transl_table=12
FT                   /translation="MPDLISIATSITTAFIPTSTPTIIPTTITTIATSVSAATETVTTI
FT                   IKDTNDSTTASILSTMFNDIILPTIFKRENFTRDHMANQLGEFTDHQARVQRIVAISSS
FT                   CGSIAAVLIAMYFLFAIDPKRIVFRHQLIFFLLFFDLLKACILLLYPTRILTHSSAYYN
FT                   HNFCQVVGFFTATAIEGADIAIFAFAFHTYLLIFKPSFNTKVKNSNRVEGGLYKFRYYV
FT                   YSLSFFVPLIIASLAFIHSDGYDSLVCWCYLPMRPVWLRLVLSWVPRYCIVVGIFAIYG
FT                   LIYFRVISEFKTLGGVFKNAAGNGGAGNHHLASNSNPTFFSSLKYFFMSMKDQWFPSMP
FT                   SDTLAPISSRHSHSHNGTGEITSPRQNGIGEITNDNDNDDDDNDDDSEELAEALEDESV
FT                   DYQDIELNKQNSRNSYRQHNSDIQQANLENFRRRQRIIQKQMKSIFIYPFAYCLVWLFP
FT                   FILQATQFNYEEDHHAVYWLNVLGAFSQPLNGFVDTLVFFYRERPWRNTAMKNFEKENR
FT                   QRVDNIIVNNLEQRKYSEGAESAQSVATASKRIAKNSLSASSGLVNINIYKPWRQFMNK
FT                   YRFPFYQLPTEKNIAKSQDRYIKHKLMDSRKLDKLVQEVTRDRQDLSFPSNIAEKYGDG
FT                   SGGNHGGSTLSNTNDSSPMSMGAGINWTEPTNAHDFSNILHSGSGSPNVFSWDTKDVPG
FT                   FKPNFGRFSFGTRTSNLSSRKSSTVIGLQGTGRNVRQPSNDSFNDPVRSLGGRRNSSFA
FT                   MGANTILNKPYEIVSSPTSSTVTPIDRERSNDIDELPTVGSNSDKADDDGELDLMEFLK
FT                   KGPPM"
FT   CDS_pept        complement(274115..275545)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381505"
FT                   /gene_name="IPC1"
FT                   /orf_name="CD36_51090"
FT                   /product="Inositolphosphorylceramide synthase, putative "
FT                   /function="transferase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41491.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397262"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000192D7BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH50"
FT                   /transl_table=12
FT                   /translation="MASAILRSRIIQKPYQLFHYYFLSEKAPGSTVSDLNFDTNIQTSL
FT                   RKLKHHHWTVGEIFHYGFLISILFFVFVVFPASFLIKLPIILAFATCFLIPLTSQFFLP
FT                   ALPVFTWLALYFTCAKIPQEWKPAITVKVLPAMETILYGDNLSNVLATITTGVLDILAW
FT                   LPYGIIHFSFPFVLAAIIFLFGPPTSLRSFGFAFGYMNLFGVLIQMVFPAAPPWYKNLH
FT                   GLEPANYSMHGSPGGLGRIDKLLGIDMYTTGFSNSSIIFGAFPSLHSGCCIMEMLFLCW
FT                   LFPRFKFVWVTYASWLWWSTMYLTHHYFVDLIGGAMLSLTVFEFTKYKYLPKNKEGNFC
FT                   RWSYTEIEKIDIQEIDPLSYNYIPVNNDDNNNNDIENRLYTRVYQESQVSPPSRASTPE
FT                   AFEMSNFSRSRQSSKTQVALSNLTNNDQVSGINVEDEEEEGDEISSSTPSVFEDEPQGS
FT                   TYAASSATSVDDLDSKRS"
FT   CDS_pept        277086..277985
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000283048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534335"
FT                   /orf_name="CD36_51100"
FT                   /product="Glucose-6-phosphate 1-epimerase, putative "
FT                   /function="carbohydrate binding"
FT                   /function="isomerase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41492.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG737737"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI000192D7BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH51"
FT                   /transl_table=12
FT                   /translation="MPVEELEDRVIITDPTDPTNRATILKFGATVVSWKNNNEEKLWLS
FT                   EGAHLDGSKAVRGGIPLVFPVFGKQKDSTHPTFKLPQHGFARNSTWEFLGQTQESPITV
FT                   QFGLGPENVDPETLKLWNYDFTLILTVSLTKDNLVTSIDIENTGKEAFEFNWLFHTYYR
FT                   IHDITDTLVTNLIDQQCYDQLIGESYIEKAPVISFHEEFDRIYSKVNLEKSIQIVDKGK
FT                   VLFNLHRKNLPDSVVWNPWTKKAEGMADFQPKSGFHQMVCVEPGHVDSMISLPAGGKWS
FT                   GGQEITIGGDIKVQANIY"
FT   CDS_pept        complement(278096..279400)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381506"
FT                   /orf_name="CD36_51110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41493.1"
FT                   /db_xref="HOGENOM:HBG448193"
FT                   /db_xref="UniParc:UPI000192D7BD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH52"
FT                   /transl_table=12
FT                   /translation="MESSTNYPIVSMNTPIKKIRDLTLNSPSSRHQLDLHSHGTSAFNN
FT                   NNSNSNSIYPSLDDIQTSPTAAAMLQKGYSQKITNNVLSELNSRAQQLLGSPPQISQSN
FT                   DYSSNDSSSNNVLNRRNKRYSTIHMNKFTQMDSINQHYSVHMKTPSPQKSESPSSGEVE
FT                   ESATKRRRTLNGSDQIVAVPVMQKEPTVENNSSPNRKISPSKGSRDLNSILRRKTTETG
FT                   SPNKEAFARPYPPSNKLRQSSLEMAGVIHASSPSQHQQKLGDPPCLYKKRSIPQLQKKS
FT                   SHPTLNRKSSIPTLNKKSSIPSLQKKSSIPNFSGSPSPNMSSMYFAHSPVNDMPPPPPP
FT                   HGSHLPALNKKPSFTQTNKNTPRLTRISPSKSIPSSVSSKSVDSRALQNSTNLPTMIKS
FT                   KSVTIPQPFSLYDKPTVSSSLKSLNKFQRFKDKLS"
FT   mobile_element  complement(279705..285984)
FT                   /mobile_element_type="retrotransposon: kotuku F, Tcd32,
FT                   LTR"
FT   CDS_pept        complement(280030..284601)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534336"
FT                   /orf_name="CD36_51120"
FT                   /product="Retrotransposon polyprotein, putative "
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAX41494.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="HOGENOM:HBG398448"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000192D7BE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH53"
FT                   /transl_table=12
FT                   /translation="MLSYFISNIQSQALKSDFVDYDPMSLKYDSGASRTVVGNKKLLSN
FT                   YDSEAQQIFELPNGQKIRSHGSGDLVINVNHHELVLKDAHYIPGFKINLVSCGQITAQG
FT                   YDVILSHKMLLCVNFNEKHVIFAKQSLNTNLFTGPSRGKVYSNGKMFMDNNSFIEDEGE
FT                   RKGYLNSINAMTKIVDPRIDQVVANPDGRKDLYYYHLITGHMSIRSLIRLHEQGRIKCS
FT                   IDDQDAKDQIKGCKQCILVNAKQHSHNKTTQSPPERSLYRFHCDTMGPYHVGHVKYYIT
FT                   LITDHYSGFSFTIVKTEKRFTKEILDLFEHLHADLYPKKIARFRSDNAKEFPTEAELGT
FT                   LKIKKEVLPPYSPEMNGMAESHNNVLKRRMLYVVLNFPNRYKELLIFFCEIVAYAVFIK
FT                   NHTPSERVETHKGWTPHELFYGRRYRPNYHQFGVDVFVILSNKQEADALGVQFIKGFHR
FT                   GVPGIFLGYGNDSNVYLIQLVDGNYTRRLFVNVRFLGSMNNINTFLDTFGEKMRKNMDE
FT                   SGNFPFFEDSSRNELLNGRYVPYEDHLPTQGTSSQDVSSDRPTTIEPTATNINMDELIA
FT                   EVPDEFLQNNIAGDFLTQQGFTFPSLQVTGKLLEHQSGQSLAPYNWMSKDNMEYSKMGS
FT                   DHKYLGQNDTENIEPNKNKQVHISEPSFQSSMANKPNESDLGVLPTADGIRHGVPNARG
FT                   ETTQDGTVSSNIDMHQPYSTIPTHRPPPPVGKNVQFSGVNNDSTTLLPSEWGLPPQQHL
FT                   SNGGAYESSPVSNVTTSVRLSASTMNIDVGNKNSIKRTKIDRHPLLPNKETVNEISVRI
FT                   EALKNEHNLNKTLDTIADSYLFTRTSELKNENMAYYKGNGRVSKPPMLLNNLKIIDELI
FT                   PPTKHISSIEARLETSTGDLNDIENDIDLSVYGVEKYVDYTDENWRRSMDNEMKKFKEM
FT                   NVYQVVKKKKNFRMIPAKWVHSYKPNDPKGEFFRSRCVVQGFRQIPGLDFDKNCVSSPV
FT                   TDLTTIRVLTAIAVESKAQIHHIDIKSAYLNATLPKDTPIFVKPPPGYDDGIHCWRLVK
FT                   AVYGLKQSGFEWHSHVSKTFKKMGLYQCENVEGLFMLEKGNEKIYIALYVDDLFVVASS
FT                   NQFFNKFMDDLEAKFSLNYIGEISEYLGIEFQKNAFGYELHQNKFVKRLIEAFPTEIMK
FT                   GADLPRTPDNIFKNGKYKIIDDNTGKPLKNQKDIPIPDEYIYEDSNSPRLDKEHHDLYR
FT                   SIVGMLLWLTNNTMPSISYGTNALAAKCHEPTENDYKHLMQMIKYLYKNNNERLIMRRN
FT                   QTKDISEDSHVIYAYSDASFAADLDRHSVSGFAIYLNGNLVSWGTKKQRSITKSSMACE
FT                   LIALGETVDRSMIIRQIVQSIGYSAPKIIIFEDNQPVIMNSYNRKSSAIRRSVDICLKT
FT                   IRQLILEYKLLSVVYINTKLNVADLLTKAVNNNTMKTLKPLLYDKGNLDGVRKLIKDNF
FT                   TSHRPVEMGQHSLVYNIITPTEEIKESYYVAPNNVQSKVESRNNKHPEISGGIARIKRL
FT                   SMP"
FT   CDS_pept        complement(284626..285429)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569380"
FT                   /orf_name="CD36_51130"
FT                   /product="Hypothetical transposable element protein "
FT                   /protein_id="CAX41495.1"
FT                   /db_xref="HOGENOM:HBG398447"
FT                   /db_xref="UniParc:UPI000192D7BF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH54"
FT                   /transl_table=12
FT                   /translation="MRDMNVNYTNDAEKNFIAEHIKSIQNSIVKAIISRILFKAKAPET
FT                   LEEMIDYYEKLCKKVAPELLFSYFERLVSHYLSVDEPKLTAPTTLMNRLRSPGQLILNE
FT                   SIARFCSHLNSGIVTQFQMFYKYKAIAMRYCGYIVGQMNDVRNGKPFDYDRLTNEIDLD
FT                   PVIEQTVTERHKEEIARIKSNNSVQNSVNSMYNTHQNNNNSNYYNNNDKNNKNNKNYKN
FT                   NKNKNNKNNYNKKGKVSKVSNETSDYEKLKRDLVRMMDDLRKEKE"
FT   CDS_pept        complement(286356..288437)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569381"
FT                   /orf_name="CD36_51140"
FT                   /product="Dynamin-like GTPase required for vacuolar protein
FT                   sorting, putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAX41496.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000192D7C0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH55"
FT                   /transl_table=12
FT                   /translation="MDETLIATINKLQDALAPLGGGSSSPVDLPQITVVGSQSSGKSSV
FT                   LENVVGRDFLPRGTGIVTRRPLVLQLINRRPSKDSKKASDLIDVNSSESTGGQSENNAD
FT                   EWGEFLHLPGKKFFNFEDIRNEIVRETDAKTGKNLGISPVPINLRIYSPHVLTLTLVDL
FT                   PGLTKVPVGDQPKDIERQIKDMIMKFISKPNAIILSVNAANTDLANSDGLKLAREVDPE
FT                   GARTIGVLTKVDLMDQGTDVIDILAGRVIPLRFGYVPVINRGQKDIEAKKTIRDALKDE
FT                   RNFFENHPSYRAKAQFCGTPYLAKKLNGILLHHIKSTLPDIKMRIEHSLKKYQQELAML
FT                   GPEMAESPASIALSMITNFTKDYTGILDGESNELSSQELSGGARISFVFHEIFKNGINA
FT                   IDPFDQIKDADIRTIMHNTSGSAPSLFVGTQAFEVLVRQQIKRLEEPSVRCINLIFDEL
FT                   VRILSQIISQPQYSRYPGLKEQLSQNFILYLRDLLVPTTEFVNDIIQAEETYVNTAHPD
FT                   LLKGTQAMSIVEEKFHPKPQVAVDPKTGKPLPPSQQPAQATSPKPEDGTSNGFFGGFFS
FT                   SKNKKRLQQMEAPPPVLRATGTMSERETMETEVIKLLISSYYNIVKRTVSDVVPKAIML
FT                   KLINKSKDEIQKTLLEKLYSSPDLDDLVKENELTVQKRKECVRMVEVLRNASEIVSSV"
FT   CDS_pept        complement(288786..289256)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381507"
FT                   /orf_name="CD36_51150"
FT                   /product="Phosphatase, putative"
FT                   /protein_id="CAX41497.1"
FT                   /db_xref="HOGENOM:HBG397260"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniParc:UPI000192D7C1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH56"
FT                   /transl_table=12
FT                   /translation="MIQYIKGDLFTHTIPAGKKVILAHACNTHGSWGGGIAAVFRKRFP
FT                   KANNKYSQYCHKNTNLLGTSFIIESDQPSILIACLFTSDFNQTPEQIVNFTKQSIADLA
FT                   RKVSDNQEVERSDGKVVINMPKINAGIFGVPWEDTEQALQGFDNLHFNVYVI"
FT   CDS_pept        complement(289349..290464)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569382"
FT                   /orf_name="CD36_51160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41498.1"
FT                   /db_xref="HOGENOM:HBG398537"
FT                   /db_xref="UniParc:UPI000192D7C2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH57"
FT                   /transl_table=12
FT                   /translation="MMIRLFPRQIRSLSYLTKTTINPVDFQLKIPEQFVPKSLLVLSTP
FT                   TNLPQVIEDSIKLYQKRDLQLVVAGVDTVVPYSHRNGVSELWLDEPISIGDSVLLEEKD
FT                   DINKPPRESDGLNVVSAQKHWKNIPSQLKINLRQEMELKLNLANTVFSTGSIITLFYFG
FT                   NGSNSGQHLCDLQISFPRGLIPRHSSAVIKDNWTDLYPGAGFKITNCVGNLVKSIDNNP
FT                   AAKYLEENKKLMSIGSKETEVYVKIKKPNSTRVERFKVTAGGGGWGAKADIIALSPEAK
FT                   LVKGSEIQFFMVTPEDRYLPNHNDDEIAQFINAFTFTNSYEETNYNDNTDENQHIYENI
FT                   FGGGSEQGFFFNDIKHHSPGESVSIKLEKKK"
FT   CDS_pept        complement(290604..291764)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176412" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569383"
FT                   /orf_name="CD36_51170"
FT                   /product="tRNA pseudouridine synthase, putative "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="CAX41499.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000192D7C3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH58"
FT                   /transl_table=12
FT                   /translation="MNGVFAVYKPSGITSAKFIETIQSKFTKSEVFAKDLQEMKDKIRS
FT                   DLSRDRKWKPHKIEKKIASTKVKIGHGGTLDPLASGILVVGVGLGTKKLQYYLAECQKT
FT                   YETKALLGISTTTGDSEGEIVSKNKIDHITSELIDSTVEKFIGDIKQTPPIFSALKVNG
FT                   KPLYEYARQGLPLPTNIKVRDVTVNSITVIKEDSLKTDHEFTKLESELDENGVPKEHGL
FT                   KDNPTLNDSPLFFSKQYLEKAEKEGLPKETGKPKLLPDDESLPEKLPMIHFISDVSSGT
FT                   YIRSLISDIGRAMESSAYMVELIRTKQSEWELGKNVFRLEDFEKDERIWGPVLKKVFEK
FT                   GGSEIQDLNKEFEEMSKTLESSVKKENKDSTSETIPQKRSIDEVEK"
FT   CDS_pept        join(complement(292051..292677),complement(291901..291954))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569384"
FT                   /orf_name="CD36_51180"
FT                   /product="Palmitoyltransferase subunit, putative "
FT                   /function="transferase activity"
FT                   /protein_id="CAX41500.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397257"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniParc:UPI000192D7C4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH59"
FT                   /transl_table=12
FT                   /translation="MNETKTDSSVIPDQSIQELVFFNYHEYLVPGSDDTSLVINHFPNT
FT                   HTVLSSSSFNETRIIRIPRVYHTVQFPDLIPQFSSYYPGTEPGAITSTQSTSGSFEGNN
FT                   FNESSSIPSLEGIISKNEFENIVNLVNESLVVAFNPMSKRILLENLLDLLSGGLFVGLL
FT                   NLLGIYSFTKRKLIDLENQINSINQINEKKGVDFKIISPRVTGYLSVNVKEYMKNLYWA
FT                   TMWW"
FT   CDS_pept        293689..295920
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077283"
FT                   /orf_name="CD36_51190"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="CAX41501.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397256"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192D7C5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH60"
FT                   /transl_table=12
FT                   /translation="MIPLRQIVGRTVKSSALQIRNATKAGTMALRYQSTTTTTNTATPT
FT                   PDHASSKTSSESVQTEKSTVSKPTQKGNQDKKPLPRRTPVNPKLRDISGQIKETILQSS
FT                   TDLNEAYSILEEGITFLREIQKSENITDRQIFREFYPLATELFVLAQKPETTIDHSLNE
FT                   ILDMFVKNKIAHSIHFTSLAANTLKQNIEAYEEVLQYWLKSFEYTKSHDFLYVDNFNGV
FT                   KTKIEYQPYDLTNLAIYAYVQSCIAQKVAYSPVDAARFSPTGKVPPFYHIKKTLEVLDI
FT                   YDPNKFREYCNLLQTDSQERFNPNGAGSIKKIENTPDKKQLDKFYQNVVDICNKRNIKI
FT                   DEKVIVALMQRYFQFDEYNEVFSLFETIMNSGVKPSINAWNIVIKAMTNPSRIASFGGK
FT                   AKQQELLQNFERTLQTIVSSGVQFNGETIGAIVSGYANFGRFEKAQEYIDKYAQGVKDN
FT                   GDIISLCNDGILRGLVYNGKIEEAESKLKQFMEAYPQYKPHTHVMNDFLNYYAKKKNYK
FT                   AINGITNFMKKHNIAENVSIKTTMINAYFESLHAIGKTPDLSSFLAKMESSENAGKRGF
FT                   NEQMHSTLLKGLIQGANIEAARQLFDILKSRYPRSAWLNTNMMIGELTLGNVKLGEDIF
FT                   NHYIKEIRNEPIIWNTFIHNLLSRDEKLADFYFEKMKQDSQVQPNYYTYYFMLQHYRRK
FT                   AKKDRLQQLVNELAEVDWTSYGTSLPDFIKKLTNYLDVPALLLSKLDKQ"
FT   CDS_pept        complement(296087..296881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077284"
FT                   /gene_name="CYC3"
FT                   /orf_name="CD36_51200"
FT                   /product="Cytochrome c heme lyase, putative "
FT                   /EC_number="4.4.1.17"
FT                   /function="holocytochrome-c synthase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX41502.1"
FT                   /db_xref="GO:0004408"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG627179"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniParc:UPI000192D7C6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH61"
FT                   /transl_table=12
FT                   /translation="MGWFWADKSSQNTVKASNSFTTASACPIDHSKLSTSSPTCPVKLN
FT                   NDNDEVLNPMNNMPMAISSERAPGQRIKLSTERTISTIPRGESEDQGLWEYPSPQQMLN
FT                   AMLQKGKGDGIPEDAVESMVEVHNFLNEGAWQQILTWEDHYTQQTKVEPRLKKFTGRPH
FT                   DLSPKARMYLWLGQLFPETFNTIPPFDRHDWTVLRSCGRNQGWKEVRYVIDYYGAPDDE
FT                   ETGMPAFMLDTRPALDNFTNARDRFTHWAYPLWKKAMGEVRD"
FT   CDS_pept        complement(304544..305500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569385"
FT                   /orf_name="CD36_51210"
FT                   /product="Cysteine protease, putative (Member of the
FT                   ovarian tumor-like"
FT                   /function="peptidase activity"
FT                   /protein_id="CAX41503.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG397518"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI000192D7C7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH62"
FT                   /transl_table=12
FT                   /translation="MSEPEQQPLVTTREELIQRHKKESKDLIATITGLKKQATKKTRKS
FT                   VLNKCQELQDNLDQKHRQELKEFDNPHGDQNEEDGEEITPEQLLAQLSLDKESSTIENS
FT                   NSGSIGGGGDSDSSKPRKKRNRQRERLNRRQAEIDKIKQEAAVEASNTIDYRQIEIESM
FT                   EKLLSLNNLQSFEIKPDGHCLFASIQDQLKVRHHEVDHSQHNGPENIPSIDQLRKLAGD
FT                   YIKSNQDDFIPFLIDENTGELRDLDDYINELTTTATWGSDMEILALSKVFNCPISIYMA
FT                   GASTLTINEHGQLPELKLGYYKHSFGLGEHYNSLRDL"
FT   CDS_pept        313604..315043
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569386"
FT                   /gene_name="CLN2"
FT                   /orf_name="CD36_51220"
FT                   /product="G1/S-specific cyclin, putative "
FT                   /protein_id="CAX41504.1"
FT                   /db_xref="HOGENOM:HBG397517"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="UniParc:UPI000192D887"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH63"
FT                   /transl_table=12
FT                   /translation="MFPNSPDAFHQVRMMQSSIKASNFKLQSMEFKCHSYNVCEYQMEM
FT                   LHHLLTVEAKTLPSLSLIEQQPEIKLGMRPLLLDFLMEVITILNLSRSTFPLTVNLIDR
FT                   YCSTRIVKKQHYQLLGLTSLWISCKNLDSKFKVPTLNDLRKICVDSYYKELFVEMEKHI
FT                   LKSLEWVVNAPTFDAFIDLYSNLLISNSSNVEVANIVKKSSHKIKLFSNYIGELFQFYP
FT                   NIYYDYTSSQIALIAILITVLTLKIPVDLISLLNFYNGLVKTDMFKSNIEQGSDNEFEE
FT                   ILSVESFKSLFNKSFFKNLIKIIDNPPSSLKIKYFADNGKYSVLMKQLVTTATNTLKCM
FT                   LDPVPTTPKANSFVKQQHHHHHNQQQQQQQQQQQQHYCPRPPMSINTSMIPLTPVSNST
FT                   SPNRFSPDQIFSENESTPGIAFGTMTPDSQSTSPGEKRSYECIDELEIGTSTITSYTSK
FT                   NHDTLKRSKSANYGTLFYLQQ"
FT   CDS_pept        324139..325989
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569387"
FT                   /orf_name="CD36_51230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41505.1"
FT                   /db_xref="HOGENOM:HBG397516"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000192D888"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH64"
FT                   /transl_table=12
FT                   /translation="MDSNNTKRQKTGNHYSNYTITSNNEKIDIITDISNLSSEKFFNNY
FT                   ISIRKPVKFNIPINQQIIQLNKFKINNLINTLNYNNNNTDNTNNDDDENFLLVEKKYQN
FT                   GFGSGQKRIKMKLNDLINEIKNGNDDYYLTTQYDFDDPDNITNDKEEEEEEEGDVSFDQ
FT                   FSDTSSIDMNNFHDDFEDIENDFNESINGDENNNNNNNSNKNDEIMTPEEVEIRIKELY
FT                   QPPLTNLINKPEILPYCPSFFNLIPQQINLWMGSTTNNEKQSNNDHFIIDESKLDLGLG
FT                   KQIPLTNEPEPKPEFEPECEPESKTLTLMGTSTGLHHDHADNLYILIQGKKRFTILSPN
FT                   DAMKLYTIGNIYKIFHNGLIDYEINENSSNWKHIRDDGAIIEEIIYWKLDKLRKSKKEK
FT                   EKEKEQKGGQKEPKEEDEKGLDEEEEEEEEKLLNELQNHIKQYQIQQQQNKRKNLNKKS
FT                   NIRLDPPNFSKIPPILLHLDELKNNIIRKKIESFANKFFPGVLQLNKLKVWLNPGEMLY
FT                   LPAGWFHEVSSFGENIVKNNNDNKENLGTTTKTTTTGEGEGEGEGEGEGEGGAHIAINY
FT                   WFIPPNTTKFDDCYEDNYWKEDWEKTKKAMKLVKDGVVSL"
FT   mobile_element  complement(326236..326635)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon B"
FT   CDS_pept        331344..333143
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094164" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381508"
FT                   /orf_name="CD36_51240"
FT                   /product="Mitochondrial protein, putative "
FT                   /protein_id="CAX41506.1"
FT                   /db_xref="HOGENOM:HBG397515"
FT                   /db_xref="UniParc:UPI000192D889"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH65"
FT                   /transl_table=12
FT                   /translation="MSDLEDINSPNSPNSPNSPSLSLEQSTRGSTPPTSTSSPPSTQNN
FT                   DSKSKRNLETDDIHDTFDNKKLENEINESEQLTDLKNDQDLEDIKNNTKDVKDVKDVKD
FT                   IKTTGGGFGGFGGGGCSKKNQDFKDSKDSKKMKKLKPKSNPKSNSKPKPISRAPIATGI
FT                   STEIEVTGEKPKPIQEGDPSLEDDVLYAIFVILYEEDLIEKEKEKENEKEKEKGMTVKQ
FT                   ITDILDEKYPQFTKNTGKVSNLVSAKINSYIKRLEAGQTNLRYAISRDWGKNTPKRMLY
FT                   KYRGILAPGWEIKLKELQKQQQEIKQQNDQQQEQEQQQNDDDDDDSQELNLQQQQQQIE
FT                   EFKSSSSESPKSRKKNSQPQSISTNFKDHFNELDQQQQQQQEDQDQDQDQDQYQYQYPL
FT                   LSSSISSSISKSKSTMKRRATMFDLGRPTFLTTGEFCDQLPPYLIRKSTKIEDVLDEEV
FT                   LQDDNDEEEEEENDLSSLSQKDKTSNKTNNNSSNSNNNINSGNIIKIKKRRLTWAPLGE
FT                   TGDDDLGLAAFRALSTSTTSATNNNGGSGGNGNGNGNGGNGGNGGGGERLLSSINYKKK
FT                   WFQMTELPKPELTSLSELEKYWD"
FT   CDS_pept        335664..337175
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228667"
FT                   /orf_name="CD36_51250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41507.1"
FT                   /db_xref="HOGENOM:HBG396443"
FT                   /db_xref="InterPro:IPR021460"
FT                   /db_xref="UniParc:UPI000192D88A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH66"
FT                   /transl_table=12
FT                   /translation="MVMPNPEEYTAIHGVSRILRFLNNYPAEGTGTLILSEKAKNLIGP
FT                   KLPQILIDYSTATQLNLFGDYPNKSDIIPSAIFIGLFSIIAILHLIVFSINYYRGHYFW
FT                   LSLGWVFYAICRILGFALRIVWSHDLTDCKVGITSEVFLIIPTVLIASFNLVLAQRIFT
FT                   WRHPVGGSRKIFWTLMWILYALVAGVVAMTIVTSGGLNIYLLSEANYSRYKKVVMSTSI
FT                   LIIIYSLTAVGLILLAWLFKPTKKDENLYTYQPWWIESFAPFYFVKKNEPQIAALSFLK
FT                   RNHNHRYAIRVIAATHNLHKTVKGLTNQRGDLTHNVSLMIIGVTTLIILVSSILRAVIC
FT                   FQGRMKYFTAPVGKAPVMYVFWGGLEVGVNLLYIIGRVDLRFYRPDRLPKDVRNIVTAE
FT                   QSLYPSEIEDEGDDQNVLDKESLDKHPQPYSGKTFSNNNNNNNHHHDDNDDNEFGFTDS
FT                   DDKDVHTDLDGNEDFDFINGGSEKPKNNFPYPFKEKSETVSEFHF"
FT   CDS_pept        337529..338344
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534337"
FT                   /orf_name="CD36_51260"
FT                   /product="Methyltransferase, putative (S-adenosyl-l-
FT                   methionine"
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX41508.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG444343"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="UniParc:UPI000192D88B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH67"
FT                   /transl_table=12
FT                   /translation="MSRPEELAPPEVFYNDTESFKYTSSTRVQHIQAKMTLRALELLNL
FT                   EQDSSQFLLDIGCGSGLSGEILTEEGYNWIGMDISPSMLATGLDRNVEGDLFLGDVGNG
FT                   IPFRPGTFDAAISISVIQWLCNADISGIDPKKRLLNFFNSLYASLKRGGKFVAQFYPKN
FT                   DIQTENIMNAAKIAGFGGGLIIDDPESKRHKKYYLVLTAGMAERQINLTGAEMDSPIDE
FT                   KTKLSNKKRKRIMESKKQFINRKKEIMRKRGRKVAEDSKFTGRKRRPRF"
FT   CDS_pept        join(338637..338715,338804..339267)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248530" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228668"
FT                   /orf_name="CD36_51270"
FT                   /product="Ribosomal protein, mitochondrial, large subunit,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41509.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG397514"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniParc:UPI000192D88C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH68"
FT                   /transl_table=12
FT                   /translation="MFGLITKSFGIKPVIQPIRSFHYLRKQLPTVFEPLPKRRNGEGVM
FT                   PYLHRQLLEKHDPTGKRRALVENSKTGLRAGDIIKVTYLDRSDVTGRVIGIKRGFLNLG
FT                   TNILIRTKLNKVGSELRIPVYNPNIRNIEVLHKPTRYMPRAKHFYIREHKRYDVDDVEA
FT                   FVKKQFGEGRKNTKSKK"
FT   CDS_pept        complement(339351..339704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228669"
FT                   /orf_name="CD36_51280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41510.1"
FT                   /db_xref="HOGENOM:HBG397513"
FT                   /db_xref="InterPro:IPR007967"
FT                   /db_xref="UniParc:UPI000192D88D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH69"
FT                   /transl_table=12
FT                   /translation="MEIQQQIEELTTIYHEYKSFFPKCELIVTPDIKSNSNSNYIQLIT
FT                   YEGRNIKVTVGFKGWYEITTTTTIRTIEKSFESFESFETFEALMQTISIDFQNRFGNEL
FT                   SNKLNQLLQQQQK"
FT   ncRNA           complement(339941..340126)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR32"
FT                   /db_xref="Rfam:RF01247"
FT   CDS_pept        340365..340640
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381509"
FT                   /orf_name="CD36_51290"
FT                   /product="N-terminal acetyltransferase C complex subunit,
FT                   putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX41511.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397512"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000192D88E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH70"
FT                   /transl_table=12
FT                   /translation="MCASLTPDKFIGANLHVKLSDSRILEGILTVIDPFGNLLLSNVYE
FT                   TSIDKLNDKQLHVREIGLVSVPRESIENIKVDRKTHKSIFGMERSN"
FT   CDS_pept        complement(340686..341483)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228670"
FT                   /orf_name="CD36_51300"
FT                   /product="Covalently-linked cell wall glycoprotein,
FT                   putative"
FT                   /protein_id="CAX41512.1"
FT                   /db_xref="HOGENOM:HBG397511"
FT                   /db_xref="UniParc:UPI000192D88F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH71"
FT                   /transl_table=12
FT                   /translation="MLLLVVTLVFLKSIFATPPACFLSCINEIAHDCPEDAANLTCICI
FT                   NEDLIIGCLVDICPFGTFISARDHYIGTCLEHGRPSITNPIPPPAIWPPEPKVSSISDT
FT                   TMKTEYTSSAMQVTQTVEFPARVTITPLPSEVINPEPEIVDESEDEFYNPNEPCEWEET
FT                   DELDENGAFIVIRRPVNVPKRYRDPTNVGNVRRVIITRPVNYYSNQHAFDKFDNPKPRK
FT                   IQHVKRIKKIPKNISKNANNLKMGSLILNQKIKPKKNKLEEIP"
FT   CDS_pept        342226..342945
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534338"
FT                   /gene_name="CVB1"
FT                   /orf_name="CD36_51310"
FT                   /product="Vacuole biogenesis protein, putative "
FT                   /protein_id="CAX41513.1"
FT                   /db_xref="HOGENOM:HBG397510"
FT                   /db_xref="UniParc:UPI000192D890"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH72"
FT                   /transl_table=12
FT                   /translation="MQGSYNNNGLPRPYYMKPSKKKSSPYSNLKEPIVYFNTPKRKLMG
FT                   YIIMFSLIGILMWWISQDFKGKSEIEYELVKNEKSGEKNTHIDLKNSANLDKIVNAVGS
FT                   KADKESENLDLAENLSEGSKGQKGIGVAEAPKGGIANEAPVVGNDEEELVGTGKSGQKQ
FT                   QKAEGNPKGKGYKASIGKANDKDSTGAAPAAAAGAAAAGADSPNGKEDPAPDVEDTAAA
FT                   ARLSNEDKVQQIIKDTA"
FT   tRNA            complement(343192..343263)
FT                   /gene_name="tRNA-Gln (CTG)"
FT   CDS_pept        complement(343764..345248)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094169" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381510"
FT                   /orf_name="CD36_51320"
FT                   /product="RING finger domain-containing protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41514.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397509"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D891"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH73"
FT                   /transl_table=12
FT                   /translation="MKFAKTLERTLEEDEIPQEWVEAAIQYKALKKCINKVVNELEFLG
FT                   LQKNTLKILLNDKVVEVNEQETNPNNPIIAEYILSKTSTDAHNIKPMLKITLDYSTEDY
FT                   TKDHIVELGKELKSKIEALLNDTDTEYEEDKIIELKEDDGGDLQIVTSREGSLSPPASR
FT                   MASPPTSPTIKVVDSSNTNIDEALLSPEDHHKKHEIFIMLNSDSKFFDMLNDELTSLDS
FT                   LTQSEESKIIEEVKKIAKYVNELKLKQSELYKWRELFKVYLDSEVYFKYNETALSSQQK
FT                   SSEQIKSNLDLFVTNLKKSGIMTQFKKKQSLETFNQFLEMNYHLLKILQFQTINNEALR
FT                   KILKKFDKQTSLGIQKTFPKLISNDHIFMSGTSLAQSICYIIQESVIKVIPQLDDYSCP
FT                   ICMNIAYKPIRLSCGHLFCVRCLVKMKQDDKTSCPLCRKENAILYADSSNLDLESMELM
FT                   KKYFPREVKEKLRERDKERYNELRKNANTGEKCIIM"
FT   tRNA            complement(345862..345957)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   tRNA            complement(345971..346064)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        346273..347694
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381511"
FT                   /orf_name="CD36_51330"
FT                   /product="Uncharacterized zinc-finger protein, putative "
FT                   /protein_id="CAX41515.1"
FT                   /db_xref="HOGENOM:HBG397508"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000192D892"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH74"
FT                   /transl_table=12
FT                   /translation="MTQDISEKIEVISINDSQPEDPSPVVPHERQVVDCVIEIWKEDPA
FT                   TESLGMSKLHALVKQKHPNWSVSEKRVRALLKQFGLAFNNQEQFTYAKEITSVMTPDIE
FT                   LPANVHIIMTSKRGKGLYAKRDIAKGDLIWSEEPLFFIPPLANVNLMKTASACTYCGKL
FT                   LKRPESATVLKGLDCNVCSEVWCSIKCKQLDGNLHSLLKHNLYNPGTKKHKLIDAEAFL
FT                   ELQDYCLEEQWNALYAITLIYANCVTDKSGVKQKQFNAMARVSQDVRYKALNSSAGTFD
FT                   SLNGGALFVQEQQEHLWKIGYEKFLRVFPKKPVEYREFLFMMGTYNINNLDSNVFLTQS
FT                   HLNHNCAPTTSVETELDRTAGLKVFAAKDIKSGEELTTTYVNPSHTVHQRQRELRVNWG
FT                   FICACGKCKDDLKQNERRKSSHNQQQNASNIRNMLKEAKDAVGEEGIELEIPTEFNGER
FT                   RKSVRFDEKVVAVKE"
FT   CDS_pept        348030..349070
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094170" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569388"
FT                   /orf_name="CD36_51340"
FT                   /product="Transcriptional activator, putative (Hap ccaat-
FT                   binding"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41516.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397507"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192D893"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH75"
FT                   /transl_table=12
FT                   /translation="MNEDPQSEIMERYNESAYLREDQLSQFDQNNIVVKEEQTHIQDHH
FT                   PSESGSHPDELQDQGIHTVIDEHEDQVSTQNIVDEEELLAAQAAAEAAAAAQQQQPGDV
FT                   FNNVAQGLSGKHRDMMMQYWQETINSIEHDEHDFKNHQLPLARIKKVMKTDEDVRMISA
FT                   EAPILFAKGCDVFITELTMRAWIHAEENKRRTLQKSDIAAALTKSDMFDFLIDVVPREE
FT                   EKPKKSNNSSSRSDTYVNTQQSPQIPEVEEEVPNMLTQDVKNSHSDALQQQILQDQLLQ
FT                   QQLQQEVQQQLQQEVQRQLQEDVSPSGPQQGSQQEEDITNGVDNSNGHNDETTTYQNFN
FT                   GYQNNY"
FT   CDS_pept        349985..350620
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569389"
FT                   /orf_name="CD36_51350"
FT                   /product="Carboxypeptidase y inhibitor, putative "
FT                   /function="carboxypeptidase activity"
FT                   /function="kinase activity"
FT                   /protein_id="CAX41517.1"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG588979"
FT                   /db_xref="InterPro:IPR001858"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI000192D894"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH76"
FT                   /transl_table=12
FT                   /translation="MTLITISQSLDEAYTKHKVIPEVVDQFDTQGLLSIEYGPTELVTL
FT                   GNTLSVEGTQDVPKIQLTLNSPTQDGKIESISENDKFILVMTDPDAPSNSDHKWSEYLH
FT                   WLVTDLKLPHTKNEDGEPEISHFIDVKEGRELVPYMGPGPPPKTGKHRYVFLLYKQDPN
FT                   VGELTAPKDRPNWGTGVPSSGVKDWIEKNAPNSKLLSVNFFFAQNEDN"
FT   CDS_pept        complement(350681..351127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198385" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534339"
FT                   /orf_name="CD36_51360"
FT                   /product="Spliceosome complex subunit, putative "
FT                   /biological_process="mitosis"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAX41518.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="HOGENOM:HBG522501"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192D895"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH77"
FT                   /transl_table=12
FT                   /translation="MGSVFLPHLKTAWHVDQAILSEDDRVVVIRFGREEETQCMLMDEI
FT                   LFSISEKIKNFAVVYLVNLDKVPDFNQMYELDQNPLEPFTIMFFYRNKHMMCDFGTGNN
FT                   NKLNFMIYDKQEMIDIIETIYRGARKGKGLVMSPKDYSRSAKDI"
FT   CDS_pept        351883..352239
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569390"
FT                   /orf_name="CD36_51370"
FT                   /product="Thioredoxin, putative"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX41519.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000192D896"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH78"
FT                   /transl_table=12
FT                   /translation="MLQNIETKQQFSSALQNKDDMIVLDFFDECSHCSDLNDKLDEFSN
FT                   MYGAQNIRFYKVNIEEDRELAEDYKVSSIPTTLFFKKGKVFDKVVGPEPNEIKKVLDKN
FT                   LLGWSGRPSHSTKT"
FT   CDS_pept        352563..353639
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381512"
FT                   /orf_name="CD36_51380"
FT                   /product="Dihydroorotase, putative "
FT                   /EC_number="3.5.2.3"
FT                   /function="dihydroorotase activity"
FT                   /biological_process="pyrimidine base biosynthetic process "
FT                   /protein_id="CAX41520.1"
FT                   /db_xref="GO:0004151"
FT                   /db_xref="GO:0019856"
FT                   /db_xref="HOGENOM:HBG628648"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000192D897"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH79"
FT                   /transl_table=12
FT                   /translation="MSEIELGITADMHVHLRDGNMCELITPTVRTGGVAISYVMPNLVP
FT                   PITTKQQVIDYHNKLSELAPQTTFLMSFYLSKDLTPELIEECADLIHGVKCYPAGVTTN
FT                   SKYGVDPNDFSAFYPLFETMQKHGIVLNIHGEKPGTSEEDEINVINAEPKFLPALKKLH
FT                   DDFPRLKIILEHCTTSDAVETIRELNSNYKPGDELFVGATITAHHLFLIIDNWAGNPIN
FT                   FCKPVAKFQKDRKALVDAATSGEPWFFFGSDSAPHPIHAKQTHVGVCAGVFTQSHAIGY
FT                   VAEIFDKANKLENLKKFVSDNGINFYGLSNEILNKHKNESVWLVKRDNKVPEIIGNSNV
FT                   EVVPFKAGETLKYAIEWR"
FT   CDS_pept        355973..357577
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381513"
FT                   /orf_name="CD36_51390"
FT                   /product="Glycerophosphoinositol permease, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41521.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325091"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D944"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH80"
FT                   /transl_table=12
FT                   /translation="MASRDLPHSFNELAFGWSKHLKEEIIVNKNSQQLVDEDFQPDEDI
FT                   TKETKVKFDNLWPAFASGAGLFADGYVNNSIGIVLACLKILYGDEFTKSNAISNIGSIG
FT                   FVGTVVGQLSFGYISDRIARKGGMMTANIMLIVFTLLCAVGSWGTTIQGFFACLTVWRF
FT                   CLGVAIGAEYPTSSVIASEFANQLPSGKRNRYFIWFTGFMIDFGFVVSAFVPFVLLWIF
FT                   TEKHLRALWRVSIGLGAILPTALFFIRLKMKDSSSFEKLHMKNVRYRDYPWWLIVKFYW
FT                   FRLTIVSMIWFIYNFSVYSFGTFNAIILGQIIPDAPLWQQWGWSVVFNLFYIPGSFLGA
FT                   FSADYLGPRLTLAIGVGLQGIIGFIMSSCLNGLRKQVAAFTVVFGIFATLGEFGPGGNI
FT                   GLLASKTSATPIRGQYYGIAAAMGKIGAFVGTWIFPAIQRRYASKTNPDLELQVPFYLS
FT                   SGLCIFSALLTFFLCPHVGQDAINREDKEFVDYLQKNGFDISKLGEDTSSVEIDVVKDT
FT                   DSAEKISETIDVGQKLA"
FT   CDS_pept        359777..361384
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228671"
FT                   /orf_name="CD36_51400"
FT                   /product="Glycerophosphoinositol permease, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41522.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325091"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D945"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH81"
FT                   /transl_table=12
FT                   /translation="MSTRDLPHSFSELSFGWVRRIRAEFTIGKSKEQLLAEDYHSTDDD
FT                   DSEVVTSVKANSLWPAFASGAGLFSDGYVNNSISTVLFCLKKIYPDEITKSNAINNIAS
FT                   IAFVGTVVGQLGFGYISDRIARKGGMMTANIMLIFFTLMCAVGSWGVTVQGFFACLTVW
FT                   RFFLGVAIGAEYPTSSVIASEFANQLPPGKRNRYFSWFTNAMIDSGFVVSAFVPFVLIW
FT                   IFTEKHLRALWRVAIGLGVIPPLSLFFMRLKMKNSSSFQKLHMKNVRYRDYPWWLIVKF
FT                   YWFRLTIVSLIWFIYDFSAYSFGNFNTIIIGEIIPEAPIWKQWGWSIVFNLFYIPGAFL
FT                   GAISADYIGPRLTLALGVGIQGIIGIAMSACLNSLKKHIAGFVVVFGIFTTFGEFGPGD
FT                   NIGLLASKTSATAIRGQYYGIAAAIGKIGAFVGTWVFPAIQSKYANNSNPDLQLQVPFY
FT                   ISSALCLFSACLAIFFCPQVGQDAIYKEDHDFVQYLSNNGFDINMLGEGGDVREICHES
FT                   DSLEKGKRDDFQVDNNSL"
FT   CDS_pept        362956..364554
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077285"
FT                   /orf_name="CD36_51410"
FT                   /product="Glycerophosphoinositol permease, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41523.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325091"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D946"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH82"
FT                   /transl_table=12
FT                   /translation="MATRDLPHSVGDFCFGWVDQIRNEITLGKSQDQLIKEDLIEDDET
FT                   VETKVEVKNLWPAFASGAGLFSDGYVNAGISTVLSCLKKIYGDEFTKSNAMNNIGSIGF
FT                   VGTVVGQLSFGYISDNFDRKTGMLTANVMLIFFTLMCAVASWGTTVQGFFACLTVWRFF
FT                   LGIAIGAEYPTSSVIASEFANQLPSGHRNRYFSWFTNAMIDFGFVVAAFVPLVLLWIFT
FT                   PHHLRAVWRLSIVLGVIPPLILFFIRLKMDNSKSFKKMNMKRVNYSNYPWWLIIKFYWF
FT                   RLTVVSLIWFIYDFSVYSFGTFNTIIIGEVIPNGTLYENWGWSVVFNLFYMPGAFLGAF
FT                   VGDYLGPRLTLAIGVGAQGIIGIAMSACLKSLKKHIAGFVVVFGIFSTFGEFGPGNNTG
FT                   LLASKTCASSIRGQYYGIAAAIGKIGAFVGTWVFPAIQKHYAYNDDLSLQVPFYVSSAL
FT                   CLFSAFLTIFFVPPVGQDAINKEDRLFKEYLEENGFDIRLLGDSGVVTQYQEDEDIGVI
FT                   SDEKDDTVKVQQKNV"
FT   CDS_pept        complement(365039..365527)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000003673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381514"
FT                   /orf_name="CD36_51420"
FT                   /product="Mitochondrial inner membrane protease subunit,
FT                   putative"
FT                   /EC_number="3.4.21.-"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41524.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG596607"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI000192D947"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH83"
FT                   /transl_table=12
FT                   /translation="MGIPRGVKTSLLTLTWFPVLYSFTNHGYQPYQITGSSMTPTFNPG
FT                   TSTMTKDIVLVQKYNVKKPGSLSRGDIIMFRSPENPEKLLTKRVVGIQGDIVRPKSPPY
FT                   PKSEVKIPRNHLWVEGDNSFHSIDSNKFGPVSQGLVIGKVVTIIWPPSRLGSDLQRNL"
FT   CDS_pept        365933..366250
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077286"
FT                   /orf_name="CD36_51430"
FT                   /product="Mitochondrial intermembrane space cysteine motif
FT                   protein, putative"
FT                   /protein_id="CAX41525.1"
FT                   /db_xref="HOGENOM:HBG397505"
FT                   /db_xref="UniParc:UPI000192D948"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH84"
FT                   /transl_table=12
FT                   /translation="MDQAKPGFLDQFLLEDISRHCPHQFLSFHQCMTLPEPDPNQCFQQ
FT                   QVDLTKCIKTSVPSFAKIQNECFGKMQAYEACLKLNKSNTKSCSHELQSLRNCAFGTID
FT                   K"
FT   CDS_pept        complement(366310..367326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569391"
FT                   /orf_name="CD36_51440"
FT                   /product="mRNA export protein, putative "
FT                   /protein_id="CAX41526.1"
FT                   /db_xref="HOGENOM:HBG397504"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D949"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH85"
FT                   /transl_table=12
FT                   /translation="MPSANDRNIKFFNSLIPIVLIDKPISSYAPSEIITVAINQTGTRV
FT                   VYSRTDRSIRIWKCLPESVIDPKTIFDAHSKAVECLSFNPMTEFTFATVAKDEYIKIWN
FT                   ANTGDKLHEIKCEFDSLKLVRYSNDGQLLVVVDRASNFLFFNVGANYKLIHQFKLDEHI
FT                   YDLKWFNHDHQFFLVSSHDGSILLYEIIDGDEDNELSSKLRASVSGHNSSITTIAISPK
FT                   GNYFTVGSSEGVISFWKTLENLINSKVITDVDQSIAQLDISRDGTYLAVAYDTDSNSRI
FT                   YEAEGGEMVHEIPNSSSGNQTFSSITWFPTKTGFAYTSDHGTVLTVMNKPIEKKHRR"
FT   CDS_pept        367620..368864
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381515"
FT                   /orf_name="CD36_51450"
FT                   /product="ER-derived vesicle protein, putative "
FT                   /protein_id="CAX41527.1"
FT                   /db_xref="HOGENOM:HBG619751"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniParc:UPI000192D94A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH86"
FT                   /transl_table=12
FT                   /translation="MSSRPKLLSFDAFAKTVEDARIKTTSGGIITLICILITLVLIRNE
FT                   YVDYTTIITRPELVVDRDINKQLDINLDISFINLPCDLISIDLLDVTGDLSLNIIDSGL
FT                   KKIRLLKNKQGDVIVNEIEDDEPAFNNDIELTDLAKGLPEGSDENAYCGSCYGALPQDK
FT                   KQFCCNDCNTVRRAYAEKHWSFYDGENIEQCEKEGYVARLRERINNNEGCRIKGTTKIN
FT                   RVSGTMDFAPGASFTREGRHFHDLSLYTKYEDKFNFDHIINHLSFGEMPVDGQADQLFD
FT                   SIHPLDDHQFMLHKKAHLVSYYLKVVATRFESLDYKNRIDTNQFSVITHDRPLRGGKDE
FT                   DHQHTLHARGGIPGVNFNFDISPLKIINRQQYAKTWSGFVLGVISSIAGVLMVGTLLDR
FT                   SVFAAQQAIKGKKDI"
FT   CDS_pept        complement(369002..369850)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569392"
FT                   /orf_name="CD36_51460"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41528.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG397503"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="UniParc:UPI000192D94B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH87"
FT                   /transl_table=12
FT                   /translation="MRGLTVHRVIRSYSSIPASTSSSISSTLVLSRLPIITPDVPKFDQ
FT                   QFYNYQTELWRRLMWTFPKWFYFRPGTLSEQKFKELNENPVSYDPKVIYPRGAPDLKHN
FT                   RDRRFRQYIRLPKTYKEESELAEGEENTQSDQDIARKIVPNSRITEADKKNDSTSLERK
FT                   LSRTLYLVVKQGESGEWKFPNFKQPENGELVPLHELAETGLYSIGGKKINYFNVSRVPC
FT                   HVTQDTNNTSKQYFIKSHILSGAFEAQEKDVEFKWLTKEELGECLSTEYYRDIEHLLND
FT                   V"
FT   CDS_pept        370448..371323
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381516"
FT                   /orf_name="CD36_51470"
FT                   /product="Cytochrome c peroxidase, mitochondrial, putative "
FT                   /EC_number="1.11.1.5"
FT                   /function="cytochrome-c peroxidase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAX41529.1"
FT                   /db_xref="GO:0004130"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG597790"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI000192D94C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH88"
FT                   /transl_table=12
FT                   /translation="MIRSYIKNIILAILSPLLITTPPLVLPPPYEKIIQEIITVFSVDN
FT                   YDDGSLAPIILRLAWHCCATYDVTTNTGGSNGATMRFVPEITDEGNYGLDVARAALEPI
FT                   KQRYPTISYADLWTLAGKVAIEHMGGPTIIWKSGRVDYTNDQDVPPNGLLPFADKNANH
FT                   VRKTFTRLGFNDRETVALIGAHGVGRCHKRFSGWEGKWTSIPKTFSNQFYVVLLNEIWS
FT                   QGEVPETGKTQYFNADKSLIMLNTDMELIRDKSYLRWVEIYAKDEPRFLHDFSAAFAKL
FT                   LELGIKREPF"
FT   CDS_pept        371370..372692
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228672"
FT                   /orf_name="CD36_51480"
FT                   /product="Indoleamine 2,3-dioxygenase family protein,
FT                   putative"
FT                   /EC_number="1.13.11.-"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41530.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG487250"
FT                   /db_xref="InterPro:IPR000898"
FT                   /db_xref="UniParc:UPI000192D94D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH89"
FT                   /transl_table=12
FT                   /translation="MIIPNIKEFDVFPNSGFLPSKLPLERLPQEYYQPWENIVNNLPSL
FT                   ILTKRIRATIDKLPVLETTRLTSEEEYRRAYQILGFLAHAYIWGTDTPTDKLPSQIATP
FT                   WIKVSDHLGLPPIATYAGLCLWNFKQIMPSDDIWDLDNLTTINTFTGSIDESWFYLVSV
FT                   YFEHKGALAITTGLDAIKCAYNNDTKGLVENLQQLAEAIDSLGSVLMKMEEMCDPHVFY
FT                   FRIRPYLAGWKNMTEVGLKGVYYGEEKKVRNYSGGSNAQSSLIQFLDILLGVKHYSTGE
FT                   RPLPFKSGSGSGAENGFMNEMRQYMPGNHQKFLSKIQEITNINQYVLDHKDSHPELVLS
FT                   YDACLAMLKSFRDKHIQIVTRYVVLQAKKTEKMGSSSTLRSGLARKKKEERGTGGTSLL
FT                   PFLKQCRDETGDPAAGNWGQRILSDGVMRLTFSKPNGINED"
FT   CDS_pept        373756..375801
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569393"
FT                   /orf_name="CD36_51490"
FT                   /product="RNA-binding protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41531.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397502"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D94E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH90"
FT                   /transl_table=12
FT                   /translation="MSSSGIEEFEAVLKEISTLPAPGVSGTRIKKLTDLAVKEINVENE
FT                   PKLISILYSQCKANSSTNKLGTLYVVDSIVRRFIEEANKKNEALVPNAPEGTYASAVFK
FT                   INELVESLVDDAMELSINPSINIKIGKLIDIWAKSETFSPEVISNIRNKHFKSTTPPGS
FT                   PPKTSIAPVKPDATEGTKESSSILSALASLAKANGTNNETPPSSQSSSANNNESGSNAT
FT                   NILSQLSALAGNSSNTDSASSQPPVQQQYPSYPQGGGQTGDAALLNMLQQMQGGGGATA
FT                   GASAVPPAGGVNGAREDHTAGFDRRRGRDNEYGSHYGRRNRSRSPKRGSNTWVRSSPSS
FT                   SVQALQQNMQNLRQQKQANHGYPQHTNGQVDQGFVPPNAMGGELNLPGTPHYRPRTVQF
FT                   DSTIPQGTVKVLSRTLFLGGVPRNMDERSLAQVLRPYAEIQSVILNSEKKHAFVKVYSR
FT                   REAEQVITSFNKDGALPLRTRWGVGFGPRDCCNYQHGISIIPIQRLTEADKNWIVNAQW
FT                   GGTGGQPISSGMVVDEPDIEIGSGLSSKAMSKKMPTNSARNGPKSNRPGEPDEEYVKTT
FT                   LIPQGNIQMTHGAQPQFNTYSQSSVNPLQGLFENNVQQQQPPPPPQQQQQQQQQQQPPM
FT                   QFPAGFPQIPPQQPGQPGMNNNEAMAMLAAMMQTMQQQQQQQHPPH"
FT   CDS_pept        376137..377315
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094171" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381517"
FT                   /orf_name="CD36_51500"
FT                   /product="Uncharacterized protein ynl254c homologue,
FT                   putative"
FT                   /protein_id="CAX41532.1"
FT                   /db_xref="HOGENOM:HBG397501"
FT                   /db_xref="UniParc:UPI000192D94F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH91"
FT                   /transl_table=12
FT                   /translation="MKEKDYGSLVNNTGNSKANVSKVSLPRTSSSVSGTSSIPSSPIHD
FT                   MFSPTKLSPRASKTYKKRPKGKILVHDNALETSKVKKLGEYQEIIVKPRKSLDPFDLID
FT                   INHIEKSTPSPVKMTKKRKTETSFKVEGLLEISDDDDYDADKSKNNVNSQPKTLNEKID
FT                   SNNILHSLEQQNRSKYHDVLKKYKNKKIPKPIVSRKALLVRANKYMDLIPKILGGKLST
FT                   SIFYEYAKAQKMKSEHETMSTSDKWRIKWEKYCGGYYGFQRQSIIGAQILDKYEKKLTR
FT                   FCKSNKTASYWNPSQFSTYVLANEIIIRMIMEDMNLDFDKAEKLCLETVDYGIVVADSI
FT                   EVDYDNGPSQGQTKNKKSISPIKQKLLPISLSADDSSSDEESIFRVKKQKEK"
FT   mobile_element  complement(377487..378008)
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon I"
FT   CDS_pept        complement(378010..379764)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534340"
FT                   /orf_name="CD36_51510"
FT                   /product="Heat shock protein, putative "
FT                   /function="binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX41533.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG384096"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192D950"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH92"
FT                   /transl_table=12
FT                   /translation="MTTADEYKAEGNKYFAAKEFEKAIEAFTKAIEASPEPNHVLYSNR
FT                   SGSYASLKDFSNALKDAEECVKINPNWAKGYNRIAGAEFGLGNFDQAKSNYEKCLELDP
FT                   NNAMAKEGLKSIESALASGNGGDDNDLGFGKILNDPNLYTKLKNNPKTSEFMNDPQFVA
FT                   KLERLKTNPQLGNPEMFSDPRLLTAFAALMGIDMNLPNMGFTAPNESQSNEPKEEPKEE
FT                   ETKPKAKEEPKATEDKDTPMTDAQDETTNDAKSQADIAKAEGNTLYKKRQFDEAIAAYN
FT                   KAWELHKDITYLNNRAAAEYEKGDYDAAITTCEKAIDEGRDMRADYKLIAKSFARLGNI
FT                   YLKKDELPEAVKNFEKSLTEHRTPDVLNKLRSTQREIKTRELNAYIDPEKAEEARLQGK
FT                   EYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLLSFPDAVQDCNKAIEKDPNF
FT                   IRAYIRKANAQLAMKEYSHVMDTLTEARQKDIELNGGVGKSTHEIDELMNKATYQRFQA
FT                   IEGETPEQTMERVSKDPEIVQILQDPVMQGILAQARENPAALQDHMKNPEVYKKINMLI
FT                   AAGVIRTR"
FT   CDS_pept        complement(380367..381593)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569394"
FT                   /gene_name="FCR3"
FT                   /orf_name="CD36_51520"
FT                   /product="Fluconazole resistance protein, putative (Ap-1-
FT                   like transcription factor, putative) (Basic leucine zipper "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX41534.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG397290"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniParc:UPI000192D951"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH93"
FT                   /transl_table=12
FT                   /translation="MIFKTENSSTPPNADWSQSKGFTNPGSSIPILEDDCELDHENLAL
FT                   LNSGEHVHEQIFHQTSELNGIGVVAPSPEMMVNLNNQPGYQYNNNNNNLAHDLYFTGPM
FT                   QMPSTQHPYTTNANNRLSYSNSSEEFSPVGANNMSPDSTGNSSNLAGNNNYNNNKRKAS
FT                   NESFSPVSSSHHHYGTETGNNGISKASHRSRKKLLDEKDAALIARDDSELTEEELQLKR
FT                   KAQNRAAQRAFRERKESKLKELEAKLLASEEERQKLLDELESIKKQNISIATENEILKH
FT                   NGIGNTNNNNDIQIGNNIIGHGRLLVDKFNFPKTQKDFIQHVLQGTNHQLKDENKDKIY
FT                   NDNQGHKLLALGAVWDYLQIKAEEADLDFNSIDFNDVMEKLKGNEKCHGYGPAYPLELV
FT                   NEAIESSLN"
FT   CDS_pept        384649..386445
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569395"
FT                   /orf_name="CD36_51530"
FT                   /product="General amino-acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41535.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192DA0E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH94"
FT                   /transl_table=12
FT                   /translation="MTTKEKDEFNIDSLQNSLEPSTNMTSPANTTPISKWQAFKDSFKP
FT                   QEQKPPLASSSSSSLSSSSPHHTDLANDYDIEKSLKPDQQGELRRDLKNRHVQMIALGG
FT                   SVGTGLLIGSGGALHQGGPAALLIAWGITGTMVFCIIHSLGELCVAFPVNGAFSTYANM
FT                   FVDSSWAFAVGWNYAIMWLIVLPLELVAAAMCITYWNDNINPASWVAIFYVMIVVINIF
FT                   GVKYYGDAEMYLTIFKIIAIVGFIILGVVLVCGGGPTHEFIGNKYWKQDGAFANGFKGV
FT                   ATTFVTASYSMAGSEMVGLASAEVANPQKSLPKAIRQVFWRIFLFYFLSLTFIGLLVPS
FT                   NSPQLLGASGTSASPFVIAIKNGGIYALPSIFNACILISVLSVGNSAVYGCSRTIQSLG
FT                   AQGLGPKIFAYVDRKGRPLGGLAMSAIFGLLCFLSAYHDEATIFNWLLSVAGLATIFSW
FT                   FNIGLCHVRFRLALRKQGRSLQELTFTALTGVAGSIYSMIFLCVVLVIQFWTALFPLNN
FT                   KGKANAENFFQNYLGAVVILIFYIGHKLYTRNWKLWVKLEDIDLDSGRRSFDLDLIRAE
FT                   IEEEKAANMAKPLYKRLWNYWC"
FT   CDS_pept        386489..386635
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(387218..387705),complement(387083..387158))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094173" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228673"
FT                   /gene_name="MTLALPHA2"
FT                   /orf_name="CD36_51540"
FT                   /product="MTL alpha 2, putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX41537.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397288"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000043A7B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH95"
FT                   /transl_table=12
FT                   /translation="MNTHSEALFQINQRLLFHIRTLSNFPVFDPQKITSDVETDIKKMV
FT                   SIMKFKRLTNEDEAIMKMINDCSKVLQEMLLERIMLQQDSIQFFTEKEASDSSFSNTVD
FT                   DAIEDGDDRKTKSRRLTKKQLLVLEGWFQKHKNHPYSQKDQTNLLIKSTKLSKSQVQNW
FT                   ISNRRRKEKNTKVSPELAALLLTG"
FT   CDS_pept        388413..389702
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077287"
FT                   /orf_name="CD36_51550"
FT                   /product="Oxysterol binding protein, putative "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAX41538.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG332907"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI000192DA0F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH96"
FT                   /transl_table=12
FT                   /translation="MGLTAKLDKLKLKTSSEDNEDDSSHAKLDNSDDIDEVDSEYQNIL
FT                   LSIIAQLRPGMDLSKITLPTFILEKKSMLERITNFFQIPKLLIESNNIEDPLDRFIGIL
FT                   RWYLASWHISPKAVKKPLNPVLGEVFTCYWDELPNNKSAYYLSEQTSHHPPKSSYFYIM
FT                   PEEKIRVDGVVIPKSRFLGNSSAAIMEGCGYVTLGKWDNEVYVMNQPNVYVRGILFGKM
FT                   RTELGDHMYVKCERNGLEANIEFKTKGFIYGTYDSIEGIIKDLETQKDLFQISGKWNEV
FT                   MYIKNIKTGKKEVLYDTGGSKTLKPKVRPLKEQWDFESRKLWKPTITGLAQRNHEIATE
FT                   EKSKVENEQRIKAKKRLEDGVEFHPKFFREVNEGDKGVKNLEYIIYKKFDLKEDPEILR
FT                   ERLFTVAPIVPGQKFDEKFHYPAFKKPESN"
FT   CDS_pept        389940..392873
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569396"
FT                   /orf_name="CD36_51560"
FT                   /product="Phosphatidylinositol 4-kinase, putative "
FT                   /function="binding"
FT                   /function="inositol or phosphatidylinositol kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="phosphatidylinositol phosphorylation "
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /protein_id="CAX41539.1"
FT                   /db_xref="GO:0004428"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0046854"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG397287"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021601"
FT                   /db_xref="UniParc:UPI000192DA10"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH97"
FT                   /transl_table=12
FT                   /translation="MSENTPEAPSKQLLERIQSSSFSLFNCIYELKNHNDSIGIQHELV
FT                   KKLYSFPYEDLQFFIPQFVQLLVTYDSNSMALEEFIITSSCRYPHFSLIVFWNLQAYIF
FT                   ELKNEPESRSFQAARNLVTKIQNIMFNTELSVVKAPEFRENLFPALVLCGAVASSALLP
FT                   SFKNYCLPMIKAQGKQQKSLVFKLANFQKSLTKNLTLKNQRMSADIPKESHSDDETVVS
FT                   SSIKPSLSRSASVPRRSTKKASLSFSSDESEAYTTDDDDNKTSIELEKEFYKMDLNGSL
FT                   KGGSTKFLETEENLHVNTAIKSKKRLSTLTSKVMASSWDSMDGYNVNSQSLPDLSKADS
FT                   RDLIPFLSSTESETSLLYNNNAIANDLQKNTLQQPKFMPGFDNDYLTKILQVNYAKNET
FT                   QFIMALQNISIRLSQVPKEARLSALRAELSIINDTLLPSEIDIPQLLPVTSNRNKKYHK
FT                   ILKLNVNEASVLNSAERVPFLLFIEYLSDEIDFNPTTEYNQRIIARKNIVGATNTSVKK
FT                   MNSFSEVPDGNFSKENNLESHITETVTSAICNESTEEADLSEMPIARRTAVSSDSFSPE
FT                   MLVTPTVTEQSKLSGFPSLNSKEVSTKVLADQMRIAAVMLQQLDSSGKANSEQSFLIKN
FT                   RIVESMIALQDQFDSFDFEKLSQLQSDQPSAGERKLENDFKLGEDWNTKKQRIKKSSAY
FT                   GHLKNWDLCSVIAKNGDDLPQEAFACQLISMISNIWKKNQVPVWTKRMKILITSANTGL
FT                   VETITNAMSIHSIKKSFTEHSIKSGENDKGKIFTLLDYFHSVFGSENSVSFRTAQQNFA
FT                   KSLAAYSIICYVLQIKDRHNGNIMVDRDGHIIHIDFGFLLSNSPGSVGFEAAPFKLTVE
FT                   YVELLGGVDSEIYSQFVHLCKQCFKSLRDNSEEIIEIVELMQRDSTLPCFNNGENTSVL
FT                   LRQRLQLQLNDEDTDQFVENFLIGKSLGSMYTRLYDQFQMITQGIYS"
FT   CDS_pept        393082..393663
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569397"
FT                   /gene_name="MTLALPHA1"
FT                   /orf_name="CD36_51570"
FT                   /product="MTL alpha 1, putative"
FT                   /function="mating pheromone activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="positive regulation of transcription,
FT                   mating-type specific"
FT                   /biological_process="regulation of gene-specific
FT                   transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41540.1"
FT                   /db_xref="GO:0000772"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0032583"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045895"
FT                   /db_xref="HOGENOM:HBG397286"
FT                   /db_xref="InterPro:IPR006856"
FT                   /db_xref="InterPro:IPR016325"
FT                   /db_xref="InterPro:IPR017931"
FT                   /db_xref="UniParc:UPI000043A7B7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH98"
FT                   /transl_table=12
FT                   /translation="MGNKKRSMKTVPKEFTSLFRVHPGRDPPRRDTREVQKSKKHGFRF
FT                   TSLPDLPVASNALQELLLEYGLLNDIRWDSKGSKASKTKKIKLKPINSFIAFRSFYSRT
FT                   ISNPEHQRELSSKLAEVWTQESNQEVWKQYTQSYNNYLLLPEAKLNFVDWLCEALDYTI
FT                   ENATPSLEDISLTSYNQLLSGTIEDVYMLK"
FT   CDS_pept        complement(393698..395374)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569398"
FT                   /gene_name="PAP1"
FT                   /orf_name="CD36_51580"
FT                   /product="Poly(A) polymerase, putative "
FT                   /EC_number="2.7.7.19"
FT                   /function="RNA binding"
FT                   /function="polynucleotide adenylyltransferase activity "
FT                   /biological_process="RNA polyadenylation"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41541.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004652"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0043631"
FT                   /db_xref="HOGENOM:HBG594063"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniParc:UPI000192DA11"
FT                   /db_xref="UniProtKB/TrEMBL:B9WH99"
FT                   /transl_table=12
FT                   /translation="MNTKTYGVTEPISTNGPTPKENILNDTLIQELKNRGSFESEQATK
FT                   KRVEVLTLFQQLVQEFVYTVSKSKNMSDAMAQDAGGKVFTFGSYRLGVYGPGSDIDTLV
FT                   VVPKHVTRDDFFSVFADIIRKRPELEEIACVPDAYVPIIKIEFDGISIDLIMAKLNIPR
FT                   VPLDLTLDDKNLLKNLDEKDLRSLNGTRVTDEILQLVPKPTVFKHALRCIKMWAQQRAV
FT                   YGNIFGFPGGVAWAMLVARICQLYPNAVSSVIVEKFFNIYTKWNWPEPVLLKSIEDGPL
FT                   QVRVWNPRLYPHDRLHRMPVITPAYPSMCATHNITSSTQKVILAELSRGSSIMQDIHAG
FT                   KKSWSDLFEKHCFFYKYKFYLCVVAATIDSAEEHKKWSGFIESKLRQLVLKLEVAEGVE
FT                   IAHPYVKDFSHTFLLDDKNAEDIINSYGTLSGEAFLRTLHSSDSDKDSDEHNKIRLTKY
FT                   YIGLDLNLTKSSDGVRKLDIQYPCAEFYSICKGSTSFTEGVNFIQIKNVKLHDLPNDVY
FT                   EDGEERPIKSGKKRKKVIKEDGQKRVRNESSASSASLNGSS"
FT   CDS_pept        complement(395973..398672)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094175" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381518"
FT                   /orf_name="CD36_51590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41542.1"
FT                   /db_xref="HOGENOM:HBG397285"
FT                   /db_xref="UniParc:UPI000192DA12"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA0"
FT                   /transl_table=12
FT                   /translation="MLKYQNISPLLIYRSRPNNLPIIKTSCSSSAFLSVYRLIFYQQKR
FT                   LSTSKSFFEQTDQPSTTTTTTKTIPINEYSIPHKISKYLSDLLIAQNERFLDEPIQNLI
FT                   EQIPNLSNELKRSIDFENKLFTILSYDPILIDPRIYLHYYDGIASLSFSSSSISSETSL
FT                   KKLYIERLLYHRKFHLCWQLFLDSCNNNNNNNNTLNELDEFLETIHNYLINKSGSYKFN
FT                   LLDLIINLPQNINENNMLQQIIDSIEYICKPDFNIEQMLQISMDINQIYNLNELEKYYS
FT                   NCQQDQNQDTFALDVLYLKRVMKLILQQQETSKGKKGIIQNYLLQFPHITSQPGWLSSI
FT                   FPSFSSSTNFVPKNSNQDIIKPPRDIIPFIEASKFIIHDKETKLNELDILYILRENLVK
FT                   PYTIYSAYNQSTIVPITQQNQKKKRTKNKIIINELTRNLLNDPPRLQIIYKENMNLLNE
FT                   SLIMECLNILIPFSENIKDCNEVFNKFDEKIRLNIIQSIDIVNKLNCWQIENLILKYNY
FT                   HEHKFTRVLINRYLYLYRSETMELDQLIKLAKSKQIKSRNALLEINRASLLRGSDDIDP
FT                   TLVCIIFDRLIQLTVPKQSGGSSNDNHEVMTTTATNNNSQFALQFKWNLTRKEKNKFHQ
FT                   TIRSFAQTLSLLTPDKLLKILIILGKFMKDNQQFYYHNDTEGKNYLIKCLTNDIFQFIN
FT                   RNNKGRKSVDYINSLLDQINQDSLHVGEPKILYWIEYWWFKSIVLNDYQKSFELLSNPS
FT                   TTTTTTTMEMQKRNTRNNLIKFIPAIISGIIDNKQFNSIEDKFEFLIKFLMDLKLNNFN
FT                   NKLTMNASVKLINQIIKSNKGNNIKNTPDSNNNNNNNNNNNNTSINSLNTTTNINTKSQ
FT                   LLNLIQSNPKMKQAIKLIVHHHKNKSHS"
FT   CDS_pept        399125..401668
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534341"
FT                   /orf_name="CD36_51600"
FT                   /product="Recyclin, putative"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41543.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="HOGENOM:HBG397284"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000192DA13"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA1"
FT                   /transl_table=12
FT                   /translation="MAQVIWNSDIDVYNKDVMPINIAENIVKYLPIQDLLSFSQVSKNC
FT                   HLAVNDPKLWVSMLKGMRVWQESKQLTKQDIKSNKFGNYLNDPLTCMDYIYRSNKNAKF
FT                   QVIKIYKCLHEFYNDLLIQQNYNRLKIFKRFQTPQDQVKILKNLRKFNKIDYIESTRII
FT                   ANEKIMQLFELLENALLRELEIHFDLEDYIKTKQFVNILIDLNNNNNNNQQILIDFFLQ
FT                   KSIFDENIELFNLENYDEMKYFKINEKRGEEEEKIDSIEKSINNDGIDELIINIAKVFN
FT                   QQSHIIDLIFPQSIPMMYKVSEELISNQLSELLMLLIESSKKFGLYSELVPMIYEKLTM
FT                   NLFIEKLNPSKNVGESYHQLIIELTDMSFESFTAEYMREEVGSFKNNTKRKLLDWEQLI
FT                   SKREQETSQKILDRVKIETKNDFLTSFKNVFTINSSKNKQPIDNSKHSHDDNSQSQEEV
FT                   EAYSEIQAKAKILSENIKSLDKIFNPELTVEILNDCRISIHRLLKFQNFSIASVRQDIF
FT                   QSIQNCFVELIELINSDHLLPGFDRALTYLQTYNPKSSTYTKSHNETFDQPLILFFNLI
FT                   NMADIIIQMIDIFYKQEILITQQNENSILNPSLQNKKKLEAIVDKYVADGLNIGIEILI
FT                   DQVETIYQQNLSDKDYYPDQQEKQQQQQQQTESEQYSQAIPIPTPSKPNTLSNFGPTEA
FT                   AIKATEILEQNMNLLVDSADKSIVDVFQQEIAERFFQIIVKSLKLQTISVMGATRLISD
FT                   LNLYFKFINNNVKSNKRLILPLYQALIKIGNIYLISGDDSKSIGKLVSDLSKFNGIFSQ
FT                   EEIYEFVQRRQDWSIIKKHVEKVMYGFGFGDCTIS"
FT   CDS_pept        401938..404343
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094176" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569399"
FT                   /orf_name="CD36_51610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41544.2"
FT                   /db_xref="HOGENOM:HBG397283"
FT                   /db_xref="UniParc:UPI000192DA14"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA2"
FT                   /transl_table=12
FT                   /translation="MNSSFIIKVPIRSYLPEQFLRRSVTRVTPSLLIYISKRHNSTTQQ
FT                   QQQQEEQVLLLEPQDRFNYIKSLKSRKEIRKNLNRIYRLKNINFTKELIELNEYDYDYE
FT                   HKYKSILNRISKDYLYEDICELILEGDLSTLKRINLKNIRPKIDSEDHNSSSQSNDASD
FT                   TSIGEYINKFLLILINEGEYIKAIKFMIRFINKYKDEIPLPIIQYETFQFLLNQIDNNS
FT                   TIDDLSMINYGLLQICVNHYQGIEELKDYEMLLLLKIFNKNLIHGNYFSNYYYDWLLIK
FT                   NCEFLNFINNEKYSKLYFQLICQMLKTNLINLNSYRCLTIWKDNQKFIINKIIGNNEDD
FT                   DKKVEIIDEILLNEFLDIMIEIFKLFTDKNQPILNNDVTLILDKFSEIDRINQNDKFIN
FT                   YKLQFYGTIVKNQQIFGNIITNQLNSSGSSSSSTTNKNKNVDGLTINKKFINRKNLSHL
FT                   FVGFLNLNDEINSNKILETIHKQYSNPNIYYSTGTGTDNNNNNNNNNNNNNNNNDNSFL
FT                   NQYEINEIIKKLLTSHNDIIKSLELIENLSWNHCKWSYLEIFNYILVNATSEQQKDVEK
FT                   FLKDFQLRLVENFKDEIFLEELTIIILKHISIMDNRDAIRLYNKILKLSSNTSVVIART
FT                   SSTSSTSFINNKPNEPPILEPQPPPPQITNNTRGNLNTSDISLFEYLNIEEIFDKYTLK
FT                   SRNKKLRKSLLINERIKYLPDWLINKNYLKLINKNSMIKICLNLLIQSIIEKDYYCIIW
FT                   LFDELRKFGWRIEDILWYCNSYDLQDYLQEIINEKVLLHYKLKHHHHH"
FT   mobile_element  complement(404394..404725)
FT                   /mobile_element_type="retrotransposon:solo LTR, upsilon F"
FT   CDS_pept        complement(404910..405557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228674"
FT                   /orf_name="CD36_51620"
FT                   /product="Mitochondrial ribosomal protein, large subunit,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41545.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG397282"
FT                   /db_xref="UniParc:UPI000192DA15"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA3"
FT                   /transl_table=12
FT                   /translation="MLIKRIISLKSLPISVISTRSKSTTSSSSSSSSSSGSSSPYGDVN
FT                   LSNRRIMKRIIQGKARPAIFYQFETLIELSDGSVIKRYSQAPKDEIRMINDQRNNLIWN
FT                   PNNNDLINGGGLGGGDLQAKGKINKFKSKFANSFEEGEREEQQKEVVVDEGEGEREGEG
FT                   EGEVDEEIIRRKQLELQKARDEELFELMGENAQEVDGGGKLYDKKADKKRFK"
FT   CDS_pept        405896..407566
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381519"
FT                   /orf_name="CD36_51630"
FT                   /product="Subunit of the cytosolic chaperonin CCT ring
FT                   complex, putative"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41546.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000192DA16"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA4"
FT                   /transl_table=12
FT                   /translation="MAFSNQTPTIVVLKEGTDSSQGRGQILTNINACLAIQDTLKPTLG
FT                   PFGSDILIVDGNGRATISNDGATILKLLDIVHPAAQMLVDISRSQDCEVGDGTTTVTIL
FT                   AGELLKEAKNFIEDGMNPHLIIKGYRKACQLCIEKIESLSIDILTKDNGNDNDNLEFRD
FT                   LLEKCATTAMSSKLIKANSKFFTKMVVDAVLTLDQNDLNENLIGIKKIPGGSLEDSLFI
FT                   DGVAFKKTFSYAGFEQQPKSFKNPKILCLNIELELKAEKDNAEIRIDQVNQYQEIVDAE
FT                   WKIIFDKLQSIYKTGAQIVLSKLPIGDLATQFFADRNIFCAGRVNDDDMNRVIQAVGGD
FT                   IQSSCSNLLKDGKLGQCESFEEIQIGNERFNIFKGCPKTKTCTLILRGGAEQVIAEVER
FT                   SLHDAIMIVKRSITHKKIVAGGGAIEMELSKYLRDYSKQIHGKQQLIIAGFAKALEIIP
FT                   KQLCENAGFDSIELLNRLRSYHAKGETWYGIDFQLENIGDNFKNFIWEPSLVKINALSS
FT                   ATEAATLLLSVDETIRNDEQDQQQQGQPQMAPGRGRGAF"
FT   CDS_pept        410367..412544
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228675"
FT                   /gene_name="CLN1"
FT                   /orf_name="CD36_51640"
FT                   /product="G1/S-specific cyclin, putative "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41547.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG397281"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="UniParc:UPI000192DACE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA5"
FT                   /transl_table=12
FT                   /translation="MASLQQQQHQQPLKVKYGPPHHIKRRPYHPILESLEFQSNQQLIQ
FT                   EYSSDIINTLSHLESLTLINPAMIDLQPEIQWFMRPFLLDFLIELHSSFKLQPTTLFLC
FT                   LNIIDRYCAKRIVFKRHYQLVGCTALWIASKYEDKKSRVPTLKELTIMCRNAYDEEMFV
FT                   QMEMHILSTLDWSIGHPTLEDCLQLAIDSNNFSNNNATTTTTTNRKSSISSAVTAVARF
FT                   LCELSLYDKYFLSVSPSLIAITANLLSCSMLQIPHASITLKNLIEQEIINPQKIQIQRQ
FT                   KQQKQQQRQEQQKKAKVTPNYIHHNQLDARHSSIDEDIDLDSEEDDEDDDYIDEFYETN
FT                   YYNNNNDDTNITTFDEDINNSTNIINDENQPPKIHTPFLSGLDEDSILSIKKICLMLII
FT                   QLSKVTEVLSKKYENLGVIQVINNFHSNYKFIIQSIYENQELLLNSLINDTNTNNGNVN
FT                   EIDYKLIQSSEILLQFPKFDEYLTEDEDENVSTDDEDDTNESQGYNDNTTNNNNQLFTP
FT                   KSPNVFSSNSSLTLNNNNQHPQFQSMVPITPPSATSQYSLFSNKNNRIHESTSGLNSTC
FT                   NTPTHISINSFAPPQPPPGSILKPKLTSTNNNNNNNNNNNNSTNNSSSNLKIKKLTINN
FT                   NSSNISIKQEKRYSHISIGSNNSNNSTSNISNISNISKYDGFSPIKSISTNGSFTNITT
FT                   SSSSPLMNQYHQQQQQQQMNQSSIYQQHNYH"
FT   mobile_element  413412..413928
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon G"
FT   mobile_element  complement(413965..414584)
FT                   /mobile_element_type="retrotransposon:solo LTR, moa C,
FT                   truncated"
FT   CDS_pept        416732..422605
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569400"
FT                   /orf_name="CD36_51650"
FT                   /product="Type II myosin heavy chain, putative "
FT                   /function="ATP binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAX41548.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="HOGENOM:HBG397279"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="UniParc:UPI000192DACF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA6"
FT                   /transl_table=12
FT                   /translation="MVSSSRTNDNNHEDPIISKNWVWVPNQQDLFTKGYITDYLPNGKC
FT                   KVNVVKGQEASHDSTIVVDQDKLENCNPVKFNKCEDMAELTHLNEPSVVYNLYLRYLDD
FT                   LIYTYSGLFLVAINPYKSLPIYNQSILMKYHQYNNVTTNNNDYKSKNSQNLTSTNNTSN
FT                   NNNKGQSPPHIFAVAESTFRNLLSNKKDQSILVTGESGAGKTENTKKIIQYLSSITSSN
FT                   HGNKVDNNNIDTKILQANPILESFGNAKTIKNNNSSRFGKFIQIYFSNTGEISGANINY
FT                   YLLEKSRVISQSNHERNYHIFYQFLKGYENLPSLGLNKDMSTYNYLSGGKLTINNVDDF
FT                   KEFNLLVEAFKIMGLTINEMNFIYQVLAIILHLGNINFTSWKSEQANFTNDSPIDKICE
FT                   LLAIDKDLFVQNLLRPKVKAGREFITKSKKPNEVKFAIDAFAKYLYEKLFQFIITKINE
FT                   KLDQSNTGNDNSNKNNDNNFFIGVLDIAGFEIFEINSFEQLCINYTNEKLQQFFNHHSF
FT                   ILEQSEYLRENINWEFIDFGQDLQPTIDLIETKQPMGILKLLDEECLMPKSSDASFMEK
FT                   LSKNFSNTHKKFSENKFKNGFIIHHYAGKVEYNVENWLQKNTDPISESILNLLPDSQNE
FT                   LVAEMFINDPHINRPQTNGGGNSKLITASQKHKDQLKTLMDQLESTEPHFVRCILPNLE
FT                   KRANKFDKNLVLGQLRCNGVLEGIRITRAGYPNRMMFDEFIQRYSIICDNELSSSQART
FT                   NCEIILKYVKLNPEDFKVGLTKIFFKNGILGKLEIIRDLALKNIFTDLQKVIRGNLTRL
FT                   ILKQKIKEIQSAQIISRTMVTLDEIKSNSPWMTLFFHVKPLLEDSVKVLDSKKLQENLQ
FT                   TLTVKLKDSEKLTKGLEMDNEKLREQMNTLQDEMINITSIAKEKDDKLSQLRLTENKSK
FT                   HRIETLEIKLKDFEKQNQDLINEHEKLTRRSLELHDKHNEKVEELNSLNKLHDAAQSEL
FT                   SNLKQQLKEITKLKQDHSKELLKFKQMHDKSIEDSNEKMQRLESLNKKLKADLNSSKDE
FT                   ISNEHGKLQNEIIKLKELCSDYERKQKDSQRTIDSLQIQLKKDEDYKSKYDLKIEEAKE
FT                   KVTLLKGKVEKKSQEIDQYKSEIKNLKTELASSNSKITQLDKSTKELAVLKSKESKYIE
FT                   EMESTKQQLSKKIEEYSSIETDYNRLQIELKQMKQTNTEYGTRIAELNSQLSQVTEEAK
FT                   SKEIEKENQPPNPQFMEEFTHMKLKVNEQTASLRKEKFENKKLSEELQMLKERIMNGSL
FT                   TSMDLTPKRRSLAIGDKSMITNTVDSFNKEIENLKFQLQQEQGNFQRAENYAIELQKKL
FT                   NKLLTTRGLNTNTDYEKKFYESQKRITQLESKIGKLLANSGGDYDDTDIDGNDDDWELR
FT                   SSTGVGGGGGGGGSTSSSARNSLVKSESITAFHNMRGVSQDYIQIYQDITKTLKSTREE
FT                   LNASKTEILRLKALLRESEDELYQVKQENYKASVHDYEQDLAQLKVKHETLLSRNKDIN
FT                   ESLEIYKKRSDEYYKKLELAESAIVISKRHEEQATKEMKESKSQLLLVREELRTSSILI
FT                   KDFRIKVGNLEATIEEKNHQLDSNKEELKQLQDKLNYHLKNFENKELNEKLKEEIKNLN
FT                   RDLDFKTDIETKLIKENKKLQLDYEDILLVKNNLQNEVEELILQEEKLQNKIDELTNTN
FT                   RQLENEKLINERKIVNCTKQISGLKELVDEISIERDKLLKDKDILQNDLQNMTTKFDST
FT                   TTELKQAHGELDFLKKHLEIQREDSEAIKTELNQSKMSTSFDIRDQQKLRNELLVTKEE
FT                   NFSLSKTNKELNLKVSDLEDKLYSNEQLKYWESKVDTLSKALDGALNEKHESDKIIKDL
FT                   QRTIKQLEIRVENESQLSKRYNDENFDYQNKINHYKSTIDIIHNENIEKDLQLKSIQRE
FT                   NIEMKESMLMLQKEVLELRERLQV"
FT   CDS_pept        complement(422745..424310)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000206848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381520"
FT                   /orf_name="CD36_51660"
FT                   /product="Mitochondrial-processing peptidase (MPP) alpha
FT                   subunit, mitochondrial, putative"
FT                   /EC_number="3.4.24.64"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41549.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG333374"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000192DAD0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA7"
FT                   /transl_table=12
FT                   /translation="MLSKRTITKKLNKSISTALLSFPRYNHSITTTTTPASSQPHIELT
FT                   TFANGLRLITDSTPGHFSAVGAYIDAGSRYEDPKAPGLSYLRDRLSWKSTEDFTGQQML
FT                   ENLSKLGGNYMSSGQRESMIYQASVFNKDIDKMVGMIGQTIRYPTFSDQEFQEALQTAE
FT                   YEVAELAYKSDLYLPEELHTVAYKENTLGLPLFIPQERIPLVSKSDIVNYNNKFFQPQN
FT                   TVIAMVGVPHEYALKLIMENFGDWENKTTTKPNLGIKNYTGGEISLPYTPPLYANLPEL
FT                   YHIQIGFETTGLLNDDLYALATLQKLLGGGSSFSAGGPGKGMFSRLYTQVLNKYPFVEN
FT                   CMSFNHSYIDSGIFGITLSLVPEAAHVSSQIIAHELSQLLVIEESQGGMNSKEVQRAKN
FT                   QLISSLLMNVESKLARLEDLGRQIQCQGKITTIDEMVDKINRLTIKDLQNVAEKVLTGN
FT                   VITSNSGTSSGLPSIVMQGEREAFGDVEFILRKYGLGNFKGPEITEPRDFSNQNTKEKK
FT                   SRWL"
FT   CDS_pept        complement(425105..427927)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228676"
FT                   /gene_name="HYR3"
FT                   /orf_name="CD36_51670"
FT                   /product="Hyphally-regulated cell wall protein, putative "
FT                   /protein_id="CAX41550.1"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniParc:UPI000192DAD1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA8"
FT                   /transl_table=12
FT                   /translation="MIPNLAVTLLLLANSILAVDITSNRVDHGTVQNINGNVRIHSGAY
FT                   WSLIDNSLTTFTGGLQVDSDAGLYIKSNGPVLSLNVNLASLIDPVLNDGIISFDSRKST
FT                   STSNYNIGGSSFTNNGEFYIASSGAGNSVSNLYARKWTNNGLIVASQNQRSSGLFSIGT
FT                   AGQSITNDGQICLYNQVFRQNTKVEGSGCITADENSSIYISNALTPISQSQSFYLADSK
FT                   SSLIVQAVSSNQTFNVYGFGEGNKIGLTLPLTGTASNLPYEYNTETGILTLRAGLLPQS
FT                   FNIGTGYVTSLFSVVTDNGAGIPDAPKGAVTYSGPIPSRSIPDVCKQECKKVPDTPEDA
FT                   PSSSSSAEPSSTAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSS
FT                   SAEPSSSTEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEESSSAEES
FT                   STAEPSSSTESGATSEYTTTWTTTNSDGSVETDSGIVDQSGSSLTTISTFPGDQTSEYT
FT                   TTWTTTNSDGSVETDSGIVDQSGSSLTTISTFPGDQTSEYTTTWTTTNSDGSVETDSGI
FT                   VDQSGSSLTTITTFPNDGTSEYTTTWTTTNPDGSVETDSGIVRQSGSSLTTISTFPGDQ
FT                   TSEYTTTWTTTNSDGSVETDSGIVRQSGSSSTTFTTFPHGSDAGKSTVYTKSTVTATIT
FT                   HCSENKCSEDVVTYFTTVPCSTEGVNTDAQPTDDSNKSTVYTKSTVTATVTHCKDSKCS
FT                   EDVITYFTTVPCSTVAATTEAVATGDNSNEGSNNGSNNGSDHGSDHGSDNSSNNSSNNG
FT                   SDHGSDNSSNNGSDHGSDNSSNSGSDHGSDNGSNNGSNNGSNNGSDNGSNNGSDHGSDN
FT                   GSNNGSDNGSGNGPKPETTLAVVTSPGSTTGSTPSSGPTVAANENGSSNVSVGKTMLFG
FT                   FLATVFVLFI"
FT   mobile_element  complement(429997..430253)
FT                   /mobile_element_type="retrotransposon:solo LTR, iota E"
FT   CDS_pept        434363..436150
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569401"
FT                   /orf_name="CD36_51680"
FT                   /product="GTPase-activating protein, putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41551.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG397500"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000192DAD2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHA9"
FT                   /transl_table=12
FT                   /translation="MVTTENVSSDIKITTTPNELLDPNNNISTLDKTNHQRNESSYSQN
FT                   FSFLREYDIDSPSHRNSMSEDEIDQELPDPSFLNEIDNLELLQGTSNDDSSTPTNNYQS
FT                   SEEEIKSNRDSFVKPTNSETDEQILKSDYDRYGFKKTSSVTGLTLDEYNEWFKSYSQYS
FT                   QTRKKKWLILMKNNGLHVNDSDTESYNNNNNNVPTRFPPRSDKVKKMIRRGIPPEWRGN
FT                   AWFFYAGGYEKLSKNVGTYEKIVKATYNVKTKDTEVIERDLNRTFPDNIYFNSSIKGIF
FT                   SSMETLQQEKEHETLLIKSLRRVLVAFAQHQPQIGYCQSLNFLAGLLLLFMEEERAFWM
FT                   LVILTERIIPKVHSANLEGVHTDQGVLMLCVKEYIPQLWQVLGKNFDGETLSEDKILSR
FT                   LPPVTLVTSSWFMSLFVGILPIETTLRLWDILWYEGSKTIFRFSLTIFKMCSDSPEFNI
FT                   KQNRRRDGGESEQIELFQFMQNFPKKILDANLLIDFCFKKIGGYGFGSLSQDEINKCRA
FT                   FVSKQREKMNKKSNQKGLTDMTDEERNTLLKSSTGFETSDIHDVYGFNRSIMSGMVWNK
FT                   NISNKMKKKFVVGKRNSSR"
FT   CDS_pept        complement(436170..438572)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569402"
FT                   /orf_name="CD36_51690"
FT                   /product="Folic acid synthesis protein, putative "
FT                   /EC_number="2.5.1.15"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="4.1.2.25"
FT                   /function="2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine diphosphokinase activity "
FT                   /function="dihydroneopterin aldolase activity"
FT                   /function="dihydropteroate synthase activity"
FT                   /function="kinase activity"
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /protein_id="CAX41552.1"
FT                   /db_xref="GO:0003848"
FT                   /db_xref="GO:0004150"
FT                   /db_xref="GO:0004156"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="HOGENOM:HBG754410"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="UniParc:UPI000192DAD3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB0"
FT                   /transl_table=12
FT                   /translation="MLKNDTVFTKEISCTAITGKDAWNRPTPQPITISLSFNTDFHKAS
FT                   ELDNLKYSINYAVITRNVTEFMKSNEHLNFKSLGNIAQAISDIGLDQSRGGGSIVDVTI
FT                   KSSKSEIRAESVEYKINRNILDQPIPLDIFQVNKLRLLTIIGVFTFERLQKQIVDVDLQ
FT                   FKIEPNSNLYFHQIIADIVSYVESSNFKTVEALVSKIGQLTFQKYREGIAEVVATVTKP
FT                   NAFSHVEGVGVSSTMVKGNFQNMEPIKFDNMIAQTNNSTFNLPVENEKTDDYTGYHTAF
FT                   IAFGSNTGNQVENINNSFELLKEYGITIETTSSLYISKPMYYLDQPDFFNGVIKVNFQN
FT                   ISPFQLLKILKEIEYKHLEREKEFDNGPRSIDLDIILYDDLQLNTENLIIPHKSMLERT
FT                   FVLQPLCEVLPPDYIHPISAESLHSHLQQLINDKPQESVQESSDLLQFIPVSRLPVKDN
FT                   ILKFDQINHKSPTLIMGILNMTPDSFSDGGKYLGKESDNIVKQAEKLVSEGATIIDIGG
FT                   VSTRPGSVEPSEEEELQRVIPLIKAIRHQSSNSDLSKVLISVDTYRSNVAEQSLLAGAD
FT                   IINDISMGKYDEKIFDVVAKYGCPYIMNHTRGSPKTMSKLTNYESNTNDDIIEYIIDPK
FT                   LGHQELELSPEIKNLLNGISRELSLQMFKAMAKGVKKWQIILDPGIGFAKNLNQNLAVI
FT                   RNASFFKKYSIQINERVDDDDDDDDDDDVTIEHKYLSFNGACVLVGASRKKFLGELTGN
FT                   EVPSERVFATGATISACIEQNTDIVRVHDVKEMKDVVCISDAIYKNV"
FT   mobile_element  438796..439226
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon H,
FT                   truncated"
FT   CDS_pept        complement(439464..442391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094177" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534342"
FT                   /orf_name="CD36_51700"
FT                   /product="Zinc finger-containing tanscription factor,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41553.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397291"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192DAD4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB1"
FT                   /transl_table=12
FT                   /translation="MDPLLHSHEKQQPVVVNGSNIHQNNARNPSLASTGTSNSTISQSP
FT                   SPSEDEKPVTRKKRTRIAKACQYCRKKKVKCDGCQPCSNCQQSNFGNCEYAVDENKKPK
FT                   ISKKKSKSLKNRSSKFQISKSIDERLSKIENTLAQLLNHIDTNNNTPTPTPTSNSTTAN
FT                   DKQTETDKYSFSPLPMAIEKEVTDESNQKYDPKVESNFLGSHSVINIFSKKSVEWLLRP
FT                   VIDKFKDDIEDFKKIAWVYEYYTQAFLDTISQPIKARISRRNDLMDNTFVDVTIPLEIL
FT                   SCYDDIFLVSYVCKGDYIRNLFQTYFEEPDQDGSRRRNFLWSELLAMTAAIGICISVLI
FT                   DDRNNTKETEKPKYSCSLSNQQLIEINFKCFYSMIFYHRRLCVISEGFPTITGFILLIM
FT                   YFDFAVPVSQITFLAVSTTIHYAKQCGLHRQETYKDMSWEEQRTRRVLWWFCEYLHTEY
FT                   CFQKGYSLEIGDEDMISFSDDDTTTNAIVKSNWHLISSALNSENPIDALTINEIRENKA
FT                   NHICASYIMHSLSKIRAESYQLLYSTSAQKKTLSSILTSVEKLTADMESLYKESCSVMP
FT                   VQSVSGYAKNTEIVLKLDNGYENVLMIQFEYFLHLMTINRLSLQDFPNDVDHRDLTDKC
FT                   LYHRNIANRSARTILHIAKDSTEKKVQFIIINWFSYAIFAAFAHLGSMCLEDPQNPVVL
FT                   EDIDLLIGISYSVFSFEDKSFKVSRFALKRYVYDMLTRYILKLYFKVTNEQTRNMFYTK
FT                   YKDLDDHLHLEKTFHEFFVNGNPGVDSTKTYRTLSKLFRPFWLKPHERSKRAQVNPDDT
FT                   GTPLGSSSSSSNGIYWTSTSILSQPSIRNDTSSTFSSQPVNYTQESPRTDAKPLEISNL
FT                   VDPFNAVIDSATKSNGKELPNSFIQQDLSAINAAPMQQPQPQPPFPQPPFSQLPPFPPP
FT                   PPPPPQQQEQQNLPRHQFNTNFNSLEEMIEENYVGDLNFPAMFYE"
FT   CDS_pept        complement(443724..446693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094179" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534343"
FT                   /orf_name="CD36_51710"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41554.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397292"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192DB75"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB2"
FT                   /transl_table=12
FT                   /translation="MDNLPSSETHHSSLDNLTKQQELTGNDPNDTNRKRIRVACDSCRR
FT                   KKIKCNGSYPCGNCIQAKNTNNCHFTERPMRKKLKQIKQENKSTAATNSNGVSKRKHKD
FT                   VFNGDSNNVNTVKQGNTFGIVENKPSDIESRLSRIENSMSRMMHTIESISQNFITQAMK
FT                   SNHSSSSIFNNNSLSPTPSEDFNKSRSDSEEQRTSQTYTNLKDHAKDANELLKLRNWDE
FT                   FVGTHSITCIFSRESLDWMEKTLGAYGEEYLTPIRNLPLVFHSELKPYILKWIDPPVVD
FT                   KLQRKKLLESPFPIDSKLISKLIDLYYEETSMINILVDESRVRSLFAAYYNNFAEPVAS
FT                   KRRRFRLSELLLMTSILLISLSCLTEDDFNEERIATPTSSTSSNYSAASANLLGDYSKN
FT                   KLLALQNSLENSAIFYYHRISVISEGLETVEALLMFIIYVESNWLTSFFNYTIITVTIR
FT                   FAQEIGLHRAETYFNLDIEEATKRRKIWWFCYFFDIEFCFKSGKPPVINTNDVTTNSDE
FT                   DLLRVINQLRQYGPLSPKDRMYSPVCHTISTSLLDLSGADSICLEILRIIQMGDVLDDP
FT                   FYFQFCALLQSRIRSNSYHDLFIASAEKRDFSAISNTLEKLNADMFELAMYLADEAKPR
FT                   FYNDPKFTSVQASNSTTIKRDTILAMKLTFFSHLMIINRYPLMIVTEDSKFDDRVIKFR
FT                   NLSLDSAKTILMLIRGWHRESASALFYNWAIYFPVAAYLVLVAAIINHPQLPESGTNLN
FT                   LLIETSLNFFKSSKQWNSSNNTQKKQQNNTTICVNKIVAIELIVRLMLRVVIKVYELHN
FT                   NVEILANNPTLQNHLQEAQEKFPDIFQNHAEFTSKMVALVGASPFSGGSGNCNGSSCNL
FT                   RDGYASHGQNTMYPSPKVPNNTYNTNISVGSSSTGDHQVYHAQSPSYNASLSNIINNES
FT                   TGRSPATATATAATTMSQPMMNENYDLFNDYLIDNSAVNLPFSQFNNLPNFFFDNNLGI
FT                   "
FT   CDS_pept        complement(448163..450916)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381521"
FT                   /orf_name="CD36_51720"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41555.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397293"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DB76"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB3"
FT                   /transl_table=12
FT                   /translation="MSETNDTLNPVYTQDGEKRLRTKVACDYCRKRKSKCNGEQPCSKC
FT                   SDKNRNCTYTFVQKERKRKQRKSTTAGVENKNNGAVRKARTTSAATIRHLTSRINVLEN
FT                   LLGRLVDKLDPTVKSELSDELQSTSLTNDNNDSRERHNRSSSNSSDNGDEDDEENDLQE
FT                   AHESGDSDGSINYNHNNESNKQIDTKDSNENEVRKLRDMLAPAEKSCVSNIKNRLMQYF
FT                   GSHALFFSISGRAVEWLRSRVQGSNANNMHDIFAPLRHVPLSLNDAVQKSTKLLNGPEV
FT                   ETDKKRQFDDLEKPLIFEIIDKYYKNLYWAPFLCDVSTIRELFQIYFYGAQRNDAAILG
FT                   NITYSDLLIMNIAIVLCLASISKDDVFESLEYPTLSTKSISYLQGELLNKLFQNAMGAY
FT                   GKVSRSSDGIRSLQGLALLILYFEINFVTDFHVNYSITSVLIRYAKESGIHRVETLNND
FT                   NGIDATLKRKLWWFCEYKGVDITYKSGKPILIDMEDVTTLTEVDDFFMSVPTTLFLDSK
FT                   YLENANDIVLNSQIHGGEYYFAYFLLILSRIKAKSYAKVYSKLPMNINIQAALTFVNEF
FT                   DYDLRILTNLMSPILASPPPKDTTFKNPLNLSEGCFNYFKVELLLSQYAHQLSINRVPF
FT                   VKSFGINDSRLIPYGNQSLAGARFMLELIKDIDSLKISPRMYSTLSFYPLAAFCSLLGN
FT                   CLVFPNEPSAVNDSVLLASVAISFFRSEGCNNKIDNKRSIYDILVRLLLRVLIDALKNL
FT                   AKVDLYEKIPELEYHINSMFTLFPEVFANQQDHIISLMSERNSNNENSNQYPSMVENGA
FT                   SSTGSGSSGSSTSSSNTIIDSDYQHMDVDVKNATSLPQSFMNTPGMLNIDNGNVMLMNG
FT                   NYDLFSNINFENIMSDETFNNMIFSELNQLPDFFNSPSSGFNEQNI"
FT   CDS_pept        452144..454501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381522"
FT                   /orf_name="CD36_51730"
FT                   /product="N-terminal acetyltransferase complex subunit,
FT                   putative"
FT                   /function="binding"
FT                   /function="transferase activity"
FT                   /protein_id="CAX41556.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397295"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniParc:UPI000192DB77"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB4"
FT                   /transl_table=12
FT                   /translation="MVTKKASPIFASKEDSNFREALSLYDAKQYKKALKLVDANLKKHS
FT                   NHAESLALKGCIIFQTNGNKDDAKSYIERAAAKNPSNYLVDHLIGLYYRANENYAEAAK
FT                   WLSAAVENGSTNKAILRDLSFMQIHIRDYKNLRDSRQQYLEHAPGYRANWTGVAVAHHL
FT                   NKDYASAVGTLAKIEDIIKDHLTESDMYEQSECVLYKNQLIGESGDFVKALDALQKDDE
FT                   SIKDRLSFLEYKAKYLLLLGEKKEASLVYRELLKRNPDNVSYYNLLETALGTTTQPPEI
FT                   RYKLYQKLNKFYPRSDPPKFLPLTFLPSDSSLFEKAARDYIIPQLLRGVPATFVNVKPL
FT                   YKNPTKLKVIESIVQDFYEHDVPKVSNPTIKVWTCYYFAQHYLYQNDLTAASKYIDIAI
FT                   EHSPTLVELYIIKARIIKHQGDFVKASDVMNEGRLLDLQDRFINSKTTKYLLRANKVNE
FT                   AIDCISLFTKLDENAVNGCKDLHTMQANWVLVESAEAYSRIFHDYQAQLNQLQKIVDND
FT                   KDKNDESLNALVENTEIYRGLALKRFHAVLKNFDIFYNDQFDFHSYCLRRGTPRDYIDT
FT                   LKWEDKIHTTPIFTRALKGLSELYFEIYEDQQKAKANENENGDGNDAVVVKKNSKKQKK
FT                   AKSQLNKKRAELVSKVESEKDDADPFGIKLYHDLIEKDILESLFELFKPLSEEGKNLRL
FT                   TWEVLFRIYLLQGKYVLALQAIKSLNKILTRGDVDKKLKQIGEMVLELSATATNDSNAN
FT                   VAIVKVVEKGLNTAFPDFEKLSNDEFIKLYNQ"
FT   CDS_pept        complement(454589..455245)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569403"
FT                   /orf_name="CD36_51740"
FT                   /product="Protein transport protein, putative "
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="CAX41557.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG323920"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniParc:UPI000192DB78"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB5"
FT                   /transl_table=12
FT                   /translation="MSKFFKSFTSKYSPLSQNDNEDGAPLPPPVTQPGAGSSSSSNQSL
FT                   KTKLQRLNPFRSQSVYLEDDENYVTSDPGMFELSRWDRMLIFALCFAGSICCYLICIFL
FT                   FPILSLKPRKFALIWSIGSILFLVSFGVLQGFKAYMIHLFSSTRIIFTIIFGSSIILTL
FT                   ISSVSLKNTLLSIIFAVIQLLAALWYTVSYFPMGKQTLSLAGNVARGQVDTWINS"
FT   CDS_pept        455490..456164
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569404"
FT                   /orf_name="CD36_51750"
FT                   /product="Ubiquitin-like protein, putative "
FT                   /protein_id="CAX41558.1"
FT                   /db_xref="HOGENOM:HBG397297"
FT                   /db_xref="UniParc:UPI000192DB79"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB6"
FT                   /transl_table=12
FT                   /translation="MSTATALETTNAERKFVNTYLELMQLSKAESLDKFNSTQDYNNLS
FT                   SLGPSLPKCIYKFPEPQNVTEATESRVNLKFKSIKPPFKFQTELTNIPVNFTIYKVKAQ
FT                   LIESLEVLHNAGVTAKDLKLMVKSKVAQDTAVLSTLINSEEPISFNCMVSAPTGVKPVA
FT                   SSTRTDEDDPEVEAASDAVSTTATTIGISEAGWNKIYEIILQDIKDAGKAKELLTKLKQ
FT                   SV"
FT   CDS_pept        complement(456245..456409)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569405"
FT                   /orf_name="CD36_51755"
FT                   /product="Non-classical export protein, putative "
FT                   /protein_id="CAX41559.1"
FT                   /db_xref="HOGENOM:HBG398807"
FT                   /db_xref="UniParc:UPI000192DB7A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB7"
FT                   /transl_table=12
FT                   /translation="MQYPYLISKSLDPIVGVGIGVLSYYSYEQRVGRKPGHSLHELIVK
FT                   KFYNGKDKN"
FT   CDS_pept        456837..457364
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381523"
FT                   /orf_name="CD36_51760"
FT                   /product="Zinc finger protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41560.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG717773"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000192DB7B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB8"
FT                   /transl_table=12
FT                   /translation="MAAVYPRTCYKCGEVGHLADDCQQEERLCYNCHKPGHESNDCPDP
FT                   KQNTAKQCYSCGDVGHIQTECPNQAQGAKCYNCGQFGHISKNCDAAPSSTDHAPSFKRS
FT                   SGRASGTTCYKCGGPNHFARDCQANTVKCYACGKVGHISKDCHSAAGGSNFSAKTCYNC
FT                   GKSGHISKECTA"
FT   CDS_pept        complement(458132..459505)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228677"
FT                   /orf_name="CD36_51770"
FT                   /product="Inositol-1,4,5-trisphosphate 5-phosphatase,
FT                   putative"
FT                   /EC_number="3.1.3.36"
FT                   /function="phosphatidylinositol-4,5-bisphosphate 5-
FT                   phosphatase activity"
FT                   /protein_id="CAX41561.1"
FT                   /db_xref="GO:0004439"
FT                   /db_xref="HOGENOM:HBG397298"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000192DB7C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHB9"
FT                   /transl_table=12
FT                   /translation="MIEYSTKKESDIPLYLFTYNCNKRVIDANVFKSKVSQSLPPKDNP
FT                   SHLYVFALQEFCTILDGSFKASANQQLIAYNELLQIMLFEEYGTDHFQTIAINHTGAIG
FT                   LIIISPYPSKFQNVRLANTSCGYGYSSMKGGVGIRLKYYPDGKYGDNSVELSFAGIHLN
FT                   AYEGEYYYLQRNANLLRIARSLNFGDGYGLIKPNNHVFILGDLNYRTTKDYKKTSVVAQ
FT                   NLLSLADQHSEFNNEYINQLFVQYDELHNALKNGEVLFGFSEGKVDFKPSYKYYINTGI
FT                   YNSKRCPSWCDRILFLSTYETIGNDDLGLQLLRAKGKDSKQKNEGLPVVGKYDCIDELL
FT                   VSDHRPVFAHIEIPFAPPKSIISPMSGCLEIVSTGLTSDESFSELEQLQGIENSTLIES
FT                   GPTSIYLKPTKLDLLIHTIVTPFMDTTIGFGLWFGTTSEGRLVLLIFILLTFSLWYLF"
FT   CDS_pept        459702..461243
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569406"
FT                   /orf_name="CD36_51780"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41562.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397299"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000192DB7D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC0"
FT                   /transl_table=12
FT                   /translation="MSNFIEISRSNIEEIGIIEDSLSKRLLRNPYILPSNLQPRPNILL
FT                   SKVTKPNSTKRISILQQYELVYFKSRYNQIIKRLNHCLTEEKESFSNTLALITEGDDNF
FT                   EKFDEMINGISQNDSIVEGPRRLYSSFSSLNKELNPQDVTLKINKKTGKEQEFVKRKHF
FT                   LSSIASHLKDIEINDILDLHHFHDLYVSNFGPISYIEYLYKFSSFPYSKVNGFYSKYLM
FT                   ELSSFLEASLIKLQPLLDYDELLQRWKTEFDDADEERKSNNGKDRDNLFCKACNKLFSK
FT                   ETVYQSHLSGKKHKKNASQQKPDNFVSSLPWLEYLIGKLCQVLAPDLEYTRAQVEKLSN
FT                   LSERELQLERQVQHDIANEFVAINNELDEDDLSGNEHDNDDDDDYLDNSFKNLPLGPDG
FT                   TPIPFWLYKLQGLHKQYNCEICGNISYKGKTVFSKHFSGPKHQYGLKCLGVDEKNMKMF
FT                   KNITKIDEATELWKVLRKETKLKTTELENSVEVEDKEGNVMSEKDYMDLKKQGLL"
FT   CDS_pept        461460..463229
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569407"
FT                   /orf_name="CD36_51790"
FT                   /product="DRAP deaminase, putative "
FT                   /function="RNA binding"
FT                   /function="hydrolase activity"
FT                   /function="pseudouridine synthase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAX41563.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG395845"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000192DB7E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC1"
FT                   /transl_table=12
FT                   /translation="MPIFKSGQVYPLQTLETLSLLFSRGMKRAASPKAEQPPHSKKVVD
FT                   AKGFRVRQQNIDKHKITSENTATQKSIHEEETEGANYLIEGRLRRVTPYFYTYLTYCKL
FT                   RWQDRKLIDVFIDEFRDRTPDAYRKAVEGGLVKVNSKVANLETILRNGDLISHRSYRRE
FT                   PPVSSREIKIVFEDDDLLVIDKPSGIPVHPTGRYRYNTITKVFEHEMGKIVHPCNRLDR
FT                   LTSGLMFLGKSSKGANNMMSQIRDRNVTKEYIARVKGEFPLERLIVDKPLSTKSPKLTL
FT                   NVVDTENGKEAKTEFQRVSYDPMTNTSVVKCHPLTGRTHQIRVHLQFLGYPIANDPLYS
FT                   SEFVWGENLGKSGEADLDQVMAKLDLIGKSRAATSWIHPQGDGEVALDEICPVTGLPLY
FT                   SDPGPNDLDLWLHAYKYEADDKSWSYKTEYPEWALEPSRKFMEMAIKEAEKCGKTQTQF
FT                   NVGCVLVHNGQVISTGHSRELPGNTHAEQCALEKYFSKNGGEREVPSGTEIFTSMEPCS
FT                   LRLSGNLPCVDRILQTKSIKTCFVGVLEPDIFVKNNSSYKKLLDHGVEYIHIPGYEETC
FT                   LEIAKRGHENIQK"
FT   CDS_pept        complement(463248..464852)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569408"
FT                   /orf_name="CD36_51800"
FT                   /product="pH-response regulator protein, putative "
FT                   /protein_id="CAX41564.1"
FT                   /db_xref="HOGENOM:HBG397300"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI000192DB7F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC2"
FT                   /transl_table=12
FT                   /translation="MYWKNAWWVGTVYSSCEPIELPEGMIISKQFEKYPISVVSKAIYK
FT                   QLCYRNCIPVLNTNVGFVIDTFAKPLPIVTESWREFTRDSLRGSFAYSVVSIIYAIAVS
FT                   AVIIWFLTIFVLTNYTIKPSWLLKTSTILSTVYILVVVIKSILILHGQQRDGYLHGAKL
FT                   LSELNDYNPIQIIDLIVVLLLQINQVQIIMRIFQRQKDKRMALLIGIVATLASQVIWAI
FT                   AQFYTPADANEASDILPAFIYLVRIAMALCYAAIITVFFISKIQIILANKKIWLLTLLT
FT                   FILIYSPVAFFVADVSNAFVYELSEIFSVVNYVIGVVIPWEWCNKFNLIMKAKEKEGVL
FT                   GRRFYEDELYELDRFELFVEEQIPEDEDNSDTHSDPPDNELNGGAHHNNQEQREGLIRR
FT                   NSPTNKLHGDNNDNDNSVPASKFRRILTTTKDAFLTLTDNIIAAGFAIPRSVSVSTQSL
FT                   TGRHRNNSTTHAEYTQEVVPDFCPEMFLHPEGNSHIAESSSEQNAAPLTTTNSNHRRRN
FT                   VYVYSRKEVILDVSSDE"
FT   CDS_pept        complement(465488..467371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569409"
FT                   /orf_name="CD36_51810"
FT                   /product="Electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase, mitochondrial, putative "
FT                   /EC_number="1.5.5.1"
FT                   /function="electron-transferring-flavoprotein dehydrogenase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41565.1"
FT                   /db_xref="GO:0004174"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG291987"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI000192DB80"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC3"
FT                   /transl_table=12
FT                   /translation="MLIQSLLSRVGSRRLLPRSLPPLRNPINYTPFIRRLHQSWTRYNL
FT                   TSEQEEILHQERARDYVDVCIVGAGPAGLSTAIKLKQLDNEQGNGDLRVIVLEKAGDFG
FT                   SHIVSGAVIEPHAFKELFPDSELTEENGIPLPSDIITKVTSDHMKYLTPKKAFPLPEPP
FT                   QLTNKGKNFIVSLNEVVKYLAEQAEELGVELYPGISVNELIYNEDKSAIKGVITQDMGV
FT                   DRNGAPKDSFEPGMEFFARLTVLAEGCHGSLTKNAIGNFNLRENSEPQTYGLGIKEVWE
FT                   VLPENFDKGYVGHSLGYPLTSKEYGGGFIYHFGDGLVAVGLVIGLDYANPYISPYQEFQ
FT                   KMKTHPFYANTLKGGKCISYAARALNEGGYQSIPKLHFPGGILVGCAAGFVNVPKVKGT
FT                   HTAVKSGIVAAEAILSTFKQMELDPCDEDNFEELSTPIDLHQYEENFKDSWAYKELYAV
FT                   RNVRPSFNSPLGMVGGLVHSGLSTMITQGKEPWTLSHHGTDSGATQDANQFQPIEYPKP
FT                   DNELTFDILTSVSRTGTYHDEDEPCHLKIPNQDSRKHTELNWIKYKGVEQRFCPAGVYE
FT                   YIEDESEPLGVKFQINSQNCIHCKTCDIKVPSQDITWSVPEGGDGPKYYMS"
FT   CDS_pept        complement(468210..470753)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569410"
FT                   /orf_name="CD36_51820"
FT                   /product="Guanine nucleotide exchange factor Cdc24
FT                   homologue, putative"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41566.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG397301"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010481"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192DC1B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC4"
FT                   /transl_table=12
FT                   /translation="MEHPPPALRSFSTQSTSSLNSASTVSSARIVSSGPVNINNFNKQS
FT                   TPKDHLFYRCESLKRKLQKIPGMEPFLNQAFNQAEQLSEQQALALAQERSNGNGHSNGK
FT                   RHQSLDGAMNRLSVGSDSSSIQGSLTRMATNASASSLISGMPNNTLFTFTAGVLPANIS
FT                   VDPATHLWKLFQQGAPFCVLINHILPDSKIPVVSSDDLRICKKSVYDFLIAVKTQLNFD
FT                   DENMFTISNVFSDNAQDLLKIIEVVNKLLSEYSNVGDTATDSGSADEDVNMDVQITDER
FT                   SKVFREIIETERKYVQDLELMCKYRQDLIDAENLSSEQIHLLFPNLNEIIDFQRRFLNG
FT                   LECNINIPIRYQRIGSVFIHASLGPFNAYEPWTIGQLTAIDLINKEAANLKKSSSLLDP
FT                   GFELQSYILKPIQRLCKYPLLLKELVKTSPEYSKQDSHGSSSSTSFNELLVAKTAMKEL
FT                   ANQVNEAQRRAENIEHLEKLKERVGNWRGFNLDAQGELLFHGQVGVKDAENEKEYVAYL
FT                   FEKIVFFFTEIEDNKKSDKQEKKSKFSTRKRSTSSNLSSSTANLLESINNSRKDSTLPL
FT                   ELKGRVYISEIYNISAPTTPGSTLIISWSGRKESGSFTLRYRSEEARNQWEKCLRDLKT
FT                   NEMNKQIHKKMRDSDSSFNTDDSAIYDYTGISMSPVNQSTQQQYYDHRTSHGSRHHSSS
FT                   STLSMMKNNRIKSGDLSRISSTSTTLDTFSNNMNGSPNTTNPSLTSSEATKVTPTFDVA
FT                   IKLLYKSTELPDPLIVNAQIEYNDLLQKIISQIITSNIVADDIHINRLRYKDDEGDFVN
FT                   LNSDDDWGLVLDMLTGEDFYQTSGNEKRSVTVWVS"
FT   CDS_pept        complement(472231..472905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569411"
FT                   /orf_name="CD36_51830"
FT                   /product="Secretory pathway protein, putative "
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX41567.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG397303"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI000192DC1C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC5"
FT                   /transl_table=12
FT                   /translation="MKISVVTPLLLTFLSLTTAHGGHEQESLKIKPQDLSWQDWHMKEE
FT                   HGLEEYDGKTFFILHDLNNNGILEPKEILNLYGLVHKIIIGDGSGMGQDKIEVTPELQK
FT                   QAVENIFELIPHGNPEGISQIEWLKFYENGGRLPDLGYGPGHHLGFEEEYEEHHWRKYH
FT                   ANDDPDVKVKHKEDIEHELLHHQQEIEETHDRSSRLKKFVGDYWSEINIENLKPKYRKQ
FT                   QK"
FT   CDS_pept        473542..473931
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381524"
FT                   /orf_name="CD36_51840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41568.1"
FT                   /db_xref="HOGENOM:HBG397304"
FT                   /db_xref="UniParc:UPI000192DC1D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC6"
FT                   /transl_table=12
FT                   /translation="MARNENTISDSPISTCVTTKSHDKNYYLSLMNPQLMYIQDIVFLR
FT                   NDHYFSSSSSSSSSSSSSSSSSSLSFVNRDLFLSIYDPLKVLQCHEKEYYVRYHHHKNN
FT                   SSHIIEFWIAKPFVDTLEERLEKIS"
FT   CDS_pept        complement(474335..475909)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569412"
FT                   /orf_name="CD36_51850"
FT                   /product="Acetyl-CoA hydrolase, putative "
FT                   /EC_number="3.1.2.1"
FT                   /function="acetyl-CoA hydrolase activity"
FT                   /biological_process="acetyl-CoA metabolic process "
FT                   /protein_id="CAX41569.1"
FT                   /db_xref="GO:0003986"
FT                   /db_xref="GO:0006084"
FT                   /db_xref="HOGENOM:HBG289696"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="UniParc:UPI000192DC1E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC7"
FT                   /transl_table=12
FT                   /translation="MSAILKQRVRYAPYLKKLRTGEQCLDLFKHGQYLGWSGFTGVGAP
FT                   KVIPTALVDHVEKNNLQGKLGFHLFVGASAGPEESRWAENNMILTRAPHQVGKPIAAAI
FT                   NDGRTQFFDKHLSMFPQDLTYGFYTKNKPNGSNLDYTIIEATAITEDGSIVPGPAVGAS
FT                   PEMISVSDKIIIEVNTKTPSFEGIHDIDMPVNPPFRQPYPHTSADFKIGKTAIPVDPEK
FT                   VVAIVESTSGDKVPPNTPSDEQSRSIANHLIEFLEHEVKQGRLPANLHPLQSGIGNIAN
FT                   AVVEGLASSNFKNLTVWTEVLQDSFLDFFESGSLDYATATSIRLTNDGFKKFYDNWDTY
FT                   SKKLCLRSQVVSNSPEIIRRLGVIAMNTPVEVDIYGHANSTNVMGSRMLNGLGGSADFL
FT                   RNAKLSIMHTPSARPSKVDPTGLSCIVPMASHVDQTEHDLDVVVTEQGLADLRGLAPKA
FT                   RAKVIIDNCSHPDYKPQLQEYYDRSVFYATKKKTLHEPHILRDVFKMHLNFQENGTMKL
FT                   DSWDKKF"
FT   CDS_pept        complement(478681..480897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248338" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077288"
FT                   /orf_name="CD36_51860"
FT                   /product="Bud site selection protein, putative "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAX41570.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG397305"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI000192DC1F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC8"
FT                   /transl_table=12
FT                   /translation="MSSTPKLTTQTHAQYSDQDGFQQLTTQIDSTITNLKQKRDYLQDQ
FT                   LVQFESVHQGLKASGDSTTPIKFQLDDGTMIEKTKSEAIEFLDKRVTEIKEALTQFNTK
FT                   INEAESTKEKLNQYNQFVQEGGNHEDLQQDKLNEEGLPFVDIQEELDEDGNVINVEFKD
FT                   VQKDTAIDKSQNNTHETPKVEMLEEKIDETKKLDKIEQSENDEFQALLEDMEIISKDKK
FT                   AQELNFDQDDLLDKIDKLQISAEDKFKLKQVCVEEFKNLEPEHDTGDKIEENSGGDKTI
FT                   GNFENLAIDKNDLIELELLADDFDDSETFQGEHYDDDEEWDYEFDEEEEEEDDDDIADE
FT                   LLYGGGRAKIIGSDEKSNNMLWDQIINLRKNKLVATDKVADEIEENAGNEKKPKAVRFA
FT                   EHLDINEVENISESLRNPPPETAKISLFKQNRMTAQHKNRTQEIKETVENDSVMTDVSE
FT                   NDVMSDIVEKEPVMTDIIEKNDDNDDEIVDSGGVVESTIIEHEPVATVNEPTPEVRTGT
FT                   VSQKPVSRFKAMRSSIPSKNTEKLNSQAPAKIPIPGNAENEAEPSESSTSLSVSELRDL
FT                   QSDMDKMAQAYVSGMYDDDIVTEGPVVHKLDDFETLNKMVEAKKQDNEELGIQEHDAVS
FT                   NEVGMEIDEEEEEDDDDDDEGPILVDEIVENELDESNGVFNDEVILDREIRENYHKLRN
FT                   KLILDQNGFKKTQQELEMEPVDEEGNPIKISRFKAAKMNRGGLS"
FT   CDS_pept        complement(481166..482224)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569413"
FT                   /orf_name="CD36_51870"
FT                   /product="ATP-binding protein, putative "
FT                   /function="ATP binding"
FT                   /protein_id="CAX41571.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG326130"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI000192DC20"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHC9"
FT                   /transl_table=12
FT                   /translation="MFGQIVIGPPGSGKSTYCHGMYQFMSAIGRKSCIINLDPANDRLP
FT                   YPCELDIRDYISLEEIMEELDLGPNGGLMYALESLDKQGIDLFIGKIEQLINESNYLLF
FT                   DCPGQVELFTHHNSLYRIFKKLTQLKRLRLCVVSLIDCIYLTSPSQYISILLLSLRSML
FT                   QLDLPHVNVISKIDMLKNYGDLPFRLDYYTEAQDLQYLTPYLEKESNSVLGQNYVRLTE
FT                   LIGELVEDFHLVSFEVLSVENKKSMISLLSVIDKANGYSFGSEIGGDTIWSEATRQNGS
FT                   GNGGYQDVDIHERWIDHKEEYDAEERRQEQAFKESLPQEEVDNKPLTEDEEWEAALKDW
FT                   EEKHGGEGAMLR"
FT   CDS_pept        482554..483546
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381525"
FT                   /orf_name="CD36_51880"
FT                   /product="Proteasome regulatory subunit, putative "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAX41572.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG524656"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000192DC21"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD0"
FT                   /transl_table=12
FT                   /translation="MSTAATSTNELALLDKSVVVSPLVLLSVVDHYNRVAKDSKKRVVG
FT                   VILGDNSTDTIKVTNSYAIPFEEDEKNPGVWFLDHNFIDSMGEMFKKINAKEKLIGWYH
FT                   SGPKLKPSDLKINEVFRRYTDNPLLLIVDVQPREVGIPTDAYFAVDDIKNDGSAAEKTF
FT                   IHVPSLIEAEEAEEIGVEHLLRDIRDQAAGNLSLRVAETHQSLLGLHQKLGEIANYLDK
FT                   VYQKKLPMNHTILGKLQNVFNLLPNLMQQSGSDPHSSSDSSHELATAFTVKTNDELMII
FT                   YISMLVRAIIAFHDLIENKLENKKLNESKAQASVADLSLNSEKKDSIEE"
FT   CDS_pept        483785..485170
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381526"
FT                   /orf_name="CD36_51890"
FT                   /product="Protoheme IX farnesyltransferase, mitochondrial "
FT                   /EC_number="2.5.1.-"
FT                   /function="protoheme IX farnesyltransferase activity "
FT                   /biological_process="heme O biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAX41573.1"
FT                   /db_xref="GO:0008495"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0048034"
FT                   /db_xref="HOGENOM:HBG397306"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR016315"
FT                   /db_xref="UniParc:UPI000192DC22"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD1"
FT                   /transl_table=12
FT                   /translation="MSHRVVTLPRLHSVSNFNYFFQNTKRNLVIEQNFINNQYLLRKVL
FT                   LPNLSGRVRHLTSQTSRFSDNTNAGRLSSSTSVIENVASKVLTCQEPEAQSSQKTGIDP
FT                   SNATTHKHIPFKIIPKDSQASKTQPVTLFPKSKAQLKNTCTAYLKLTKPNLTVLVTLSS
FT                   ICSYAISPLSVSLQELLFLTVGTALCSGAANAINMGREPEFDKQMPRTVGRPVVRGLIT
FT                   PTQAYQFAAVSGAIGCGMLWFGVNPTVSLLGFSNIVLYAWLYTSMKRKSIINTWVGAVV
FT                   GAIPPLMGWAASSSLAHPAAWCLAGLLYAWQFPHFNALSHGIAQQYKSAGYVMAAAENP
FT                   RLNARVALRYSVLMFPLCFGLSYFGVTDWVFPFDSAIANGWLTYLAYIFWQQQERNYKN
FT                   GAKATSEGLALAGVHAKKLFWCSVWHLPAVLILAMLHKKDQWNRLFEHIGLKTRKIEGR
FT                   LEV"
FT   CDS_pept        485515..490518
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248339" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077289"
FT                   /orf_name="CD36_51900"
FT                   /product="Cellular morphogenesis regulator, putative "
FT                   /function="actin binding"
FT                   /biological_process="cellular component organization "
FT                   /protein_id="CAX41574.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0016043"
FT                   /db_xref="HOGENOM:HBG397307"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="UniParc:UPI000192DC23"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD2"
FT                   /transl_table=12
FT                   /translation="MSPLSKAKLSPKDKKYSQSVEKTLATFDSLEEWADYIAFLSRLQK
FT                   SLQFNIDTAKESYYVPYSSQVANRLALCLSSDLPNGVHQKALSVYEYIFERLPESTLNK
FT                   DINIWLPGLLPLFSYSSISVKPLQIKMFRHLILSQLSATTLRSISKPFILCLLSGLDDE
FT                   NSEVFGDVIELLDAYKQKLNDDSHFWQSMFLCIIRNPERRPGALHWCVKRLPSFISFKD
FT                   QNGNPVLSEEAQLCLKPEPGLLIRAMAISIDNPESFDIVVVRGFFDLMLSHIPLDSDVI
FT                   TNRITPTDREALIMACSKITLCKDMSLNRRLWTYFLGPETEHESSKALTRTEYFKQYVE
FT                   ETLIGGLLTMANSDKIESKCDAFKILLPLIMDKWEIGNVLTPKLFSSFLKIAYNNCDHQ
FT                   DLMISASTLFDGVESVYIWSDIIGVILGDGNDDEEHDFDVVHFVLKDFNVNEEEMATVH
FT                   VPFAILCLLSKSTITSKRLDTLELLVNLASGRSLGTLDEEVTCCESEIISKIKAWYSSS
FT                   LKGESLDTPFSQGQVSFLIVNLLQKVYIDNMEDTRFCVRIAELLNHVRNFAMIKSSHGI
FT                   QDSKLVEKILNISVPDFGCEPNQDGLLVAFGISKLVGIFAKSLTHETNEKVLKVLLSNL
FT                   WTAVVSSDPANHQVEAVRAIFELETCYSLKKLEAGLVELFLTLPENRRVKAFEILWIHS
FT                   ISINESDRILEKALQLLLDGCSDDSSQNRLPIDEFLKQIIKTGASNRLLKLITNPILAF
FT                   DFIVAENESLVLDDDLGQFSYFLNLIVKVITADVKSFRDCFNNELAVMDSKSKIALVKE
FT                   NNWDISTYKSLLLSVIQKFFQLNLASEMAKDREQMQNYYSSIDNCLQLLHLLVTGNEND
FT                   FGDLLMFLIQISLKLSKSDTISPTIEAVQSKILQCIFYYLERATELRLDLNLLHVEEQN
FT                   KNPLLINFISLGISKSESPILLEKWISLLIKSLYLFGESVFSVLLILNDTLIKKIDNLF
FT                   DQFSTWQHFKDPQDFESSIDILFSGLEDLLTISHGYLMTSNIKSQAENQKNSTTDNGFL
FT                   NTVISGVFQIESPAIRSSEQNKLYSILLAFHDAVRVSFKIWNWSDSKTTTPSTVNYYSD
FT                   RSLTYISHKLKFRARKLLESLLDMERQEVVESILISNGSVNAKLKLIDILDGGRPQMTL
FT                   PSILKSILSRSNLPVFSELSRVAVDLDFDLNMKELSRFLVDFLNFIDNDSVADVWNYIM
FT                   VFFKDILAHVGAFNEILSDCLLICSGLSKKLASIKNRDHKYEKELGDIFVRLFNQVLSL
FT                   KQFLLSDMSKTNPKTMDNGNLVNSKVDLENNFKTFCQIIPVFEDILQDNDKVTSLANST
FT                   VTNFIIPRTKSKTVSEIPEDVVVIMNILGEANSCRSWKTLVSDLFMERSFFNNTSSISS
FT                   VWRSVINSWMVHDKERFGEIISRITITSGASPSNLFVWNEMSEIENKANLLKRLVYLIL
FT                   VLPKDYFLNYLEPLFDKVNVLLNGNCPDIIRIQIMILFRAVCLKFNELHLLSKWTLISH
FT                   ELLSIFENLLAKSAKELSTLSQDSLQLIFFGCKLLDQLLILSYDEFNLKECLFVSTSPD
FT                   LDDGESISVISKISKKYDLTYLKDEPFKVDQASGSLRPLLEGRRKIESLTQLRLFFDSL
FT                   GLINYERTYSLYPIDYGSCITDALNDLVN"
FT   CDS_pept        490728..491714
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094182" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534344"
FT                   /orf_name="CD36_51910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41575.1"
FT                   /db_xref="HOGENOM:HBG397308"
FT                   /db_xref="UniParc:UPI000192DC24"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD3"
FT                   /transl_table=12
FT                   /translation="MSRESSPEYEEFDETYIETPQRASNSPKKNKSTNFLSFRTVRSSP
FT                   LRQPPIERKHGISLDEESIIQSNKSNPISDLPAISNAPSSPPASIRFNKTMKQTRSFED
FT                   TPKKESNTTADLNQQFSRHSKGLNFSDFGFSRSSKFSTSQSRRPSLRELSEKSIVRPQV
FT                   SRDVDTYSHSVLEKVNSTLEELHNYDGKWGPNCIENDEKIESTKTDPVTVTNKYTGNSD
FT                   LRGHEVLDNSTPIKPNSREGAVQSQTKSGLLQSAWWSSAKWGKLRKIVKSKSISREEAI
FT                   NSTLLMSELECTNKMELRKRYDFLAKYINRNPKSNTTRGKGRVSKTH"
FT   CDS_pept        complement(491750..492724)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000242500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569414"
FT                   /orf_name="CD36_51920"
FT                   /product="Pre-rRNA-processing protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41576.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG716559"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DC25"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD4"
FT                   /transl_table=12
FT                   /translation="MSTASARESDRESDFESEDESNFQDKVFNMKSKTSTFFRATRSED
FT                   EEFSEDEKDKDERNEFNTKTEPKEGKHNFEDIVYDEESGESNGEDEDGNTDLSLDSGSK
FT                   VNKKLKKLTDKELAKEQKRIKRTGVCYLSRVPPYMKPAKLRSILSRFGEVDRLFLKPED
FT                   PAVYHKRVKYGGNKKKNFTEGWIEFVNKSDAKLCAATLNGNKLGGKKTSYYYDDIINIK
FT                   YLSGFKWLDLTQQIAKENEVRQAKLAMEISQQQKLNKSFVSNVEKSKMIANIQKKRKTT
FT                   DDDNIRRDFKQRKVTTTRSDAKDDLKSKSKPTDKLNDILSKVF"
FT   CDS_pept        complement(493689..494072)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569415"
FT                   /orf_name="CD36_51940"
FT                   /product="Heat shock protein, putative "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX41577.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG736631"
FT                   /db_xref="InterPro:IPR007250"
FT                   /db_xref="UniParc:UPI000192DC26"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD5"
FT                   /transl_table=12
FT                   /translation="MSDAGRKNISTKINEAITPDSNKSTLEKGKEQVTSTIDKAVGSNV
FT                   PDNQKSFTQTVADNVQKGADNAKADLKKQSEQAEGETKTLAETAQEYVEVAKTEIGKAA
FT                   EYVSGVVTGATEGAKTGADSTKK"
FT   CDS_pept        500592..500975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569416"
FT                   /orf_name="CD36_51940"
FT                   /product="Heat shock protein, putative "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAX41578.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG736631"
FT                   /db_xref="InterPro:IPR007250"
FT                   /db_xref="UniParc:UPI000192DC26"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD5"
FT                   /transl_table=12
FT                   /translation="MSDAGRKNISTKINEAITPDSNKSTLEKGKEQVTSTIDKAVGSNV
FT                   PDNQKSFTQTVADNVQKGADNAKADLKKQSEQAEGETKTLAETAQEYVEVAKTEIGKAA
FT                   EYVSGVVTGATEGAKTGADSTKK"
FT   CDS_pept        complement(501427..503919)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381527"
FT                   /orf_name="CD36_51950"
FT                   /product="Ribosome biogenesis ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAX41579.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000192DCDF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD7"
FT                   /transl_table=12
FT                   /translation="MKAMSKSKSITGSLDQKIYNLIHDLLQEQTEENKRTVTTDEEHDP
FT                   FSCMASSHNLTVSQVLTYVQMKDFQLKRMKKNYLEKSIAASLKVIRQDEAEEFGNRENG
FT                   NGEESEVDYDKENENELMEVKDSNAINKSVVSLWNQEKTEGESDGANNEESQQTDSADL
FT                   LKGSKRKAKDSARTQLKKQKRKIDYSTPNIDLSSLGGVESVTTQLLEIIGLPILHPEIY
FT                   SSTGVEPPRGVLLYGPPGCGKTTIANALAGELKVPFINISAPSVVSGMSGESEKKLREI
FT                   FEEAKQIAPCLIFMDEIDAITPKRDGGAQREMEKRIVAQLLTLMDELTLEKTGGKPVVV
FT                   IGATNRPDSLDSALRRAGRFDREICLNVPNEEQRISILKAMTKNIKLENGEYFNYRELS
FT                   KLTPGYVGADLKSLVTAAGITAIKRIFETMSELQEETHSAKDDSMDVDPVNLDASKEDM
FT                   IKKFEKKSEAEKLSTIKKFLNMHPDPLNQEQLTPLAIKYQDFVNALPSVQPSAKREGFA
FT                   TIPDVTWQNVGALFKIRMELHMCIVQPIKKPELYLKVGIAAPAGVLMWGPPGCGKTLLA
FT                   KAVANESRANFISIKGPELLNKYVGESEKAVRQVFQRARASTPCIIFFDELDALVPRRD
FT                   TSMSESSSRVVNTLLTELDGLNDRKGVFVIGATNRPDMIDPAMLRPGRLDKTLYIELPT
FT                   PEERLEILKTLVRTNNSPLNENVDLNAIARDPRCGNFSGADLFSLVKEAGVWALKKRFF
FT                   QNQKIQELDSSGFYEDSIGGDDISITAEDFDHALSSIRPSVSDRDRLRYEKLNKKLGWN
FT                   IIADKEPDDVGSTAEKKD"
FT   CDS_pept        complement(504332..504883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248348" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569417"
FT                   /orf_name="CD36_51960"
FT                   /product="Putative pyridoxamine 5'-phosphate oxidase
FT                   ylr456w (Ec 1.4.3.5"
FT                   /EC_number="1.4.3.5"
FT                   /function="FMN binding"
FT                   /function="pyridoxamine-phosphate oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41580.1"
FT                   /db_xref="GO:0004733"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397311"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000192DCE0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD8"
FT                   /transl_table=12
FT                   /translation="MSQKESLPESVLNLLNSSRFIHLATCLDNKPHVSLMNYTFVRQGD
FT                   DNLVIVSTPRKTTKFENMLSNPNVSLLIHDWISVKNTAGQSVEESSASPKRNSLYELLA
FT                   NFNRNELSRVSVMLDGEAKILDKTVDGKDFDFYKSLHLNNSKIDHTQVKNYIENDDNAL
FT                   IIIRITNCKVTDTDNNVESY"
FT   CDS_pept        complement(505092..506774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534345"
FT                   /orf_name="CD36_51970"
FT                   /product="Origin recognition complex subunit, putative "
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="CAX41581.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG397312"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR016527"
FT                   /db_xref="UniParc:UPI000192DCE1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHD9"
FT                   /transl_table=12
FT                   /translation="MSSQDHLEDDFEGEFRSIRYLPKRKIDNEESGELATNSSNSYVTN
FT                   KRSKKVSVVAGSSGVDTSPDDPLNKTGYSKIATDLAKPLPETSEDDIEIVKTQLLDQLN
FT                   GNFEIFSSTPSVSEKYTEIYSIFERTIRDKESHSVLMVGPRSSGKTTIVKSALKELDRN
FT                   YNGEFISIYLNSSVQTDDSSALREIARQLDINVKKDVGDDGSEPMGLTNEKIGYASFEK
FT                   KSINDTFSNILSVLTSHKGERDERMPLVFVIDEFEKFTVDNRQTLLYNLLDISQSSATP
FT                   ICVVGLTTKITTKETLEKRVSSRFSQRVISLVHETSLDNFWDNCKASLLLQDSTINTLK
FT                   NPEYGLSWNEHIEQLYCKKNSLLRNMVVRNYHSVKDYRKFNNACRVPVSKLSAHHAYIE
FT                   EDYFKLRSAGSNGVQDLVTSLSDLELLLVIAGVRWIEKFEIQTINFNLAYTEYQEMVKD
FT                   FNTGNAIVSSASLDNRIAASIKVDRRVLSRKVSLNSWGTLYKLGILLDPKGDTVEAQSN
FT                   TYSYHINKNLIIEENQMVLVDITLDELNNFIEDKHAFKRFVRL"
FT   CDS_pept        507377..509389
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248349" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569418"
FT                   /orf_name="CD36_51980"
FT                   /product="GTPase-activating protein, putative "
FT                   /function="signal transducer activity"
FT                   /protein_id="CAX41582.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG397313"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI000192DCE2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE0"
FT                   /transl_table=12
FT                   /translation="MSQSNMELNDESQKRTKKSILSASLSSRREKSQGLITELGCSPSK
FT                   ISVLHEATHHKFSRTSSGRIFEKDIKDIFSLLVISLRLERDGSTNYLFNSPPIIKFHKP
FT                   LRKNYPYSFSLESAIEKMKDLQLDIESVNTVTCISYSFNSEVSLALIESFYKGRLLHSP
FT                   ADRTRGKPKSNVALQPTPKGIAIVQEFCERIGMEREAFPEVLLSHDFNTMELFNFDRDS
FT                   RSDSILYSEYLLYLLFNIMMGPEPNVWTPSNTQDALPSWNFSDTESFDKLYEVFSNSKD
FT                   TKNVKGNNKNASEFEGFNFGDYQYISKARQSSEIHSFTDHREIASSPFHHRYFTNPESD
FT                   AHSQYYVSSVGVRLLKDKIVLAASNKSVTVDYCISGKAVCQWILDCTDIINPNHAIELA
FT                   RLLVKHNLIKPISLSGNHSFSRDAYYQLSTLGLALSSWDFSERNLQDSSCFQTGTKILR
FT                   LTNNATLENILNDPGMRLQFRKHLIKDHCAENLEAYIQLTQFEEKYKAWENLSDIIDNQ
FT                   NHSCKPVSCSDVNRRLKNLQTTCMSFAFQIFHTYLSIDSPKIVNIDFRLRSKITTLMIG
FT                   DSGAKVNGDNESIIFLKTPTEDFALGSSVLEETADSASRSHVDGKLLAPDNSFRKIANS
FT                   LLQIKFQIYHLMKVDSIPKFLETLGITSNKRITTF"
FT   CDS_pept        complement(509470..511074)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229292" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077290"
FT                   /orf_name="CD36_51990"
FT                   /product="Eukaryotic translation initiation factor 2 (EIF-
FT                   2) subunit gamma, putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX41583.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="UniParc:UPI000192DCE3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE1"
FT                   /transl_table=12
FT                   /translation="MSYDDIENATPDIVIGSTIEEPEEDYQIESDNELQAADHESSQIN
FT                   EDSAKGKKSVAFTGLDEDEENAEEIARKEFEEGGGLPEQPENPDFSELTPLSPEIINRQ
FT                   ATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCDNPECPE
FT                   PDCYRSFKSDKEIRPKCQRAGCDGRYKLLRHVSFVDCPGHDILMSTMLSGAAVMDAALL
FT                   LIAGNESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHEKSIIQFIRGTIA
FT                   DNAPIVPISAQLKYNIDAVNQFIVNYIPVPMRDFTASPRLIVIRSFDVNKPGADVDELK
FT                   GGVAGGSILTGVFKIGDEIEIRPGIVTKDDQGKIQCKPIFSNVVSLFAEHNDLKFAVPG
FT                   GLIGVGTKVDPTLCRADRLVGQVVGAKGNLPSIYTDIEINYFLLRRLLGVKTEGQKQGA
FT                   KVRKLEQSEVLMVNIGSTATGARVVAVKADMARLQLTTPACTEINEKIALSRRIEKHWR
FT                   LIGWATIKKGTALEPIS"
FT   CDS_pept        complement(511259..514069)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569419"
FT                   /orf_name="CD36_52000"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41584.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397314"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DCE4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE2"
FT                   /transl_table=12
FT                   /translation="MSQEFRLPNRTSIPANQSLSQTPLNHQPASDYNSATSTPSPSTTT
FT                   GRKSSRSKKMACVECRQQKSRCDAFEKQPDPCTRCAKKGLQCDVKSDYKRTYKRARIAQ
FT                   IEKEFEELKKTLTNTQAAELLSKFPSLSSASPDTNPQEETSQIKVKIEPGTSCDSSRGI
FT                   AADAGVTKSISNIDLPRHSTIVAETAYPQQSLAKSTQIPPYQFQSLNSSETSQSLPNTP
FT                   SITRQVESNILHQIPAASHENQVQLPESSLICEEKSVDDISLMPETIKKLYLEYFERYH
FT                   PILPVVDVSLGPERIYRLCPALFWVIMFVSLRRFPDNSSKSLLVRLSPVVKGILAEIMI
FT                   SPITRYNPIEEDEPIYNVSSVYSVQAFLLYSYWPPITSSLSADSSYNTVGTAFLQAIRI
FT                   GLHTPTLVNTSEMNKDERTQQQLAMTHEQLKTWIFCNIASQTIATAFGFPACTQFDSSM
FT                   WFYNQPGSTIRIPRNLQLMMEIAQFEDQMAKALNSNPMDPCGLIDASERLPLLKLLSKR
FT                   LDNIEITLKNEMLQPSDRRFRVFEILSTRVHLLSYYFMDTVRIAQFELQKGLIRLYNAA
FT                   ISFINHTSECQANDKKFVKYLPGVYLLNLWQAGCIIGKLIHSSLKKFIDVGTGKQSYES
FT                   VIAFTASASILKHDMAYRSSGITRNMWQLFRTLDANKTNSLSIDIRNRMSASVFFDCLK
FT                   LLRAQVGITKLTTKTDENHPADDEEAIEESLEEDEEPTDMDNEKTVHSEDDKNGSLHNG
FT                   SQKSTPNSTTSSRVRKARTLSNNMDAESKTRKIIRTIPLDPEPISIGASKRSSIFKVVN
FT                   SSTDSSPLMKSDVSTPNSNRINNHQIKTQTYNPTHVEKQQSPYPSSKQTPQFLQFQQQP
FT                   QQSDNRSYQSAQNASEVPLSQFSAFAFNESPIQLGLENLDIDNFDHDMLWKDVDSVMND
FT                   FGFHAS"
FT   CDS_pept        join(complement(515065..515137),complement(514768..514988))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077291"
FT                   /orf_name="CD36_52010"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41585.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG398542"
FT                   /db_xref="InterPro:IPR020373"
FT                   /db_xref="UniParc:UPI000192DCE5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE3"
FT                   /transl_table=12
FT                   /translation="MKTAIRLLKYVQSIKFVGGPHPAPKPHAAGPHPLAPEGLVPSGLN
FT                   SAKSSTYHNSNPVEPQNGEFFARSELSARFRYRPIKAEEIEQVESGGAEFVF"
FT   CDS_pept        515681..516724
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228678"
FT                   /orf_name="CD36_52020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41586.1"
FT                   /db_xref="HOGENOM:HBG397315"
FT                   /db_xref="UniParc:UPI000192DCE6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE4"
FT                   /transl_table=12
FT                   /translation="MKSMEEESPISILALPYPIIARILYECWKETYKVCSILPMLCTCK
FT                   QLYYGYKYMLYTLRPLVIINKSTKNTGKDCISCSGFLKLLQDTRIRQKLDTLCLHLFPA
FT                   MFNNKSVSSIVTNLNQFSNLTHLIIHVKSMEWLVQWIKHFPTTITILKITLVKHVMSSS
FT                   SSLNTETFSIPEFQLKQLKFQSLVPLQKKKLCYGLSIISTAASTYTPQTIEERYKSNLP
FT                   LFQTGQVLANLIHANRESLQFMELEMINLNEIYLILQQQYGFNNQCSKYFTTLNLLKVD
FT                   QCTNYPILQLSHWLRNCKQIIYLNHFLSTFIVLQQNSSSNVIKEFKYHMSLFEYKMQKY
FT                   KYEIKFN"
FT   CDS_pept        516975..517958
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569420"
FT                   /orf_name="CD36_52030"
FT                   /product="Uncharacterized protein "
FT                   /protein_id="CAX41587.1"
FT                   /db_xref="HOGENOM:HBG397316"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="UniParc:UPI000192DCE7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE5"
FT                   /transl_table=12
FT                   /translation="MSDKLARTIQRFQAKIDSGSFYEAHQTLRTITNRYVKAKQYKEAR
FT                   DLLYQGSTILLNNKEYASASDLINYLIQIYDEEGILVSDKDAKLKLIDLISNLPNNDPS
FT                   LNDLAKSSLNWSKKSSGCEKFGDCELHHLFGSKFLKFVEYGTFQDNAESENGKTVLDPE
FT                   ERAKVFAIAELHLVLGTFESVPLYINYLVQYAKANPDVDPGVFLGRAIINYSYLKNIKF
FT                   VKEAQDLFLKEIKVSNKETLKTDFQFYQDYPVLNFLQLLVITLQKEHTSNSQKFIKLYE
FT                   QYKSTLQQYEFLAPIEYLGKIYFNVNIGNSNQQGNMLANIMSGLFK"
FT   CDS_pept        complement(518100..518684)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165198" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381528"
FT                   /orf_name="CD36_52040"
FT                   /product="Diphosphoinositol polyphosphate phosphohydrolase,
FT                   putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41588.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG713158"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI000192DCE8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE6"
FT                   /transl_table=12
FT                   /translation="MEQQQQQSYNNPNLPAKSQKAREGRENQRYNPETGARIVSGCICL
FT                   NETKDKIIMISSSKHKNRWIVPKGGNELDESELETAVRETWEEAGVEGIIIKKLPVVLD
FT                   SRGNQAPVIKGEFDPDIATPKSEFHFFELQVDQLSTTWPEMKKRQRRWCTYSEAKHELL
FT                   KSKRPELVDALNMSSIIKDTIDNKNPKEDKY"
FT   CDS_pept        519378..520214
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17569421"
FT                   /orf_name="CD36_52050"
FT                   /product="Proteasome beta-type subunit, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAX41589.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG629728"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="UniParc:UPI000192DCE9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE7"
FT                   /transl_table=12
FT                   /translation="MNHDPYSWGRPSNDTYGPYNYKIAHANNNQVEQTTHNFPKMNTQQ
FT                   PIITGTSVIASKFKNGVIMAADHVGSYGSLLRFNNIERLIKVGKETVVGISGDISDLQY
FT                   IVRLLDELEIEEEVYDNDGGDYLRAPNVHEYLSRVLYNRRSKMNPLWNAVIVGGFNKDR
FT                   TPFLKYVDLLGVTYHASTIATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSKAVEDSMK
FT                   VLFYRDARSGENYSVVIIKIDENTGELNFQFIKDAQVQNQSWKFAGDIRGYGSAQQ"
FT   CDS_pept        525645..526838
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381529"
FT                   /orf_name="CD36_52060"
FT                   /product="cAMP-independent regulatory protein, putative "
FT                   /protein_id="CAX41590.1"
FT                   /db_xref="HOGENOM:HBG397317"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniParc:UPI000192DCEA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE8"
FT                   /transl_table=12
FT                   /translation="MLIISEFNPQLMHSDDSEDDYDHQSNHRNSSNGATTINQIITYKG
FT                   QISSLNDALLIIEACRLQKLPMVTRRLTGIERNKFIKPNTVFVWNETQCGMKRWTDGRL
FT                   WSASKVYNGNFLVYKQLNKKTKREQEEEESGGQGLVKQSFSVVTKDHQRYHLISYYENI
FT                   PGTFRPRSASKQATTINIPSQDSKVCHLDLSNTVYPDSLLNSVYKRKHQQQQYEQKLEQ
FT                   LRQQSHSPAILSNNNNNNNNNNNNNNPVHQESYPSPGINSNLYSPMHQTATYCKSSSSL
FT                   SSSSRSSSSSRSSNSSSSNITSQRTTQSSSPLPMSSLNTKSAAYFTSSGHNHAAFALQR
FT                   ASPQNHLQRPHNTLTLQPLSKISQLSQTPTLGNNNNTGIINDYDSRTVSVLNKTWLK"
FT   CDS_pept        complement(527828..529237)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094186" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534346"
FT                   /orf_name="CD36_52070"
FT                   /product="Mitochondrial import protein, putative "
FT                   /protein_id="CAX41591.1"
FT                   /db_xref="HOGENOM:HBG397318"
FT                   /db_xref="InterPro:IPR015222"
FT                   /db_xref="UniParc:UPI000192DCEB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHE9"
FT                   /transl_table=12
FT                   /translation="MITKCYVQVFRYRRVCHNTKYSFNSVVSVKWLHSAGSSLSQANPS
FT                   KASSSSLRSSGFLYYEDPHRYNGSDDNFNVSATTTTSTTKPIIHSATPYSDKYYQPIIS
FT                   QGAKGFDKLIIPVGFRADNQTVLLEEDKEAPIQQDQLQEIVNSFDAPIDVSIGYGSGIL
FT                   PQDGYDTDKSTTNNTNKNSKQLDFMFLVKDCRKFHEENLKQNRDHYSVKSLRLINKIQG
FT                   VNGMYFNPFIKINEKLVKYGVISSKSALMDLSEWHSLYFAGRLQKPVNFITANDPRVKF
FT                   LNQYNLKNAMTIAIFLIDGEGNSRQATFDERQLYEEITKLSYLGDFRMYIGGENPNKSK
FT                   NIVAKQFHHFKKLYEPILQYFIHKNFLIIVDNDPINRTFKPNLNVNNRIKLITGLPLKF
FT                   RQQLYGRYYEKSIKEIVIDDQLSQNLTKIISRTIIISSIKQAIRGLLSAGLFNSIKYAI
FT                   AKQIKFWTSNK"
FT   CDS_pept        529614..531146
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570390"
FT                   /orf_name="CD36_52080"
FT                   /product="Threonine synthase, putative "
FT                   /EC_number="4.2.3.1"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="CAX41592.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG521025"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI000192DD95"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF0"
FT                   /transl_table=12
FT                   /translation="MPSSSQVYRSTRSNQPEELSFEDVVMTGLAPDGGLYLPSSIPQLP
FT                   NDFLTKWSDLSFNELAFEILRLYINENEIPNADLKDLIARSYSTFRSSEVTPLKKLNDN
FT                   LYILELFHGPTYAFKDVALQFVGNLFEYFLTRRNAQKDLTKQPKDIITVVGATSGDTGS
FT                   AAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVEDGNVHTLSVNGTFDDCQDIVKQIF
FT                   GDKEFNDKYHVGAVNSINWARILAQQTYYFYSYFQLQKQAKTTNKVRFVVPSGNFGDIL
FT                   AGYYAYRMGLPVDKLIIATNENDILDRFIKSGEYAKEQEVGVKATYSPAMDILISSNFE
FT                   RLLWYLIRDNVPEVNKSDEKAGQLLNDWMKQLKEQGKFKVPAEVIDAARQVFDSQRVDN
FT                   DTTVQTIKQVYDQSGDKYVIDPHTSVGVTTSYSFIAKDTEPTQYISLSTAHPAKFSEVV
FT                   NKALDSFDGYSFDKDVLPAELKALSSKEKRIKLIDEASVEKVKQAIKDELKF"
FT   CDS_pept        complement(531198..532592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077553"
FT                   /orf_name="CD36_52090"
FT                   /product="Copper transport protein, putative "
FT                   /function="binding"
FT                   /protein_id="CAX41593.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397319"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019156"
FT                   /db_xref="UniParc:UPI000192DD96"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF1"
FT                   /transl_table=12
FT                   /translation="MTDIAIDTIINRTLHALENSDYSEFDLLLNQLSFLIKQSANNNNK
FT                   PAPEERITQILDYTPNDFNQIKTLRLYRGLLILVRNFAPALDIDLFPKVVVSFEKFLKL
FT                   HQTNEWTDKILEAYWQILTNFQRNEFIAIVNELFGQWECKYKWSNSLMAVMSPVIHFLF
FT                   RQFNTQDPHITNENLLHLLKIFETNHVMNAVYEIFKMIDFTDTNNIGHDYKMFVHLLYD
FT                   IITHESFQKWIEQQDEEETITKWLSLTSIVVQTKTDWNNYELIALLSWNGSLFMKYAPL
FT                   LNSNKGNTTTNGEDNLNYVEDDLSTIISILAELSQFNATKQYFEHYQDLLPQLIFVFKW
FT                   IHENIEPITIKNKQIEELGRYSSVKTNIITILSYLSYDSFQFQEKIRELGGLSLVLSNC
FT                   IIDNNNPFIKEQAIVCLKYLLQKNPKNQQFVADLEAKKVVDDQVLSEVGYQVEVIDGKV
FT                   EVKRKQ"
FT   CDS_pept        534404..535681
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381797"
FT                   /gene_name="PDE1"
FT                   /orf_name="CD36_52100"
FT                   /product="3',5'-cyclic-nucleotide phosphodiesterase,
FT                   putative"
FT                   /EC_number="3.1.4.17"
FT                   /function="3',5'-cyclic-AMP phosphodiesterase activity "
FT                   /biological_process="cAMP catabolic process"
FT                   /protein_id="CAX41594.1"
FT                   /db_xref="GO:0004115"
FT                   /db_xref="GO:0006198"
FT                   /db_xref="HOGENOM:HBG397320"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="UniParc:UPI000192DD97"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF2"
FT                   /transl_table=12
FT                   /translation="MSFEITILGSSGGPLEGSTCSILLKPANISYHDIINDNLPDQLLC
FT                   IDAGSGMGKLTEIIHQETTTKTSYCNFLQYYPDCETVSYYYHPDIAITTPFSNFQPGRP
FT                   ILHTQKVFNNLQNYLISHSHLDHVCSVVINSAGFNKNVSNKTLYGSHYTINSMQKHLFN
FT                   GKIWPNMPSFKIVNLNYLESNRSERIGIYTVRMFDLSHGEFNKLTEEKEEAQHHINSNS
FT                   NNIWKKRYDRRRSSITTIPENTSGLIIKNSEALNHHYLSSAFLITLDVPESTITKENPP
FT                   SILIFGDFESDLTSKLSRNLFIWKNIAPLILRNQMKAIVLECSNCIEIDANELYGHLTP
FT                   KLLIYELKQLAHECKQLDTTTNIEQPLLGLNIIVNHVKEPITDPNEESQLHDPRKRILT
FT                   ELNKLNAVEKLGCNISIALSGTSIMV"
FT   CDS_pept        complement(535894..537606)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570391"
FT                   /orf_name="CD36_52110"
FT                   /product="Delta subunit of the coatomer complex, putative "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAX41595.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG521204"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000192DD98"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF3"
FT                   /transl_table=12
FT                   /translation="MVVLSASICTRGGKALLSRQFRDISRDRITALLANFPSLISNSSG
FT                   QHTSVEDENVRYVYQPLEEFYIVLITNKTSNILQDIDTLHLFASTVSNLLRNIDEREIF
FT                   ESSFEIIDAFDEVLSLGYKENLTLTQVQTFLEMDSHEEKIQEIIERNKELEATEERKRR
FT                   AKEIQRKEMARKTMDQLHSGASAGVGASSFGYDSYQNNHQPTYQPTPVVETTHSAGSNT
FT                   TNSSSHSLLSKPRGGGLQLGGKKTAGRTLPSGNGAHEPLLATSQPVFAHRTAVESPQTS
FT                   AGAGSGVKSGSVSRTGSPAPSNAATRVPNNGILITVNEKVSAQLSRDGSISSSEVKGDL
FT                   QLRINQTELANAKILLKIAGDKKQFKTHPNVDRNLFQSDSHISVKDKSKTFPSNDQPLG
FT                   VLRWRSVGKQDDTSLVPIVFTIWVSVNEEGQAQVTVEYELTNEFVENHPNHPNVENLKI
FT                   LVPVLTDNVQLQDGGNDTVSYELYDGQGVVFNIGTIAIDDPQGSFEFTVPVVDEDSLFP
FT                   MQVQVDILNQEVVESDISLGGVSITDVVSNNEDEESLPFDLHSNISFENYVIQ"
FT   CDS_pept        join(complement(537990..539987),complement(537868..537906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570392"
FT                   /orf_name="CD36_52120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41596.1"
FT                   /db_xref="HOGENOM:HBG397322"
FT                   /db_xref="UniParc:UPI000192DD99"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF4"
FT                   /transl_table=12
FT                   /translation="MSDCLSNKVILEYFNHHSKQLMPSCDLQTVLPREFTSETLKLNRS
FT                   TSIKLHDLIRITPVQVTLKGPFPYELNAAKYIVKCENPISESNTGFKNTIKRHHWYPNV
FT                   NINPTYNNEVLQLESIEPYSPPPFQTLHSEMKKWRNSGFKVDSPINFNTSHKSISIHPS
FT                   PKWVLPDSIDLFSISQDNLNSHIPKHSIPEREVLLIKDKTPSCKYFCESQLIFTPLEPC
FT                   INTMRYDPWLYNDSSLPNPCVEDITQYLLDQNRVTKSGKYLVVPVACPNTKMKDSPVVI
FT                   ISKFIFSHLKPEKHNWKLPMRVLIENMTWNPFNVDTANFVNKYLIETIAQDRNFMATTD
FT                   KTIISSVQMAIPPTTTHAFPKLSKTESAQELKPVNIKYPQRNNTPTKSDGLINTQIETN
FT                   VATYHNDTDIMNELISSRKRKRKKLDTVSNAVLPPEISMLSFVEPKIPQNKETIEEINS
FT                   SVLSITTIDKSVFAKTQHIIINETLWDTNYQLAKSLSDVVHALEMKIKLPIDIIVNATT
FT                   GIYCTSSDYLFQSDGHGEFLILKTLLHLKKHFRSLLLFSTVSTPIFLKYNSKKLQKLQV
FT                   LCMSLNIKLFLIPPQDLVVWILQVLNVEGPENSTLSVDTDDQEGNLLAECGLSYFQVNQ
FT                   VLQRCSFDEFLIMDTKEKINQFGEIITSELIYQLESILSQQLY"
FT   CDS_pept        complement(540217..541401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534580"
FT                   /orf_name="CD36_52130"
FT                   /product="ER protein processing protein, putative "
FT                   /protein_id="CAX41597.1"
FT                   /db_xref="HOGENOM:HBG443801"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniParc:UPI000192DD9A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF5"
FT                   /transl_table=12
FT                   /translation="MNHFLHFTFTIALLAYTILASPGDDLYAFQDCLYQCEQITCHNNP
FT                   YHIIQQEFYTELSSNPDYEFKYYNPYWEFDSMPLPLYLRLLGWNCESNCDYQCQRIITS
FT                   ERIKNHEEIYQFHGKWPFLRILGIQELTSVIMSLGNLYVNYQSFKKIWRSVINNDSVPS
FT                   NLKYQFTNICVVQIVTMCAWLFSTIFHVRDYILTERLDYYFAGLTVLTQFHALGARYFN
FT                   LYKHSRVVYRWLFSLSCALAYAYHVYRLYTDWSYTYNMQANICVGLFQNVFYCLVCFGL
FT                   YVKYYNLEQTENKVILNHLNYIESSRIILSSFFTRSSKLFSLYPLLLCFIVVCGMALEV
FT                   FDFPPVFFDLVDAHSLWHLVTILPVYMGWYDWLVWDVNENVWSNIQEEEKKKKE"
FT   CDS_pept        complement(543434..547012)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570393"
FT                   /gene_name="CST20"
FT                   /orf_name="CD36_52140"
FT                   /product="Serine/threonine-protein kinase, putative
FT                   (Pseudohyphal/invasive-growth/pheromone-pathways signal
FT                   transduction serine/threonine-protein kinase, pak "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41598.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397324"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192DD9B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF6"
FT                   /transl_table=12
FT                   /translation="MSILSENNSTPTSITDPRKTSHSHNTESNPRSRVSSAPEVGSTPL
FT                   APPTQVMNTTSANTSSLSLGSPMHEKIKQFDQDRVDTGEINDAFTKSVSGDVDDLQQSR
FT                   NNHIESDKEQNEDDDEKTQGMPPRMPGTFNVKGLHQNDDSDNEKQYTELTKSINKRTSK
FT                   DSYSPGTLESPGTINAMDANNVSPAVIEEEQTQSFQDVPSTLQHQNENASLSAPRSGPP
FT                   PIPNSKTSSYHDMSSDISSSASVHKIPSNPTSTRGSHLSSYKSTLDPGKPSQAAPPVDI
FT                   DNLLTKSELDSEPDTSSSATDSPNLLRNDTLQGIPTRDDENIDDSPRQLSQNTSGTSRN
FT                   TSGTSTSTVVKNSRSGTAKSTAHNQTAAITPVIPNHNKFHQQATNTSSSSLEPLGVGIN
FT                   SNSSPKNGKKRKSGGKVRGVFSSMFGKSKSSSSSSSSNSASNSHSQEVNIKISTPFNAK
FT                   HLAHVGIDDNGSYTGLPIEWERLLSASGITKKEQQQHPQAVMDIVAFYQDTSENPDDAA
FT                   FKKFQFDNNKSSSSGWSNENTPPATPGGSSSGGGAPSSPHRTPPSSVVERSSIEQKTST
FT                   PSQSVPKTDSKQSQHDDNVQYTPKTPTSHIQENQFIPSRPAPKPPSTPLSAMSGSHRTP
FT                   SSQPLPRNDSQSDLRSSTPKSHQEVSPNKIKIRSLSSKSLKSMRSRKSGDKFTHIAPAP
FT                   PPPSLPVIPKSKSHSASLSSQLRPATNGSTTAPIPSSAAFGENNALPKQRVNEFKAHRA
FT                   PPPPPPPPPPPANILSDQNVEIPQQRTAPSQALADATAPTNIYEIQQTKYQEAQQKLRE
FT                   KKAREIEEIQKLREKNKQHNAEQNISELRTNAATTGTAGASNNAPPVPIPNKKQPTGSG
FT                   GGRDAKQAALIAQKKREEKKRKNLQIIAKLKTICNPGDPNELYIDLVKIGQGASGGVFL
FT                   AHDIRDRSNIVAIKQMNLEQQPKKELIINEILVMKGSSHPNIVNFIDSYLLKGDLWVIM
FT                   EYMEGGSLTDIVTHSVMTEGQIGVVCRETLKGLKFLHSKGVIHRDIKSDNILLNMDGNI
FT                   KITDFGFCAQINEINSKRITMVGTPYWMAPEIVSRKEYGPKVDVWSLGIMIIEMLEGEP
FT                   PYLNETPLRALYLIATNGTPKLKDPESLSYDIRKFLAWCLQVDFNKRADADELLHDAFI
FT                   TGCDDVSSLSPLVKIARLKKMSESEQ"
FT   CDS_pept        complement(548966..550663)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570394"
FT                   /orf_name="CD36_52150"
FT                   /product="Ubiquitin-binding protein, putative "
FT                   /protein_id="CAX41599.1"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI000192DD9C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF7"
FT                   /transl_table=12
FT                   /translation="MTLNKTYNNNGLSYPTTNVTNTFDFSNNNNNDKSRKTIYQLIYGE
FT                   LKTKNDNERNRTGGKYTLGSNDPDINSETIKMIENLCELFPMSTIDELRDHPTNVDHSE
FT                   DLVTELFDKATALIQSEKDREKEKEKEKKNNQKEPLSQQSKRYNQKYMKVGTSLYSDAV
FT                   YELQVMFPSIAIKSVEKILQENNGNIEDAAIALLELSSGTTTAASQKQRENDNEWVEES
FT                   SIVIKVCRFLQTNSNDIFLDKSDVLHYTRKNGGDYYKTLYDVVMNCKSMVLTKQQESTS
FT                   GGATKTHDKSRNNRRVQRGGAMGLASSTRNRISHGQEPQNEISTTTPTPSNYRYDENSM
FT                   EAKELWSLIPLNKDGKNSVESISSQKLPINKKFAIKALEFFQGNVYKVIELISELSSSQ
FT                   ISSSKQSRHLNEKQPVDIKIENSKFGMPKDSSNNTFIPSSTREYQTDRIILDSHDEQYL
FT                   FDRYLKTGTVDLHGFTVVEAMELVPLILHHWWNQELTHRQSIGQLEKFGNSASLGSVLI
FT                   ITGRGVHSTGGVSTVKVSVNRYLTNNNYIFEQPTSGSFEVTGKRINKK"
FT   CDS_pept        complement(550972..552285)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094191" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534581"
FT                   /orf_name="CD36_52160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41600.1"
FT                   /db_xref="HOGENOM:HBG397327"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192DD9D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF8"
FT                   /transl_table=12
FT                   /translation="MVDRSETTGTITIIPPQPQPLQNSTITNVSPKSDVNKIYSRTSTI
FT                   DTSATSTFDNNKLLISTVLYKRSRHTRQWKKKWVVLRKCQLSYYKDSKEHKPLKVYHGE
FT                   DLLSFSIIPDHTKNHFALYTSNKVLHFKAPDETIFRSWVDTLNGYFNSQDNEDDTQLLD
FT                   QQEEDSLDCENKEENGEPRGSEADRNPEEDRDSQISSPVSPPLNSQQTLPIHSIQNKQQ
FT                   AQVRRSISLTDSINTSTEFSDCSSEVWSTIDSPITPSNAVNMNRGSSLFNALDAPNEED
FT                   ERRKAEPSLSCDEPQTKLTKDKSKSSTPVTDLTESVIEQGYMTVLKKKYNRNHTKRVYL
FT                   VLTNMNLTVYKTREDYHADFQQPKPLSELIYKNFPVNDILDIIELDPMNSKYQWCLLII
FT                   TPLKRIRFCCRDEEDMVKWFSALKAVVVTQKKKQKEMS"
FT   CDS_pept        554837..556630
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570395"
FT                   /orf_name="CD36_52170"
FT                   /product="Phosphatidyl synthase, putative "
FT                   /EC_number="2.7.8.-"
FT                   /function="transferase activity"
FT                   /protein_id="CAX41601.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG593961"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192DD9E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHF9"
FT                   /transl_table=12
FT                   /translation="MTKEQSNNDSKNSVIVEEDGGAQFQSYLNNDGIDELTPSVRKHRV
FT                   SSLSLSDLNQWQTGLTKLSSSTSLSKKNSSSANLKKVDSLAKLSRNASIIKRKKKEIID
FT                   HERVASYAFCFDIDGVILRGPDTIPQAVEAMKLLNGENKYHIKVPSIFVTNGGGKPEQQ
FT                   RADDLSKRLNCTITKEQIIQGHTPMKDLVDVYKNVLVVGGVGNVCRNVAESYGFKNVFT
FT                   PLDIMKWNPAVSPYHDLTEEERVCTRDVDFSKIPIDAIMVFADSRNWAADQQIILELLL
FT                   SVNGVMGTQSKTFDEGPQIYFAHSDFIWATNYNLSRYGMGALQVSIAALYREHTGKELK
FT                   VNRFGKPQKGTFKFANKVLSHWRKGVLDEHLKKLSVNDPNANDADILINEDGEEIINQS
FT                   KLENYNWSDSEDEEDQEDEEGNGCSTTNTALKNVSKIADVGKPDKITLELPPASTVYFV
FT                   GDTPESDIRFANSHDASWHSILVKTGVYQEGTEPKYKPKHLCNDVLEAVKYAIEREHAK
FT                   ELAEWNETAQDANDDDKGSRLNFADLVMTPSEKKESDKNGKKPASAVSTSKSSIAEAEE
FT                   VEVPDILAAQIEKLKDVSVSK"
FT   CDS_pept        complement(556901..557800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570396"
FT                   /orf_name="CD36_52180"
FT                   /product="ER-localized protease, putative "
FT                   /function="peptidase activity"
FT                   /protein_id="CAX41602.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG397328"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000192DD9F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG0"
FT                   /transl_table=12
FT                   /translation="MDVILPNLPPITKGWCIAILSTATLISANRLKLVNLLFFPDKALT
FT                   TEPWRLLTSFCTFRPLSIELFLEVFYAASSCGQLESRFTTELSLFPTRIIDQFNQNHRN
FT                   ARDQGQGQISQLELLRSFIDRNKSIDFLYYVGQICLSIIVVACLIHYRLQFTILNLGQI
FT                   LSHLLIYVDSQKTPNEQINVVGLFSIKKSYYPWLVAIVTIILNTSGGLLDINNIFNSPL
FT                   VWTYIVATGLGHFWWMLRDVFVSSIHYDSNDRRRLLKQKLLSRHGIMKFDIIREGLIWL
FT                   LLPPWYWVILTKIKQRRA"
FT   CDS_pept        558554..559249
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077554"
FT                   /orf_name="CD36_52190"
FT                   /product="Acyl-protein thioesterase, putative "
FT                   /EC_number="3.1.2.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41603.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI000192D2D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG1"
FT                   /transl_table=12
FT                   /translation="MSVSAIRIPANGSSAKAAVIFLHGLGDSGDGWSWLPQLVGQSKLI
FT                   HEPINYVFPNAPKIPVTINNGFAMPAWFDIYELGNPHARQDVAGFFKSCEVLKEFILEQ
FT                   HNQFNIPLEKIVIGGFSQGAAISLATLALLDIKIGGCVALSGFCPVKNEITDRYNKNPG
FT                   VNFDTPIFQGHGTVDPVINYDYGKQTSELYKQLGFKNLKFNTYTGVAHSASEEELADVI
FT                   KFIKNVVEK"
FT   CDS_pept        complement(559357..559881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570397"
FT                   /orf_name="CD36_52200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41604.1"
FT                   /db_xref="HOGENOM:HBG397329"
FT                   /db_xref="UniParc:UPI000192D2D2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG2"
FT                   /transl_table=12
FT                   /translation="MFRSIIQSRRQLVQFRNLSKYARNPQIYIHEDTLVPQLYKFSLSK
FT                   SPSALHMGTSLSLNPTAADFKANNEFIKLLDFTLQDNIHDDFTYIMEASTNASSFMPIY
FT                   DMREIPRYARTPYIEDVFGYVQVDDKGSMIPNSYQKNEMYQICSGKTGLPVFSEFLFET
FT                   LQEKCEQSSSS"
FT   CDS_pept        560395..562470
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534582"
FT                   /orf_name="CD36_52210"
FT                   /product="Zinc cluster transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41605.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG626372"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D2D3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG3"
FT                   /transl_table=12
FT                   /translation="MNSEISTSNDDVDPLLSSDQELQNPNPKRRKHNRVRTGCFTCRKR
FT                   KKKCDEHKPHCENCIRNKLKCQYPSQWNEALPLDFKLETFQYDELVPLHYKRKKISSNL
FT                   KLQKVPQDLFGVFLLNASSLDVSSSSPKNKEILIVEEMADSEQVKEREVIGTELAGSII
FT                   HDKMENVTQLPIKTSLSTSSTSLPLLMHEENNISQVVRYEVDEHSNDALSWVFTGPMTN
FT                   LHLFGKYIPNIELSPQDAELYVHCARDFMQQVSLPHAHPSLSPPNVWVNLALESSILID
FT                   VYLSCGATYLACLHQNSKVEQSQLQTNDNEQLAQKYHELSETKYNLAVKSLMSAISTNS
FT                   IDLDSDWLMTAGLSLCLRDRANGLNGSRCTKHVSFVYNLIKRRIDKKRQSQRLGNTSPL
FT                   SSITPVERLLIDSFLFNYTCSFLTCGKQDFASLPSPYSFFPDIENWFDVPIFQNCEVKW
FT                   MNNPVLGAARNSFQTLAKLIYLLRSHYEFDGDGADNCHHMNDEIFWGLILAINDQEIDQ
FT                   VEKDNVLKLKQLLEIFPLGSKTMATSHSGEELSYSVLRSNLAVSIITINACKILAAKLI
FT                   NPKIPAYLPQIQSSVSIILEELSLYIPQDNYSSSICIASLFFCGVAIINKSQQDLLCCK
FT                   LSNLKNNLSQIVANNLISILRKCWDKETTERVIFGDKCYKCFDTIFDRAILESVAF"
FT   CDS_pept        complement(562529..563395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000226425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570398"
FT                   /orf_name="CD36_52220"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41606.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG574115"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniParc:UPI000192D2D4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG4"
FT                   /transl_table=12
FT                   /translation="MTDNLIAKVQEHVPNIPLKLISQGAEALVFETSVHPYYNYNSNDR
FT                   SHEKPYLHNYTTFIIKYRPTKPYRHPKIDLQINKSRTIGEVKFMYKLSKLNIACPNIIS
FT                   TDFNNGIIWMECLGSKLPNDTISSFKNWLWYLESQEKENPNINLHDDGQVELVCQKVGQ
FT                   LIGRLHLNDMIHGDLTSSNIILTEMDASNNLFNFEPALIDFGLSSFSGLAEDKAVDLYV
FT                   LERAILSTHSSYADKLNRWLLEGYQQIHDSAEFNKTKQQQGKLKLKDTLKRLEDVRLRG
FT                   RKRSMLG"
FT   CDS_pept        563677..565989
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077555"
FT                   /orf_name="CD36_52230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41607.1"
FT                   /db_xref="HOGENOM:HBG448718"
FT                   /db_xref="UniParc:UPI000192D2D5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG5"
FT                   /transl_table=12
FT                   /translation="MSDNNSSSGSSTIPTLCYVIPPYLLNSNYGSNLQKQLLAKNQQMG
FT                   LLNVISTDSKNYYNHFKEQQQDQGEGNNNKRKRKFSKDPYLNEIIKMKLIYKLSIIGVL
FT                   GDNPMEFLNGNDNDEYIYDMLDTFKRRLISSDDNDDNNGDNNSRDESKNGNVANNADAQ
FT                   HILVESLRRNNKDNNNSNNDKLPKSVFNSRNNKIGEVEFNQLGGIPPQYKKYLSMSLKD
FT                   LILVTNCHINDRYKFPPSFIDFGNDDFFNYTLPITWIPLIPNRYLNYLEKSFNLVIQDD
FT                   QGFSNITMSIDSSPSSLSGIKNGASANLYQHDDSNEDFDIDIDNEISRKQRQSRYYNLI
FT                   TDKPIISSVGIFYYEVEIEQVITESTNFNSIIQMNDSSINSNNSLMLSLGFIKRFINFE
FT                   STPTTSPNSLHNHHNDNNSAANNNTGSILSGRVDLENIKSDLFVNDSLEEEESIGDIEI
FT                   KKYLTARPGELRGSVAINLEDSTFYNSINSISGEFGASLASASSSMHRAQILNMNRRLS
FT                   NRSEYDSTATTIAGGGGVAGKINIDIPLKTKLIKDCRDERVYKTDIIGMGVNFIDKSIF
FT                   ITLNGVLARVVTETELNNNVDGDKTSSNNSNNSNDNSNSNKTSATNNGRIDEDAMYPMI
FT                   GFKINEISRNINNVTDQKANDKTKSTKVNIKTNFGSKSFFYDIDSYVAHYKKLTRQLLN
FT                   MKILEMINLDVKEYNAAQQEIDKSNVFEIIKNYMMSNGGVHNNNIFANLQRNLLELNEK
FT                   DNKDHLFTLINLENDFM"
FT   CDS_pept        complement(566265..567506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570399"
FT                   /orf_name="CD36_52240"
FT                   /product="Uncharacterized GPI-anchored cell wall protein,
FT                   putative"
FT                   /protein_id="CAX41608.1"
FT                   /db_xref="HOGENOM:HBG397330"
FT                   /db_xref="UniParc:UPI000192D2D6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG6"
FT                   /transl_table=12
FT                   /translation="MQIKSFLLPIVAALLASVSAADSSDKCSFSKTSITEATGISQLNA
FT                   CSTLDGEVTISGNSIGNIDLSSVKVLKAKLSILNSPSIVSLNFNQLQNITGSLVINNAT
FT                   QLNSIDLTQLTNVETLQLVSLPSFATLNLNQGVQKAGTIVLSDTALHNLNGLASFNTIE
FT                   SININNNKNISSIEFSDLQTVTDSLILSFNNDDAEVKLNSLKWAGNLTIQDVSSIQASN
FT                   LTSVNGSLLISYNTFDELEFPNLKNVGNSMQIFAHDELARVSLPKLSELDGELEMFNNT
FT                   QLEEIDFGNLTTIKGAVTISGPFDNLTMENLKLVSGDFEVNSTSDKFDCSDFDKLHEKG
FT                   KIEGHNYVCTHPANPSSSSKSGSSSQTGKSDSKSSDGSSKSDSTSSSKKGAGNALVVPG
FT                   MVLTTALGVLLALI"
FT   CDS_pept        join(571664..571789,572206..577143)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228899"
FT                   /gene_name="INT1"
FT                   /orf_name="CD36_52250"
FT                   /product="Integrin alpha chain-like protein, putative "
FT                   /biological_process="integrin-mediated signaling pathway "
FT                   /protein_id="CAX41609.1"
FT                   /db_xref="GO:0007229"
FT                   /db_xref="HOGENOM:HBG397331"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI000192D2D7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG7"
FT                   /transl_table=12
FT                   /translation="MQTSLSTTTIEDHLHHHYSPEESQKLISRESSINTDLFKHENESV
FT                   DLLLKEMNSTPSKLLPIDKHSQLQLHPQSSSASIFNSPTKPLNFPRTNSKPNLDPNSSS
FT                   DTYTSEHDQDKAKEEKKDSTVQTSFDRNFDLDNSIDIQQTIQHQQQQPSQPDHNLVDEF
FT                   SFQTPMTSTLDLTKQASTADKVNQNHAPTYINTSPNKSIMKKATPKASPKKVAFTATNP
FT                   EVHHYPDDTAEEEDQSQQKQDSVEPPSIQHQWKDPSQLNYSDEDTNASVPPTPPLHTTK
FT                   PTFAQLLSKNKDANLETEALTDMKLRHENFSNLSLDEKVNLYLGPNTNNNIGGNNKNVS
FT                   DMDLHLQNLQDASKNKTNESIHNLSFSLKTPKNDIENPLNSLTNADISLRSSGSSQSSL
FT                   QSLRDDNRVLESVPGSPKKSNPGLSLNDGIKGFSDEIVESLLPRDLSREKFETAKENDV
FT                   AEHNNDAKSTNAIKGQPLVSSDEHLDSFDRSYNHTEQSILNLLNSASQSQVSLNGLHKQ
FT                   THGPEQEQTQQEEASSTDNIKVKQEPKNSMDSIKVTVKKEPAMSTEEKPPKREFSSQRL
FT                   KIENTKEFAELAEYYPKKENEANIQVEDTDGLLKKALDDDDESDATQNSTKMSIRFHID
FT                   SDWKLEDSNDGDREDNDDISRFEKSDILNDMSQTSDTTGDKYGNSSSEITTKTLAPPRS
FT                   DNNGNKTSKVPTNTDSSQQQPQLEVPHTKEDDSILANSSNIAPPEELTLPVVEANDYSS
FT                   FNDVTKTIDAYSSFEESLSAEHDTDTKPIDFISIWHKQEKQKKHQIHKVPTKQIIASYQ
FT                   QFKNEQESRVTGDKVKIPNTLQSKKFKEVNVMSRRVVSPDMDDLNISQFLPELSEDSGF
FT                   NDLNFANYSSNTNRPRSFTPLSTKNVLSNIDNDPNVVEPPEPKSYSEIRNARRLSANRT
FT                   VSNQAPPLPPQRQPSSTRINSNKRMSRFRVPTFEIKRTSSALAPRDMYNDIFDDFGTGS
FT                   KPTIKAEGMKTLPSMDKDDVKRILSAKKGMTQDEYINAKLVEQKPKKNSIVTGPEDRYE
FT                   ELQQTASIHNATIDSSIYGRPDSISNEMLPYLSDELKKQPVALLSADRLFMEQEIHPLR
FT                   SNSVLARPAANSSMLPEPDFELINSPTRNVSNNSDNAAVSGNASTISMNHLDMNFDDEA
FT                   TIGPNTREQFATKAVNCADGGDNVPETPRTPTKTESISGKRAVLSSNSPRKSPIKIGSP
FT                   VRVVKKNGSITGIEPIPKATQKSKKSFQGNEISNHKVRDGGITPSYWSDHQQHNPSMVS
FT                   VPSQYTDATSTLPEENKDTQHQPREKHHHHHHQHKHKSDISGVVDDEIPDVGLQERGKL
FT                   FFRVLGIKNINLPDIKNHKGRFTLTLDNGVHCVTTPEYNLEDNNVAIGKEFELTVADSL
FT                   EFILTLKASYEKPRGTLVEVTEKKVVKSRNRLSRLFGSKDIITTTKFVPTEVKDTWANK
FT                   FAPDGSFARCYIDLQQFEDQITGKALQFDLNCFNEWETMSNGDQPMRRGKPYKIAQLEV
FT                   KMLYVPRSDPREILPTSIRSAYESINELNNEQNNYFEGYLHQEGGDCPIYKKRFFKLMG
FT                   TSLLAHSEISHKTRAKINLSKVVDLIYVDKENIDRSNHRNFSDVLLLDHAFKIKFANGE
FT                   LIDFCAPNKQEMKLWIQNLQEIIYRNRFRRQPWVNLMLQQQLQQQNQQE"
FT   CDS_pept        577689..578594
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228900"
FT                   /orf_name="CD36_52260"
FT                   /product="Pre-mRNA polyadenylation factor, putative
FT                   (Subunit of cleavage polyadenylation factor "
FT                   /protein_id="CAX41610.1"
FT                   /db_xref="HOGENOM:HBG626660"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="UniParc:UPI000192D2D8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG8"
FT                   /transl_table=12
FT                   /translation="MANSDDDDAFLYSDEEQQVEEQQPKTKRVKFADEESKKEDKSKEK
FT                   EQQQKEEHTDGASDSESGSGSESSSESDSDDDIDIIIGDNQPTKSKSSGTTIIGNEALS
FT                   EMTDPEASSSSSTAGAGAASGSNKRQSTSTVDLDSVPRYQEGEDGEGEGTLITQLDIET
FT                   LKLKPWRAPGVDVSDYFNYGFDEFTWLAYCHKQDKLRGEFNPQKVMENIMKGPGGANGV
FT                   NSGDKTGQQQQQQQQPPQPPMGMMMPPPGFMANMPMPPMGSMPPMPNMPNMANMPPPPP
FT                   GFNGQFPAPYNIPHNMNQKQ"
FT   CDS_pept        complement(579042..580271)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570400"
FT                   /orf_name="CD36_52270"
FT                   /product="Eukaryotic translation initiation factor eIF-5,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAX41611.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG559646"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI000192D2D9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHG9"
FT                   /transl_table=12
FT                   /translation="MSFINICRDNTDPFYRYKMPPIQSKTEGRGNGIKTAIVNLAEVAR
FT                   ALNRPPAYLVKFFGYELGAQTQILNDRYLVNGAHDSNELQDSLDGFINKFVLCGSCKNP
FT                   ETEIVLKGKDSLERDCKACGKISLVDPKHKLYSFIVKNPPDNKKGKKSATATANVVGGG
FT                   KSISDIASGHNGQGDSGNNAANGESGENGEGYNDDEDDDLLAKKINAEVAQLKDVEIKD
FT                   DDWAVDMSQEAIAARARELEGLSLQNNKFDEFGEWLLKESNGSKDDLPSDVEIYKRIVE
FT                   LDIADSPETLQVLGQVLFDDDIINQIEPHVGLLAKLINGDEEFEKALLGGLERFFGLEK
FT                   PNLIPQIPKILHGFYDRDLISEEVLIKWGSKVSKKYVPKDVSKKVRKAAKPFVKWLQEA
FT                   EEEEEESDDE"
FT   CDS_pept        complement(581161..584025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381798"
FT                   /orf_name="CD36_52280"
FT                   /product="RNA-binding protein, putative "
FT                   /function="RNA binding"
FT                   /protein_id="CAX41612.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG448555"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D2DA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH0"
FT                   /transl_table=12
FT                   /translation="MNTGSSQDSIPIENISLGLSTSPLNTISSGGSDSTIGHLNTPPTT
FT                   RVRSGSLFSIWNEPSLSHNSNNTSNGHEMATSTSRNRSYTTTGALPSITIDSFSESLQK
FT                   SSAPRVSTSPFISVPNNDMIVLDNFQTNLPRLRSQTISGTPISSQNTLPHPSESLNAPH
FT                   HFPQVFETVSSNPSSASVLPFNQSPQLFDDVDFTRFLITTSFDNPNLGPTKYLLFDNLP
FT                   LIINASKLFGILSNSLNQRMGSIHGIRITTTTTSKLALVECTSIDTAMSLKASFNHLEL
FT                   VPGNILYVAFAKVDDVQSIGQQRVRSQHPQQLVTSPAQPLPQLQQQHQPLPLPQLSPNH
FT                   NTNHTHNHNHNHNHQQPQLVQHSLPDKSESPDPTDILSIQQNLMNSIAKLSSTVDSKKI
FT                   ESLINKCIAYSNDQYQSDFGPLPDPIPLRKFDSPTLRDLRKVLENNEAQLIGQNVDGGE
FT                   VMSSFELEEFCLAMLDELPELSYDYLGNTIVQKLFTLVESPLVKLMMVKEVAPYLTQLG
FT                   IHKNGTWAIQKIINLCHSDYQQMNLIGASLKPYAVKLFNDQFGNYVIQGCIKFGSPFND
FT                   FVFEAMLDNFLEISVGRFGARCIRTVLESCHDSSSTSPVTNEQVLLVAGLIIEFANELA
FT                   VNSNGSLLITWYLDTFKDCDSKIELLMSKFLPNIKTLCVHKLANLTVLKILNNRVDDKS
FT                   RVTTMDAIFNNKETLEYILQESDNSNTTAGPLFIYKILSNPILADLVNQHVPTIRKILM
FT                   ELNIVNFQNYKKLMDEVGISSTRIGRNGSTKRNGTFNGNRRGGSMRGNKQDGYIAPPPP
FT                   PPPPPQQQQYFVQGIPNPQGQHSPIKPQLQPQQQQQQQRSGSPPFQNRYIPMPQVPSQY
FT                   NNVTPQMYMKQMYAQQQAQIQQQFYLQQQQQQQQQQQQQQQQQQMSPQEFAVMQQLEQL
FT                   SLSSAALGYNSNPGTPTLQRHSFT"
FT   CDS_pept        586180..587043
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228901"
FT                   /orf_name="CD36_52290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41613.1"
FT                   /db_xref="HOGENOM:HBG397333"
FT                   /db_xref="UniParc:UPI000192D2DB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH1"
FT                   /transl_table=12
FT                   /translation="MSIKIDHIIKSSKELYPQIIEELSSQFKKKYDKNTKTFEQLNTWK
FT                   EDELTNTLLKRYQQTGTTWITKDELVNLLDWKLAKGKFRPMLPKLIKSNDSLVVEETTK
FT                   QGYQFLLDYFKLHSNSKKQSQSLDKFWGEAKDEDKIEYSETIKKSFEKFSLLKGVGPAM
FT                   ASLLGSLVIKINPYLTPPFFSEESFLFYYLESFGSGEKVKYNMKEYIEELLPVYFEIIT
FT                   QHPEVTMDTLERGGWALKAYQIQNDDKLANIETEYTDEDTDRLKLEHKPDLKLIASAPR
FT                   RKKQKK"
FT   CDS_pept        588205..589665
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186273" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570401"
FT                   /gene_name="UAP1"
FT                   /orf_name="CD36_52300"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase,
FT                   putative"
FT                   /EC_number="2.7.7.23"
FT                   /function="UDP-N-acetylglucosamine diphosphorylase activity"
FT                   /protein_id="CAX41614.1"
FT                   /db_xref="GO:0003977"
FT                   /db_xref="HOGENOM:HBG527090"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="UniParc:UPI000192D381"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH2"
FT                   /transl_table=12
FT                   /translation="MTVKSQQPIIDSFKQAHQDQLFQYYDSLTIDQQQQFIDQLSTIEE
FT                   PAKLISTVEQAIQFSQNNSASRNFTQLPNEQTASTLDLSQDILQNWNDLGLKAIANGEV
FT                   AVLLMAGGQGTRLGSSAPKGCFNIDLPSQKSLFQIQAEKILKIEQLAQQHLKLETKPVI
FT                   NWYIMTSGPTRNATESFFIENKYFGLDSKQVIFFNQGTLPCFNLQGNKILLESKNSICQ
FT                   SPDGNGGLYKALKDNGILDDLNSKGIKHIHMYCVDNCLVKVADPIFIGFAIAKEFDLAT
FT                   KVVRKRDANESVGLIVLDEDTQRPCVIEYSEISEELANKKDPQDSSKLFLRAANIVNHY
FT                   YSVEFLNKMIPKWISSQEYLPFHIAKKKIPSLNLETGEFYKPTEPNGIKLEQFIFDVFP
FT                   SVELNKFGCLEVERLDEFSPLKNADGAKNDTPTTCRNHYLERGSRWVTQNGGVIDNEGL
FT                   VEVDSKTSYGGEGLEFVNGKHFKNGDII"
FT   CDS_pept        join(complement(590643..590895),complement(590324..590543),
FT                   complement(589775..590261))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197910" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570402"
FT                   /orf_name="CD36_52310"
FT                   /product="Meiotic septin, putative "
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAX41615.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI000192D382"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH3"
FT                   /transl_table=12
FT                   /translation="MIYTAEQIRHKKKLKKGINFNLLVVGVNDLGKKTFINTLINQPYY
FT                   QINQPIPNTSQSSIAGTSSSKSFQDSSNNNELSIETNSFECCPGSIPVKLKISVTHNFG
FT                   FNVHDDSHGHTLLSFIENKHRAILHEELKISRNPNLQDNRLHLGLYFISANVKGLSKFD
FT                   ISMMTTICHRINLLPIIAQRDGLTDTELSQCKHAITRDIQENNIQIFNFLSKSNDDDHK
FT                   RDGDFEEYMTLSAKEYDYLSELNKLIPFAVIGSNSIGELQNEIVRNTKWGAIRIEDKNI
FT                   CDFKLLKNVIFETHLQEFKDVTVEKIYEKFRLQQLIRN"
FT   CDS_pept        complement(591132..593504)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570403"
FT                   /orf_name="CD36_52320"
FT                   /product="U3 small nucleolar RNA-associated protein,
FT                   putative"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAX41616.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG397335"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013934"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D383"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH4"
FT                   /transl_table=12
FT                   /translation="MDTLKTTYAHTDIEPIYVGGTSASISTSNGELLATPLNEDVIVTN
FT                   LTTNEIIYKIPGDGEVVTNLAITPDGSYLAMISQSQLLRIFDLNKGSVVKNFKLPSPVY
FT                   ISSVDTTSSLFAFGGSDGVITVWDIENGYVTHLLKGHGTTICSLTFHGELNSQDWRLAS
FT                   GDTMGTVKIWDLVKRRCIHTLKDHNTAVRGVGFDRDGDLFISGGRDNVVIIYNTKNFKT
FT                   LNTFPINEQIEAAGFVSLIDERQYFYTAGSENVLKVWDIKLGEMIGRSPIPLKTNEELL
FT                   IIDVIKLYNNNLYLVISDQTLIELDLQELTPDHEVVEFPIVKRIAGNQGIIADIKYVGP
FT                   EFNLLAMATNSPALRIVDTEKPLELRVYEGHTDILNAVDVSTDGKWIATASKDNEARLW
FT                   RWNDELQDFEPFARFQGHAGAVTAISLSKSQNEPRFLITGSSDLTIKKWKIPNAPNSIV
FT                   KTSEYTRRAHDKDINSIDVSPNDEYFATASYDKLGKVWQTDSGETIGVLKGHKRGLWDI
FT                   NFYKFDKLIVTGSGDKTIKVWSLLDFSCKKTLEGHTNSVQRVKFFNREHPQLLSCGADG
FT                   LIKLWDYKQGEIIKSLDNHDQRIWAMDLKNDGEFFTTADADGKLSSWTDNTEEEVKLKE
FT                   LQAKEKIEQEQSLSNFIKNKDWSNAFLLALTLDHSMRLYNVIKSSIETNDDKDSIIGSF
FT                   ALENTISLLDDVQLVKLFKKIRDWNVNFKFFEISQKLLNVILNNFAVDKLTEVPGLMKI
FT                   MESIIPYNERHYNRIDEMVEQTYVLDYTVEQMNKLIA"
FT   mobile_element  complement(593649..594128)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon A"
FT   mobile_element  594131..594425
FT                   /mobile_element_type="retrotransposon:solo LTR, nu G"
FT   CDS_pept        complement(594458..596137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228902"
FT                   /orf_name="CD36_52330"
FT                   /product="ABC1 family protein, putative "
FT                   /protein_id="CAX41617.1"
FT                   /db_xref="HOGENOM:HBG397336"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000192D384"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH5"
FT                   /transl_table=12
FT                   /translation="MFRQSLIYINRPKKSVNPVYLRHYVKTQIPITTFEFSKPKPQNKF
FT                   RPLVYRVAIVATGLGTAYYIDNHYYSALMTRSVRAVYVLLWIAYAYGFNSNSYKNIDDL
FT                   HEIASDKLLHLLTTNKGLYIKLGQAIANQGNLFPLAYQKKFPQLYDQAPVQSWQDVDRT
FT                   LKENLGDDYQTRLFETIDHEPIASASIAQVHYGKLKNGEEVAIKVQHGYIENQIVVDLM
FT                   IYRFISKVYEKVFDIPLSMFTKYISEQLIKETDFVHEMQNSEKLKKLIDNDSSLKHDNI
FT                   KLPKNYPHLTTKQVLTAEWINGIPLTNKQTLLDHNYDLTLIMKQYIKLFGRQIFEYGFI
FT                   HSDPHPGNLLVCFDSNNKQQLVLIDHGLYITLSDLFRLQYCNLWRYLFSLNTKGIEKIG
FT                   REWGISSIDLFATVVQLRPVLLSPEVQSNENGEDHRNISDLFRDFIGDEKKFPGELPFL
FT                   SRTMRMIQNLNQSFGSPVNRINLLTKESINALLSEKDLKFGNYWDLLRIKITLLFSGFM
FT                   FYIVRLRQILSGDRFGGKGKGLEDYIEMYMQNTAKSLGMEWI"
FT   CDS_pept        596775..599000
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077556"
FT                   /orf_name="CD36_52340"
FT                   /product="Alpha-1,3-mannosyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX41618.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG396768"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI000192D385"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH6"
FT                   /transl_table=12
FT                   /translation="MFRPVLGTKKIRRVICIISLLCILLLIGAVKYNYINSVKDEASNS
FT                   TTGFEAEQYTFPKTVLFESNNNLDDLLAKKNNWKFQSNVYNQLFTDHSIESVLSLSFNQ
FT                   RCELLVRNVISQKVSWAFDPLETFEINYESKDYIQFIQEEGLKLTEEFERTKNNLKYKT
FT                   SLNNFLKDEYKTIRSKQYEQKIIDQLTIVRIFNKCFIHNDQRDRNNLLERLIQEQQKQV
FT                   ANANSANVQSELKLTENEKMVEALAEDYTTLGKRVYPWISQQFPLYERWNGDSYYHPPN
FT                   YEEILKDETHKGETPTTRYSTSQIFLNQFKDTSNGKGIVLSITEKHIDDTVNLIRLLRA
FT                   LNNKLPIQIIYFDDLSQSSKTKLLRAARGEINKFPKSYEKVYNGKQPSFPPQEVWFVNI
FT                   YESVNPRYRNLFKKFDFKLLASLFNSFDEFMLIDADTILVKRPEFFFKQQAYQQAGAFF
FT                   FKDRTPLLKRPITDGQFLDKMGPSAIDSMMFDIPMMSQYTTHRELFKGLRLYMESGLVM
FT                   IDKRRHFSSILMMIQLKFIHPISGSMWGDKELFWLGFAINGDENYKFNNRFAAAIGQLT
FT                   SSQYRKGKDGKTLNAKEICSSHPGHISDDDDRSLLWFNSGFRFCHEANNLNYEKESKNS
FT                   EILKSLNGPLEFEKYYSDPLRITHAIVPPLNKNLQKMYNYDEEPADGWTSEPNCNKYMW
FT                   CAYSSIGGRTSPEENSHKETLDGLLIDYTPEEIAYFNYLGDVWVGNY"
FT   CDS_pept        599443..599727
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570404"
FT                   /orf_name="CD36_52350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41619.1"
FT                   /db_xref="HOGENOM:HBG397337"
FT                   /db_xref="UniParc:UPI000192D386"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH7"
FT                   /transl_table=12
FT                   /translation="MFSVSRQLFRSSIRSYSTTAAANGAPVKVTKKVGAFRGGFIGFLL
FT                   GVTTTGALSYYYLLDQYKLANTVVVADIVALQNSISNLEKHIKSLEERK"
FT   CDS_pept        complement(599932..602508)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094195" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570405"
FT                   /orf_name="CD36_52360"
FT                   /product="Sigma-like sequence protein, mitochondrial,
FT                   putative"
FT                   /protein_id="CAX41620.1"
FT                   /db_xref="HOGENOM:HBG397338"
FT                   /db_xref="UniParc:UPI000192D387"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH8"
FT                   /transl_table=12
FT                   /translation="MALSSKKCFYKYLNPYGSLLRNFTVSSLRSQKIQSLDDFVLPELK
FT                   SEEKTLYDTSKRIFLKANQIYNDQKKNKYKNKAQRGNKGSGRSPRDLDKLPVIDRSFFM
FT                   DFKPTESEEGNDINNSIETYKPLDSVIGAKKFGKLVKTMNNAFTKEQLREYYDHQQSIN
FT                   PGMRWKGSSSLVKLKLIERIILDVWNISKSKKLIVNDMLEDRQLLLKPWQRYLLGFNQS
FT                   LLFKNMLRLKVKGKFSKNKLQLTGSESDLNFIEPELHKLLSDYTMESVDLSLFLEKNIV
FT                   INFDLIQEMAKVYFHRTKKTSNVYEIYAKKTEGISLAKRLLIWSLNSNPHIKDEVFGKS
FT                   TLLESTFVPFSNEELFPWYKRPFNYFAPLKKDHKSSNDLVFDKFDKMSNYFIESEELEE
FT                   LTDARFSLGEERFQDNTEIDLDELLNTATDESSKVDFPDMTKILDNQEKAKQQKQSHQD
FT                   LEDLRKELGTFSNEDVDVSEFPNIAKLVEDFENADSSKQPDNLENLRKELNQFAETEES
FT                   KDINFDVIDKLIESETDQGVLSSESLDTDISEHLTKQQIDDLYENVSDLTFTSDLNGVN
FT                   EENIVSSAYTLQFGTLVMKNKKSPSDGLIPKPVSPITENQEFQFVNSAPFMNDLISSYP
FT                   VISQPGRQELSEQPYANSMAIRLVPSMYQMKKKNKYEVTDKYVNYPPVEIQANLDRGRI
FT                   LHYTLQVLSLEAVKNVAVPLPKLPCDIQVSRLLLGSLLPMNEESSSSSSSSSSSSSPEV
FT                   RLASQPDLINFLEESKLNFSGTEKISVKPSLELIINGEPVKYDYLHVSYKTDMNFKVNE
FT                   RELLVSFIEGGEFGGRSCEIAIGNGELSRDDFEKLLKDSIQLINQI"
FT   CDS_pept        603869..605311
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534583"
FT                   /orf_name="CD36_52370"
FT                   /product="Proline oxidase, mitochondrial, putative "
FT                   /EC_number="1.5.99.8"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAX41621.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397339"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI000192D388"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHH9"
FT                   /transl_table=12
FT                   /translation="MSIRLYSKQSLNIFRRSARIPTATQLYRAQLRYFHDTPNKQNVTV
FT                   NNMMPGVTKPTNTFTTPQLASTEYLKAFNNRELISFFMIGIVTLNKPILQLCIKLFPYV
FT                   PMSIIKALVYRIYCGGETIDQVKQTGLRLHERGIDNMMISLTIEACDGNDNVDPKYIVE
FT                   ETAKSIENILVPHTVKMIDQAADINDIPPGYVALKPTGFAKDAANVLKNYNTTMSKEFD
FT                   ELVDKATTVCQTVYDSNLKLAKQYPDRVSPFVVGVIDAEKHDLQEGVYELQRRLYKKFN
FT                   KLNQPVSIVGTLQMYLSESASLLTKEEKLANENKYRLGLKLVRGAYIHSEKNRDVVIHK
FT                   TKQDTDNNYNSGISYCIDSIMNQSGNESTIGHLVVASHNAESMRLASGKVYNPVNESNK
FT                   NKTNVVLGQLLGMADNVTYDLITNNKIGNVIKYVPWGPPLETKEYLLRRLEENGDAVKN
FT                   DNGWPLVKASFKMLTKRVFGSA"
FT   CDS_pept        complement(605496..608693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077557"
FT                   /orf_name="CD36_52380"
FT                   /product="DNA repair protein Rad9 homologue, putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41622.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG397340"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR013914"
FT                   /db_xref="UniParc:UPI000192D389"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI0"
FT                   /transl_table=12
FT                   /translation="MDTQVDQHVLPQSAQSENSQFQQQGHSAINVNSEPTQKDSSLFKD
FT                   YEDHNSSLIFGGNITNDDNVDDNDTEIIPTVEDQIIVDRTVEDVTEADDKYQNDDTISP
FT                   FSKKLKEMIDEQKQSSHDQGQTNGTHSEYLKSYSRESFRDNGNDDTQIIIQRHYNSNDN
FT                   YDIESSNGTSQQKQTNSKIIVENKMNTQDNQLGDTQVIGRALPDTQIINNVLPDTQVIN
FT                   KVLPDTQVIKKVLSDTQIINKALADTQVIPKLLPNTQVINRVLSDTQVIQKNIPESQVI
FT                   QLPDTQTQSVSYYDSQKVLHSSPADHSQAISPSHNKKTCKSQTQVLNTQDLSDISTSED
FT                   TTQEHASKSVIEIQTDSDEDESEDKKIQSKYYDDSLTAHQFKRKLSLSPQKIKRRNTEL
FT                   IPSRTNKNSLLTTINGISSSSSSSNKDFLKTPGLRQYSIPLVLASPTNPLSSSSPLKKQ
FT                   LNLDEEDKSIQTDKIEEDSTSMDIAPLPSSPNKGVKISFEEEHEPSDLEEFDIDIDQIK
FT                   AKNKAIIEIDDDDEEEVDDDDDDDDDDSSSSSKKQSDEAIPIIAPRSRANKKIIDSQSM
FT                   NTNEDVDSITEDSTEPDILRQEESTTLTEDDIINHDSVWAIYNLKMYTGRIVAKYIEDS
FT                   NIEFDEGTYNVKNVDLNVLDIRIGDTVNVKGNRHKYTVTGLSTLAGDEKSKLSNIKCMR
FT                   GYNVVYLRRSQQKPNLNVPAKEFSVILSDCFMELSDWIMHQQKYKLIIGNYNIFTDEAI
FT                   LPSTPKKSQKYKLPSTPLKSLKHTNSEIIKPNSADSKIFQEMIFCITSIDGDRKMELKS
FT                   IIETNGGILWDKEIHELFSYHEQQEKEGSQISLNLTCDLEVAQTFNFIALISNNFCRSA
FT                   KYLQALALGWPIISDVYIDDCLKDTTNKQKWTNYLLPSGLSKKLTTIKSIDIFRFKENY
FT                   EAGKMLVDQFNNNHHVFNGLDILILQNKSINHNSMETCKFIFYAFGAKSLQYFTKTDQI
FT                   IKCIKEDFTGIEDNITIYDESNDMVQALTNNRNITGKNNRDKPKSNYSIKLIDWEWVVQ
FT                   CVINGAILESPKYTVSV"
FT   CDS_pept        complement(609119..611065)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248389" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570406"
FT                   /orf_name="CD36_52390"
FT                   /product="Negative regulator of transcription elongation,
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41623.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397341"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000192D38A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI1"
FT                   /transl_table=12
FT                   /translation="MEEPTKRVTRVNRGQNMKRHIEELLSNDVKYFSSQSVDSTNKKQK
FT                   VKKNATKDVTVTQSNTEDHADESDDEVRCRPCGATKDNYDEDEDTLGDMVQCDQCKTWQ
FT                   HAKCMGYKTKRSIPNIHKCDVCTGKPIPQSKTNPKKTTTKTEEEEEDTIEITDVNEKKS
FT                   VAILKDEVRISTFKAFYNFFKKVIPKDGENTSEEAIESRVNDMALEIESIIHEEFPGKA
FT                   YPTEGRRILFVLKKHFMQEIFDGTITFKDVIHKTPQEINADIVRIEKQNKENIKNIILT
FT                   ENDTTQIIRRTHKGEIVKENDFENSNQIDESIATRKVDHRHFSPEIVPESKFRSHTKTQ
FT                   SKGYNNLNPRFEEDDDDEIVNQNNEEEEEEEEEEGSVATVTESSGTNPPQSENKSTPKS
FT                   SESLSDVDTLNHNDADDSHLYSFLSGVENSVTNNTKVESKHVWSGRITFPEFATFKAKG
FT                   EFYTSTDYNDKPMDHLINTAKDILHLPSYTILGRLDRHVADKYLPKVIGSRDFYFVQIL
FT                   NDDDNDDQFQKLYQYLLIKNKVGVLSGQPSFVKDSYLIPIDFRDENLPPFLKNSRRDLR
FT                   IGLFALFVVRKDYQPRPRSSVTNSSNHYHHVEERNRSLSATGDSTSSASAHSVEAKQET
FT                   KEPRLDDILSQLN"
FT   CDS_pept        complement(611743..614145)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381799"
FT                   /orf_name="CD36_52400"
FT                   /product="Alpha-1,3-mannosyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX41624.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG396768"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI000192D431"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI2"
FT                   /transl_table=12
FT                   /translation="MIRKLIRNRQRSKWVLFTGASIWIFFILYFINSNYYNTESHLSSY
FT                   SIYNIYDNLHEENESPSKSILSPLVDNSANDQQHISNFKNHTLYESLIKSTFQNTTKRT
FT                   KDLNSNIYDDIFTNHKLETVLGTLSFKERCDLYFKNVFAQDVNWHFNPDTKYDVNFDKK
FT                   TKEYQEFNKVKELIIQEKFDKMKQKLKEEDYSKELEKLQKSMFTDYMHQKFEQEIVNRL
FT                   STFRIFNKCYITNDETPQINKINQFITNQQKLVQNLHRESETSDKTKIDKLELTDKEAL
FT                   VDLMVTKSSTFEHRVYPWISKEYPVYERWTGKVYHEPPNYYEILNHDPMQKTTKKTQHS
FT                   NNAAEPFLKQFKNKFNGRGIVLTIGNQHSDYAANLIHLLRALDNKLPIQIVYYDDVNEK
FT                   SKRKIVTAAQEDFRSLPHSFEKVAHLFGDKYINSQGKGLQPQEVWFVNAYNSIHKNYRG
FT                   KFSRFGNKLLASLFNSFSEFILIDVDTVLMQPPEFFFQLKNYQTTGTYFFKDRSVFQKR
FT                   SLEDGKFFERMGPSTVDQIMFDIPIMTNYTTTRELFRGLQHYMESGLVMINKDKHLNSI
FT                   LMITQINLIGPITGKVWGDKELFWLGFAINGDEEYYFDNNFAAAIGELTPPQDRARKDG
FT                   TWHHSKEICTPHPGHISSDDNHSLLWINSGFRFCHQADEVDFEKEAEKKTRLKHLQTAD
FT                   QFRTFYYNPLRITHAIVPPLDPDLQDRKNAMDEPTNGWFWESGYCRRYMWCAYSSVGGP
FT                   QKRPDEKDDKNDNNKIKDNTLEGILVEYNQDEIALFDYLGDIWVGTE"
FT   mobile_element  complement(616320..616505)
FT                   /mobile_element_type="retrotransposon:solo LTR, phi F"
FT   CDS_pept        616844..617443
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228903"
FT                   /orf_name="CD36_52410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41625.1"
FT                   /db_xref="HOGENOM:HBG397342"
FT                   /db_xref="UniParc:UPI000192D432"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI3"
FT                   /transl_table=12
FT                   /translation="MSNNHLQPPNNSHEDSSQITTISDISCSKISTLADLEPFCIGTGT
FT                   TPRVHLQCRYYRFPNEDSFETWLDDRKQVVHWICRQKKPHKNSAFLEYREYECNFAGRY
FT                   TQTSANHINTTNDLQQQNGDGTNETTPAPIKKRKRKPTIKINCPAKIQMKITPKDPDGI
FT                   YVTWIYKHNHDVGTEEYFNSSREKKNAKRKSKKRKR"
FT   CDS_pept        complement(617842..620451)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248388" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228904"
FT                   /orf_name="CD36_52420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41626.1"
FT                   /db_xref="HOGENOM:HBG398545"
FT                   /db_xref="InterPro:IPR018837"
FT                   /db_xref="UniParc:UPI000192D433"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI4"
FT                   /transl_table=12
FT                   /translation="MGYKNSDNTNNKFSRKSMSPSFTGGKGRKTVGKKVKKTIPRKTVT
FT                   WSSYNVNSDSNEDSDEDIENDSDDDDDDDEDEDEDDETEHHHLDGLYSLIGKKPQDSSS
FT                   NDDDEDEKNNKNIFSSTSSDGDSDEAMFSSSDDDSDVDFVKLQAQQKAHALKVARARKG
FT                   LKSKPKNESNDNAIASSSDSESEPLSDSDNEDDVASMKKLKPRKTSFLKYGRRRSDAVL
FT                   PDINFKFEFDTGENEEVDADHQQTHIREPEEEDIGEEVDYSPEIPVDSTNVPSLEFEFD
FT                   HHLIDVPKINEEELNSDEDYEIDDNELLATLQAENDADEFLPPIIKENDQPHRNDSLIS
FT                   SSIEEEEERNNGDDDDDDENDPFLKEEEKYLVNEFETNGFDENENEEEDEDDLHTFDSD
FT                   FSTTNRIVNSFKGIGEDRSKPIVKYESSASGGSDYDEDDYIDLINFDVPLFDDKNGSIG
FT                   NGTKSSHHKGDSDKSKKDKIKQRSNSNHNSDEDDDSYLWNYFFSSDNESSSEEADEKNN
FT                   NPKPVIKNRKNKQNKKALSTKAITGADELFEQIENDNTFKSKTKPIHHGNSLYKAYSDS
FT                   PMTIQELGAGLGVGSDDDDNYDSSESTDVDESLPKSSSNNSLVGSSKKATEVLSSKTAD
FT                   YRPPKLGSWVTVDCKPFGVIDGLSTRTLQLNKSQEPRSAVQSGASHSTSIVNSPNGAGL
FT                   PTTSSMASSLATNSRKSIVVGPTNASSMISSDDSALGLDELLNVSELDNDDENDVKIWR
FT                   DFNNNQNKKKIPLGAFRNKSVLYNNHIYQDNDNNHHLNHRHSNVDKKFNGSGHIKKQQP
FT                   IRRQSQSKIERRRASIVEAVSQGYRPTKSGLFSETALADVEELFGDDRDLMELIQGL"
FT   CDS_pept        complement(622967..623965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570407"
FT                   /orf_name="CD36_52430"
FT                   /product="Translation initiation factor eIF3 subunit,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX41627.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG397344"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000192D434"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI5"
FT                   /transl_table=12
FT                   /translation="MSQTNSFMHLVRPNVIAPAAGSANGPASIKIHAPAMLTILEIISQ
FT                   QVLNKRIIGTLLGSRSDDGLEMEIKDGFMVPINETGDSIAIEDQVHKSLYQLYKKAHPK
FT                   ETVLGWFGSSNQIDDITSLIHDFYSKGADRAFPFPAIYLNVEFLNEQNQIIEPKITTYI
FT                   GAAVGKPVTNAQQIGWKTTNVNNSYIFTPIPNEVINATITERIAFKNLIDVKNNHHQND
FT                   TTATTTNNNNNTDDLSYLSQQLNKANNNVAQLLSYIENNGNKDQDIDLLRLLSNQLLNK
FT                   PSILTNLPELEKLFKDHNQDVIMIEYLTKAVKDQIELNARLTASAEADKAR"
FT   CDS_pept        624863..626491
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094198" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570408"
FT                   /orf_name="CD36_52440"
FT                   /product="Cyclin subunit, putative "
FT                   /protein_id="CAX41628.1"
FT                   /db_xref="HOGENOM:HBG397345"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI000192D435"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI6"
FT                   /transl_table=12
FT                   /translation="MTSTTTKINNSITRLFEDDKFLLPQLKSLNNTWIFSEDAVINNSP
FT                   TRHQKLTISQELKNKESMHDFLIRLGQKLKVDGRTILAATIYLHRFYMRVPISQSKYYV
FT                   VSAALTISCKLNDNYRTPDKVALLSCNVKLPPNAKPIDEQNEMYWRWKDQLLFREELIL
FT                   RKLNFDLNLILPYEIRDHIFKNFVLFDQEDESVKLFSTHKLDILKMTTSLIESLSSLPI
FT                   ILCYDMNIIFGTCLIITIIEGRKIIDEKLNIPPAFLHRFLNIDSETCLKCFHFIKKLLK
FT                   FSQDDPHTISNKASAKRLLELRSKLFHEIAKQGDSKQSQPQSQQHENETTNKEKKPEES
FT                   KNEECKTSENIKNGHGTTTTNIDPKIHDSKVDEVEKNEINKQEVDKIQTQGECTQEENT
FT                   IGIAIEKKIPDTENNETKSETTNSTREKDDKINHKTVISNESMAEKNSDVHGNDSNGNN
FT                   GDSGNTSNSLKQGEDTKNEVSKKTADSKEVPTSTNNTSSNNATADLHDSTNGTNEKSIG
FT                   EKRNLEPDSNDANVDSPSSKIARVE"
FT   CDS_pept        626897..627847
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381800"
FT                   /orf_name="CD36_52460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41629.1"
FT                   /db_xref="HOGENOM:HBG448256"
FT                   /db_xref="UniParc:UPI000192D436"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI7"
FT                   /transl_table=12
FT                   /translation="MDPNIDIDIFRDLDASFIELFHRAQLQTHLEHLPPTEREEQLNNL
FT                   LSQRDLLNSHHHQQTQYYHIHWIFSYVPFIILNFDQIWRDFSWRAFWARTVDVVTSAMI
FT                   MAVRALRFTTFIIGSGVYFQGVVRRLFVFCDVITFSDNFIRDMFTYILRDSQDILDQCI
FT                   LLERHSRNVFYFLQYDEYNDLSSLQVLQLAYRNLLASLINVECITYSPNSTGTTTTTSS
FT                   SSSTATTTSCKILTDTLVFKLSSVFQDFFPALGSTGLKLITLWIYISYALIGDIVCLNI
FT                   LLFVSYNLINRFMGYKQMFQGLKDILWNSLFKFIL"
FT   CDS_pept        628153..629277
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228905"
FT                   /orf_name="CD36_52470"
FT                   /product="D-xylulose reductase, putative "
FT                   /EC_number="1.1.1.9"
FT                   /function="D-xylulose reductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41630.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0046526"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D437"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI8"
FT                   /transl_table=12
FT                   /translation="MSIPASMKAIVFYAPYDVRTEERPTPKIKDPKDVIVKVRYSGLCG
FT                   TDLHSYRGHIKGPVGTILGHEFVGTVVAIGDNITKFSIGDDVISNFSIECGECWYCKHG
FT                   YSGQCNVTNTFGKIGLDGGQAEYVRVPYAETTLTKKPPTSSSTSSNNDIDDSVYVLMAD
FT                   IFTTGYYGVKKIKDFLSIPAAEGIKPQSFEETTILQLGAGPVGLCALRILKYFGFGKVV
FT                   VVDNVPSRLEEAKRLGATKVINFDTEPDGINKYISEETDNVGFDAVLEVVGSAAAHKTS
FT                   FDAVRRNGFISSIGMGHEPFPFNGLDVYLKNINMSFGRCHSWSLFPESLAIFEKMKGDL
FT                   ASFIDYKAKLEDSKEAFDMFDKHKVKKIVFDLTS"
FT   CDS_pept        629744..632398
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248386" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534584"
FT                   /orf_name="CD36_52480"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41631.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397346"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D438"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHI9"
FT                   /transl_table=12
FT                   /translation="MSNTPSNTSQASRDNISHSTTSPETSRDEKEMKAKNNIKTESAES
FT                   SAAATLGSMGTARDHLHSQFPPSTPGPIPTHLTSSFGGTARHAQPQGTPQVTAPASTSF
FT                   GYCQPLQQLHPIQQYQHLNQAPSQPQASSPSPIPPVAHSPTATNTSHTPDQNGASRQRM
FT                   RVVKACDRCRSHKIKCSGECPCATCLKQAKECTFSNKVFQKRTKGTELPEQKRAKFAEP
FT                   FGLPEVKKDDQQEYINHLENRVHYLESLLTNSTTDTFKTPLSNEPESEFVTETLFCTSS
FT                   KWRFSRRHQNLLIAELCRSMYSNLSEESKQLVTLPRYQYFGWNMSGVKYVTSEELPPLP
FT                   DLGAKLDSKFLTKYYFEEINPLFAILHETVFKEQIGAYEKLLRDQIMLHKDDHDSKGNQ
FT                   TRLFSAMLYLVYALAIRFSEISKPKNPSIEMLQLEEKLFKYGYKVISILSFEWESFELI
FT                   QGWLLITLYLRVTHRQTSCSHALGQAMDMVKSMGLGFAHDNAKFYSSTAYERLKAKRIF
FT                   WCVFTFDRVFGLQTGRYCGIRDEDFNNEFPGFDFKHETEKDDWLTLPALGLIHIARVSN
FT                   FVHTASTDNPHLIKYQQVNAELVKLHEWFNANGFRNDLFFNKKNDSSSLVKAQVKLHYY
FT                   DLVLCIHSKILFNYIGRRIASHGLKVEMVIDACNGVIEVLDKTNKAGLLYTPWYSVLLL
FT                   LFNVGVNAITLINGGAFVEQAREVLKNTMRLLTILRKSPIRNEQNKLVFRERFKMVREC
FT                   IWALKMANRILTLRLQEDISVLNSIGVDHGSSDVNKQTFTQLGIASESTEGSSTQPKTN
FT                   EFNQVFEKHLHRNSDIRQSITNDVDSPVSVNSDSTSNVQSIEPVDTYSSAEIDNLLGNI
FT                   QWFDQWTDFNIDF"
FT   CDS_pept        633346..634308
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570409"
FT                   /orf_name="CD36_52490"
FT                   /product="Thioredoxin reductase, putative "
FT                   /EC_number="1.8.1.9"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="thioredoxin-disulfide reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="removal of superoxide radicals "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41632.1"
FT                   /db_xref="GO:0004791"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019430"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG669726"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000192D439"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ0"
FT                   /transl_table=12
FT                   /translation="MVHHKVTIIGSGPAAHTAAIYLARAEIKPTLYEGMLANGIAAGGQ
FT                   LTTTTDIENFPGFPNGIGGSELMEKMKEQSQRFGTEIITETISKVDFSKRPFKLWTEWN
FT                   EDAEPITTDAVIIATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNNPLAVIGGG
FT                   DSACEEAIFLTKYASKVFLLVRRDVLRASTIMQKRVTNNDKIEVLWNTEALEAKGDGKL
FT                   LKSLRVVNNKTKEEKDLQVNGLFYAIGHIPATKIFADQLKTDEAGYIQTTPGTASTSIE
FT                   GVFAAGDVQDKIYRQAITSAGSGCMAALECEKFISEQEA"
FT   CDS_pept        634634..635473
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077558"
FT                   /orf_name="CD36_52500"
FT                   /product="Syntaxin, putative"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41633.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG397347"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI000192D43A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ1"
FT                   /transl_table=12
FT                   /translation="MSFNTPFSEDLERTATNNSHRYKDYPEFDSLSTTIENQLHFINSE
FT                   LLSSIRSDLAKLEKDKTDTTLSESLSGQFRKTTDAFKKVNKFVKQLNASIVATEREHED
FT                   VETVNYLKQKEAIQIKLIRDSLANFNNFQKRFESCQTTQLPEDGSNLSEAEPGTAQQQQ
FT                   QQQQQVQITYEPINAEELEQQTLLIQEREREIHQIQQDTQEINDIFSNLSSIVNEQQFQ
FT                   IDSIENNIFSYNSNAREASNELRRAERYQKSSSGRLLCCFLILVGIVSFIILIGLIF"
FT   CDS_pept        complement(635525..636667)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570410"
FT                   /gene_name="CIA1"
FT                   /orf_name="CD36_52510"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41634.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG520580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D43B"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WHJ2"
FT                   /transl_table=12
FT                   /translation="MVELLHSIKAHNDKAWSVSVHPTLPIIATASTDKSTKLYKLSTKQ
FT                   KFPLVAELEDTHKRSIRSVAFKPPLGGVDAPKLDFLDLPALAAGSFDSTISVWGIDEPD
FT                   VEYDIDEVVANQKEILTSPNNEWNLMAIIEGHENEVKAVDWNFQGQYLASCSRDKTVWI
FT                   WETDPETLEEFECVAVLNDHSQDVKNVSWHPSMNILASSSYDDTIRIYQQDIAGDEWSC
FT                   VGILNGHEGTVWCSKFESFKSPTADSSILRLVSASDDLSVRIWVAKREEEEDKPELPSS
FT                   IKHTKEMVWEVESVLPAVHKYPVYSVAWSSLTGKIASAGSDGKIVVYSEAEKGKWVIDS
FT                   VHEGSHGVHEINCVIWAQLDDENEILVSAGDDGYVNLWNV"
FT   CDS_pept        636868..638490
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077559"
FT                   /orf_name="CD36_52520"
FT                   /product="Cytochrome c mitochondrial import factor,
FT                   mitochondrial, putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41635.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397348"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000192D43C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ3"
FT                   /transl_table=12
FT                   /translation="MLGLRQIRQYPIHRSRLINFRRFNSTNSKKPEQEEENSQSSEHKN
FT                   IPSKQDDKTDVGSFNIKPTTSRSAPAPMENTGIEQLMHKDNKPYIPKLKHKRVSFEYPN
FT                   LPNQDEYTNLIEKPKSITRWTRYVPKILTVIVLVWSGYAYHVWMTDTEEGEDSSDLLNP
FT                   EEFHKFIVTHKEKIDDDHYIIEITPKFFHWEYSHGTDPEGKSLWKGDKFWSVEIKQPDI
FT                   NVVRSYTPLPLYYLKSEYTRSGEKEPLLKVINPEIDEYDRHGTMCLYVKRYNDGEVSKY
FT                   ITDRNVGEELELRGPNIEYKFPYHPLHKLHKRPIFKDLPSKVEADNMIETVKRVNNLPD
FT                   VDNIVFYAAGTGIAPILQVLFSKKPYLGHVDIHYSARHPGELGILQRFLLFLDKLDRIN
FT                   ITYHYDDQPKTVLNAKDIKPPGIPNYITPKTLEEKSKFLTGDEIEQLRLQKEQQGKSFD
FT                   SDMTTKLVQKPEDRGEVFESGLHQASKTIQLPKKTASLAIVCGPEGFVDYVAGSKDLVR
FT                   NKQGPISGLLGDKNWDNSNVYKL"
FT   CDS_pept        complement(638563..641538)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570411"
FT                   /orf_name="CD36_52530"
FT                   /product="Histone transcription regulator, putative "
FT                   /function="chromatin binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41636.1"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG397349"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D4E9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ4"
FT                   /transl_table=12
FT                   /translation="MKFLKLPQSYHKGGIHSIDVNQDNTILVSGGVDKKIGVWDLKKLI
FT                   ELSKLVSVNNSPEVRLKLKSLEPKQNITCHESLVNVVRFFKGDNKRFVSSDVDGNVFFH
FT                   VLHEQLETETKQLFPFKGSKTQVKTPVVDLSISADNRLVAWSTNDGKVYLYDVVKDTFQ
FT                   ELTSICHEKPIIQRSIAFDPSNNYLITVGDDTQINVFQYSYEKDDNNTYKFRLIYKISK
FT                   LFSQNPLNVRYKRISWSPDGNLVSIPTASKNQTMLISLISRSEKWTNIESLVGHDFACD
FT                   VVKFNPKIFSSREHDTSKVHSVIASGGSDRTMAIWNTSKSTPITVLQDAVQGEILDITW
FT                   TTDGTSLLFCTSQGKLCIGNFEPNELGYAFSQETMERFVQLQNNLVEPMNFRYPHEQTV
FT                   GNRKQLPPIEFLNQKNAISTTSSSSITENDEKKSEENVSMSSQSKSTTAKGGVITPEVI
FT                   APPKLQSLDDDVDDNDEEDDGKGSMLDSVMNDRAEASPRKSNKQKNIASAVSEPTGQSL
FT                   SFNKQKVTTKNGKRRIQPMLISSGNSASSVLPRSNSVVKPVANNIKSSMEFDKPSYSVS
FT                   EEFYKQNKRPRTEDTTGGGINKKLKREMEPVKFIGSVILNPNTSFSKIRLATPKVRLFF
FT                   QLKSKTDDGMFILDIKNGSGNESKPSRLTYLKKDKEIWCDFVPKYIQLATEGSNFWAVT
FT                   TSDGTILTYSHVSGKRLLPSIVLGSPVSFLESYEKYMMAVTCIGELYVWDMEAKKNVLK
FT                   CSISPLLELYNKEGLVKSDNITLCAVTSFGIPLITLSNGSGYLFNKDLGVWQTITESWW
FT                   CFGSHYWDSTETSTTKQPQTMNMFNDEQSIIELLEHKTNEEILRKTRTGRGKYFNKISK
FT                   NMLMKEGFESLENTISISHLENRILCCELLGENKDFHKFFTTYVQRICELGFKAKLFEV
FT                   CDELLGPIDAPSNESDWDPKICGFDKRELLKEVITSCSQFRDAQRVLVHFGKKIGVVVD
FT                   EL"
FT   CDS_pept        641971..642783
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570412"
FT                   /orf_name="CD36_52540"
FT                   /product="Casein kinase II regulatory subunit, putative "
FT                   /function="kinase activity"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="CAX41637.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI000192D4EA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ5"
FT                   /transl_table=12
FT                   /translation="MANEEYVTDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNL
FT                   TGLNSEVSKLPTLIDIITDVIDIESQPEEHKDSLEHNARILYGLIHARYILTTRGLNKM
FT                   FEKFRSGDFGYCPRVHCQLNPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDG
FT                   AYFGTSFPAMFFQNFPNTVPIHAKDTYVPRVFGFKLHEYSKLNRWRELQRLKLENRLRK
FT                   NGIQIDNVVGGFITNGDDEETQDNNNNSNNKQLQNVSSQYKSSSPNQK"
FT   CDS_pept        643064..644260
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534585"
FT                   /orf_name="CD36_52550"
FT                   /product="Mitochondrial tryptophanyl-tRNA synthetase,
FT                   putative"
FT                   /EC_number="6.1.1.2"
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41638.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG293263"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192D4EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ6"
FT                   /transl_table=12
FT                   /translation="MTKTVALVSTQPPSLQMSLKSIHTLRRCCRPLTTTTRGTNTVQEV
FT                   SQNKLVIPSNSTVFSMIQPTGRIHLGNYLGAVKSWRTLSESNTDPTNKFIYGIADLHAI
FT                   TIPKDPIEFKEYRYAAIASLIASGLDTSKCTLFFQSSVPEHSELNWYLTCMTSMGALNR
FT                   MTQWKSKAQQSDDSSILEDNVLEKTKAGLFCYPALQAADILLYKSTHVPVGDDQSQHLE
FT                   LCRNIAKTFNSTYKTNVFPLPKTLLTPAKKILSLKNPKKKMSKSDPIATSCVYVTDSPE
FT                   DIQLKIRKATTDSVQGSIYYDPIERPGVSNLINIVSGISNKPVDEVVKDMSDFVDHKQL
FT                   KDYVTEVIISEFDDKRQLYEELMKDKAYLDTICSQGRDKAREMASVNLHQVKQIIGMD"
FT   CDS_pept        645214..647589
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534586"
FT                   /orf_name="CD36_52560"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX41639.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397350"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000192D4EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ7"
FT                   /transl_table=12
FT                   /translation="MATEDPSSIRSMQIKILYSLDNQPNVYLSRSENTLPVQIVQISLG
FT                   MNDDELITLGGLELKDCVKQVVRSAPDTFNLSFRDFEVYYQDISEQPDEPFVANGVISK
FT                   LLNSNESCLVPGRVCQSLGAGSIFGKKSKMASETLEIRMQLRTIEIPVTKEKTPAPEQQ
FT                   SHSHSRKYSHSSLAKRSNSQIIMERKRNHESSSHYGSNYPPVKATRTLSLPSFVNPPVT
FT                   TPRHKRDKVEDRFKNAPFYSNSDKVTYTTTSTTTSNRPGPQRRYQSPSTSTSLQPQRAA
FT                   RTRSMFTSNIPSISSPINEEPYSDDPDYNANEDNFHNEDEVSSGGNSPVTSPYTPQQPP
FT                   YKPPTPTQLPDDLDSIRSHTIQSSKLSENHGLVCINECCRTTSSINWRYFETEYRPEYS
FT                   KILTAHKFDKRNYEGMLGPLCNACFLFYKNKGFMRPEHVVRKYIHQQRYTAKLRKKQKE
FT                   DESNRTTLDAIAMKKFVSGTSVSLNAGSSPAGSFPAPSHTPSAINQVIQNKALTSHGNN
FT                   GNNNNLNYDPTPPGFTPDYNDLLHQINIYGGPSTDIDPLPGATPPMVATKSNTRVINVD
FT                   AGGAEGAEGAEGEEYKKATKLNTRIIGVPVESNIEEDDNNKENLPPKINKNHNDYDAMI
FT                   SSFQENNNDWMSFFSSPKHHVSPNSKTPVDNPNEIQKSPLKNNVNKKTIVNMPSSPYQS
FT                   TLDAASENGHYDQQNVLNDEISKMINMSPFKSSPNRANRLDTGNSIMSNQNKDEDKKNQ
FT                   ASTPNTEFYSNDDDSEGHKNITETGSTVLEKENQLVSH"
FT   CDS_pept        complement(647726..649477)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534587"
FT                   /orf_name="CD36_52570"
FT                   /product="General amino-acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41640.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D4ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ8"
FT                   /transl_table=12
FT                   /translation="MLHKKETNDTFVQLNRSPSTEQGQPSSNIWSSIKDSFKPALPQEK
FT                   LTGVDDIPDRELTDIERININAANSNLQRKLKTRHLQMIAIGSSIGTGLFVGTGGALST
FT                   GGPAAIVLAWAISAISVFMTMQGLGELAVAFPVSGGFNLYASKFLEPGIGFAVGWNYFL
FT                   QFFVLLPLELVAGAITIKYWNASINSDVFVIIFWFVVLVITMLGVRWYGEAELMFCTIK
FT                   VIAVIGFIILGIVLICGGGPNHEFIGGKYWREPGPFANSFKGFASSLITAAFSFGGTEM
FT                   IALTASESSNVRHALPKAIKQVFWRIVIFYLGSIIMIATLVPYNDKRLLGSSSVDVTAS
FT                   PFTIAIVNGGIKGLPSVINAVILISVLSVGNASVYATSRTLNSLAEQGMAPKWTGYIDR
FT                   AGRPLFAILITNVFGLFALIAADNEKQVVAFNWLLALSGLSSIFTWMSINLSHIRFRRA
FT                   MKVQNRSLTELPFVAQSGVWGSYFGLTLNILYLIAQFYIGLFPVGAKPNAYDFFLSYLG
FT                   VPVILASWIGYKIWKRDWTLFIRAKDIDLDTGRINVDLDVLQQEIAEEKAQLAEKPFYI
FT                   RIYKFWC"
FT   CDS_pept        complement(650087..650833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077560"
FT                   /orf_name="CD36_52590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41641.1"
FT                   /db_xref="HOGENOM:HBG397351"
FT                   /db_xref="UniParc:UPI000192D4EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHJ9"
FT                   /transl_table=12
FT                   /translation="MSHHQPTTQTQDTDYSSDFDSFAATFNNFKPKEFKPSIETSNLIS
FT                   SAARLELESMTLKQTMSETMKSFSKLPGKKLTETLSQIKQIQKDIQELKLITNKRQSCN
FT                   QDIKEELLETKDLVSNKQDESFLQIEELLSNHWKIIEKGFQEQTNQFSEIIQNNQHLLE
FT                   ASSQQYHSNLQEKIEHQLIEYNNKLTTQLTRQDKDIQEIKQFLKLLVPRVVGIEASYRV
FT                   LSTENPIMGKTKAKSKPKPIKRKKQS"
FT   CDS_pept        join(651064..651091,651162..651442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223549" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381801"
FT                   /orf_name="CD36_52600"
FT                   /product="U6 snRNA-associated Sm-like protein, putative "
FT                   /protein_id="CAX41642.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000192D4EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK0"
FT                   /transl_table=12
FT                   /translation="MSELSSFLEKRVHVITSDARFFEGKLEGYDKSTNIILSNCIERII
FT                   YSKDDEGEENEEISLGVYIMRGNEIVCVGEIDDELYKSINWETLKGHALKTTKNSLK"
FT   CDS_pept        complement(651513..652328)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381802"
FT                   /gene_name="MDE1"
FT                   /orf_name="CD36_52610"
FT                   /product="Methylthioribulose-1-phosphate dehydratase "
FT                   /EC_number="4.2.1.109"
FT                   /function="metal ion binding"
FT                   /function="methylthioribulose 1-phosphate dehydratase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41643.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046570"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG315099"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="UniParc:UPI000192D4F0"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WHK1"
FT                   /transl_table=12
FT                   /translation="MSAPCHCQHADDDYSSIKKLSVLSPELQQEFKDPNHPANLICELC
FT                   RLFYDNNWVTGTGGGISIRDVDGPNPNLVYIAPSGVQKERIQPWEMFLVELPQEKILRT
FT                   PNDIPKELTKSYKYKPSACTPLFISCYTLRNAGACIHTHSQHAVMVTLFFENEKEFVIS
FT                   HIEQIKALPKLKYNQETGKIEKIGSMEYYDKLVIPIIENTPHEEDLTDSLQEAIKNYPG
FT                   ASAVLVRRHGIYVWGETVWKAKVYNEAIDYLLELAVKMKLAGIPLVKEE"
FT   mobile_element  complement(652689..652986)
FT                   /mobile_element_type="retrotransposon:solo LTR, nu H"
FT   CDS_pept        653190..653798
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570413"
FT                   /orf_name="CD36_52620"
FT                   /product="Vacuolar protein-sorting-associated protein,
FT                   putative"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAX41644.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG379179"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000192D4F1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK2"
FT                   /transl_table=12
FT                   /translation="MSGLEQSLFQLKFTAKQLNRQATKASKEELQEKAKIKKALSQGNN
FT                   DIAQLYAQNAIRKSNERINLLRLASRIDAVASRVQTAVTMRSVTGNMTQVIRGMDKALQ
FT                   TMNLERISLVMDKFETQFEDLDASTNYYETTTNNVNALTTPQDQVDELLNQVADEAGIE
FT                   MKQGLNATKVEITNPIVSPNSISEEKEDKLAERLRALRN"
FT   CDS_pept        complement(653925..658382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248381" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534588"
FT                   /orf_name="CD36_52630"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41645.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397352"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020671"
FT                   /db_xref="UniParc:UPI000192D4F2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK3"
FT                   /transl_table=12
FT                   /translation="MSTVVNRKSSHQFDSPNNLLDHSSSMNVDKVVQSVTNATKRLSQI
FT                   STNTNNSNKKRKTQNKIGPWKLGRTLGRGSTGRVRLAKNTTTGQLAAVKIVPKSNFKKL
FT                   ENPKYKRSKEDATRLPYGIEREIIIMKLISHPNIMGLYDVWENKNDLYLILEYIEGGEL
FT                   FDYLIKRGKLQEYEAINYFKQIINGINYLHQFNICHRDLKPENLLLDFNKNIKIADFGM
FT                   AALEVKEKLLETSCGSPHYASPEIVAGKNYHGAPSDIWSCGIILFALLTGHLPFDDENI
FT                   RKLLLKVQSGKFNMPPELSFEAKDLITKMLKVNPRERITIDAILTHPLLAKYPEPSVSY
FT                   SSTTTLDINSINIKQIESIDKIDKEILKNLSVLFHNCDEKTIISRLLSPNRCPEKMFYY
FT                   LLMKYRNEHLSNSNSFNSSNDLDSTKSLPRSTSYVKTTVTDHATGEKHTTVKKIQQSSS
FT                   IYSNRSLLKKSTSAKGNVLSNITNRPNTPKQFSASNSFNKKKAHHSKTQIYASRSRNTS
FT                   SRSLKSNSSAGRNGVNASATSVNKIPEISGATVLQPIPSMALNRGEEQQSNKIKKNLTD
FT                   TFGNNKSLLNFQLICEEVFENDKENSKPPPPPPSAPVPSLPPPPIEAPTLRTNSVKRGK
FT                   TWSLARRERELAEQVRQRNEARENKLKAEELARKELEQEKKRIAEEKRRLEQQERELDE
FT                   KQKLQEKQKAALEKLKKHQSANDFEGLFATNRRSVTDMPTGLSSLDPRAHMVSRANTIG
FT                   SSNLSSSSVNIDENASKVLHKFGIDVAPSPKRFSRASKTSTSKNLSAFLAPTVSRNLSS
FT                   QLKTSSSKNLAGYLHAATDTNGSSGATNKKDASTNEALTIEEFNAKERTAMSPSISKTS
FT                   VNKRNSNQSSYYRSMFSDNDEVTKVRTRDSRLPVPSVQEEQQQEQEEEMDMENSIDDDN
FT                   ISLIPNPRFSRFSFGGLLGSNTVANEEGDWTIMNSTLNHSNTVVRRTHNKSSTMLGLGI
FT                   KMRDTTTIKEDEEFEDDEKPFISVPSSEDDEEANAQKNKHGGLRDSGNYDFDEEHSVAS
FT                   TANTEYSDASQGQIPGSHTIHQMETELSNFDLLSYRVADVGKVNTHKPSIVDSKETLLK
FT                   NQSSEEATIEVNEEDNGNHDRREDHGFNGRDDENYDDNSEEDDDEEDDDDDDDARSSFE
FT                   ARPHSHNYSLAEITSESPVGGGYESPSIANDFKKSRHSTGIFSTTQFPRSPYIVNNNNE
FT                   ASNKDEIGQQQQQQQQQQQQQQIKHVLNDDHKELITSPVQDTFDTKKPAESNSLFRRLS
FT                   LNPNRAAPKAPKAPASASSPITTAAKANISQPLSSPIKGHNRFSRISVGSKNILQTEDK
FT                   TTKSSNWFKKFFHSLTTTPSSKEAQSGKSSNKVASKDIKIIDTSLTASQLIRVIKYQLE
FT                   LKKIEGSISKVDIDEEFGLISGIIPSKFANGRKLKFKIEIIDLINSSSLHVIKIKGNDK
FT                   GFQSLVNIVSFIIKKEEQDKISTK"
FT   mobile_element  complement(660240..660989)
FT                   /mobile_element_type="other:novel LTR element 4"
FT                   /note="3' end of copia-like Pol ORF"
FT   CDS_pept        complement(661273..662298)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570414"
FT                   /orf_name="CD36_52640"
FT                   /product="NADPH-dependent methylglyoxal reductase, putative"
FT                   /EC_number="1.1.1.283"
FT                   /function="coenzyme binding"
FT                   /function="methylglyoxal reductase (NADPH-dependent)
FT                   activity"
FT                   /biological_process="cellular metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41646.1"
FT                   /db_xref="GO:0043892"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D4F3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK4"
FT                   /transl_table=12
FT                   /translation="MSSSTTVFVSGASGFVAQTLVKQLIEKDYKVVGTVRSNEKGDSLK
FT                   ENLKAAKLASENFTYEIVKDISVKGAFDDALKKHPEVTVFLHTASPFHFNITDIEKELL
FT                   TPAVEGTNNALQAIKTYGPQVKRVVVTSSYAAIGRFGDLADPSIPANEESWNPITWEQS
FT                   LADPLSGYVASKKFAEKAAWDFVEKEKPNFTLSVINPVYIFGPQAFEIKNKSQLNTSSE
FT                   IINGLLNSKPNDTFTNLTGYFIDVRDVAKAHIVAFEKDSIQGKRLILAESPFTTQSILD
FT                   LIHKDFPQLNSKLPKGDPSQADAWKKGESRIDNEKTRELLGFKFIDFKKSIDDSVVQII
FT                   G"
FT   CDS_pept        663958..664413
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228906"
FT                   /orf_name="CD36_52650"
FT                   /product="Nucleoside diphosphate kinase, putative "
FT                   /EC_number="2.7.4.6"
FT                   /function="ATP binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41647.1"
FT                   /db_xref="GO:0004550"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006183"
FT                   /db_xref="GO:0006228"
FT                   /db_xref="GO:0006241"
FT                   /db_xref="HOGENOM:HBG445152"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="UniParc:UPI000192D4F4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK5"
FT                   /transl_table=12
FT                   /translation="MSDERTFIAIKPDGVQRGLISSILGRFEQRGFKLVGIKLVQPTES
FT                   LLRTHYEDLQSKPFFPSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIR
FT                   GDFAIDMGRNVCHGSDSVESANKEINLWFKKEELVEYKPALFGWIYE"
FT   CDS_pept        664853..667249
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228907"
FT                   /orf_name="CD36_52660"
FT                   /product="Transcription factor, putative "
FT                   /protein_id="CAX41648.1"
FT                   /db_xref="HOGENOM:HBG397353"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D59D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK6"
FT                   /transl_table=12
FT                   /translation="MASIEQDDLFNVQDDEEEDMEEEEEEDENVEDEVEIEEVGENADA
FT                   SQQEEEEEEDYQMDIDTEDQQQQNDDEGEEEEEEEEEEEEEENEEDDEDEEMADEDAEN
FT                   EEEENGEEEEEEEEEEEEDNKDEKDNKVVEKAIETGPEKKTTDNDKEKDEIKSTSESQL
FT                   PSAAIDQSKDNDEDIFLGDDTTKNSDNPTPKDSSKDANIDNTLSKDDKSPKDDSKKKPP
FT                   IDQSNNNNNTNKSQSQQSENTKLEKSKNKEHLIEDNEKNQIQPEELETNLSFREQTIRK
FT                   ARKATEFDIIPQVAIPYANQCHALAFTNGPKWILTGGEDGFIRKYDFIASIQGKSPLTM
FT                   AQKHNLFSDSLTNAGVICSYWENEQPLTRKQLMTQNPKLKDSDFSTGSVSYEPKINPVY
FT                   ALDAEKNGYWCLSGLLSGGISLYTMRYNEGAIHHYFHQGNKENKSRGHTDAVSVIKLNQ
FT                   EQDKFLSGSWDKTIRQWDLNTGRTVLEYTGNSGQISNIEFRPDGLSDITFVVSQDEEEE
FT                   KKEEKSIGGSGGSGGGGGGNSGETLINSNDDIDSLFGDSDKDKDEEMTDTTKKDKEKEK
FT                   EKEIPRIVIESIDESKSNKNNNRGAHNKPHLNSNIFMSSTIDGTINIWDIRTNSPVIRL
FT                   GVSEGTPPWCMSSTWSNNGDFIYAGRRNGTVEEISIKMPHKRSKSGHHQDTMIPNISKL
FT                   LQFPKISGPVSAISTMPNDDFLLCGSNDNIRLYNLKLYDELNNISINSKKQATPFLIVP
FT                   GHHGGMLSQLYVDETGRFMVSASGYRGWGHGNYTDTVLIYEIDFQ"
FT   CDS_pept        complement(667483..669741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570415"
FT                   /orf_name="CD36_52670"
FT                   /product="GTPase-activating protein, putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41649.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG448441"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000192D59E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK7"
FT                   /transl_table=12
FT                   /translation="MSVITSEISYQPSSSMDIDFLGESLYRSNEDNLPLNDHIKNLKVK
FT                   TIYNTITKTNDKQEVLKLLTDLARSTDGLINNELRCKIWPILLGIDDNSNIHNKDVTIK
FT                   NDNHLPPSILSNNKFSTDLFLQDLQCVELPPHKDEDQVKLDIQRSITILNHIQSLSYSG
FT                   SSSYTTILTTNEIDHLKGKLSNLIIKLLRKYPSLNYYQGFHDIASIILLVCYIPNDKSD
FT                   DYNININGSKHNDGSNNTYEDGNDYQIDEELAFKMLEKLAIYHLRDYLITDINLSINHL
FT                   RLIPTILQIVDNQLFELIKQTSNSFIQSQGLNYDYKFYQALSSILTIYSHDLINLSQIL
FT                   TLWDFSLSYNSVLINMYIYVATLITFKSKIWQTLNIPQEENDDISIDFSNIDPDIVHST
FT                   ISSSNLFDGLTDSQLVTILNKSKELLEMFPIDELTNNETTWNKWFQQYNVDSVLCNTSK
FT                   LVDNGNDNSKLEKFNQYRYLISQDQNEKLEEYVDELSNLIAKQDNQILKQVKDEQIEEE
FT                   KIFQELLAKQQQQQQQQEEEEELSQSIQSIQYDEDDGNSLSSSSGNSLSSSLTLANSIT
FT                   SSSIHRIKSTLLFRKFFHNNDVEESQEINDTTITTTTNNNNNNNNNSNDDDDADERVIR
FT                   NKNWILSLLNNNNNNNNNNNIYKISITIGFIGFILHFFLIKPNNNSNFLITMIINPIKQ
FT                   LLQYEPLFTLSTIGTTFINDLEESFNSITNGGITTNNIGNFFGNIGIGNIRNTIYGFN"
FT   CDS_pept        670917..672119
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077561"
FT                   /orf_name="CD36_52680"
FT                   /product="Uncharacterized oxidoreductase, putative "
FT                   /EC_number="1.14.11.-"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /function="trimethyllysine dioxygenase activity "
FT                   /biological_process="carnitine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41650.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0045329"
FT                   /db_xref="GO:0050353"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG445343"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR012776"
FT                   /db_xref="UniParc:UPI000192D59F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK8"
FT                   /transl_table=12
FT                   /translation="MSVTLATPIEDSIELKWSDNAISKYHNIWLRDNCHCDKCHYSLTK
FT                   QRLLNSATINPNIKPKSIDCKQDQLYIVWDQDNHASNYDFNWLRLHSYQPRLIPIDEKL
FT                   KNGKKLLNRELWQVKDIENNLPKVDYNKIMQSTNDDDDDKDEDVIKDWVLKIWKYGFCL
FT                   IDNVPITPEDTEKLCEKLNYIRPTHYGGFWDFTSDLAKADTAYTNFDISSHTDGTYWSD
FT                   TPGLQLFHLLYHDGIGGTTSLVDAFKCAEILKQKYPESYEIFCRIPVPAHSAGEEKVCI
FT                   QPDEFNPIFKLNDQGQLLQVRWNQSDRSTMDNWENPNEDIPKFYQAIRNWVEIITSPEN
FT                   EMWYQMKPGQCLIFDNWRVFHSRSEFTGKRRLCGAYFERDDFVSKLKLLVLGRQAVLDA
FT                   I"
FT   CDS_pept        complement(672235..673230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381803"
FT                   /gene_name="XYRA"
FT                   /orf_name="CD36_52690"
FT                   /product="NAD(P)H-dependent D-xylose reductase I,II,
FT                   putative"
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41651.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000192D5A0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHK9"
FT                   /transl_table=12
FT                   /translation="MSTTTPTTPTTPTIKLNSGYEMPIVGFGCWKVTNATAADQIYNAI
FT                   KTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKREELFIVSKLWNNYHSPENVEKALNK
FT                   TLNDLNLDYLDLFLIHFPIAFKFVPLEEKYPPGFYCGGDGGDNKFHYENVPLLDTWKAL
FT                   EKLVNLGKIKSIGISNFNGGLIYDLIRGATIKPAVLQIEHHPYLQQPRLIEFVQNQGIA
FT                   ITAYSSFGPQSFLELQSKKALDTPTLFEHEIIKSIADKHGKSSAQILLRWATQRNIAVI
FT                   PKSNNPDRLAQNLAVVDFDLTDEDLQAISKLDIGLRFNDPWDWDKIPIFV"
FT   mobile_element  complement(673906..680155)
FT                   /mobile_element_type="retrotransposon:kotuku E, Tcd32, LTR"
FT   CDS_pept        complement(674230..678465)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570416"
FT                   /orf_name="CD36_52710"
FT                   /product="Retrotransposon Tca2 polyprotein, putative "
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAX41652.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="HOGENOM:HBG398448"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000192D5A1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL0"
FT                   /transl_table=12
FT                   /translation="MLLCVNFNEKHVIFAKQSLNTNLFTGPSRGKVYSNGKMFMDNNSF
FT                   IEDEGEEKGYLNSINAMTKLVDPRIDQVVANPDGRKDLYYYHLITGHMSIRSLIRLHEQ
FT                   GRIKCSIDDQDAKDQIKGCKQCILVNAKQHSHNKTTQSPPERSLYRFHCDTMGPYHVGH
FT                   VKYYITLITDHYSGFSFAIVKTEKRFTKEILDLFEHLHADLYPKKIARFRSDNAKEFPT
FT                   EAELGTLRIKKEVLPPYSPEMNGMAESHNNVLKRRMLYVVLNFPNRYKELLIFFCEIVA
FT                   YAVFIKNHTPSERVETHKGWTPHELFYGRRYRPNYHQFGVDVFVILSNKQEADALGVQF
FT                   IKGFHRGVPGIFLGYGNDSNVYLIQLVDGNYTRRLFVNVRFLGSMNNINTFLDTFGEKM
FT                   RKNMDESGNFPFFEDSSRNELLNGRYVPYEDHLPTQGTSSQDVSSDRPTTIEPTATNIN
FT                   MDELIAEVPDEFLQNNIAGDFLTQQGFTFPSLQVTGKLLEHQSEQSLAPYNWMSKDNME
FT                   YSKMGSDHKYLGQNDTENIEPNKNQQVNISEPSFQSSMANKPNESDLGVLPTADGIRHG
FT                   VPNARGETTQDGTVSSNIDMHQPYSTIPTHRPPPPVGKNVQFSGVNNDSTTLLPSEWGL
FT                   PPQQHLSNGGAYESSPVSNVTTSVRLSASTMNIDVGNKNSIKRTKIDRHPLLPNKETVN
FT                   EISVRIEALKNEHNLNKTLDTIADSYLFTRTSELKNENMAYYKGNGRVSKPPMLLNNLK
FT                   IIDELIPPTKHISSIEARLETSTGDLNDIENDIDFSVYGVEKYVDYNDENWRRSMDNEM
FT                   KKFKEMNVYQVVKKKKNFRMIPAKWVHSYKPNDPKGEFFRSRCVVQGFRQIPGLDFDKN
FT                   CVSSPVTDLTTIRVLTAIAVESKAQIHHIDIKSAYLNATLPKDTPIFVKPPPGYDDGIH
FT                   CWRLVKAVYGLKQSGFEWHSHVSKTLKKMGLYQCENVEGLFMLEKGNEKIYIALYVDDL
FT                   FVVASSNQFFNKFMDDLEAKFSLNYIGEISEYLGIEFQKNAFGYELHQNKFVKRLIEAF
FT                   PTEIMKGADLPRTPDNIFKNGKYKIIDDNTGKPLKNQKDIPIPDEYIYEDSNSPRLDKE
FT                   HHDLYRSIVGMLLWLTNNTMPSISYGTNALAAKCHEPTENDYKHLMQMIKYLYKNNNER
FT                   LIMRRNQTKDISEDSNVIYAYSDASFAADLDRHSVSGFAIYLNGNLVSWGTKKQRSITK
FT                   SSMACELIALGETVDRSMIIRQIVQSIGYSAPKIIIFEDNQPVIMNSYNRKSSAIRRSV
FT                   DICLKTIRQLILEYKLLSVVYINTKLNVADLLTKAVNNNTMKTLKPLLYDKGNLDGVRK
FT                   LIKDNFTSHGPVEMGQHSLVYNIITPTEEIKESYYVAPDNVQSKVESRNNKHPEISGGI
FT                   AHIKRLSMP"
FT   CDS_pept        complement(680804..682540)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248385" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570417"
FT                   /gene_name="MIG1"
FT                   /orf_name="CD36_52720"
FT                   /product="Transcriptional repressor, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41653.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397355"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D5A2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL1"
FT                   /transl_table=12
FT                   /translation="MSMSTPMPSPTPTPTPLDSKKMAPKEKKNKDDRPYKCTFCDKAFH
FT                   RLEHQTRHIRTHTGEKPHACTFPGCVKRFSRSDELTRHLRIHTNPSSRKRKNKNQNMMI
FT                   NTTNGTNTTTTTPAGMAISPNNLPPGSYAIPNTAIPFSIDRNGNHVYHQPYPVYFVPHA
FT                   NGYMQPMVQTQGVTVVPNSDPQQQQQQQQQQQQQQQQYHQQFQYQERPQQQTNIRSNNH
FT                   LQQHGSAIFSLPSSPTMSSAQTPNSGTSSSCESIKLAPLSIPNNLSRPQQQQQQQQQIP
FT                   KSESSTSLYSDGNRLFSRPNSTLHSLGSSPENNNSSGQLSGVPTPSFSNLNDYFQQKNN
FT                   NNNNNNNSRLFNASSSSLSSLSGKIRSSSSTNLAGLQRLTPLTSTTTTNTSLSNNNNMT
FT                   RLNIIPKQPSSTSLNLEFYNGNNQQQQQNYHATKKSRPNSPSQTPIHLSSSRKSANNSF
FT                   IISPNETPLQTPLQSPQLKPYQDQPIGNNINNTSDTLIGSVVNEKLNNISIATNGTQLP
FT                   PIRSVLSFTSLVDYPPDSKQKIVAPPIVDTTTIIRGETNGNNGTNNDNSNAKPMSLTNL
FT                   LS"
FT   CDS_pept        685983..688502
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189891" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534589"
FT                   /orf_name="CD36_52730"
FT                   /product="Dipeptidyl aminopeptidase, putative "
FT                   /EC_number="3.4.14.-"
FT                   /function="aminopeptidase activity"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41654.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG398049"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="UniParc:UPI000192D5A3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL2"
FT                   /transl_table=12
FT                   /translation="MTSIIRYDYFKESGRGNENMPSRTILSYKRFIYFGTLLAILLYGS
FT                   SFLITTIENFTLKFESQSISSIDNFKGERPDYASPSSKSTDFKGKIPLSKEVYDKHILS
FT                   PKLHSIQWIRAPESIHNDRGTYVIKEDKHDKGFRVVVKSIADEEYEKELIGNSTFKYKG
FT                   QEHEIIDYFASPDLQKVILKTDVTSLWRYSSIAQYWVLDINNGDIKPVFNEVDKISTAS
FT                   WSPDSLKIAFIYENNLYYKSLQSNEIIQITFDGSTEIFNGKPDWVYEEEVYGSDHVFWW
FT                   SPESDKVAFLRSNNTQVPEFIIPFYAQSTHQDYPEIVKIKYPKAGYPNPIVDILTYDLN
FT                   TKNLHKHNLKSEKINLENRLITEVVWIADSLKVKTSNRHSDLLEIFLVDKHEKVKLIRT
FT                   LTASDSWFEATSSTFYIPANETLGRKYDGYLDIVVENGYNHLGYFSPPDNSQYELLTKG
FT                   NWEVTGGVAFDFTSNTVYFTSTVKSPVERHIHAINLLDRSDDGLPYIKDITTKEGWYDS
FT                   SFSSGARFLFLSELGPGIPTQRVNDLKLHKNVKTIEDNSELIETLRNYVIPEVKYSQVE
FT                   LNDETGGQPFLVTAMETLPLNFDKKKKYPVLFYIYGGPGSQTVTKKWAISFSSLIAAEL
FT                   DAIVVTIDGRGTGFNNLNYKLGSKFKFIVRDRLGQYEPIDVISAANKWAEKSYVDHERI
FT                   AIWGWSYGGFLTLKTLETDIDNPIFNYAVAIAPVTRWRLYDSIYTERYLNTPQENPKGY
FT                   EIGSIHNVSNFKHVKKFFIGHGSGDDNVHVQNSLQLLDEFNLAKVENFEFMIFPDSNHG
FT                   MNYHNGFTVVYDRILDFFKRAFDWEFV"
FT   CDS_pept        complement(688663..689166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570418"
FT                   /orf_name="CD36_52740"
FT                   /product="Endosomal protein, putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX41655.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG397358"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192D5A4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL3"
FT                   /transl_table=12
FT                   /translation="MNNITPNRNKSDSISQLNKVLPIPIELHNGESLEQHQHNHLNHIT
FT                   NVIVGEYHLISGEFGKSYMTWQIKITINDLDHSSIILYKRYNEIYQLRQDLLKIFPNTI
FT                   NNNNNNNNNVPSLPPKDNLSLDRLLMSKNWLEERRKGLQWFLSNVLLDPVFQNCNVVKQ
FT                   FVLS"
FT   CDS_pept        689394..689942
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381804"
FT                   /orf_name="CD36_52750"
FT                   /product="Putative uncharacterized protein "
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="electron carrier activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41656.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397359"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniParc:UPI000192D5A5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL4"
FT                   /transl_table=12
FT                   /translation="MDIIKNKYSFWKRLLHKWQSRKDIPFRKKFFVGYDLYGNTYWEFT
FT                   IDGNMSRLRRKLQPFRKELFEVDYFKTIPPQWLQWLRRTRDHPPSLNELIKDQLRQEKI
FT                   KILAQKVDENWKLEKLRLENQQQLKLSNELNKVKLENEKFIEKQKAMGNKSIENPWKQV
FT                   EQELKNENPIESAIIKPRS"
FT   CDS_pept        complement(690061..693564)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077562"
FT                   /orf_name="CD36_52760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41657.1"
FT                   /db_xref="HOGENOM:HBG397360"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000192D650"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL5"
FT                   /transl_table=12
FT                   /translation="MNSDIDIHNNLNINHNFFNLNIKKIIGTSAKTSHQFFIQDDLIAY
FT                   TASGGVVVCTIDIETNEVITQRFFCANISYTNNYNHNGMKKRGGGGNGGGTSSANAYLN
FT                   MIKNYDYSEKELKRDLYGYPINSEPIEIFGTSIDNFDDNYNNSTNNDINIGGGGGSGTT
FT                   GNTSPSKLKDKVRSINCITISPDKKLLAIGEIGYQPRILIFSLAENSNNNPIWSIYEHS
FT                   FGINSLVFSPNSKILCSLGLINDGFINLWKIGIGSTNTNNINLIASNRCSNIIHKLIWH
FT                   ENLIITLGLRFIKLWQFDDEELNNFKKPLILKGKNAILGNLINENFIDGNILNNDELLI
FT                   ITDTNQLLLLLKLNFENPKIIILKSPDYEFNSIVVDYHHEKIWFSTGNEYIIKSLSFNE
FT                   LIPINSNNNNNNNNNSITIPLNLKKSITTTFTAKDDTTIISRPIIQIYDFSKTHLVFLT
FT                   NQEEIKFINKNNDDSNSSTNSSTNNKVLTSSLLKNFAGIKYTYSKEFLAFSHNGMIKKF
FT                   IDSSELQDIIKFNVIDMDIIPVSNNVTAIEKNDKNSLFIGDKYGTLTILELLESNNNNN
FT                   NNNNNNNNNNNNNNNNNNNNNNNNNNVYDYDYKILYQVKAHSSTINEIIYFTFANYQIV
FT                   CSISRDRMIQIFTSPINKTNWDLLQTLPIHNGNLLQIIHFQDKIYVCSSDRTISIHNLV
FT                   INKQAEEEENNLRLYQEKIITLKSTPLCMKIFDNDLVVSTNDKSILIFDIGNNFELKRT
FT                   LKLINDKINETILVESFIKYRNLIIVWSNDKSLRAFNYHNGKEVGVAWGHSESVLELYL
FT                   FNDHEIISIGNDACLFCWEVIENLKSSTSISSAGSIISQDNNGKEIYEKQISGSGSGSG
FT                   SSSAPLYTKVTRKILPTIPIKPIEKEGQITPTKTNSVTTTAINSPIPKLTAATLKRLEA
FT                   KQNGGHISYTSRSTSPNRSNSSSIINSAPVKLSVRTSNSNFSKLQSPLKTPVINTTFPK
FT                   RTTSPSRVETNKVKPPPPPTTTTTTKTTNNISNSSPTPSSRPILKKQERNKTLLDNTMG
FT                   KLDDVANVISKCNENEKQIIKQKLQSILSLVNNSNPNLKANPKAKLNTINIDEENQDKE
FT                   LLEKYSDKLMKMIEKKFSMTSLNQNNTSTSSLISASSSSSSSSSSSCSSSPSSPTPEAQ
FT                   N"
FT   CDS_pept        694034..696121
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570419"
FT                   /orf_name="CD36_52770"
FT                   /product="U4/U6.U5 small nuclear ribonucleoprotein
FT                   component, putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX41658.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG397361"
FT                   /db_xref="InterPro:IPR005011"
FT                   /db_xref="UniParc:UPI000192D651"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL6"
FT                   /transl_table=12
FT                   /translation="MSEEISLSLEETNKLRINAGLPPIPTPQPNNDAEEEDKVISLSIE
FT                   ETNKLRQQIGLPLLPITTITNLFGDDIEYKNYENYEKKQLQELENNQLLERINNAKFNT
FT                   NKRKFLTNNTLIDDNDNEKDLDLDLDTDDWLNNLGKTDSIPKSSKNKKQKVVTGIAKPN
FT                   KYNESSEIIIGHSIKELRSLGNNEILTLKDSNILNDEEREREREREREPEDILINQDLS
FT                   NKATLKRNLTERKEAENIKFNGRHYRRNNNDNDNEEEEKEEEEEDFDDNGLLINDKVIM
FT                   SGSTIDLSKPIVSVKDKKKNMMTITNLFEDLDNDDDDDNNVKSNVPIKMKKIKKKKDNI
FT                   KKKLTKYKLLDVTIKPNNNDDNDNNDNIDDDIDDIENQLSNSISSLRTKKLQTRSEFTP
FT                   EQLAEEISTNKRWEFEKNLEQENLKNNVLYNDTIGFLNNLESNILSESGEVEMITNTNE
FT                   SDNEQQEQEQEQDHAQEQDHSQEQDLKQIIDKLDSNVVEEKQKNDEIPKFNGGLAETLK
FT                   FLKSHNIFESTRGISTITNQELRQQELAREEVIKKSELLKMKISIEERILKEELNKDKS
FT                   YIRMPKIERSRYFEKLLDIRLKQKGIIIDNDNNNKRNSSGMVQNNLKIYNPKVELTYKD
FT                   ELGNVLNTKQAYKQLSHKYHGTGLDKTKKKQEQMKKKKMQKGKNSTTTTTTTTVTERII
FT                   N"
FT   CDS_pept        697531..701250
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570420"
FT                   /orf_name="CD36_52780"
FT                   /product="Cation-transporting ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41659.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D652"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL7"
FT                   /transl_table=12
FT                   /translation="MPSSSSIFESNSNENNITVVLEILDLHTTKDITDITTILNKLFPK
FT                   LISKDFHHQQLTIIYDSYDYDDISILNAISEIGFPVKILSSTAPQYKTTVNIQGMTCGA
FT                   CSASITEALEKTPGVYKASISLITENGLIIHSPKLSIENIITIIEDCGFDAQIESSKTK
FT                   HTQSQSQSLPKTSQPQRFKTTIGIIGMTCGACSASITNVIEKLPGVENVSVSLITEEAS
FT                   IIHDSTITIQQLKQTIEDCGFTATFTKSINLNQYSSNNNNNEDDSNEQVTLKIVGVNHT
FT                   TDLIGLRYNIEAYLRSISGIQKFDLTLRGMNASSDIMPTQVGTLITEEDTITDVKNLVN
FT                   ELVFQYDSDNVGIRDIIDGLNSIDHGNNNNNNIEFMVINSLDQSSTTQLKLLSKIKDIN
FT                   YWKNIFIQSLIFGIPVLFLNHTKNWPIWETTMIFPGLYLVSLLELILSSYIQLCLGAIF
FT                   IRKFSSFLRKGFKGATMDVLVCISTMCSYIFSLTTIIVSVWNGKKDGAPPVLFDTLVML
FT                   ISFVSFGKLLENKAKGATSTALSSLLSLTPSICTIINDIPEYEKFINIQQNQSIEKSEN
FT                   KIKNKNSSFIQDFPTRVISIDLIQPNDIAIVLPGGKIPADGEIVFGETEIDESLITGEP
FT                   LPVYKKFKDKVIGGSINGPHLIHIKVIHTGKKSQLQQIINLVKESQINKAPVQKFSDYI
FT                   AARFVPFVLLLAIFTFIFWMIICFTIHQDKLPKIFQNEINGKFFVCLKLSISVIVVACP
FT                   CALGLAAPTAVMVGTGIGAINGVLIKGAKVLEKITAINIILFDKTGTLTTGEMSLVNFQ
FT                   PLLSSLSKSQSKSQSKSKSQLKSQLKISDWWKLVGSVECHSEHPIGRALTKSAKSNLNL
FT                   NFDDDHFDTIVNDINVLIGLGIQANVTLTGATTVGTETNQYNVYVGNDKLIEEKFPNLL
FT                   NNIDEKLLHSTNTVSHVIIDGEYSGYIELTDALKPGSWEVVNYLKNQGYIIGMVTGDNR
FT                   GAALKIAQEVGIPFDNVFYEVSPIHKDNVITDLHNRLGGITNNGNVNVAFIGDGINDAP
FT                   ALAKADIGMAISSGTDIAIESADIVLIGGRNNQTDLYGVINALKISTTTFNRIKINFLW
FT                   AIIYNVFMLPFAMGCFLPLNIVLPPVAAGAAMMFSSLSVVFSSLLLKRWTPPKIEIKET
FT                   FINDDLEMGNNTFDGFSLKNGTLEQFNNVKRKSAINFSSLFAKMTRRRRGGGGGGGRRN
FT                   NNNQSYELVSNRFS"
FT   CDS_pept        702115..705243
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570421"
FT                   /orf_name="CD36_52790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41660.1"
FT                   /db_xref="UniParc:UPI000192D653"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL8"
FT                   /transl_table=12
FT                   /translation="MKVYNLFLIANLANGLTINPASAQPSNDVSSQVDAADAAAANGNG
FT                   GGDGMKTKHSFSKGISIRKDLAQDSEKQQQQQQQQQPSLEDLSQFSFDASSLKNVMGED
FT                   GGPKVELAARGFGEIFWQLLTLGKELTMEKVAILKDILSLLDKLKQFKKDGYKALVPEW
FT                   DGIYQPVAPAPGPGPSPGPGPGSAPKGDVVNVENWSFNPDQQQVESLSKNDNDNESETL
FT                   DKRDAEDDEEVTAAIDLGKWKSKLGGMKGGMNKGGGKSGMGKGGGKSGGKGGAKKGGLN
FT                   KGGKGGKGGGKVKPSKPSFEEECSEEETYSSSSEEECDEFNNGKFKGKNTVYGNKKNQL
FT                   DKRDAEDDEEVTAAIDIGKWKSKLGGMKGGMNKGGGTGGMNKGGKGGKGGMNKGGKGGK
FT                   TTQPVEEECSEEEYSTEEEECDEFNNGKGNTGKGGKGGKGGKSGKNNKGSSWKAKREED
FT                   EVTAAIDIGKWKSKLGGMKGGMNKGGGKGGMNKGGKGGMNKGGKGGKTTQPVEEECSEE
FT                   EYSTEEEECDEFNNGKGGKGGKGGKSGKSGKNNKGSSWKAKREEDEVTAAIDIGKWKAK
FT                   LGGMKGGMNKGGGTGGMKGGKGGKGGMNKGGKGGKTTQPVEEECSEEEYSTEEEECDEF
FT                   NNGKGNAGKGGKGGNGGKGVKGGKGGNGKGWKVKRGENHSDGNKHDGHHKGNKEDNHHD
FT                   SDCECGYSSSDDEHEKPKVIDRKKQDHERKKQEDHERKKQEDHERKKQEDHERKKQEDH
FT                   ERKKQEDHERKKQEDHEHEKQKEHERKKQEDHEHEKQKEHERKKQEDHEHEKQKEHERK
FT                   KQEDHEREKEDHEHEKQKEHEKEKDHGKEKDHGKEKDHEKENNHEKEKPKDHGKKKEHD
FT                   GFKYEDCDEFFGDHKKGKHGNDKRESNNEDEDEVTASIKIGKLKGFLEKGEKNTKDNQE
FT                   TKKTKEIDCEDEKENKGGLKPELGKGGPKAGPKAGPKAGPKTGPKGNKGNKSGAEKPYE
FT                   SGSESESESECECFEEEEGNFKKGKDGGIKGGYARGYGKDGNASNRKSKGGKF"
FT   CDS_pept        705077..706660
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381805"
FT                   /orf_name="CD36_52800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41661.1"
FT                   /db_xref="HOGENOM:HBG398547"
FT                   /db_xref="UniParc:UPI000192D654"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHL9"
FT                   /transl_table=12
FT                   /translation="MNSGSNRNSNSNVNVLKKKKEILRKEKMVVSKVDMQEVMVKMEMR
FT                   AIAKAKVGSFDVVSQGSNKQQDKMMIAKLNKDYVAKENEIFGMDDEIKMLEKRAGKLWN
FT                   WKSESKEKGYSGFKEEDYIENDKVSKKQAIKDKLIGKFKNQGDNEFGLSADDDPDDERD
FT                   MVDELLLRVFNSLKGSGFINDIIRMSLTDPRVRSGMIDMTIRLLNAEVIPWDDIFIALK
FT                   RHGLAIDVIKFTFTDAQTRVGLAAFVVELLPALVNSGALNLRQILETVPRLQEESIKMY
FT                   NGKHNSSDPVDSGNTNHGFEDSVGSIIDSENQAEGGINNPVIPEKNSTSTLVDVPAKSP
FT                   SSDAAPKVIIPSEKNSSGNYNGGNESKSSLNDNKEKTISQPEALDENKNDQLIGKQKNW
FT                   DDKTLEEKVEEYKKLKEKYDEARRKLVTNENSDLIRDHTYFNNPEKLKNVKPLFPKTGV
FT                   KYSNNTSNSTIGDHVAPYPKVRIFYDGTFIPNYPVDFKPPIAGGPPTNFDPNSNPIKPN
FT                   ATEPTVGVAT"
FT   CDS_pept        complement(707207..708040)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570422"
FT                   /orf_name="CD36_52810"
FT                   /product="Vegetative cell wall protein, putative "
FT                   /protein_id="CAX41662.1"
FT                   /db_xref="UniParc:UPI000192D655"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM0"
FT                   /transl_table=12
FT                   /translation="MQFSTLVSLAAVIVSTNAAALLTQTVESSTVVTITSCGTEATNCP
FT                   AASPAPSGSAPAPPAPEQPESAPAPAPSAPAPEQPEQPATPATPATPAAPAPSAPAPEQ
FT                   PEQPATPATPDTPAAPAPSAPAPEQPAGPAPSAPAPGPEQPAAPASPAPAPSASAPEQP
FT                   AGPAPSGPAPSASAPEQPAGPAPSGPAPGPEQPAAPTSKEAESTPAPAPSAPAGPEQPE
FT                   SAPAPGPSAPAGPEQPASSVSNSTSPSSVPTFEGAAAKQYITGSVAVIAAALLAL"
FT   mobile_element  709990..711534
FT                   /mobile_element_type="retrotransposon:iota W (truncated)
FT                   and G, Tcd23, LTR"
FT                   /note="two inverted LTRs flanking remnants of ORFs and PBS"
FT   CDS_pept        710363..711280
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570423"
FT                   /orf_name="CD36_52830"
FT                   /product="Tca3/gypsy-like retrotransposon relic "
FT                   /protein_id="CAX41663.1"
FT                   /db_xref="UniParc:UPI000192D656"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM1"
FT                   /transl_table=12
FT                   /translation="MRFKSTNLEKTNNLLTGTTSTAPAISHILMLTTIAITISPMPIKT
FT                   TTTRNQISPESLKPIIKRQEIRESNSTNYQSPTTTTTMSILPISMLSKPYSRLHTNQTM
FT                   TQSSNPFNQTIQRGNPTIRNVAAIDISQGLPHVLLDSRADANFIPPQLSTQGKVTPLDK
FT                   PIIATTATNKRHAITHRVEFTITQPFHLKFSAYVLPGVKRIILDKPTLRHLQYQIIPHA
FT                   EFITLAGKRYNCSLKRFANSISISVSSISTLNHESLLTAIKTKYPSLTDTTPRKPKNRA
FT                   LQIRHHNNHHYTSDFKTIFHQCPR"
FT   CDS_pept        complement(711719..713254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077563"
FT                   /orf_name="CD36_52840"
FT                   /product="High-affinity nicotinic acid transporter,
FT                   putative"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41664.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D657"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM2"
FT                   /transl_table=12
FT                   /translation="MTTLEEEKHTTTDMSKDPEYVSSDDSFPEHNIDSKLDPETEVEQL
FT                   AQELGINQKKLMWKIDLWVVPPFCLLYFLSFLDRVNISNANLYGLTTDLKLTGNQYNTA
FT                   LTVFFVPYIVFEVLANYCIKFVKPHIWLSTLVLLFGGISIGMGFVQNFGGLIACRFLIG
FT                   VTEASTFPSIFYLLSTYYSKAESQRRFSAFFSCTALSGAASGAIAYRINDLNMVHGLES
FT                   WRWVFIIEGAITAGCAILLFFIIADFPEESRFLNSNERTFLKRKLEILAGTKSAFEIKN
FT                   TLKDVGKCFKDWLIWLPALSYFGLIIPSYGYAYFAATIIKQLGYTAVSAQQHSVYPWVC
FT                   AFGVINVVAFVSDRFKKRLPFAIGTCIMAIIGLAMILGATHSPNVRYAGCFLTASGLYT
FT                   AMPMVVCWAALNNGSHIRKSVGTAWQIGFGNIGGIIATFIFLAKDAPVYKPGLATSIAG
FT                   VCFSILCSIAYFFVCYRMNKIKHTDAYKQEFNAMPEREQINAGDRNPNFVYLY"
FT   CDS_pept        715233..715910
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570424"
FT                   /orf_name="CD36_52860"
FT                   /product="Ribosomal protein of the small subunit, putative "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAX41665.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG297325"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="UniParc:UPI000192D658"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM3"
FT                   /transl_table=12
FT                   /translation="MSDVEEQYQEEQQPVVQEELQVVELATAIPLDVQEAQREVKLFNK
FT                   WSFEDVEVKDVSLVDYIQIRNPVFVSHTAGKYASKRFRKAQCPIVERLTNSLMMNGRNN
FT                   GKKLKAVRIVKHALEIIHVLTEQNPIQVVVDAIVNSGAREDSTRIGSSGTVRRQAVDVS
FT                   PLRRVNQAIALLTIGAREASFRNIKTIAECLAEELINAAKGSSTSYAIKKKDELERVAK
FT                   SNR"
FT   CDS_pept        complement(716222..718288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381806"
FT                   /orf_name="CD36_52870"
FT                   /product="Transporter of the Major Facilitator Superfamily
FT                   (MFS), putative"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41666.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397365"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192D706"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM4"
FT                   /transl_table=12
FT                   /translation="MAHTPEEAEEENGPTKSSISSDMSHDDDDDDDDGLEDVEEINTNQ
FT                   VEEYQIHPIQSQQTTYSRLSRTRTNHSELSRIISGIKDDQQIDEQNKNNYKQTGDAEYI
FT                   LTNEIDRVTTNIIDSRQHSTTDLESQRRHLHLQQQQQQQQELNENSKPSSRSSPISGDS
FT                   QRDNLSINEEKKKDFVDDEDEDEEKEKDSDYKPDGGMAWIMAICAMMAMFSTWGANSGY
FT                   GVFLNYYLESNTFPEATKYDYALIGGIVVFMANILSPLSALLYKMLGFKFVCCLGIVFQ
FT                   TLGWICASFAKKIWHLYLTQGVSVGISFSLIFIPATLVLPTWFEKKKATSMGICVSGAG
FT                   LGGLIFSLSVNKVIQDTGDQRWALRMVGFVTLFSTLLSALIMRPRNYKQPPLKESLSKT
FT                   FIIESIKAIFDVHVFKNRGIILIALWFSIALIGYILMLFTMSSYATSVGLSHYQGSILT
FT                   SVMNAAQMVGRPSMGLTADRIGRANFTTSACLVITILLYAFWINATTFGSLIAFVVIVG
FT                   LLIGVGSSLAQPLAADVLDPHMEQMPAAWSGINITVSFFCLVSEVIALALVVPGSKRPY
FT                   LHTQIFAGACFFACFLLMILIREFLIKKQLTLRLEFTKNKLLEISGTTKGGYLRCQDNE
FT                   QHVKKDGEKEQEEEEEEEEEEESILIERVERYENLLNNTLTGFFIRALYPIKV"
FT   CDS_pept        719944..721257
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228908"
FT                   /orf_name="CD36_52880"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAX41667.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI000192D707"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM5"
FT                   /transl_table=12
FT                   /translation="MSGASDFLSKGIDLVQKAIDADTATRYEEAYKLYYNGLDYLMLAI
FT                   KYEKNPKSKELVKSKFTEYLTRAEQLKDHLEKQAQNKSTAESSVNGSTKAKKSNSNGDG
FT                   DDNDDADTKKLRGALAGAILSEKPNVKWSDIAGLDGAKEALKEAVILPVKFPQLFVGNR
FT                   KPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESERLVKQLFTMAR
FT                   ENKPSIIFIDEVDALCGPRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQ
FT                   LDAAVRRRFERRIYIALPDVEARTRMFEINIGEVPCECTPHDYRILAEMTDGYSGHDIA
FT                   VVVRDALMQPIRKIQQATHFKPVIDEIDGKEKLTPCSPGDEGAQEMNWMDLGTDELKEP
FT                   PLTIKDFIKAIKNNRPTVNEADIAQHVKFTEDFGQEGN"
FT   CDS_pept        complement(721409..722413)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077564"
FT                   /orf_name="CD36_52890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41668.1"
FT                   /db_xref="HOGENOM:HBG397366"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniParc:UPI000192D708"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM6"
FT                   /transl_table=12
FT                   /translation="MMTEPEVAPYGGFLIKSLEDESENLKQLQQQSIEITTNQGTIEII
FT                   RPEAIKIIGVDNLSTNDIQNYIDYYINYITTIINPETNELKYELIPFDQSIEFKIEWID
FT                   DNSVNIVFQTINDCYKSFQKISESPILEKLGSQEYINQSIIERKGKSYNPIIDFKKHQN
FT                   LANRLKLANEATNNNNNNQIKVEDAGDMEEDEVFVELIIRQSFQSDRKIKNASQYSRYY
FT                   LIHGEPERRSRPRKHLDPQRRNKYPAGYRSRKNNNDNNIGDDQEDLFADKLKGERKSRS
FT                   DNRNVNEDHNHGNDDGNDDYDDDLFADKLKQSKRDRSRSPMRIDNEDISYRQR"
FT   CDS_pept        join(complement(723537..723545),complement(723065..723451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570425"
FT                   /orf_name="CD36_52900"
FT                   /product="Small nuclear ribonucleoprotein, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX41669.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000192D709"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM7"
FT                   /transl_table=12
FT                   /translation="MSNFQPINPTPFLKSLIGKSIIVRLKWNKTQYKGILISIDNYMNL
FT                   QLDQTYEIISDDINTTKEELIGEIFIRCNNVLFIREYKEIEQQNQQTDSKPIENDDNNN
FT                   NNGNINEEENVEDEKVTNNEDIEIDKE"
FT   CDS_pept        723874..725331
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228909"
FT                   /orf_name="CD36_52910"
FT                   /product="GPI transamidase subunit, putative "
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41670.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG747640"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniParc:UPI000192D70A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM8"
FT                   /transl_table=12
FT                   /translation="MDKSTIRVFIIGGLIRFLLPTIIFPQLTSILDSSILLSTPITSFK
FT                   SIQESIFYFFHNIELYNGGINHSPPILIILLSFLGNINELNMDNNLNKIGYDLLYTIID
FT                   LIIAYKIIIINRWYNNYQQQKRQQKRNKKKEEEEVEVEEEEEELQKNSLGKFDDYLIGC
FT                   FYLFNPLIILTNLSHSSIIFSWYFIIESIIQIIQYENISRSMISLAIASYLSYSPIYLL
FT                   PSILALGHVIIRDKTNLQQQQQQQQQQPPKKNVKDLIMKLYVEGLAIFLICEILLIMIS
FT                   FIITASWEFLDNVYLTIILFKNPRPNIGLWWYIFIEMFENYSSFYLIVFNIYTWIFILP
FT                   FTIRFFQYKNNNNNKFFLPIGDSFLAIILCLCWISFIKPYPILGDLGLILSLLPILNNT
FT                   IIQYCKLKNIIGIILIIGLLLAPIFYYIWIVLGTGNANFFYSITLIWGSIHGLILMDLI
FT                   WTKLTLDYYIDNEIEIDMNDGISLAQI"
FT   CDS_pept        730631..731812
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534590"
FT                   /orf_name="CD36_52920"
FT                   /product="Sterol uptake protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41671.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397367"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D70B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHM9"
FT                   /transl_table=12
FT                   /translation="MSDLLSYSIMNNNTTTTTSTNNKYHSNHTKTVLPPISSITNQLPP
FT                   LGSIITSPIRPSTINNNSNINLPTLNQYYDRSYTTTTSTTTTNNGLTTPSPPPLKYSYS
FT                   NNNLTEANLSKFETSRNCHGLGLLSSAVLYQQQNNCSTSSSSSSSSPNGLTLVTPPPSL
FT                   TSRTSSISSISTPSSPHINDISITKTSTITPTTSKTSKTSTIIPTSKNQCQVPTKRRQR
FT                   LGPSCDSCRIRKVKCDAEIQIINEETIINEYCLQVDEINEIKSGKKKLLLSSSSSTTTS
FT                   STSSNCLENGGTTTTTNNNNKAIKIELIYSHGKFIKFKSCQNCIYKLNVDCCFKNGYTK
FT                   EDILHNKKLKIFHPVTTTNTNTNTTTINSNSNSNSNSGGGGGSKRIMKKKLQK"
FT   mobile_element  732978..733184
FT                   /mobile_element_type="retrotransposon:solo LTR, phi K"
FT   CDS_pept        complement(733368..739868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228910"
FT                   /orf_name="CD36_52930"
FT                   /product="COPII coat assembly protein, putative "
FT                   /protein_id="CAX41672.1"
FT                   /db_xref="HOGENOM:HBG397368"
FT                   /db_xref="UniParc:UPI000192D70C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN0"
FT                   /transl_table=12
FT                   /translation="MSESSNENILESQESASQVTNDKTVTNDSHDLFGDDDQNTSNQQD
FT                   DFFSNIQHPDQPDQPDQPDQPVIVTDDGVETVHKPNEEESPQEIPLEQEQISSQQPQQE
FT                   NVIDDLFGSSTHDDDFFSNHNQDGLNSVEIKSEENIEVPVEPVSEQRQDLQPQTATIPI
FT                   DSKEEDPVVESLTNETDVIHHDQESTNKAVGISSESELTEEKSIVEKEQSIVEDIPGVA
FT                   NQSPGAKTLPTEQINHIDESEATAPNAEQSHNSSKLDQLFTESNEGDFFESISKDNLEQ
FT                   NASETNQKLEDLFVGSANKDGEDLGFLQQSQPHVTDAKSNDPISEAVVATGSANLDLFG
FT                   DDDTNFLEELNPKEHQQQEEVKLSSATTVNAEDKLAALDLDDDLLLDDDFLEEGSAPPK
FT                   VESSLPETKPIKHHYSYIPSSHSTNQKSVYAPPQVSGVDKNEFIKNLEQSKKKHDAYDF
FT                   PDTLLVNKSRPAARHAPSSNKYGPASVSQTSIPSISSTSTLPPARDIKPSSSAPAAPTG
FT                   APPTSASILKVTKKSFFEDFPDEEEIPKPKRAGRAAAPVKAVNQIHSPQVLNQQVQQQK
FT                   QQQQQSQQNTAPPPPSKTNKQPPVNPYMPKSGTSPILQQQTPVVHKSGIAAPNVNVPNS
FT                   NAYAPQLNSFAFPPHQPNQKTNDYSPQLQSSAAAAAAPPPPTSLQPFPLIGQSQSAPVH
FT                   HNRQPSNSINTNVNKVPSINSPYVPNAGPYAPSTHHRSHSRASSLVGGKGKEINPYAPA
FT                   LETVASGDIGQQQQQHQQQQQQQQQQQHLSPATAVLPPARARGFSNSKSNIYKSAPKVV
FT                   NPEQLVFRQYPIFSFSINSNCSMIIPNTGYNQGTSINIGPISNLLKDKDIYATFPGPLS
FT                   KNKTKKKDVEKWLESSSGYLRSLGKNDEFILNDILLQLIKYDGDVKNKEFLRSACSILN
FT                   PNVNFDVNNFPTSGLTIGATNAHKLDNSGVNTVFTLIQSGNLEKALEYCVSRGDWALAL
FT                   IISGPENFSKIAAEYARNTFPFAKTNNKVLHIMPIILKVLGGNVSSVIEDLTAVVNEGE
FT                   YANLHWREIISTIAICGSLKAIEFLIEFGKFLNKQGNFIGSEIAYIMAGLPFGHQNFMV
FT                   LASGHNSMYTEVYEYALNLHKTMHFPHLLSLKLKHALTLADYGLINESQKYIDHINSSI
FT                   KTLGNKSPFVTPNLLHEFQNLIMRITEAGSGDDQNNWFSGKISRVNLDKIWGQIDKFIV
FT                   GGDESKNGNNNDGNTSGNASGSVFNKFSPSVSRNASSVNLHNYSQPSMIRQPLHAPYQP
FT                   QPLSQLQQPQQQQQLLDQVYIERKPTTGFTPQPPPLVGHPSTTSVNKYSPSVKSSPRQA
FT                   QQNKFEKYAPSTNSSHHNLSLVEERTSAVTSADGPEHPPNHSNHQQSINASAIPVPLPF
FT                   PPPTPTPTPPVGVTRHTSRSPRNHHQSHQPSALPPQHPQHVQPVRDRSPLATRVYPYSN
FT                   SVGGQFSTTSIGSIPSQIPLGGQTQTQTQTQTHGKQPSISSVISGDSIAAIGLGEQENV
FT                   LPPSTGQIGQTGQAGQTGSSQVNKNEESYEFGDDHHYGHHDQPETIKESPELRGLQQSS
FT                   TNEAPITKDITDDVVELNNPMVSETSHSPEKETDKSSSIVPIAPPRKSKSSRSNPYAPT
FT                   TDNEAINDTKSSTVLTPGVDKLNVKKSKSGSRTRTRTNKYGPPSEVNNNQSTIDISPPS
FT                   VTNNVGNEDSIDMFSYGGYQNDSNPQMKQSSQSSEFNQSVGTSVNIPPPLQPQLAVPER
FT                   VPTKNITNIDDSFDESSLVADTSINYTTTNNNNNNNNNDSSSSSMINKPYGHTNIGSGS
FT                   VNSTPLILNQGNTNMKLSNISTISVSGTAPGTSGAFDGFPIPGSPDETTRPNSIFGGHS
FT                   RGLFSSRLSESQSVLYQQYAIVDDTVGDYVPIMEEDEDEENEEVKQQQKQKQKEKEQEL
FT                   RRKQEQEQQQKAMAKNNNNSSGSGGGGSGGGKFFNLFGGGGGIGGKNNKKQDNDTKVYK
FT                   AHLGQKNTFVYDEKLKRWIDKSKPLEEQLQANLPPPPPPSMKKKPNPVGNNNGNNNGNG
FT                   GPPPPPPPPMVTPNSTPTPGGNDSSTIATGGLSTPIPASAPPSRMSNNSKPTPINRPKS
FT                   SLATVSGLDDLLSLTEDNIPNGRLGAKGAGGGSGTTGGGSRRNKPKRRGYVNVMEK"
FT   CDS_pept        743865..745787
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570426"
FT                   /orf_name="CD36_52940"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41673.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397369"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000192D70D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN1"
FT                   /transl_table=12
FT                   /translation="MTTKSRNQPLSLNTNQSSTGAGTGANSIPPGTAITDNNQSFLLPG
FT                   LASPPTISNSPIFQNPAPHSNRKMDLSIEVPSHQFETNEQTTTPIDINMNMLKYYEILQ
FT                   LPTPIFNTGSFANYNQPLSSLSSNSSNASISMSPPAFRSISRVCSLKQPKRYVSEPIPI
FT                   SSSTSENKVTTSPITPSSSPPTLQQEEIAKKEKQKTFYSKRLGLSFNFVEEIGKGNFSH
FT                   VVLAKTNIYHNDSNGNSVSNNNHNQDVVDLAVAVKIISVPMESKQQVHNFKSFIRRELN
FT                   ILYHISHHPCITSLIDYEISLDIPIEQIESDVIIDDDEIYQKNSPQNLSMQPHSDIDKS
FT                   SSPDQFIFMNYCNGGNLLHFLQKNNSKHHYLHHHHHHHHHHNHQQDHHDTIHYWQFLKR
FT                   IVCELIATTAFLHKNLVIHRDLKLENILLLHDFESLVSLSSSVSFDELLMSNAISNLSD
FT                   FGLSKKLSTQDQLLSTRCGSQDYIAPEILMGLKYNGKLTDTWSIGVIIYSILENRLPFD
FT                   IPPPPPSSSATPHYNSSTSPNKGSPTVIKRRRSKTNSTAYRIAMIDWEWSKLDNANIEH
FT                   YQESVKDNGNDTIPTEVLTIWKQLKSVVDTVLFRKEKRINVEQMLQLDEFKWITDCLPD
FT                   FIVNV"
FT   CDS_pept        746819..750643
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570427"
FT                   /orf_name="CD36_52950"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex, putative"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX41674.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG397370"
FT                   /db_xref="InterPro:IPR013947"
FT                   /db_xref="UniParc:UPI000192D7C8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN2"
FT                   /transl_table=12
FT                   /translation="MNTQDQSSMPNGKQQHEVAELSSPPEIPHITANMIPLSNIIKYYT
FT                   QEAYKQLTTAIENLSMNVNEESDIKRKKYFLNVIINLRQDFIKVYTLIKWASISKDVSK
FT                   FIDLLNWFRMQEFHFENLLFQLNALTGYNAAKLPNSDIVTALEVLYHGRPKLPSYNYIK
FT                   SDNLSPQKILETLNDLNLVLMTRFALMDNIPKRFDYEIKDGRAYIRVSNEFEVSITVGN
FT                   DLIVENPEEYYKSPFYFIDFKFLFGANPESGLITFNDDKISTKLPTSSHKKLEKIVNQT
FT                   LLTRGLQGLYELLHKYSNSFKIYLLAKQFQTLLINSRWRGNFQINYQTNKSLIVINYWS
FT                   QHYLSRNWKSFIELGIDSNSNLNYRWFKNGEYCFGDQGNNELDKIFHLQRRNSNNGLTG
FT                   SASININGSMIATMGRSAELSNEIATVDDNGNDNDDTTTNNGDTENEDLNVDLILNVVV
FT                   NQHAKSIMSAIYSQLLTRFSETDVSMVSPHQLLLQISPKKSTVFAINPLTGFFYFIDPT
FT                   PIQTYITKKVNLPPPSQVSNKQLFIPESNMVSYVIDQIIQLRLEVFNKEVNTKLATTAW
FT                   INNGIIKLNDHELSKLTQFLIQNDESNNDEDDISGTRLDSVLQSFKLQFYRRKNWPSSW
FT                   FLINMISGVTTKSFWWVARIKSINGDWKIQWAQIIKFHGENNAKQELPPNEGKIFVKPR
FT                   RTVDCSIDSEQLNYEFFKTLSTLSSNLILDHMILEELQVRNIRFIKLDWETIDDNKIFS
FT                   RFKQNHDISLKRKSSSNINIDVNVDIADSSNSTTNGKHIRGPKLKYESMFLIYNDKLLP
FT                   IYNSATILFLKIELVESNKMYLKLFGNLRNLQIKNSSEDIHKLHLNIDEANQYFEIDNT
FT                   VDLSTVINEPKTLLLNLIFNTLNKLNSLIKILDQLNKSNVEVLDNSMDNITIKIKDSYN
FT                   DNNDKLIVIKLPEQATDPIQLLMKNTTTDKIDLKKNNILEFESILKFLNEYLQESKSKN
FT                   NSHHQISIIKIIQYLTEINPILQSTKLINEQLAELKRKNNNNNNNDNDKSNKSNIGKLS
FT                   NGLYKLYFNLNIISLTHLQLIFFMNSNIVSNSKKIQKDKILINLNLIKFNRFSQPNGNL
FT                   NDDNNTNSNCHLIRISFKNSLIKENLKFKKLFEIIFKNINELLITKSKQIKSLHQTNNK
FT                   QQSQQSQQQGNNENTIVKKESQSIEDDLLDFGEYDNDNKSQQQQQQQNEKDQLSNNEKE
FT                   NTKENKTVRPDDVLIKLNYDYLLSMNNLPLLINQITKSFIQYLQQQQQE"
FT   CDS_pept        complement(750777..753173)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228911"
FT                   /orf_name="CD36_52960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41675.1"
FT                   /db_xref="HOGENOM:HBG397371"
FT                   /db_xref="UniParc:UPI000192D7C9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN3"
FT                   /transl_table=12
FT                   /translation="MSSFKTNKIISKPNLQPVNSPTTSEQSPATTIDQHAQMDRIPTSE
FT                   SFLPPSNLTDIESFDQNHDVSPKSRRTESSSIYEDPGDSTYQYLQQQSPQQPPSVISKN
FT                   SSSEAIPVSIKLSQLPNNSSSSLFINNRTRQPNSPSVNSQRGNSKSPSKSSHFSSKDEP
FT                   IIENLKPSLESSSASTHSLESPITPLVRKTKSSSQSIQQQQQQQKTPSSSMVSPGFLIM
FT                   QQESSHSPHQPSPALSHSSVSTFGHKKRESMLSTYSGAVEYDAVPMTVKRSSSSKIKYV
FT                   GNASQMNANNNYNNMVSSRTHHRKKSSLSSTTSNKYSDHNTVSDTKSVETSQLLAGDSS
FT                   NSNNSKHNRSYFDDDDDEEEDDSSILMGKLPTRSSKEDELKAQQPDKTVTTNIEGSIPA
FT                   RSPRRPASVMSPNFSSIDMINSSSISNNTTGSKDQSRRKSYVEDNKRRSIQINDGLEKL
FT                   MLDATSFTSQDENDEGKQEGEEKVEHDNTKFIKDVTPNHLNIHRKNGTDEYNEDDDITP
FT                   KFDPALMTGLHDGVDIDELDNNVPISSRNSSYESWSRHESKRKSPIKPLNLPPRPTKDN
FT                   ITKARTISNNLQQQHLREQYETPDGNPDNININEGEEIMPSKNNLVDDEEYEQRGTTNN
FT                   HIDDNDDDDDDGFYDITGEPVTVQPPLVRARSVKNSIKRPGRHTKSSKDNQISGDTERH
FT                   HNSKKHRGRGSGGGGNKKHHSQRGKNGLKPFSYTTLISLLESMNGTIIGEEFNQLNIPI
FT                   KEKQLIEKIIDSLSRLTSDMILDQQRYEIGIDRLEKCLRVLEGFM"
FT   mobile_element  755194..755664
FT                   /mobile_element_type="retrotransposon:solo LTR, zeta A"
FT   CDS_pept        complement(763532..763833)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(780040..780420,780423..781127)
FT                   /pseudo
FT                   /gene_family="HOG000093772" [ FAMILY / ALN / TREE ]
FT   CDS_pept        784410..785531
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381807"
FT                   /orf_name="CD36_52990"
FT                   /product="Cell cycle arrest protein, putative "
FT                   /protein_id="CAX41678.1"
FT                   /db_xref="HOGENOM:HBG397372"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D7CA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN5"
FT                   /transl_table=12
FT                   /translation="MTTSFVELQAPKNLDIISDVCFMDNTDQHRLLVSNWNSEILLFSC
FT                   DSLLHEHQPPHLQPINTFTTPDIPLCLLYDNKQNISPLVGLLDGSIRELDFENGKLGDN
FT                   IGDAVDDNDEIDSGINNLKNVTINGQNSNTIVASSFNGKFQLIDTRQSQRQQQKLSPQI
FT                   FHNQRKIFTMDTSDQYLILGLQNNIIEIYDFKNLHHPLETRQVGLKYQIKDLKTFPDNQ
FT                   GFALSTIDGRVSMEYFNSDPQFQLQNRFTFKCHRHPDPNPESTGDLVYPVNSLEFNHKY
FT                   GTLFTAGSDGYVCLWDCKKRKRMRQYPRFLSAENEPESIVKLKINRQDNLMVVATSDDN
FT                   YKRRRRLSESENSKTPSRVYVKQLAENECKPKS"
FT   CDS_pept        787278..788906
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570428"
FT                   /orf_name="CD36_53000"
FT                   /product="Lysine methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX41679.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG397373"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniParc:UPI000192D7CB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN6"
FT                   /transl_table=12
FT                   /translation="MDEFNKKSKLFQDWLIKNNVEISPKIAIHDYRDTNQGRGIIALQN
FT                   INPDEMIFKLPRSIVLNIDNNSLIKQYPSALKKLRLLDQWIGLIIVLSFEMKFKFNPSD
FT                   NDDNNNSFWYEYLNILPNDFNQLIYWNDEELNHLQPSCILDRIGKENNLNMYNQIISII
FT                   NQDLSIIEEFKSSPLTFEEYNKVATIIMSYSFDVEVPKSKPNKEMTENGTNEEDDEDDY
FT                   EEEEDHEYYKSMVPFADTLNADTHLNNAILIYSTDQLIMTCIKVIAKGEQVYNTYSDHP
FT                   NSELLRRYGYVELNGSKYDFGEIPLSIIKTVFIDQFNNSSTNQNSTNSNSFMTNQKFDE
FT                   LLEFINKLQIKKSIEQDGLDEDETEELILDSYDCFNSGDVIIELIFLIQILSTILVIYQ
FT                   DEQQQQNQEKDTSKTKGFEIDQLLINRIFNKIYQLIESKKITTKCFEIYQYIINARMNQ
FT                   YPDVAKKPFNDNAGTNSEDKTINSIRIDMAEVVLKSEYQSLEKCTSLIKDFKIINDSKL
FT                   NKNILKKRNNDTNSVDVANNKKSKH"
FT   CDS_pept        join(complement(789941..791245),complement(789097..789975))
FT                   /pseudo
FT                   /gene_family="HOG000093309" [ FAMILY / ALN / TREE ]
FT   mobile_element  complement(791314..791496)
FT                   /mobile_element_type="retrotransposon:solo LTR, kappa J,
FT                   partial"
FT   mobile_element  791498..791800
FT                   /mobile_element_type="retrotransposon:solo LTR, vau H"
FT   mobile_element  791806..791939
FT                   /mobile_element_type="retrotransposon:solo LTR, tara D,
FT                   truncated"
FT   CDS_pept        complement(792220..795522)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570429"
FT                   /orf_name="CD36_53040"
FT                   /product="Transient receptor potential (TRP) ion channel,
FT                   putative"
FT                   /function="receptor activity"
FT                   /protein_id="CAX41681.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="HOGENOM:HBG397374"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI000192D7CC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN7"
FT                   /transl_table=12
FT                   /translation="MHTSGSGISLLLLLLLLLTCFIQPTYSTFVGNQHCNLNITNYKLR
FT                   PFVIDVALDNKDKKLKFFMNSQVANFAQNSTNDDPSIIINDVNTTTNKYTTLHVEIGFM
FT                   DKVIVKENVRFCDMIAVKNTTAFQSSPRFIHDTSSSNSSHNFTTISNKNKNYHSFETLS
FT                   SKLTTANNLDDGLISKSPLSFPGHIFNNSLAATNTTIDRIFSNSTGQLVQCPLYYNDSI
FT                   VLYYEVDVNDHFHKLGSYSVQFNVISNEEDSKIIGCSKAYVTPVQPRVISNVVAYGVLV
FT                   LLIVTLVLNVVTIAYSTYQESSNPFLFKASAICNQELLKQIDTSLPGIITYLQYALFMG
FT                   GLDLAYPGFFQPIIGQIKWCALVGFSLVFKNANHSHNHVDNVYATLESGGLPNLTRYIS
FT                   SDLIINNWANFIVTLIVVIAIHVVSNQLFIMSKLLLDKIELGNFRSKKFFMKGGDFNGF
FT                   SIFSKKNLYLIIGQVLHLFLLVFAMPFLVLSSFQFLAASDILGKRRYGTNYEQLRKDAY
FT                   SMIVPYNELSIPSSIFAFATKMGDGSQYSSTKYPPIFDSGHLSDEAERFRRSYESPQSS
FT                   QDRMSLFANGNATLFHSTYHNANYTQKVDASFMRISEPCLVFSGILFALWVILCLYFAF
FT                   HYLISIKRYFRVKQSSNISRLYTSLRTILIWGYLYVEYRPERVEYVLYEFFTMFFKSMV
FT                   IGLLQRHGIAQVVCLTLISILDLIILFIIHPHYVKISWWSSKFMFPIARFLTAILCIAF
FT                   IRDLEINVTSKIYVAYTQLLIHAIVGILFCIQLIYWFTRTMISIFRNLKNDHMNNGDVN
FT                   QSLAVYDSLDDFQRQFEYKPLQPLPTYQIYSAATTTLLSPIDQMEDPFIYAESSSSCIV
FT                   KQTGASNKMIPGKATYDKNDKDEMEQLEEEEYLDSDYYYRSKSEQVLKNIVDHELETRS
FT                   SNNSDVTSFEQQQYESNMRKLKNDYKVREGDYIYRKYFTDDLIDPEVKELWENRKNNTN
FT                   KVVIEKAEQHQKHKGPQVYHGQGTHDPSHSSNSMIDKLKHAFHNNTNRRHPRKTGATQD
FT                   AVELQRFVVNRPKKLVVKTVDQIRQEQQQKRKEQDDLLSNNSTESSSTSHLI"
FT   CDS_pept        796518..797447
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570430"
FT                   /orf_name="CD36_53050"
FT                   /product="Proteasome regulatory subunit, putative "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAX41682.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG499867"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000192D7CD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN8"
FT                   /transl_table=12
FT                   /translation="MERLQRLLGQGAGAVPTQSDGPAIDNSETVYISSLALLKMLKHGR
FT                   AGVPMEVMGLMLGEFVDEFTIHVHDVFAMPQSGTGVSVEAVDDVFQTKMMDMLRQTGRD
FT                   QMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLNKRAVAVVIDPIQSVKGKVVIDAFRTID
FT                   TTTLMMGQEPRQSTSNVGHLNKPSIQALIHGLNRHYYSLNIDYHKTEYETNMLLNLHKK
FT                   NWQSGLKLVDYNCKEVENLDNTEKMVGIAKLYNQRVQEEKDLSEEQLKTRYVGKQDPKK
FT                   HLGDTAEKLIDENVSSLLKGCVDVVAIQ"
FT   CDS_pept        798404..799048
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077565"
FT                   /orf_name="CD36_53060"
FT                   /product="Translation elongation factor, putative "
FT                   /function="translation elongation factor activity "
FT                   /protein_id="CAX41683.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="HOGENOM:HBG397375"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192D7CE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHN9"
FT                   /transl_table=12
FT                   /translation="MSQGILYVLKFSPRSTVLTDLIKYYKLDIEISTDTESDSFIKQFP
FT                   LRKTPTFIGNDGFQLTETIAIGIYFLSMIPIHNLLGDNDQEYASIIRFLSMLNQEGAMS
FT                   WAGAFFRLSGRLPYNKEIIDEHLIMLNTIGQILDTRFIDGSDYLVGDKISYADLYGVKL
FT                   FGIALYTLLGEPFLKKYPNFAKWFKRASNHEFFRGQYKDIKFPEQQLTYPG"
FT   CDS_pept        799519..800760
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534591"
FT                   /orf_name="CD36_53070"
FT                   /product="Translation elongation factor, putative "
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="CAX41684.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG436026"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000192D7CF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP0"
FT                   /transl_table=12
FT                   /translation="MSQGTLYIMEVSPRSSILVDLIKYFKLDIEINADTQSESFIKKFP
FT                   LGKTPAFVGAKGFKLTETIAIANYILSLIPNQKLLGKNNQEYASIIKYVSLLNQEGINS
FT                   WVGAFFKLNGRFPYNKKEVDENLKTFNIIGEVLEKRLNDFTYLVGERISYADLFAVKVV
FT                   ISAVATVFGKPFLTKYPNVARWIKTISQNEIFQGQFKDLKFPEQQLAFIPPKKEKKKDA
FT                   APKKDAAAPKKKEATPAAASEEPAPAPKPKHPLEALGKPKNPLDEWKRTYSNEETREVA
FT                   IPWFWKNQYDPEEWSLWKVDYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCMVVYG
FT                   ENNNNGITGAFLVRGQDYVPAFDVAPDWESYEFTKLDGSNEDDKKFINNMFAWDEPVVV
FT                   NGEKREIADGKVFK"
FT   CDS_pept        complement(800968..801255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228912"
FT                   /orf_name="CD36_53080"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41685.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG736580"
FT                   /db_xref="InterPro:IPR017264"
FT                   /db_xref="UniParc:UPI000192D7D0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP1"
FT                   /transl_table=12
FT                   /translation="MPFKKVGPPPKNLPPLPRLKVRKPVIGKSTNQCFVFMSSLLNCWA
FT                   SNGEGNQICNGFENDLKNCMETFKPQQESLSTINYHAQRLYPKLRGKVHD"
FT   CDS_pept        complement(801692..803887)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570431"
FT                   /orf_name="CD36_53090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41686.1"
FT                   /db_xref="HOGENOM:HBG397377"
FT                   /db_xref="UniParc:UPI000192D7D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP2"
FT                   /transl_table=12
FT                   /translation="MYLLRSSTRNLLRHSYCLGHYRINQRSFHQSTTLLKDEKTKELLK
FT                   NLGLNLQKGTINRSNKTKDNKTNSSSIKDEKINDTENEKDESVTRITENDNEEDKTDNQ
FT                   LVTTTTTTTTTDIPPDQQEVELKSTIPNDANTKTNSHGNNGQTDSNGVNNNNKKKNSEP
FT                   IKNKKSGKNKPTTTTTNDENIIHEQLKNAFVTVALMTNKEFLEQIALDGRNFPFKHFKS
FT                   EYLIDRQEILRQIPDMINIFNMKDMEKVEEIYQQLSQLDNDKSMHLQFLKQSFIDYKND
FT                   LLYLDQFLRGINSKFKQYRRGEVRYFFVYPTVFEHVHDKILHQYNVVGYDRSLFGMPLH
FT                   QQQQKNKDRLVLPREFIQDLPQFDNIIELNKIDAALGFKLVEEKQSGKLVDSLWDPRMV
FT                   KPLKELQKEYQERFNEQKKNQTSKQQKQQPLKSKGKFDGKTPKKYIVIKKGGYRQIKLK
FT                   ETSLQYSPVIRRIEEEIEMMINDLNKQIKTTLESDNIKVLIPNDNDKQMVSNFASSPSK
FT                   IKTNHHEIVFKEKMYQGYIVSVERIISKNFNILPNYAVFYHGTNYPPIIKRKLLNHIFK
FT                   IFLININEKFDYLQKIKYLTQRQQLEFQRKLIKQIKYIIKFKLSRYFDNNTLNQTTNSL
FT                   RLNNWNVFNHEENNSYDNNNQSNEGKSCRDNANNDDDGVHAVIFNPYTDNCFKRIYWIS
FT                   SPFPSSIMKRQNMNLKRKFTKIKFKTIDERYITTTIA"
FT   CDS_pept        complement(805193..806290)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570432"
FT                   /orf_name="CD36_53100"
FT                   /product="Cyclin, putative"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAX41687.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG397378"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI000192D7D2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP3"
FT                   /transl_table=12
FT                   /translation="MVSSIDLQALKVFLNGPITHDMIHKIVVATLQVIPCEDTKSKTYT
FT                   ASNNTIKQLPSLMTFLTKLVKYTNVYTGTLMATLIYLQKLKSRLPKNAHGLPCTRHRIL
FT                   LSCLILSSKFHNDSSPKNKHWAKYTDGLFNVKDINLMERQLIFLLNWDLKVSNEEMCQS
FT                   LQSFLEPIKSGLIKQEKFQKYLQQKNQEAKQMANAAVAVSITTPVTLSRSSTTSSTSSL
FT                   ASSSSTTTSSGRSSRSSSISPDHLSPIHYNNNNHYRQDSSSSISSFGSNNSPSSVYSIS
FT                   PKHTHQNIITKNNHNSNNSACQIIDPIIELTAQKEELELKNFLSRKLTTTSNTSNTTTT
FT                   TTTTSNNNYGYGYHAAYGYNVANNF"
FT   CDS_pept        complement(810231..811946)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094214" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570433"
FT                   /orf_name="CD36_53110"
FT                   /product="Fungus-specific zinc cluster transcription
FT                   factor, putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41688.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397379"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D898"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP4"
FT                   /transl_table=12
FT                   /translation="MSIPNNNIFIASSNSSGNSNLTQKNSKKKRNRLSLNCFNCKTRKI
FT                   KCNRQRPCLSCIKKKLKCEYQRQQWLASPNNENNGIFQIQQLNSHNENSKITTSHEISN
FT                   EDKNYQIQQQQQQQQQQTSELSQIQLLNDILKDSIKNQFHGNRNRDRNGNIENIELKKY
FT                   IITDLFQYFIKYYYHKNFLKNLKSNLGLSDRPQEISKFESLLLEFEIYIDEKYSIINEY
FT                   EIKMKFKDYINMKMILYMIYFYYYLYYEKKKKQLQLQLQLQQSLSYSYLKKILGSCINE
FT                   FIPYLFELIINQNHNKLNDLQQTLGDTDKHTDKDHIVNPMIIIFKTVIPKVMMINFEIL
FT                   IRLNSSIYKLRYLNPHHNENLRDDFEYRLKFAKLNKLTQIYKKILEISLLIIAIIIIFK
FT                   LNQKYDYQQKIKESYNINYILKQVFTDNTIPSNQTEYYYNNCMFNELSNDEINEITKIL
FT                   EVGLKKYTELKNKLGINTNFEDEHEDEHEDKHEHKHEEFHEAMRNHCLIELTSLIPVSN
FT                   SSNLQQQQSLSFDDEEQDFNIMNNMDIDKFWSLMVQIKNKNKNNINDERSTNTN"
FT   CDS_pept        complement(812262..815903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570434"
FT                   /orf_name="CD36_53120"
FT                   /product="Fungus-specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41689.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397380"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D899"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP5"
FT                   /transl_table=12
FT                   /translation="MDKKSNPDKKDSRSSSSPQIPKKRSRVRQPLSCSVCRKRKSKCDR
FT                   ARPCGTCIKKSIVHLCHYEDDNRPPINHFLPPQQQLHQHIDNNGYILTDHPLPPPLVHY
FT                   QEQYNNQHHLHPHNNNSNFDPSLSHIQGNGNNQFQHQPLSSQSPSGNHQYLPIPPPPPP
FT                   QQQQQPEQQPPSISPVGYTSSTKSSQTQISIPTPPPPLPPPAAPKSSNSTSNHSSPNRP
FT                   PATSGQNSYNTSNYSNFNPTSISDANSKPKLNSISLPLPPPPPPPSVTTPSLPIPSTTK
FT                   SSISGMSLTHDNPFGQLSIPSPIPPINELSPSLSRLKSLGTNSEGVLSPTTIGVNDLLN
FT                   PSGSNGGYNQVENNVSSVQDKSNPTVQSVLSDQTASSLKSISSPQESESFSSNSLVSIP
FT                   LGANSSLQINASDTMDVFTNGVFSLHSTGNEWQQSGTLSYLGLTKSDPFITILRNFTVH
FT                   LFRSDEFLNVIRNDATRKRRNSNGSLISIRSSRTGDEGLSPVATKRPKLDNNGNNNSNA
FT                   SIPMNRSNSSDSNYLSHNVNFNDAFDMISENGKPSTNTPLDTFSPSVQQYESPKKTPGD
FT                   MAFMQSFYNGGQKRHEYYRFVEEEVLKVLPDKTNSFQLFCRFFRFVNPFIQIIDEHALL
FT                   FDINPILPKFLKFNHEKITEIKIKNENDLRTLGIFMLVLKLGYQTMIHNDNEHNNYNEQ
FT                   ELSIIDSMQQLDNPTFNRIINLCIADGLITARSSFKLVQLLALLYHYKGMSPDDSHGLS
FT                   STDSQILLGTIIRHAFSIGLNRDPTCYTTFDNLAKNQVLIKTWRHLWWFLVATDAMSAL
FT                   NTGCNLNLASLDGCDVEYPHVADDPTGEMNKIYGVLAKICEHYRNIVNKINNLRQKPKV
FT                   VEILKETNQMERIFFDFFGKDFFKDVVCKPAKEPTNINGFEEASKEHMERVVKVFKYCL
FT                   FVQLRTNLSGMYYKIAIHYENEYDKSKTPSMKAGIELFKIYIKSVVQLVYIMSYVLDNS
FT                   VYLFGKNFDYMLTASNERYMIKTHSFLTSFFVRLLHQKKELSFKVFKEISYMSRLECIN
FT                   NLFDIVLEDVELFVGDFRRLSKTYINSYRLYIITFIVLRQSIDNSDAFFEKAASDQSFF
FT                   HQGTNMIEFFSQQELNHLCRLCRDWRNIKEAQKKYKDAKKNKNDTKDDGFDPLKELESK
FT                   LFGSSFFDDDNIFSNLNNLSDEILDPVACKEDLIRLFNIYGDFNDLL"
FT   CDS_pept        818045..819169
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159494" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534592"
FT                   /orf_name="CD36_53130"
FT                   /product="Subunit of the ubiquinol-cytochrome-c reductase
FT                   complex, mitochondrial, putative"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41690.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG737788"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000192D89A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP6"
FT                   /transl_table=12
FT                   /translation="MLSRASIRAYSSIPNSVKIAAKESATDLTKLSVIINNAGSKTGKS
FT                   GVSHLLSKFTFLNNGAKSALRFTRESELLGGTFEAKVTRDALILNTSFLKQDLPYYVEA
FT                   LGNVVSNTQFTPHEFNEVVLPTANVEAKLADANPAFKGVEKLHEITFRRGLGNPLFYNE
FT                   STPIKVEEVAQFSKDQFSGENISIVAEGANEEDLTKFVSESAFCYLPSTSSNGAKALPT
FT                   NTFTGQEARVSSAGASSALIGIPVKPADFGKYEVLSAAIGTSTLPSTSTPLAQIPGATS
FT                   HLYKYQDAGLFVISVSGEASQVAQGIKQAKSVAESVSSAALSDAVKAAELSVALQSTVD
FT                   SPLNVKAVAEKAPISKFNYVAVGNLDVLPYADEL"
FT   CDS_pept        819554..820027
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570435"
FT                   /orf_name="CD36_53140"
FT                   /product="RNA polymerase subunit common to RNA polymerases
FT                   I, II, and III, putative"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="RNA polymerase complex"
FT                   /protein_id="CAX41691.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0030880"
FT                   /db_xref="HOGENOM:HBG646526"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="UniParc:UPI000192D89B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP7"
FT                   /transl_table=12
FT                   /translation="MSDYEDNAFNEVAENFEDFDAPDHFSDNEYDDPSANGGDAALKTT
FT                   DGRTIINGGFGPDDAQSASQPRKKTTKELAIPKEKRTTTPYMTKYERARILGTRALQIS
FT                   LNAPVLVDIEGETDPLQIAMKELAQRKIPLVIRRYLPDGSYEDWGCDELIVDQ"
FT   CDS_pept        complement(820213..820728)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534593"
FT                   /orf_name="CD36_53150"
FT                   /product="Regulatory light chain for the type II myosin,
FT                   putative"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX41692.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG397382"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI000192D89C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP8"
FT                   /transl_table=12
FT                   /translation="MSHLTSLSSTQKGQIRNAFTLIDGESRDSTITKDDLVKLYSTLGL
FT                   PSPSESQLTEMLTVDGQDKSQTGINFTQFSNIMAKELSKFEDQSIIYNALKVYSDKENL
FT                   KTFKDELQIDVNKLKDACCSVQLGEIGSGDHRLSRAKFDKLVEGFVQEQMDGTQIFLAS
FT                   KWIDAYID"
FT   CDS_pept        820949..822193
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570436"
FT                   /orf_name="CD36_53160"
FT                   /product="Centractin, putative"
FT                   /protein_id="CAX41693.1"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI000192D89D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHP9"
FT                   /transl_table=12
FT                   /translation="MAEILYNQPVVIDNGSGNLKAGFAGEDKPKSYASAIIGRPKYQKI
FT                   MAAGSTSLVSEQQSHDQLFIGNAAQDNRGLLKLSYPIEHGIVNNWSDMEKLWYHTYTQD
FT                   LKTQSEDHPLLITEAPLNPRTNRNKMCQILFENFNIPCIYISIQAVLSLYASGRTTGVV
FT                   IDSGDGVTHVVPVYEGFSLPPSIKRMDIAGRDITESLAFNIRRMTGVALQSSSELEIVR
FT                   LIKEQNCFISKDPVRDEKKYGSHYSRNNPNNELMSTYKLPDGHEIQLGVERFRATEILF
FT                   NPQLIGHESSGIHELASLAIAKTDLDLRSILYQNIILSGGNTLLKNFGDRMLKELKDLQ
FT                   QPLQEDQKMSIWNKNVQNDVYNTKMKVKIYAPPERKYSTWIGGSILAGLSTFKKMWVTS
FT                   EEYHENPDIVHVKCM"
FT   CDS_pept        complement(822315..822971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381808"
FT                   /orf_name="CD36_53170"
FT                   /product="Uracil phosphoribosyltransferase, putative "
FT                   /EC_number="2.4.2.9"
FT                   /function="uracil phosphoribosyltransferase activity "
FT                   /protein_id="CAX41694.1"
FT                   /db_xref="GO:0004845"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="UniParc:UPI000192D89E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ0"
FT                   /transl_table=12
FT                   /translation="MSVAKAVSKNVILLPQTNQLIGLYSIIRDQRTKRGDFVFYSDRII
FT                   RLLVEEGLNQLPVEEAIIKCHGGYEYKGAKFLGKICGVSIVRAGESMEMGLRDCCRSVR
FT                   IGKILIQRDEETALPKLFYEKLPEDISERYVFLLDPMLATGGSAMMAVEVLLARGVKMD
FT                   RILFLNLLAAPEGIKAFHEKYPDVKIITGGIDEKLDEDKYIVPGLGDFGDRYYCI"
FT   CDS_pept        join(complement(823781..823789),complement(823473..823692),
FT                   complement(823256..823395))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077566"
FT                   /orf_name="CD36_53180"
FT                   /product="U6 snRNA-associated Sm-like protein, putative "
FT                   /protein_id="CAX41695.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniParc:UPI000192D89F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ1"
FT                   /transl_table=12
FT                   /translation="MSDERRPRQQQYRRRNNNSNAPKQEGPKREAILDLNKYKDQKIRV
FT                   KFIGGREIVGILKGFDQLMNLVLENVTETLRDPEDDEILTDKTRDFGLVVVRCTSLLTI
FT                   SPVDGSEIIDNPFIQPEQ"
FT   CDS_pept        complement(824099..824620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248354" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570437"
FT                   /orf_name="CD36_53190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41696.1"
FT                   /db_xref="HOGENOM:HBG397384"
FT                   /db_xref="UniParc:UPI000192D8A0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ2"
FT                   /transl_table=12
FT                   /translation="MIRTTIRRVSTKSIPYEPIPKNKYNQVRSAYNFKPAKNNGFVYSP
FT                   PAAIIKPQMITPYIFLPENDPRRELAKQHRIDPKIVSEMPIIRQIKAPHEREYNVDADT
FT                   INKIKELRAADPERWTIKEISKEFNIEMNKLHFFLRSQFPKKTTEPVKVVSKKSLDRQK
FT                   RKQLWLRNQY"
FT   tRNA            825453..825546
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        827771..828598
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381809"
FT                   /orf_name="CD36_53200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41697.1"
FT                   /db_xref="HOGENOM:HBG397385"
FT                   /db_xref="UniParc:UPI000192D8A1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ3"
FT                   /transl_table=12
FT                   /translation="MSAFLLVNEHTNTQVVKKKKRHNVTPTSSTKSIISGSDTSSHYRK
FT                   KVFDINSNRYVDTTSSFEISVDDIEEERNDLSHPSIRGHQIVKNKKPFFPLEEYIILRH
FT                   TYFDQIKNNNNNSFACNNIQTLLSSNQFWNNVYQEMKDDSLQSTFDYFPLLPNRAVLAQ
FT                   FYQTVINKILEENNIEADYEDYKMQHNHLYSSHYKLSVQEKLADTMIINLKIFLRGEAD
FT                   STFQQWRRFLRFLILGFLQTPEPFSSSLKTIQSTGPKKPKKISFFKKLIGSKH"
FT   ncRNA           832419..832499
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR40"
FT                   /db_xref="Rfam:RF01201"
FT   CDS_pept        complement(832841..833854)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381810"
FT                   /orf_name="CD36_53210"
FT                   /product="ER protein processing protein, putative "
FT                   /protein_id="CAX41698.1"
FT                   /db_xref="HOGENOM:HBG443801"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniParc:UPI000192D8A2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ4"
FT                   /transl_table=12
FT                   /translation="MRILYSFVMLFVVAFASLGDNLPEFQSCLYQCDCHAIPQSIIWSC
FT                   LANCNYFCQQLITDQLESSNVPMVQFYGKWPFKRVLGVQEFFAMVFSLGNLYVNYKNLR
FT                   IIYRQFRRNESEYKTMYVQYLVLLIVTCIGWSFSAIFHFKDTKMSETLDYFGAFAIILC
FT                   NLNVIVVRVFQLFRHKKNLILWHIALVVLYLYHVIRLERNWDYSYNTLINIIVGVSAMI
FT                   LWCFHSWRVYRVYNQKRIIYNNSIQLLPYETKLLQKLSYIGMSLSNLIPLIPIFNNVIL
FT                   LLGISLELNDFPPIGRLVDAHALWHLVTIFPSIIWFDWNVWDIEMLKITNSSESKV"
FT   CDS_pept        complement(834281..835777)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570438"
FT                   /orf_name="CD36_53220"
FT                   /product="Uncharacterized mitochondrial protein, putative "
FT                   /protein_id="CAX41699.1"
FT                   /db_xref="HOGENOM:HBG326531"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192D8A3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ5"
FT                   /transl_table=12
FT                   /translation="MLPSDVSFSKRLIQCTCAIFWCLLSGGPIFGFAALKPILIKEHVY
FT                   EYLCDIHTPVFSSFNSNHNNNDITAKCTDQDLKLNMMFTVAAMLTNVSALAIGRILDVY
FT                   GPKVCGLIGAFFLYLACFVFIYSKYLVGSIIDPYLLGYAFLALGGPFAFISSFQLSNSF
FT                   PKSSGTILALITGAFDASSAVFLLYRIGYNASFGSFTLEKFFTLYLFVPTFIAVVQIFI
FT                   MNSDSYQTEGTSKLCANDEENHAHVASPVSSNNQETTPLLNESGTRIRRDSMGDAIKHP
FT                   YEIEGEEFLVEHSSGVFGIMHGYSAQEQIKSWWFVLTTLLSIIMMLRLNYFMATIGTQY
FT                   QYIFGSFELADQINKFFDVALPLGGLISVPFIGLFLDNCSTLMVLIIMMLLSLTIGLLG
FT                   LVSNYALAVLGICMFVVYRPLFYTVVSDFCAKVFGFQTFGTVYGAVMCLSGIFNFGQSF
FT                   LDDLTHTTFNMNPIPINVILLVLTVIIGCSTVGYVYKTAK"
FT   CDS_pept        complement(836232..837803)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248355" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228913"
FT                   /orf_name="CD36_53230"
FT                   /product="Urea transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41700.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397386"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniParc:UPI000192D8A4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ6"
FT                   /transl_table=12
FT                   /translation="MAQLSSQGNNAIIYLSYAFMLATGLFLAWKFSSNKDFLSSNGTQR
FT                   GIPLALNFIASAMGVGIITTYAQIANIAGLHGLLVYTICGAIPIVGFALVGPIIRRKCP
FT                   DGFILTEWVRHRFGMVTALYLSAFTCLTMFLFMVGELSALRSAVETLTGLNALGAVIVE
FT                   CVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLLKANK
FT                   LGWQLIYILFVAIVTNDCFMSGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLIGTTGF
FT                   LAVWSGDLTVGDENGYDAFFILLSKMPRWLVAFVLIFCIVLSTCTFDSLQSAMVSTISN
FT                   DVFRNKLHINYVRIMLVLIMVPIVVLAVKVANNILQIYLIADLVSAAIIPSVFLGLADS
FT                   WFWYLRGFDVMAGGLGALVGVFIFGTVYYHSAREGGKLLLIWNGLYDPSDWGAFGAFVI
FT                   APVGGVVITLASAALRIAVLYAYSKVTGGEFTALDKPIAVEVDNEDQKYGSIDDDDDES
FT                   DTKKVV"
FT   CDS_pept        complement(838294..839925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248350" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534594"
FT                   /orf_name="CD36_53240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41701.1"
FT                   /db_xref="HOGENOM:HBG397387"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D8A5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ7"
FT                   /transl_table=12
FT                   /translation="MTLPANFKFKSTEDPKVIEQLYALCGTEWGGKLTPEQFGAAQVKG
FT                   NFKYVEEGGRILSYYIEDTTTGTIVATTSVKFCKAFYKPADRSSAISSIPDPSLFGVNN
FT                   ATALLISFVFTHKDYRKLGLAGQCVSKAIETTEKLIIKEKVDSSDESVADNFKKMTIAD
FT                   GTNETDLQLANYYLSKEYIWILYSGVNTYYERFGFKSFPMDFYEVPNTLLTSDVESAIE
FT                   KLIKESKEEKQSPSGKTIRLLLRDNPADQEIVQFILQNKELNIVTEINKLQFHSNLQSD
FT                   RKSSTSLTNMTNILSMSKLGSSTGLSSVTETNAATASSSSQGSPGVRRKSSVHHQTIPK
FT                   FAIKPTYAHYQSNATVTKEMFDNFSEVSQKFANIQGAIVTNEVQQRSYYALWSPLKGQF
FT                   FITGMGEIQFQGIPSSLPANRPRRASSLSGINELGGYNFKDLEVLVFTALHVAKNCDAQ
FT                   LDKVHISVNDLPEEIPDPVMYDFFINYLPASIHESGDAKEEVKADVKLLTDAAHSIHVL
FT                   PMVRKFGSRKPEFDLDWVADGMWCWG"
FT   CDS_pept        841154..842884
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570439"
FT                   /orf_name="CD36_53250"
FT                   /product="General amino-acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41702.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D952"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ8"
FT                   /transl_table=12
FT                   /translation="MSRKSSIDMPKETSSPECYTSSTSSHEINEKPGKWQNFKDSFKPP
FT                   VPIEDIENGSISSAQLKGGQNVPLQQSLKKRQLQMIALGGCVGSGLLVASGAALRNGPA
FT                   SLLIAWFIVSTFLYCTMQCLAELSSTFPVSGSFAVYSIKFIDPSWGTAMGYNYALFWVI
FT                   VMPLELVASSMTIKFWPSNINTSVWVAVFYVLIIGTNLFGGTRAFGETEFVASVIKLLG
FT                   VVGFNILAIVLICGGGDQGYIGGKNWHPPFTTGVKGVISVLLTATYSLAGTELVGLTSA
FT                   EAAGDARKVLPKAIKQVLWRILIFYLLTLTLVGFLVPASDPQLIGGGSGASASPFVIAI
FT                   REGGIKGLPSVFNVVVLVALLAIANSAVYGFSRTILALAEQGVAPSIFKYVDRQGRPLA
FT                   GIATSAIVGLLSFVSASKQQEQVFDWLVALSGLSTFFTWGSINAAHIRFRIAMKVQGRS
FT                   LDELPYKANTGVLGAYYGLIMNIAVLALQFWLALWPVGGKPDVTYFFKQYLAAVLVLAV
FT                   YLIHKVVTRNWKFMVDYKDMDLDSGRSNIDIDMLKQELEEEREAYKTQPWYYKFYQFWC
FT                   "
FT   CDS_pept        complement(843293..844828)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534595"
FT                   /orf_name="CD36_53260"
FT                   /product="Uncharacterized protein YNL144C, putative "
FT                   /protein_id="CAX41703.1"
FT                   /db_xref="HOGENOM:HBG397388"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192D953"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHQ9"
FT                   /transl_table=12
FT                   /translation="MNVESTISQKQIALPTTMHIQPLQPIPIANTRDIKYTWPEASRSP
FT                   SISSSTSDDEEEDDDDLSLEIVAERSSTPPTPCSSVCHDKFMYTSSCDNYLQYIEPNPV
FT                   SPPSYDTLPPGGCPRFPVSAPSIFPYSAETVCENSDLQPPAYKPAIYKIGVVARKMEWI
FT                   NPNELSPHRSWKYYIIELNSTQLNFYNVPAKYEHQLVTFTPDSLTSQQSFPNYDTNLNS
FT                   LFTCSADHQFYDMVKKMGLIERNSGCSKKGKCLVRSYSLQNSKIGLATDYKKRANVLRM
FT                   RVEEEQMLLNFGNVDEVITWNLSLNVGKDVALDLTERELPKYRTVPRRRRRNRNTENNG
FT                   SSSLLSAIHPNGSLARLRSASDPNKFRGRFSRLKSKLSSAKLSAYNNKHAVEPAAMYSN
FT                   NSLPHSTFYIQLPTPVSTSSSESIDATRSNSVSDFRNVSSTDISETEPHEDDDEDEEDE
FT                   DGGEYDQASVNSVTNVHVEASPSYCYKWSPEKKFDKHKYHRDCLRCIKPLLYN"
FT   CDS_pept        846454..847785
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570440"
FT                   /orf_name="CD36_53270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41704.1"
FT                   /db_xref="HOGENOM:HBG397389"
FT                   /db_xref="UniParc:UPI000192D954"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR0"
FT                   /transl_table=12
FT                   /translation="MDFLYLSLDFATNIVCVGFFFFKRKPIFLTSSKPQKVYSFLFVLN
FT                   IYTSVYLKMYRKSFGENRRTSLEERLDSSMTNESSTTGPRNGEFKPNTNRKVSTEFNSV
FT                   DSKTQQDTFVPSLNQQNQLDDTQSDRFEHQSISPLRKRKSWFTGVLRRRKLSLVNDIQS
FT                   APPVQQQQNAKSKGWLFKSKAETDSTLILNTAQYSNIRSAESDQAELLSTGSVDRNSKS
FT                   NSIQFESRNLEYDDTIPIFFGKYSGSPMCTSVLKNSQIVYFQISAYNRFYDFDEATYHP
FT                   WNIWEVDDDVKKLRGTIDGKDDFTDFAKEFEYCQVLLMRSWLVPNYEIFKNGYLIQLKI
FT                   THKKNDAEKAINLYLSCSRDSIFRKLPEQGVRISVCGIRYFRKTPQLSEVIFWIHPIKN
FT                   MSFSIVEQVVLLLKSFRISTGIHKTILVDLNNGSRSTIKSSYTH"
FT   CDS_pept        complement(848192..848737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570441"
FT                   /orf_name="CD36_53280"
FT                   /product="Coenzyme Q-binding protein, mitochondrial,
FT                   putative"
FT                   /protein_id="CAX41705.1"
FT                   /db_xref="HOGENOM:HBG397391"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="UniParc:UPI000192D955"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR1"
FT                   /transl_table=12
FT                   /translation="MFKRVMLGNVCRIPRRSFFGVSKPQSYEISKILNGTAKQVYDIVS
FT                   QVDQYKTFVPFVEDSFISQRTKDDLPMRAGLLVGWKDIVEKFECDLICVENKEVTAKSL
FT                   QLDLFDNLETIWKFQDHGGNKCKVDFKLAFKFKSPIYDKLSSLFAPQVSEIMIGAFEKR
FT                   LKQIKLNESMKKYQKAKL"
FT   CDS_pept        complement(849140..849457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570442"
FT                   /orf_name="CD36_53290"
FT                   /product="Ribosomal protein, small subunit, putative "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41706.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG610520"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="UniParc:UPI000192D956"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR2"
FT                   /transl_table=12
FT                   /translation="MAPKVQQTKAAKAAAALAGGKKGKKKWNKGKVKDKAQHVVILDQE
FT                   KYDRILKDVPTYKYVSVSVLVDRLKIGGSLARVALRQLEEDGIITPVLKHSKQAIYTRA
FT                   Q"
FT   CDS_pept        850150..852555
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248337" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228914"
FT                   /orf_name="CD36_53300"
FT                   /product="Nucleoporin, putative"
FT                   /biological_process="intracellular transport"
FT                   /protein_id="CAX41707.1"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="HOGENOM:HBG397392"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192D957"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR3"
FT                   /transl_table=12
FT                   /translation="MAKRVADEQITKDGMSNYSDNGPDAPAIASSDVLSRRKILKPKGR
FT                   LGSNSTGTGSNAFGALNGPQQPMFSFGGSGSNAASGITSSQPAQSSNPFNFAKKPESST
FT                   TDKDSKIKALNENFIRAITQLNVPNTIADFTPIAQKYIDYYKSISKNEPSLNIASKEVK
FT                   NPAQPPSASSFQFKPSTASAPSTTATATSFSFKPSAQPSESKLNGPVFSFKSNSQEQTT
FT                   TKPAFSFNPPASSTTGSATTSTPSFTTKPISSSVQNEASKTENKRELINLDSDSDSESD
FT                   KEQPKAKEVKVQGPMFTLTANPTTKSSPFTFDPKKLAKKNAPDSDDSEDDVEIKGPTFQ
FT                   FNKPIQDSVFKLTPNIANNTLKSDEKKEEAKSTPLFGATTQNKDQIATQTSLFGSSQNK
FT                   LEETKAPNVFGDSFGSNGKTTEQKPASSFSFGSFQPKTDASANTETKKPETTLFSSGTT
FT                   NSSSKPLFGSSNNETNAKPAFTFASTTDKKDESATATSSTTTTPSFLFGKQPNQTDGAK
FT                   EAQSDKPATSLFGNSSDNANKSATTGFLFGTQKQEEESQTPKFTFGSSEAKPFAFGVPN
FT                   KQGDSTTPPSFNFGSNSSNSAFSFGSKPAETFKFGEKQEDKKDEASSTLTTSSSSFGST
FT                   KPAFSFTFGSAKSEDKPEEEKNGDTVPEEETGGNFEPVAKLSNEQVDSKSGEENETAKF
FT                   TIRSKLMEYDSKNSENPYTNKGIGELKVLFNEQTKKSRILIRADGSLRVLLNTLILSSV
FT                   KYDSIGNGSLIRVPTIDADDSSRIITYVIKVKTPQDGEQLLKCINELK"
FT   CDS_pept        853128..853634
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381811"
FT                   /orf_name="CD36_53310"
FT                   /product="Histone deacetylase complex subunit, putative "
FT                   /protein_id="CAX41708.1"
FT                   /db_xref="HOGENOM:HBG397393"
FT                   /db_xref="UniParc:UPI000192D958"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR4"
FT                   /transl_table=12
FT                   /translation="MANRNSHKESASESESNTNTHTRHTTGSSSNSKISQKARNQLALQ
FT                   QQQQYLAKHINSNGPQDKPKLQPLDFTTYSDTALLKYSERYGFHNFSRIESLNSDILNS
FT                   EIGKKTYSKRSNKNQKDTGRISKLEIANHVKNHFSSLPAKENDIITGFLYKVKHQDKEF
FT                   KLTFQ"
FT   CDS_pept        854022..854588
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570443"
FT                   /orf_name="CD36_53320"
FT                   /product="Coupling of ubiquitin conjugation to ER
FT                   degradation protein, putative"
FT                   /protein_id="CAX41709.1"
FT                   /db_xref="HOGENOM:HBG397394"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI000192D959"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR5"
FT                   /transl_table=12
FT                   /translation="MDSSTILFIGAVAVAFIFLKWMVSPIPQQNEFNIDRLSQDQSTGS
FT                   TTSSNAQHNRDTHSISTQSHRNSRRAVTESMIEVVQSIAPMLTVEQIRYDLENTGNVEA
FT                   TVNRFMELGDLPFPPGYVRPQQPSSSEEPKKQEVFGRRSVNLLEKYNIDAKNPKNDHNS
FT                   LLHQRRQEMILGARKRLAAQLSNEL"
FT   CDS_pept        complement(854667..856061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570444"
FT                   /orf_name="CD36_53330"
FT                   /product="Chromatin assembly complex subunit, putative
FT                   (Chromatin assembly factor"
FT                   /protein_id="CAX41710.1"
FT                   /db_xref="HOGENOM:HBG715018"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D95A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR6"
FT                   /transl_table=12
FT                   /translation="MEATILTVHWHNDNQPIYSVDFQPEQPELANSSTSMSTESTRLAT
FT                   GGGDNNIRIWRLTSSNSVEYMSTLQKHSQAVNAVRFNPRGDILASAGDDGTLLLWKKSE
FT                   AIVKTLESEDDEDLKESWQVVGTIRSSTAEIMDICWSPNGDQIVTGSMDNILRIYQLEF
FT                   SSGKVSGTIIRSFSDHTHYIQGVFWDPLNKFIVSQSADRSVNVYLISQSESKSIEINLK
FT                   QKFQKFGNLYLYYPETLQSFFRRLAFSPDGSILVTPAGLEETSNNETLNNVLYIYSRAS
FT                   LFTSPIYKITGLSKPAIAVSFNPIRYKLDGTSTLKLPYKLVFAVATQDGVVLYSTRDNF
FT                   KPLGLVSNLHYSSITDLKWTIDGSRIIVSSTDGFCSTINFPDSAFGERYTDGQVSVPHN
FT                   NGILLEEISQAKTESNLESAVSSEIPNENSPNPKNENSQSSTPPIDLFFDKNQKVKKRI
FT                   TPTLIS"
FT   CDS_pept        856999..858525
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570445"
FT                   /orf_name="CD36_53340"
FT                   /product="Vacuolar aminopeptidase, putative "
FT                   /EC_number="3.4.11.22"
FT                   /function="aminopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAX41711.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG630643"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniParc:UPI000192D95B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR7"
FT                   /transl_table=12
FT                   /translation="MDSIFRFQLPDMSATIPRLPSKQEAAPTKNDIFDNYYESYSEKYI
FT                   EFMNNNPTTYHTIGHFKSLLENNGFTFLPDNKPITDLSPGFYFTSKDDQCLVAFIIGGN
FT                   WEPEKGSCFVGSHCDALSVKINPRGSLRDSVNGYELLGVAPYSGSLNKLWLNRDLGLAG
FT                   SILVRDYKTGKIFRKLIKSHPDPIAFIPQLPEVFPGSPKEYNTQTEMVPIYGYTTENLV
FT                   PTDEEKQSKFFNRHSLALLRYVSKLAEVPLASIVDLDLDLVDIQPSCRGGLGNEFIYSG
FT                   SLDDRLCAFASVYGLIEYSQRFYLDKDIETFDGLNGIYLANHEEIGSESRTGAKGGFLI
FT                   DILKSSVSDKHQTHTPEAIANLTTNTIFLSSDVTHALNPNFKNVYLENNFPVPNTGPSI
FT                   KFDSNYHVLSDSKGNEFLTRIIDDLSGIKLQHFHIRNDSRSGGTIGPIMSDSRRGINGA
FT                   KLIIDVGLPILSMHSIRSIAGYKDVGIGIRFFKEVFSKWKSTIDIMENRE"
FT   CDS_pept        858863..860329
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20228915"
FT                   /orf_name="CD36_53350"
FT                   /product="DnaJ family chaperone protein, mitochondrial,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41712.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000192D95C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR8"
FT                   /transl_table=12
FT                   /translation="MRIASARFVRTGLRSFKPRTFASGRLPYTYVATRAFHSSRIRAID
FT                   FDPYKTLGVDKSADDKQIKKAYYDLVKKYHPDVNKEKDAEKRFHKIQESYELLRDKEKR
FT                   AQYDQFGASAFDANGNANPFAGQRGNPFGGFGGASAGGNPFSSMGFDFEDLFREAFAGG
FT                   RGAGGGGRGGRSFVTEHVGDNIEVLKTIPFKDSIFGTSVTINYKAVDSCTTCSGSGLKS
FT                   GAKKNTCPTCHGAGQTTHVMGGFHMSSTCPTCQGAGVTISKSDECGTCHGHGVKEIPKS
FT                   KTVEIPAGVSDGTRIRIPGAGDAPMVTKDPYNQLVNGDLIIRINVQKDPIFSRNKNDLV
FT                   INEEILMTTAALGGEIVVPTLDGQKIKLKVRPGVQNGRKLTIPEKGVPINRNLNNRGNL
FT                   EVILNVKTVVPETPTQKALLEALADTFNDKNAKRTDADWSLDIEDDKNGKINETFDESD
FT                   LHPSKLKRIGKVLGKFFNFEQNDKDTKNNK"
FT   CDS_pept        861102..862790
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570446"
FT                   /gene_name="HEX1"
FT                   /orf_name="CD36_53360"
FT                   /product="Beta-hexosaminidase, putative "
FT                   /EC_number="3.2.1.52"
FT                   /function="beta-N-acetylhexosaminidase activity "
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41713.1"
FT                   /db_xref="GO:0004563"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG591688"
FT                   /db_xref="InterPro:IPR001540"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192D95D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHR9"
FT                   /transl_table=12
FT                   /translation="MVFDKMIVFHLLLWLCNAIIHAAKVDILPAPQSIIWENDTAIIIN
FT                   PRLLRENTSCSLLEDAFSRTVSAIEKSKWRPFPIDDFENANGKDIKTSLVDIQVDDVTV
FT                   DLQLGVNESYTLKINSNGIKIHAATIWGALHGLVSLQQLIVYTCDDKYVVPSSVTISDF
FT                   PKFKHRGLMIDSGRNFLTVDSILEQIDIMSLSKMNSLHWHLVDSQSWPVALESYPHMIK
FT                   DAYSNDEVYSKNDLKYIVDYARSRGVRVIPEIDMPGHARAGWKQVDPTIVECADAFWSD
FT                   AAVEPPPGQLNIESEKTYEVISNVYNELSDIFVDDVFHVGNDELQEKCYSAQLSPNNTV
FT                   TDLLRRYLKKTLPIFNKINHRKLTMWDDVLLSDVSVDNIPSNITLQVWHEIGGVKNLTS
FT                   RGYDVVVSSSDFLYLDCGYAGWVTNDPRYVEIPENIDFNTGQGGSWCGPYKSYQRIYNF
FT                   DFTANLTEAEKEHVLGAEAALWSEQVDSTVLTTKIWPRTTALAELTWSGNKDRKGHHRG
FT                   YEFTQRILNFREYLIKLGYNVSPLVPKYCLLNPHACDLYKTPPVY"
FT   CDS_pept        863457..864455
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19381812"
FT                   /orf_name="CD36_53370"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transferase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAX41714.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397395"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI000192D95E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS0"
FT                   /transl_table=12
FT                   /translation="MQIDINKLIQPTEAYVPESSDPIVQPYTYISETPSNNQNVRTRFL
FT                   HAFNDLFYKISDESLLTKISEIISVFHNSSLLIDDIEDDSKYRRGVPVAHVKYGIPSTL
FT                   NCGNLMYFVALQQAQQLSGPHGSMEIKFKSSQILIDELLNLHRGQGLDIYWRDYLKKLE
FT                   KLPDVEEYLEMIKDKTGGLFRLAIKLLSLYSDIKENDQLISLANLMGILYQVRDDYLNL
FT                   VDAKYSAMKGTICEDLIEGKLSLPILHCLRTTKDSPVHKILYDYDSSSDRMSQNTLIDL
FT                   SLSFMKNESKSLEYTLNLIKVLEKKLRHLILKYPESENSALLKIVERLCDL"
FT   CDS_pept        complement(864452..865075)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094219" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534596"
FT                   /orf_name="CD36_53380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41715.1"
FT                   /db_xref="HOGENOM:HBG397397"
FT                   /db_xref="UniParc:UPI000192D95F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS1"
FT                   /transl_table=12
FT                   /translation="MFSSSSARPPTNMTTRSGKRTNNTIIRKSLRIQAKLQKKNAEHDL
FT                   DVKRYQELLKKNLENDIPPKRVKGKKKASGKPDDQNVSAPLMLPQRPKFTSTQKANEEI
FT                   KSNYSNTDALPPSLMQARTKSFENRVQLQYTYPELIKLINDNLSRNTIDISLVHNFAPK
FT                   NLELEQQRFAIPSNFYKQTNYSSSITDEIEFFFCETIKNELPLV"
FT   CDS_pept        865174..866073
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17570447"
FT                   /orf_name="CD36_53440"
FT                   /product="Diphthine synthase, putative "
FT                   /EC_number="2.1.1.98"
FT                   /function="diphthine synthase activity"
FT                   /biological_process="peptidyl-diphthamide biosynthetic
FT                   process from peptidyl-histidine"
FT                   /protein_id="CAX41716.1"
FT                   /db_xref="GO:0004164"
FT                   /db_xref="GO:0017183"
FT                   /db_xref="HOGENOM:HBG460511"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniParc:UPI000192D960"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS2"
FT                   /transl_table=12
FT                   /translation="MLYLIGLGLSYETDITVRGLETVKKCKRVYLEAYTSILMAANQES
FT                   LEKFYGREIILADRELVETGSDDILKDADKEDVAFLVVGDPFGATTHTDLVIRARELGI
FT                   KVESIHNASVMNAVGACGLQLYQFGQTVSLVFFTDTWKPDSFYGKIMENRKIGLHTLLL
FT                   LDIKVKEQSIENMARGRLIYEPPRYMDIATAAQQLLEIESMRQEQAYTPNTPCVAISRL
FT                   GSPTQTFKAGTLQELSEYESGEPLHSLVMLGRQVHELELEYLYQFVDDKEKFKKVVEED
FT                   QEYFKPAPYVPPEDVDCE"
FT   CDS_pept        complement(866225..867469)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571418"
FT                   /orf_name="CD36_53400"
FT                   /product="Esterase/lipase, putative "
FT                   /protein_id="CAX41717.1"
FT                   /db_xref="HOGENOM:HBG396385"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI000192DA17"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS3"
FT                   /transl_table=12
FT                   /translation="MLSFKGWKILLSIPIKLLSVLLKYPFSGGVNKKFQYDLLNSLKLI
FT                   LYRTALHMPVRESALLSIMSNHFILNILIKTLYPTLTKLPNYGKKYDKQSYWLVKSRDR
FT                   KPSDPILIFLHGGGYFFETMPCQIESLLSIYHVLDAPKKSNLSILVLDYKLASRGYKIP
FT                   YQLTQLIETYINLVNDGNTNMMLMGDSAGGNLALTFLQHLRLDHVNLPYPTSTILISPW
FT                   VKLAPDAIQNTPGYSYYDNTPVDMIQVDFFRDVEKQNAILGDIEHTELTISPGNCLYRH
FT                   EDWEDIPSLVEPGHSVFVIVGEHECFRDDVLEWCHFALKSPLISQRDDSKGIFNPKIHE
FT                   YIRNTDNFAYVEVVVEPWGVHDSVLYFENTIISKVKKNPKLKVNSLNSHEYFGFIKLAN
FT                   FLNNVLPGSSQPKSV"
FT   CDS_pept        complement(868421..870793)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571419"
FT                   /orf_name="CD36_53410"
FT                   /product="Zinc cluster transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41718.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397122"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192DA18"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS4"
FT                   /transl_table=12
FT                   /translation="MSAPAVEIIKVPKKRNRRIPDDQRQKVSSACDNCKKRKFKCSGEK
FT                   PCFECSKKGYDCTYTIIDKRSLRGERMAKLKQKKDNDEKQRESLNEQFTQSSNVQPHIN
FT                   PALPISEYANLVYQSSRHSPVSGNDGHYSMYHLPSQSSIPQSLPTIVLPDPIKDARSRG
FT                   ILTPGSTPNSVSSESSASSVCVPKSLQPLLSFPLENNNNLRHKSEEPEMDNNAINVSKK
FT                   GGISNQDGKSAILLVDKSGIFRYMGETSPLSVLYEARGIFYEYVGSTKLTEDLRGCPVI
FT                   DKPLKITLKEVVPLPPPNERDVYIEQFKVNINGAYFMFDIDRFYEDIVDKVYQNPNSEA
FT                   VQESRVLLYFVLAIGSTYKDFSEKNPQAEKGALYFQSGRLILRDLVEDSAMWCVLCHYL
FT                   QFHYYESILKKSTALSHLSMAINYAQSLGLHRNFVNEQFSKITSEYEYRKKLFRSLYIS
FT                   DRISSVFIGRPLIINDYDWDDPARFKRSDASGVPVDFNSKCHIELTRICTLVGRIVANF
FT                   YQDKMIDVKKTKNLAIQLRLWLKSLDPDLAFNNILKPSELSNNEDNANTVILLGIHVLH
FT                   LWAIMLLSRPFFMFEAVSKLNPEMRKSFEEEELSKQLCQAATKASILAIKLMTHYINTT
FT                   FHEMKRMECYVIITCCFYASIILGITILSGTSEDAGYTENDLMNSLKDAQYIMSQFSVC
FT                   NKGAERYSEINRDLISALINRHKSKELKPVLDNWSCDLFTDFSFMDRSGQNDVQTMMEF
FT                   QQFFVSSDLIQFEEINDGSSCLPFDYNNYNLFFGDKL"
FT   CDS_pept        872945..873805
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571420"
FT                   /orf_name="CD36_53420"
FT                   /product="Aldolase, putative"
FT                   /EC_number="4.1.2.17"
FT                   /function="L-fuculose-phosphate aldolase activity "
FT                   /function="metal ion binding"
FT                   /protein_id="CAX41719.1"
FT                   /db_xref="GO:0008738"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG289811"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniParc:UPI000192DA19"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS5"
FT                   /transl_table=12
FT                   /translation="MSPTSTTQQPVTSRGYEIGTRGSHNIAKGGKHPYQIPKFTDKKEE
FT                   RKWMLQHMAGAFRVFARKGYTEGTAGHISIRDPIDPNTFWINPLGKHFGLLKASDMVHV
FT                   DHEGNILPDGSQIAINAAGFSIHSALHHARPDVHAACHTHSVYGKAWSAMGKPLEMINQ
FT                   DVCTFYKSHAVYEDFGGVALEAEEGTHIAEALGDGKGVILQNHGLLTVGNTVDEAAYLF
FT                   TLLEKSCQVQLAAQAALVPGEKFKIIGDEEAAYCERNDGDPETLYTEFQPDFEMEVYLN
FT                   DDFLK"
FT   CDS_pept        874594..875991
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571421"
FT                   /orf_name="CD36_53430"
FT                   /product="Esterase/lipase, putative "
FT                   /protein_id="CAX41720.1"
FT                   /db_xref="HOGENOM:HBG396385"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI000192DA1A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS6"
FT                   /transl_table=12
FT                   /translation="MSLSRYTYKTNASSFGIVSKPNFYSKSNDYFFYAIAFSLSLIREF
FT                   IVKKMISIQGLVILLSIPIKLLIVLLKYPFVGGINPKFRNSLIGSFKMTVYKTALSIPV
FT                   KDSGFLSIMSNYFIINKLIKTLYPTLTTLPNYGKKYDKQSYWLVESKDRKPSDPVLIFL
FT                   HGGGYFIQTMPSQIESLLSIYHLLEEPQKKKLSILVLDYKLASHGHKIPYQLTELIDTY
FT                   TNLVKDGSKNILLMGDSAGGNLALIFLQALKIDKLNLPYPSSVLLISPWVKLAADNIQN
FT                   TPGHSYYDNAAYDMIPFNSHASEVLEYLLEDSRVYSLTISPGNCPYHETDWKDIPTLNH
FT                   PGYSVFVIAGEHECFRDDVLEWANHALQSPLTPQKGDSQGRFNPKTHEYIRDIPETAYA
FT                   EVVVEPWGVHDSVLYFENSIISLLKNNPRLNVKSLNKVEYFGITKIVGFLNKTLSSEEK
FT                   KGVKPLL"
FT   CDS_pept        complement(876396..877295)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571422"
FT                   /orf_name="CD36_53440"
FT                   /product="Diphthine synthase, putative "
FT                   /EC_number="2.1.1.98"
FT                   /function="diphthine synthase activity"
FT                   /biological_process="peptidyl-diphthamide biosynthetic
FT                   process from peptidyl-histidine"
FT                   /protein_id="CAX41721.1"
FT                   /db_xref="GO:0004164"
FT                   /db_xref="GO:0017183"
FT                   /db_xref="HOGENOM:HBG460511"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniParc:UPI000192D960"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS2"
FT                   /transl_table=12
FT                   /translation="MLYLIGLGLSYETDITVRGLETVKKCKRVYLEAYTSILMAANQES
FT                   LEKFYGREIILADRELVETGSDDILKDADKEDVAFLVVGDPFGATTHTDLVIRARELGI
FT                   KVESIHNASVMNAVGACGLQLYQFGQTVSLVFFTDTWKPDSFYGKIMENRKIGLHTLLL
FT                   LDIKVKEQSIENMARGRLIYEPPRYMDIATAAQQLLEIESMRQEQAYTPNTPCVAISRL
FT                   GSPTQTFKAGTLQELSEYESGEPLHSLVMLGRQVHELELEYLYQFVDDKEKFKKVVEED
FT                   QEYFKPAPYVPPEDVDCE"
FT   CDS_pept        complement(877641..878525)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167385" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571423"
FT                   /orf_name="CD36_53450"
FT                   /product="Phytanoyl-CoA dioxygenase family protein,
FT                   putative"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="CAX41722.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG328178"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000192DA1B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS8"
FT                   /transl_table=12
FT                   /translation="MPAKLSNKYHDEIEQNGFTVVRNFLSPQEIEKYTKASEALVQYAR
FT                   DGNWPHVRTRGKQFPPWPKNFSPDIWGVSGLLHPDLGELSKPFHDLYSDEKLLDVVCDI
FT                   LLIEKTDLSMELLNMLINPLTDFELDWHRDTIKPEVTVEEEAQDLLKFPYAGAQFNLAL
FT                   TEDDCLIAIPGSHNRVRTTEEREKTIDPNRRKEFITGEIRVELHPGDLVFYNNNILHRA
FT                   AYSSKNKRLTLHGSYGNVNQGRSRAKGILQHGVAEWLPRLQTDNANLKMLQEKLLKLAK
FT                   EFEGVELGYALDG"
FT   CDS_pept        879332..880174
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248175" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534838"
FT                   /orf_name="CD36_53460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41723.1"
FT                   /db_xref="HOGENOM:HBG396387"
FT                   /db_xref="UniParc:UPI000192DA1C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHS9"
FT                   /transl_table=12
FT                   /translation="MSNESLSKASIRKINDNAVTISTPYTVFRILNFGSRMSLINFDGN
FT                   IVIYSPIKYDQEVFDKAIKILFENQENPQYEVKYVIAANDEHNLWAHVYKEKFGSKIIA
FT                   GENCKLKNNCKADYIVTPQIYNKVIKGSMWQEELNVSDPFMQNLELIGLGNHVIHDLEL
FT                   FDTTTKTLYVGDSVYNLGVPGTTSGNVILEQYSPELGYAKGYNPHGWFSFLTRYLQPDS
FT                   AVCRYLANYAAGTKTEQGRQAIQSVYNWDFDKLVMIHGNVIEKDGKDAWKKLFSTSLV"
FT   CDS_pept        880711..881532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248175" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229171"
FT                   /orf_name="CD36_53470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41724.1"
FT                   /db_xref="HOGENOM:HBG396387"
FT                   /db_xref="UniParc:UPI000192DA1D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT0"
FT                   /transl_table=12
FT                   /translation="MGYPSPLKVVTKKISANVLTVSSPFSILNKLNVGARMVIFHYHGD
FT                   IIIWSPLPYDKEILENAIAQLTTKEYTVKYIFVINIEHNLCAEKYKEIYPTVKLIGPEN
FT                   TSRCEISIPLTEDNALKIIKGTAGWGNLGISNKSIVDNFELIYNNAHKNRELVIYEKND
FT                   KLLLLADMIMNLGIHGTTTGEYVLEQYSPELGFPEGFNPHGGWSFLSRYLQPNSIVGKF
FT                   LMNRLQKTRQTPEKTKKVMELINSWDYTTIIMVHGDLITKEAKQTLSNVHL"
FT   CDS_pept        884801..885223
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571424"
FT                   /orf_name="CD36_53480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41725.1"
FT                   /db_xref="HOGENOM:HBG397398"
FT                   /db_xref="UniParc:UPI000192DA1E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT1"
FT                   /transl_table=12
FT                   /translation="MSSSSSALPSELVLDATASTTATVTPSLTDLQLATGIRAEKNSQA
FT                   TIASDSVQTISASVTSQLVYASVSSQLTNAIGSFTASSDVKALTLSSASSSSKSSGSSN
FT                   ASASVNSNSGNSIDLKKIKYGIILSSITVLSFVCSF"
FT   CDS_pept        complement(885902..888778)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534839"
FT                   /orf_name="CD36_53490"
FT                   /product="mRNA transport regulator, putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /function="receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAX41726.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG325346"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DA1F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT2"
FT                   /transl_table=12
FT                   /translation="MSSGTIAQLNSALVTMYSNVPQQEKMTATHYLEEFQKSQQAWDIV
FT                   HQILNNDDDNANIQLKVFAAQTLRSKIIYDLSAQFPESNFENLKNSLLDILGKYTAPNQ
FT                   KLIRTQLSIALSHFALQYLSWRNALSEIINKLSSSETLLPVLLEFLKILPEELSDVKKT
FT                   NLTDSEFNQRTQELISDNVEQVMMILKNLTESNTSNNASLNSSILDCLNGWIKECAVEQ
FT                   VLQVNSLVSLVFQSLSNDQTFEKAIECLVTIIRETRDIDNYEIIDALYQQVLQLNKYMH
FT                   ENTPEKLEDPDYMDGLTRLYVECGESWHVLIGKNPAHFKPLVLIILECTKYEEDLDIVK
FT                   YTFQFWYQLKQLITLPKFQESKVEFSDIYLQLITVIIKHLTYPISSNDNDLFNGDKEQE
FT                   DKFKEFRYEMGDVLKDCCAVAGATKALQVPFEQIQNIISNSQGQWQYLEAPLFSMRTMA
FT                   KEVPLKEKTILPTIMSYLVQLPEHPKIRYAATLVLGRYTEWTSKHPEFLEPQLNYITKG
FT                   FEVADKNNDIIMATSHALMYFCQDCSALLVNYLEQLYMLYGQVKDQMDLESNYELADGL
FT                   AHVIAKVPEANLYKTTEMFIEPTMNYLTKVLTETATDEINKLIADQIEVISIFIEVLKC
FT                   PDSDWEKPKYPVADLFVDKIWPLTTQILSKFGSSVIVSERCMKLLKNAIKSFGLFLSGI
FT                   LPDLANLLHQGLQSTQFGCYIWVTGVLIREFGDEYSTEAIKNAVYEFGLQQSLTVFDLL
FT                   FSKNEQQLKQIPDVIEDFFHMINDLLMFYPFQLIPKFDILKNIFKVVDLTLSYVNEFEP
FT                   IISCIHFMIDLISWGLPHPPISLFDMGDTTSLREAVQQFLLIDNQGGELLRVTLNGILF
FT                   KFHNDIQQDANDLILKILIVVPNNDIALGWLKQVVEALPNVNEKETGRLLNTVKVALPN
FT                   KDNRRVRSALRDFINWYSRRNVTPRSEF"
FT   CDS_pept        complement(889185..890324)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000136703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571425"
FT                   /orf_name="CD36_53500"
FT                   /product="Formate dehydrogenase, putative "
FT                   /EC_number="1.2.1.2"
FT                   /function="NAD or NADH binding"
FT                   /function="formate dehydrogenase activity"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41727.1"
FT                   /db_xref="GO:0008863"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328050"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192DA20"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT3"
FT                   /transl_table=12
FT                   /translation="MGKPKVLMALYSGGKHAKEEPRLLGTVENELGIRKLVEEHGYELV
FT                   TTADKDPFPSSTFDKNLPDAEIIITTPFFPAYVTKERIAKAPKLKLCVTAGVGSDHYDL
FT                   NALNERGIAVLEVTGSNVQSVAEHAIMTMLILLRNYGEGHAQATQGTWDIAAVAKDEFD
FT                   MEDKVFATIGAGRIGYRILERLIAFNPKKLLYYDYQPLPEEAINKLNAASKLFNGVDNI
FT                   IERVENLEDLVSQADVVTLNCPLYEKSKGMFNKELISKMKKGSYVINTARGALTDPQAI
FT                   ADAVNSGHIAYGGDVWPVQPAPKDMPWRTMHNPYGKDYGNAMTVHVSGTSLDAQARYAN
FT                   GVKQILTEYFDKTYKYRPQDVICIDGHYATKAYGQRTTK"
FT   CDS_pept        complement(891601..>892107)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200788" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571426"
FT                   /orf_name="CD36_53510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41728.2"
FT                   /db_xref="HOGENOM:HBG397399"
FT                   /db_xref="UniParc:UPI000192DA21"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT4"
FT                   /transl_table=12
FT                   /translation="IPISSLLDASPVNEITDNSDSIDEIGLLPDHVRYEILYYFNIKDG
FT                   EPTLRDGYSRKNNGYVEINFLTGDHYDPSLDTYVAETSGYNKRTNVGLSRTRFNKHRIG
FT                   YQYNRSGFDDISKCKTMDTGPITIKMADLLPSLTDMSETPSNVSSSSYRETHKRKREED
FT                   TLENN"
FT   CDS_pept        892728..893300
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571427"
FT                   /orf_name="CD36_53520"
FT                   /product="Guanylate kinase, putative "
FT                   /EC_number="2.7.4.8"
FT                   /function="ATP binding"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41729.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="HOGENOM:HBG671982"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="UniParc:UPI000192DA22"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT5"
FT                   /transl_table=12
FT                   /translation="MSSSANRPIVISGPSGTGKSTLLKKLFAEYPDRFGFSVSNTTRKP
FT                   RPGEVDGKDYNFSTVEEFKKLIDENKFIEWAQFSGNYYGTTIKAVKDVAEQGRTCLLDI
FT                   DMQGVKSVKKTDLNARYLFISPPSIEELKSRLTGRGTETEDSLQKRIAAASDEMEYAQT
FT                   GAHDKIIVNDDLDKAYAEFKKFIVDEQ"
FT   CDS_pept        join(893665..893708,893825..894248)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248375" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571428"
FT                   /gene_name="AIM31"
FT                   /orf_name="CD36_53530"
FT                   /product="Altered inheritance of mitochondria protein 31,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAX41730.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG745170"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniParc:UPI000192DA23"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WHT6"
FT                   /transl_table=12
FT                   /translation="MSVRLPSSMSYGEEEEPDVLQKMWEKSKQQPFVPLGSLLTAGAVL
FT                   LAARSMKRGEKLKTQRYFRYRIGFQLATLVALVGGGFYYGTETSEHKQIREDKLREKAK
FT                   QREKLWIEELERRDSIIQARKQRLEESKKELRELAKQGFIEEKESNDEKED"
FT   CDS_pept        complement(894416..895108)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077802"
FT                   /orf_name="CD36_53540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41731.1"
FT                   /db_xref="HOGENOM:HBG397400"
FT                   /db_xref="UniParc:UPI000192DA24"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT7"
FT                   /transl_table=12
FT                   /translation="MYANQRLSMFQSHLDHKQKRTIPSFPFSSIEEQEKYEVSKSLNHV
FT                   TTLKSTNLRVLPSPSPSVYSLGIGSNFSTDSVQQQERPSPPPPRRLISKLPITPISPTP
FT                   EPDAVETKLVLNDVVKDFHNGKVLCLSKDDDEEKIEIDNDSVIYDTINEISEDKFTTNY
FT                   DAIILNKLGQESSYEISTYLKNLHNDTVVVIRDEFEIDNDNNNNEKLDFDFYVDLENSV
FT                   IVDITKRK"
FT   CDS_pept        complement(895599..897845)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229172"
FT                   /orf_name="CD36_53550"
FT                   /product="Clathrin-coated vesicle protein, putative "
FT                   /function="binding"
FT                   /protein_id="CAX41732.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG735608"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI000192DAD5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT8"
FT                   /transl_table=12
FT                   /translation="MLPPTLSSIPEVKEEYPGACLIERTARLPQFIELGPPDLCNIHKY
FT                   SVNAKRENEIGTFLYFTGVDTSNTASIAAHLQNIANLMTNKSQYWFGEKKHWKVPELTY
FT                   CTFNAFSKIDLRVTVHIPGKFEMQIIGQDGKLINDKLTDEELDKLWSETFLTSIVRAVL
FT                   ESEDGDEVNKVGGLVEVRKINPFNNGITSKELLNNFLLAFEQLFFQGVKLGCNVEIPQP
FT                   TIINNYLVDGFIKVIQLTQSYDRGIEVLQKLHKVEPSVISLIAKLQLLKQDEIEAVKTM
FT                   NQGIQENRRDSDLLVLQAEFCLEKKKPELALELAKQAVKSSPSDFKTWAILVQIYTKLG
FT                   DFENALLTLNSCPMNSHKEKYFLKRVVPIKSNDDLHLPSPTDVTLDQVSNLQSNEISYE
FT                   QRNLDPSLVNLPAGNLKSTFAKAYDLLTEIVVKTGWESLLKYRAKVFVMEEEYRKDRQS
FT                   SATGVGVGVNGSQTRKNSTTSTANNGTEAPPTTSATANTTSPPDSDAASTVAIKSPGPS
FT                   NDTEDTTSNVSYDDEFRKKRLCERWLDNLFMLLYEDLRAYTMWQAESLHFQAQQMEYKK
FT                   TTLEWEILGSIAFRLKHFKEGSIAFANALSGRFSAKSQRELLKYYLMERSKLLSKNSSN
FT                   QSSTFIHSYTKMMNQLNEKILESIIKLLVWNHRWYSDFSSFLLLTLSDLVAWEGSVKIN
FT                   SSVTALYSEAKTSSSSTSTSNTSNDHISNHGIIEMMTDLDNDYIKLYNLHNADE"
FT   CDS_pept        complement(898177..898878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571429"
FT                   /orf_name="CD36_53560"
FT                   /product="Transcription initiation factor TFIID subunit,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="CAX41733.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="HOGENOM:HBG320253"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000192DAD6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHT9"
FT                   /transl_table=12
FT                   /translation="MSVPAPEDIRPSTSNGDQSIKDTNKPAASTSVSTNAPPPPPTSST
FT                   TNNNNNNNNNNNNNNNNDNTQASQQPQEKKEKIIPRDVRLLHLIFATHAVHNYQDHVPL
FT                   QLMDFAHRYTKSVLKDALVYNDHSKPINTNTNLNSNTNATVNTDDIRLAIAARSNYQFK
FT                   PVPPKELLLELAQERNSRPLPPVIPRWGLNLPPEKYCLTAKDWDSIYDEPDEDNVNNQS
FT                   SQQKNKKLKTK"
FT   CDS_pept        899104..900093
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248374" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229173"
FT                   /orf_name="CD36_53570"
FT                   /product="Thiamine pyrophosphokinase, putative "
FT                   /EC_number="2.7.6.2"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="thiamine diphosphokinase activity"
FT                   /biological_process="thiamine diphosphate biosynthetic
FT                   process"
FT                   /biological_process="thiamine metabolic process "
FT                   /protein_id="CAX41734.1"
FT                   /db_xref="GO:0004788"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006772"
FT                   /db_xref="GO:0009229"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG397401"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR016966"
FT                   /db_xref="UniParc:UPI000192DAD7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU0"
FT                   /transl_table=12
FT                   /translation="MGTMSQESALIEQVIEQPDSLVISPPSDLSSYNHIQPFVYLEGDN
FT                   DNDSKTTTSQTNHNVLLILNQKITIDLISLWNKCEIIVCADGGADSLYEYFSNNNNNHH
FT                   HPNLQRSDYIPDYIVGDFDSISPDVKAYYQSHGSKTIRQSSEYYNDFTKSIHCIQLHYQ
FT                   LNHENGNWFESVNNVDGLAKLWDSLDHTNRGIDITIYVLNAIGGRFDQTVQSINQLYIM
FT                   NKIYPTVTVFFITVNDIIFLLKKGVNYVSFTNRLTFHKDDGLPPTCGLLPLSNSTPIVL
FT                   TSYGLKYDMRNWKTEMSGKVSSSNRISGETGFIVECSDDIVMNIEIDV"
FT   CDS_pept        900452..900820
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229174"
FT                   /orf_name="CD36_53580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41735.1"
FT                   /db_xref="HOGENOM:HBG397402"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniParc:UPI000192DAD8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU1"
FT                   /transl_table=12
FT                   /translation="MLRSILRFPPKLTIGVSVFKQFASTTTTATTTISRTVFQRPTILA
FT                   STSTTSNSLLFQYNRPHTVNFQSFIEQKEYDLDTVEDDDSNTMHALSVLRKRRLKMKKH
FT                   KYKKRRKAQRALRKRLGK"
FT   CDS_pept        901164..901769
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229175"
FT                   /orf_name="CD36_53590"
FT                   /product="Deoxyribonucleoside triphosphate
FT                   pyrophosphohydrolase, putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41736.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG697237"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI000192DAD9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU2"
FT                   /transl_table=12
FT                   /translation="MSTITFVTGNANKLKEVIAILATSGTDSSSSSSSESSNKVGKFTI
FT                   TNQSVDLDEVQGTIEQVTIHKAQAAAKVINGPVLVEDTCLGFNAYNDLPGPYIKWFVQS
FT                   IGLSGLVKMLIGFEDKSAKAICTFGYCEGPGNEVKIFQGITKGKIVESRGPTNFGWDSV
FT                   FQPNGFEQTYAEMDKKVKNSISHRYKALDKVRDYLLSQ"
FT   CDS_pept        complement(901925..902674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571430"
FT                   /orf_name="CD36_53600"
FT                   /product="Uncharacterized protein ydl173w homologue,
FT                   putative"
FT                   /protein_id="CAX41737.1"
FT                   /db_xref="HOGENOM:HBG397403"
FT                   /db_xref="InterPro:IPR022024"
FT                   /db_xref="UniParc:UPI000192DADA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU3"
FT                   /transl_table=12
FT                   /translation="MPFTTHLPTVFIILFFSFPKSSFPSFLSFLFTTSLLYHHISISFS
FT                   IMAYSTGRGGAGNIHSNKNKTSENNVLTPQKSKTFSPQQSNDDGTPLQKVTSQNKRVYY
FT                   STGRGGAGNIKTSDQLPSPTLIPQGSNTPHLHTAKVSTGRGGYGNMVNNDDPELTRKLQ
FT                   DVDGEPASPKDDLYAITSNKSFSVGRGGFGNVISKSRSTDSQKDGNGGGSGGNGAIVPE
FT                   LYTVTSQPEKKVKKKHGFLGKIKEIFT"
FT   CDS_pept        complement(903472..905982)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534840"
FT                   /orf_name="CD36_53610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41738.1"
FT                   /db_xref="HOGENOM:HBG397404"
FT                   /db_xref="UniParc:UPI000192DADB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU4"
FT                   /transl_table=12
FT                   /translation="MSTTTNKLIYKSINQDQKIQSNEIKRNGKLSLPISSTIHPYLSKQ
FT                   SRTCPSQLHDKMSLIPKIPRNKQLLSSSSSSSYQNPQSLHKISQDDSFSFINFNEFEFS
FT                   QRGTLLKSKTRTSNQFFLTKNPNPNHIYNNPNFHNQNNDNNNNNSGSSDTINNDITTTS
FT                   NNNNNFETNDCSIFSTLEENQKRIDTTTSTTTINNNNNISNELVDTLSIVSSNLIVDDK
FT                   YRLNIISDDASFQPSHGNFFHTATTTSTNNNNNNNNNNNNINNGTITTTISTAGGNVGN
FT                   SMITPTESTKVVVGKKLIDRLHHSLIDYTSDHVSIEQGSIDSSIESRESYDCKFNIHHH
FT                   HNYKEKEEEEEEEEEEGGEFGNNKCYQNIIHHNGIQYNNTGNNIVDNEIPPSPSISSPS
FT                   SSYMQDQPSLDLLLLSPQKSPIITSHHHHQQQKYKRKLPTTTATTTTTTTPRVSKLSLL
FT                   DSPNPMIPTISSKFSSTILIDDPMTINNNLMTNAIYQSKLIDHQHHQHHHQQQQEEDCQ
FT                   WEPFQESSATTTTSSSTRTISIASKHGSLTNVIQLMKKKVRHLYNNVVHNKVSKKKELI
FT                   SEISKIDDKSNTSRKDKTEIFEMKSVISDDDHEMKSNIGTIITTTTQNKKKKKKKIKNN
FT                   NTINIENHYTTTTTNNSNNNNNNPKLTEFRSSSSFNTTLNRNIITGINHDNMSSNGSII
FT                   NEGYDKDEQLTGALLYIISEYPQEEEEEEEEEEEVGEVQQNHTIKSKETLPHDEDRLMG
FT                   KLEESSNDGDDEQSNSNLHSIESFHNQQQQQPQEVREQMMREEENDTEKEQQEDFYDNN
FT                   DSNTSLENFYGLDNEFLFNSITIK"
FT   CDS_pept        911591..911848
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571431"
FT                   /gene_name="CSU51"
FT                   /orf_name="CD36_53620"
FT                   /product="Regulator of sorbose utilization, putative "
FT                   /protein_id="CAX41739.1"
FT                   /db_xref="UniParc:UPI000192DADC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU5"
FT                   /transl_table=12
FT                   /translation="MQFTKVIASLALVASINAKFHNTTGAAAGNGTVAGGSNSTGGGAA
FT                   SNHSGAAANGSSSKTSGSGAAVNSVTGLAALAAVGAALLY"
FT   CDS_pept        complement(912606..913112)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094226" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534841"
FT                   /orf_name="CD36_53630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41740.1"
FT                   /db_xref="HOGENOM:HBG397406"
FT                   /db_xref="UniParc:UPI000192DADD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU6"
FT                   /transl_table=12
FT                   /translation="MYRVKPTLSCTMNDNLNSSIYSSFKQSSTLLTNTNEQLDKLWNLL
FT                   VKFDKISISSIDINIEENDDTTNTTTTTTRVDQFISIEKFYKLLINYHKLIELITIKNN
FT                   ELTIMKFQCFQIIRNVQQQEQLNSKNNNFDTLSTTTSTISSSLNETGKKLQDIFNPKEE
FT                   FDSTL"
FT   CDS_pept        complement(913328..913921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382067"
FT                   /orf_name="CD36_53640"
FT                   /product="rRNA-processing protein,putative "
FT                   /protein_id="CAX41741.1"
FT                   /db_xref="HOGENOM:HBG499799"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI000192DADE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU7"
FT                   /transl_table=12
FT                   /translation="MGKAKKTRKFAAVKRTLNTKKDQRLTQNNNNNNNNNNTTTKKSDD
FT                   PELTRSIPQVSSALFFKYNESIKPPYQILIDTNFINFSIQKKIDIIRGLMDCLMAKCIP
FT                   IITDCVIGELEKLGSKYKIALKLAKDPRIQRLKCSHKGIYADDCLVNRVIQHKCYIVAT
FT                   NDADLKRRIRKIPGIPIMSVGGHSYVIERLPDVF"
FT   CDS_pept        complement(914336..916138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534842"
FT                   /orf_name="CD36_53650"
FT                   /product="Phosphatase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41742.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG398551"
FT                   /db_xref="UniParc:UPI000192DADF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU8"
FT                   /transl_table=12
FT                   /translation="MSSIKQSRPKSIFNILMMFNKQYKKLILLLIGFITLTFMIHIFNS
FT                   TSSTISPDLSLFQAQQLQSHGFLPTSNKKSIQIISDFTILKCNIYSKCNVPKGYIQLFP
FT                   SLNYYHNSKIKNDYYLIIKLSSIDQTTKIITDISINKNDDESESSFYEEVVIEPGKLSL
FT                   YKKIQLINIDQPINDKLPILRSIDILFGNNDLIDSRPHHKSLHLSNSESIHTILSLNMM
FT                   TLIDQNELQEIHQQTMNLRNSQLIEITNNKYKIMQLSDLHFGQDLGRCDESNSNTNENV
FT                   IIDEIKCSSDLKTLKFIENSIQQENPDLIIITGDLIDINRSIDFKSILLKSLQPILAHK
FT                   IKFIYTFGDEIKNHLTKISIINFLSTLPNCLNIIPDDYKYDNNNNNNNNNNNNNNNNYD
FT                   LKGNKMHGVTNYNFQIKQKQSSTSSSSSSSSISVTVLDSEDHLIDDSQMTYLYRINNQL
FT                   INDYKLLFFHYPLPQFRPKGKFKLVGSYNEKHELDDKTKLKVHDDIINCGYNVISVGHE
FT                   HENDACLLSKSTFDDSNKSSIWLCYNSVTGDSGITKLDKQYVRKLRLFEIDFEKNRILS
FT                   WKRQEKDNKPFEYQAIYEKPQLKK"
FT   CDS_pept        complement(918404..919804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571432"
FT                   /orf_name="CD36_53660"
FT                   /product="Transporter protein of the Major Facilitator
FT                   Superfamily (MFS), putative"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41743.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397407"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192DAE0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHU9"
FT                   /transl_table=12
FT                   /translation="MHLWKSLLQSNKDIRILWGSVFFRMANYGLTNQVLTLYLKSLNIN
FT                   EIKIGLFMTLTLIGDIIISYYLTWNADEKIGRRNVMIMGTIMMFFSGVIFGINIEINNE
FT                   TIHFYILLIAAIFGVISPSGDETGPFKSVEEASIAHLTPHNHRPEIFAFYGLFATAGAA
FT                   IGSLLCGILIDYWNLSLGLDIVQCYRYVFFVYSGIALIKFSLMMGLSEKCEINNKYHIP
FT                   TTTTTSSSSNNEDSPLLTEGNESSDDLDNTSILSTGTKISKLSNISKYYLPRLLCIFML
FT                   DSLGYGFMPNAWIVYYLKITFKLTASSLGLLFFITNSMDSISSLPSAYLSKLIGPVKAI
FT                   LFTQIPSAIFFGLTIIPKDYYFMVAILLILYFTTSSMDVVPRQVLLTSIMPKQDITKVM
FT                   GIVNIGKTLARCIGPIITGELASINRLYWGFIINSCCVLLADMILAINFLHLDQEILLK
FT                   QSIIQEIE"
FT   CDS_pept        923322..925781
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571433"
FT                   /orf_name="CD36_53670"
FT                   /product="Putative uncharacterized protein "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41744.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000192DAE1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV0"
FT                   /transl_table=12
FT                   /translation="MMIHQRTLSTDSFSFHNKHNNNNNNMLHSNKQININDTNFEEISI
FT                   PSKKRYSEISIKQQQQQQQHQQVFQTPKNYCPSPLQQQLTRSSSIRSNGSMNTILQQQL
FT                   QQQSPMAILQQQQQQQSAPNTPPSQYIINVNRTPTNLTPSQRLNLRKSNINNSISQYKS
FT                   DQTNIFKYKQQPLPPPPPAAAAILQQRGGAPPIIDDADELIDDNVIFNVPFSQSVLSLN
FT                   QHEKFLFDNQSRNMSFVTDDSTRTSSIISHVSINDSASSIGGTTTNGNDSIEEEMHNIT
FT                   TSTMKNNIMTNITNEQFSSISKDAQELTVLCNKDEFAQIYDESFQKRKMLSNFKKIQSI
FT                   LPGRTTSSGTSSGTSSGGIDTKYYTFTRPTWLPPKSSYEKAKHQKESEDILYNALYQES
FT                   QLQQKRIIELDTTLKQRNQDIKTWERSLLNIKTLQELSFKDITELYWRGIANDIRSNVW
FT                   WKINLLKKPGKFNESFCDFYFDKYLIIQSKLCHLDKISRESKGSAHSGSNSNDDDDDDE
FT                   QTLLNSKVFDVKLLQWAKLYNQIYKDLMINVYPDANYFQDHQVISKINKIVISVILYLC
FT                   DQSEATTTTTTTNSNCDIDIFKFYFPGMINFAAIYYYNFKNTYKSFVSMCQFYNLRLPS
FT                   MMITYLNCSTNDLKLQSILKSSLNSYMIYKFEKILKFKLNRISVHFKIHNINSFDYLPQ
FT                   LILSLGLNLFNFEISQRIIDLILFDPNYDEIIINLIINYMMKIQHKLFGNKQEILSALL
FT                   GENNYTTTATTTTTSTNSSPSSSSSGSSSGSGSTSNHKYITGSNTYRYVNVGYEIEFIN
FT                   SLRELCK"
FT   CDS_pept        926677..927042
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382068"
FT                   /orf_name="CD36_53680"
FT                   /product="Hydrophilin-like plasma membrane protein,
FT                   putative"
FT                   /protein_id="CAX41745.1"
FT                   /db_xref="HOGENOM:HBG398553"
FT                   /db_xref="UniParc:UPI000192DAE2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV1"
FT                   /transl_table=12
FT                   /translation="MSKDEYFNKPNGPPPNYNNNQQSQPQQSYVPQSQPNYSQQTQDRG
FT                   MFSGGGGHHQQQQGYNAYGPPPPQGGYYQQQPGGGGYYQQQQPMYVQQQPRSGGNDSCL
FT                   MGCLAALCVCCTLDMLF"
FT   CDS_pept        928316..929701
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534843"
FT                   /orf_name="CD36_53690"
FT                   /product="Esterase/lipase, putative "
FT                   /protein_id="CAX41746.1"
FT                   /db_xref="HOGENOM:HBG396385"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI000192DAE3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV2"
FT                   /transl_table=12
FT                   /translation="MITFKGFFLILLLPTRLLSFIIKYPFIKGIPGKYQNNFSKSLFIK
FT                   LCRLIQLLPISDKGTLNFISTNFLLNKIMKYLYHTRYFIKDLNNFGEKFDDQSYWIHES
FT                   INRCKNDPIIIYLHGGSYYFDNSLNQMESLLGIYQLLKNSSSQLKDNNNNNNDDDDDVN
FT                   KDKMKRKNNLSILVLDYKLASKGYKMPYQLNQLISTYKNLIYQENTNIILMGDSAGGNL
FT                   AITFLQHLRITNCKNLPYPKSLILISPWCKIVPELSDYTKGHSMYDNNKYDIIEWKAVK
FT                   ELIQDTTPLMGDLSPANLTISPGNLPYNHQDWESIDTLKQSGYSTFVIMGEYETLRDDI
FT                   LNWCQYALNSNLSSPIKHTQGIFDNNIHQFVSNHNNNNNNNNNNNNNNNNNNNNNTDTD
FT                   TDTDGAYIKCIIEPNGIHDGSMIFENDILKEFQKNPTMNLQTINKEKYFGIYQIVQFLN
FT                   EIL"
FT   CDS_pept        931123..933678
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534844"
FT                   /orf_name="CD36_53700"
FT                   /product="Uncharacterized protein "
FT                   /protein_id="CAX41747.1"
FT                   /db_xref="HOGENOM:HBG397408"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192DB81"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV3"
FT                   /transl_table=12
FT                   /translation="MNSTTSPTSPTSPTTKSKLPPPLTHLNTAPQLTQIHSDTELITDK
FT                   DRSGHHIINNNNNNNSTTTTTNTTTNNKSTLMNNSSTTTTTTTTNGDSTNKSKRQQAND
FT                   LYNSLRNKQSDNYRFVEFTDKKPTPGAQPQLQPQPRQYVKQVSFDDINIQYDMDDIPDP
FT                   DDDFGWELYKLKNRDRLSGTNNNNPNNSLPGYSVGSSIGRGRGLGRGRDTLRTPSPLGN
FT                   VGSSRLSPSPNRTSLNYEDLDLETRLDIAQMIQYPSTPITTKRFCTLKKSHKKFDQLYK
FT                   DQSYRIIRPMFRTILVYISGRIHTWVALDWILSKFIEDGDHIIIIASIDPCLLNTKDYK
FT                   DRSRRSTSRTRMSLSPAKIGSQSSLIRGNTLSPQRSRTDESQPFQPTSDIYDPFIRLKE
FT                   KSRPENIVKIANNLMDYIMKVINPKIITRITVELVEGDTKGVLQDMYRLYEPSLVCTGA
FT                   KPNARVGAPLRSWQSSKLTDRLIKNFPLPVIAVPAVNMCEFEYDLQNKLNGTINAKTID
FT                   QQNELNVSNNILENGNTNNEEEDDSELGEENDDNNNDNNNDNDNDDDNDDDDENDVRSI
FT                   QSSVSMSSEDSYDSFIEVADVYLEHKRDLQKDLQHLEQTQSINNENYYADMVKLISDES
FT                   VALCTEIISIQPNFIGNGAKLAREITGSNSFGNVPYKTKSMLDPSAPGGGGGSGINGNK
FT                   PSLSFKELKEQLKLNKIKTESAVNTPISGSTSSFGTPIVSTSSSSPQKQDPPSIKIDDI
FT                   SSPTTTTTTATTSSTTTSSELPETSLRFGNLEKPSIQSRRKKPSMLHKCLSHSDDSVDR
FT                   PKLEARKSHPDVLEHIRDEIKPRDNNNNKKKKKKFLGIF"
FT   CDS_pept        934165..935850
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534845"
FT                   /orf_name="CD36_53710"
FT                   /product="Stretch-activated cation channel, putative "
FT                   /protein_id="CAX41748.1"
FT                   /db_xref="HOGENOM:HBG397409"
FT                   /db_xref="UniParc:UPI000192DB82"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV4"
FT                   /transl_table=12
FT                   /translation="MIPFILLLLLLPFLIINSSYCQHFDLFQDLQPSTNLTESIINNNN
FT                   NVFQVQNFDSKSSSSSSSSSSSSGEGLQEFTPIRDTILQSETKYYSFSVDTQSGIGDFY
FT                   ELLIFLSGNICTQPPNLLENDTSLAVYYSFNSTMFTNNEIGQMQLFKNGFFQGLADLPL
FT                   TDTANNDTTSTTSSTSTSNPVPEKILYIAVRAPENTNRTAQWTYQIGVSQHDLVFQWDD
FT                   RTWGSIVDVDDNSALIVTGNLTKLSTGNYSNLNATNSQFSLYLYSYDNKDYFQGMNNSW
FT                   CAVRSGPVLIKPENIETKFIARHGSIQQQFMVENLNASTKYIAYIVMDFEGVEYGGAVL
FT                   RPFEFETMDGTACELIYDLEFCDQVAYSVPAIGNSSLLNLNGGNVDNKTLTKKLYDDYA
FT                   KSLYTNFSKGLQQIACDTVPEAIYSNLKNCHDCAQSYKNWLCAVTIPRCSSKNFTGYIQ
FT                   RNSTNQRNDFLKEIIQPIHDYYEVLPCVNVCQAIVRDCPADFGFLCPTKNDSIKLSYYW
FT                   DVHVSDQWPSCNYLGPLKIDKSGAMKLIVNWTIVVVSISLMVII"
FT   CDS_pept        join(936045..936076,936139..937126)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229176"
FT                   /orf_name="CD36_53720"
FT                   /product="Replication factor C (RF-C) subunit, putative "
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="CAX41749.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000192DB83"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV5"
FT                   /transl_table=12
FT                   /translation="MPVKSKDNLPWVEKYRPDNLEEVKGQQEIVDTVRKFVETRKLPHL
FT                   LFYGPPGTGKTSTIIALAKEIYGSINYKDMILELNASDDRGIDVVRNQIKNFASTRQIF
FT                   TKNNSINNDQFKLIILDEADAMTNIAQNSLRRVIEKFTKNCRFCILANYSHKLNPALIS
FT                   RCTRFRFTPIDISAIKDRLNIVIIKENVNISSDAIDALLKLSNGDMRRALNVLQSCKAA
FT                   LGDDENIEINVDMIYDCIGAPYPQDIETCLDSILKDDWTTAYLTLNKYKIIKGLALIDL
FT                   ITGFIEILNNYKLKSKTRLEILKGLSDIEYGISKGGNDKIQTSAIIGVIKDAMEFEAK"
FT   CDS_pept        complement(937162..937923)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571434"
FT                   /orf_name="CD36_53730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41750.1"
FT                   /db_xref="HOGENOM:HBG397410"
FT                   /db_xref="UniParc:UPI000192DB84"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV6"
FT                   /transl_table=12
FT                   /translation="MKQHNNRFKDLKKSKSLNFINSIVESKRIINDCSEKNSINTNSTT
FT                   TNNNICITNNTNITTDNDDDLVKKFSLTRTINHENDSIDSSISKEFNNLNTTIKNDNSN
FT                   WIRNFIQSNNNNNNNNNNNKDNPNSFYSFNHELKNVVSVTPTSSSFSSSSSLSFSSLNF
FT                   SFYGDSIHDFTVKHKHSMTTTTKQQQQHQQNTYFTQKYNNNFFNINKKRNDNRNFKNKF
FT                   YNWLSIFNHQNVIDYDNDTIYYNTCGSSIYS"
FT   mobile_element  complement(942524..942792)
FT                   /mobile_element_type="retrotransposon:solo LTR, kotuku G"
FT   CDS_pept        complement(944829..944864)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        947137..948501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571435"
FT                   /orf_name="CD36_53740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41752.1"
FT                   /db_xref="HOGENOM:HBG397411"
FT                   /db_xref="UniParc:UPI000192DB85"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV7"
FT                   /transl_table=12
FT                   /translation="MSQQQQQQQHIRKSKRTRILTEKAKAETNTISLVNNNDNDNDNNN
FT                   NNTTTTTTTTTRKNKKKSCNLPKTIKKRKISNIEEEEEKAGKLSDKIDPVEKLLNLINV
FT                   NQDFLSDWEDNCHHHHHHHHHHHQHHHHHQHTSISSFTAVNNNDNINNNNLISTTSSTL
FT                   HCGFSPKLGYHNSNSSSSSSSSSSISSSSLFSQNEESEIDEYESDNYDYDYDYDYDYDE
FT                   PNEIESVNFTKIIQDNIRQYYFKRRLENQYKDSFALLNKQKYPHEEENNNNNNNNNHYQ
FT                   NNNNKLPSNNDKSIFKQYEVPFFKSVNFGNKPKEYTIEDYFQYEEAEEEEEESQPKKDN
FT                   NNNNNNNNNSTTTTSTTDSGISPITTPKSTIQSLYIPKINNTNNHNYRRPTTIMMNNNN
FT                   NGGTNNNNNNNNNNNNNNNNNLQDLSKILNKNSIITGNASEMISSGNFMLTDFYL"
FT   CDS_pept        954677..957565
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571436"
FT                   /orf_name="CD36_53750"
FT                   /product="Uncharacterized protein ypr091c homologue,
FT                   putative"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41753.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397413"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI000192DB86"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV8"
FT                   /transl_table=12
FT                   /translation="MGLVYFLFVYILGGLTFLPGLVILYFYLAPETTLSKNNNELDEEK
FT                   PSGELEENHQSGLEAYKSGWIFVTRDYIESPDEINSNTQSITESNDNKSAYSALYKLVK
FT                   DSATKKFKDNSQSIKNQEDKKFLDHNDNDNNDLDELNKDTFVLPKDTNNSKSYNHHQRH
FT                   DPQPQHNHQSQNQPQQQIRSSQKKHRYFAVLKHGNLFLYKDQTLKDVKHVIVLAHHFVS
FT                   IWPRDLTDAQLFTKYSALALINPSKLTDTPFPTNDTFNSNVNTSNGTEISSSTRSSLSS
FT                   RTTDQQQQNLQQQQQQSNNNAPPGTFFIYCENNCDKEDWYFALIRAMKLEKSELPDILS
FT                   PENFAQTSHFQTKEMINLIQTLYSSEGQLQTKWLNAIIGRWFLAMKNTKHFEDYFYKKL
FT                   SKKLNKIKKPGFFNQFEITDIQPGKSAPFFTYPKLKEINPDGTVVASCYVTYNGGLSVT
FT                   IETKVDLTFGTKFTNREVDLVLKITLSKLEGPMLFKLKPPPSGRFWYCYELDPIVNFKI
FT                   EPLLSSRTLNFNFITNSIEKKFKEAIKESLVYPFWDDIVFFDSSDQLYRAGIWKQPKID
FT                   KDEVTTNISETTNIEKNQGQIDNGLVGTDENNSTNSTNSTNSTNKFDDIDAKSELSTSS
FT                   RSIRNAKFSNTLTDLTKRIKKKSSPSLSNTEESLSKTPSISSGHNTNITKTPSKSDLTV
FT                   SQQQQQQQQQQPQNTNSTLVSNTFKRIGKWYFKDDVSTKKQPDEKPGYTPPEMISSRRA
FT                   PRKSSSSMTLGSDSTHYTLSTEDNKGSNSLVSESINAPISSTTTTTTTTTGSISGTSSE
FT                   FPNKSTTTTTAPVNVTSLSNNSTIPSIAIGTGTGKDSTMTSPLTAIPLENQTPSYNFSR
FT                   LDNNNEDLSIFSVAYQNAAQMIPSSTPPPLPPREISDNLSIKSGSLVGEPTISLSQPST
FT                   PIRSKTLTRKPPPPSKSPLLQANSSNQHIKDL"
FT   CDS_pept        complement(957666..964646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534846"
FT                   /orf_name="CD36_53760"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /protein_id="CAX41754.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG397415"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI000192DB87"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHV9"
FT                   /transl_table=12
FT                   /translation="MTSNQSISTNELLQFLTDIETNINDHETDFRKLLLYLLRFTNEKL
FT                   ILIAQEEINTPTEVQLLIKLIDSIELVLSKKTNLLSTLLTIEDVNIIHATGSGSLVYEV
FT                   PLHEWCISFALSHIPNFVSHTTGLNQLKRLVFLIVNFVCTQLHSFKVIKSTRIYLLKTL
FT                   DDNLNFCLENLASANTFLFKSKLTTAVNLFSIVHDYDISQKLSLNLNNYQLKFESYGRK
FT                   IWFILNEISLVSEIDNLNFLDCLKSVFILDQSSSLTLNVSVGWNQFGFLLTCIVEHLRQ
FT                   DFKTLDSNTNNFEFVNLNRSISLSLLNTFMLCLEKDLLENFMSFSNIKGLLWKLIYDES
FT                   IPYLIRKSLNIVQYIYQSKSNPDGDKLKIYNTPVYNDYVSKTFVDPELESFRTRLLNLQ
FT                   GDYEVSRKEQLLSFAIDETHKLTKSANLLNYHDERAWIHIVKKLTGTNKDVLEDETTLY
FT                   TLVTALGHYPCILKGDYDYTINECTRCGFGPLSKNNYSSIDPKRLPLNYDTEATVLEDI
FT                   IQSFLVPKLERQPDPLLCCNTLLLIFNFYATFSPVTDMKMPYVLDFLLGLLATNDNRDV
FT                   RMLVARILPLYLIQSNDDKLLDETFKYIFQKVTSIDFSSQHRLHFGESTIRAVVELATV
FT                   STGERLCAIYFKLVDWLGEQNEQHSNYVYCGILNLASAKSLPPHKLLSPYLPSVAEIII
FT                   KKPQLFERIIKVSMITKNYFLNRTKEYTVPRILEYYKDPTLLTQIANAAGLEVGKLLAN
FT                   CLPRILATYLTKESVNERYIMKVLSSVCPDYKMVHTEELFTRIGDITWYILLEIQMDEF
FT                   GNIRNLTNILRALDCVCKNVSLRKNGSETTKNNSINDLIEDQVLLLIQKFSDVTHSSRG
FT                   AKPYLELKNSFYAIEFLIKRHIDAITSALGQLSTCLQATLEEPDFHVLSLRCWNELIKK
FT                   VPPSHLISLIDIIISIILQKFESFGSEAKSIAIEILRKIYEEIKDKYNRYSLYFLSLPF
FT                   LSYMEDYQMVKEFRNMKSPSRAMIFSEFTRRLQTSNMYVVKHALFDLSNYFDKYQINCQ
FT                   RDLFKDPGLTPAITSLVRTLLDTAAKFKNKDTTVSTACAKALAIIGALDSNRFQFKTVK
FT                   QLIIIASDFENSEENSTFLVDLIENHLLKIFWASNDPHKQLFAAYVMQSFLAVMGLDEH
FT                   VLQTKDNRVWNKFTDVAKSTLTPFLKSKYAASKPKLDNIKFPFFKLGMKYETWLIDVTL
FT                   FLLKRASIDNGKGNQKAKTRKLIFQSCAVLIQKEHDIPLCEHLLRYVALSHVINEGVPE
FT                   ELHKEFLHILKIDSKSTSPDRAEQLKLCYQAIFSVLDYFNQWSSNMRVVTNNSQIESTS
FT                   DDIRHKMDAVAKFSSFPQDLLTIRSAECDAYERTIMYLENCYRDSHSEKSFKLSNLNGA
FT                   ATLQDMYAHIDDYDALNGTLKMFSTNNLNEKLITFQYSDSWSLAHESFEALGSTKDSVS
FT                   NNTKLLQSLNEHGLYNEVLSTLSARTDPNDLKSIPLDWSLMGLHAAVYKGDSKQLEKWL
FT                   QVTNSIGKPHDMETMINYELAKALSFLFQSKIDMFKSSMDKLYNIIGCSLVPSVSSNFT
FT                   RNITLMNQLHAIYDVSLIVSSQDSENTLDLRIGNVDQDFDTQRSILTLHNVANTAMKNP
FT                   AMISKNLLRESSLARKYNRLDISTRSIVQAMSLEDDQAIIEFAKLQWAQGKQSEAIKCL
FT                   FDILKDHKFHQDDTKKAQIQLQYANWLDESNHLSAHQIIKEYTKAFHLNMRDEKCNFDI
FT                   GKYYNKLMESSNDPSGEYEHLTVRNYIRAVSVGTTFIFEALPKLLTIWLDFADKPKKSK
FT                   TAEKKLNQIIEDLYNGLANVPNYAWYTVLTQMLSRIVHHHEPSFQVLRTIISNVMLEYP
FT                   NHCVWYIFSHAKSSDKERKTRTQKLITKVCEENTRHPLTRSIFATGGLFEKLIKIAELK
FT                   IPKTNRKRQMSLLKDFNMDLSDPIDDLVIPVQSNLQIQIPSQLGSKYKGFSRSSSITFD
FT                   GFDDTVNIFFSLQMPRQLTVRGSDGNAYRLMVKSDDTRKDAKVVEFTTMVNRILSTSTE
FT                   ARKRGLQIANYSVVPLSDHFGIIEFVMNVQTMKGVIIEQRKRQGISINERKIFMHIGGL
FT                   QKAKQKDNKKLDKLMVDFRHIMDQCPPVLHNWFVEQFSDPNAWYMARNSFTRSSAVMSM
FT                   VGYIMGLGDRHCENILIFKNTGAILHIDFDCLFEKGTTLPTPEIVPFRLTQNMVDAMGI
FT                   TGVDGIYRITCEVIGTLLRENEQILMNILETLIYDPLIDWRNHNPREDLSKVRKKIRGL
FT                   INEDEGLPMNIHGQVDVLIQEATSLERLSQMYAGWAAYM"
FT   CDS_pept        complement(965074..965382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571437"
FT                   /orf_name="CD36_53770"
FT                   /product="Cyclin-dependent protein kinase regulatory
FT                   subunit and adaptor, putative"
FT                   /function="cyclin-dependent protein kinase regulator
FT                   activity"
FT                   /function="kinase activity"
FT                   /biological_process="cell cycle"
FT                   /protein_id="CAX41755.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016538"
FT                   /db_xref="HOGENOM:HBG611605"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="UniParc:UPI000192DB88"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW0"
FT                   /transl_table=12
FT                   /translation="MSKPRFLTDLERAKVLEFQDMIHYSPRYSDDSYEYRHVMLPKNML
FT                   KAIPQDYFNAETGTLRILTEEEWRGLGITQSLGWAHYETHAPEPHILLFKRPLNPGQ"
FT   CDS_pept        complement(966265..966930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229177"
FT                   /orf_name="CD36_53780"
FT                   /product="Pre-mRNA-splicing factor, putative "
FT                   /protein_id="CAX41756.1"
FT                   /db_xref="HOGENOM:HBG397416"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniParc:UPI000192DB89"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW1"
FT                   /transl_table=12
FT                   /translation="MAGDLNLKKSWNPALVKNQQKVWEEEQQKLDELKRIKERNQEYKQ
FT                   EQEYLELLKLQHGDRFQIKDLNKQQKLKLSKLNWMYDDVPFESNEKVEENSSGFIESSV
FT                   EFTDGKTKVENLLKGNHAVGKKRDGSDTSDRINKIIGVGMSKSSKTSYSDDPLLRIKQQ
FT                   QQQAQRVSKKPHNNDKHSHRFSHSSKSSSDRVHKSHEHERSRKHNSSHTRRRDRSPNR"
FT   CDS_pept        complement(967419..967748)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000279813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534847"
FT                   /orf_name="CD36_53790"
FT                   /product="Eukaryotic translation initiation factor eIF-1,
FT                   putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX41757.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG522548"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005874"
FT                   /db_xref="UniParc:UPI000192DB8A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW2"
FT                   /transl_table=12
FT                   /translation="MSTIQNLNAFDPFADTGDSEAQPTNYIHIRIQQRNGRKTLTTVQG
FT                   VPNEYDLKKILKVLKKDFACNGNIVKDEELGEVIQLQGDQRVKVSEFLTAQLQLPKKNI
FT                   KIHGF"
FT   CDS_pept        969232..970590
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571438"
FT                   /orf_name="CD36_53800"
FT                   /product="Phosphatidate cytidylyltransferase, putative "
FT                   /EC_number="2.7.7.41"
FT                   /function="phosphatidate cytidylyltransferase activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41758.1"
FT                   /db_xref="GO:0004605"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG629124"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniParc:UPI000192DC27"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW3"
FT                   /transl_table=12
FT                   /translation="MTSSTKDTSLKQVETEVSSSKSTSITPTNNELSNSTSKSTPSNNK
FT                   SVEQTKEQPVVNEKEKKKQAFVTRTIWTFVMIGGFFAILASGHLALIIMVSVFQMLTFK
FT                   EVIALTSEPARDKKIPWNRSLNWYFLGTTWYYLDFPALFDFFQESVYSSKFLTLLVKNH
FT                   KFISYSLYIAGFVFFVWTLKKGYYRFQFAQLCVTHMTLLLVVFQAHLIIDNILQGIIWF
FT                   FLPATLVIVNDIFAYLCGITFGRTQLIEISPKKTVEGFVGAWICTGIAGVIASHILSKS
FT                   DYMICPAENLSTHLYNFPHCDLNPIYIPQVYQLPAKIVEITGYELITFKPFYFHAAVLA
FT                   TFASLIAPFGGFFASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYHTFVS
FT                   NQNVNLGHVLQLAIMNLSVPQLIQLVKSLLKYLNREEVLSGEQLSLIFDILEN"
FT   CDS_pept        972317..973786
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571439"
FT                   /orf_name="CD36_53810"
FT                   /product="Glucosidase, putative"
FT                   /EC_number="3.2.1.-"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41759.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG397417"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192DC28"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW4"
FT                   /transl_table=12
FT                   /translation="MFSNIISTLALLQLLNAAPILLTRYHVAAPTTEIKTVTTGTTTVW
FT                   LPPVGIYISDGQTSTSTITDGQWNTYPVTFTSIINRDQAAPAPVPTQQTTEAQPQPPQQ
FT                   PTTTTSSTSPAQPTTTEQQQQPTTTEQQQQQQQPTSTEQAQPNTTSTEQTPQAPQSTEQ
FT                   GQQQQQPTTTELAPQSTEQNETTIQSPSTTSINYTSSSSSSYSPTSTSTSSSSSSPSSS
FT                   GDISAPSAIVYSPYADDRSCKSADTIKSDLQLINSKGIKQIRSYGTDCGSLTTVLETCR
FT                   ELGITVNQGVWMSNAGVDSIDDQVSDVVNYGKSNGWDVFNLITIGNEAIVAGYVSPSDL
FT                   VSKIKSVKSQLQSAGYNGKVTTSEPPATYLKYPSFCTDADIDVVGINPHSYFNANISPE
FT                   NAGSYIVHQQQQVADICGGKSILITETGYPSKGSTLGVNVPSPENQKIAVSSIIKETGG
FT                   DCTILTTYNDFWKDPGPYGIEQYFGVIELFQ"
FT   CDS_pept        complement(973895..974917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163182" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534848"
FT                   /orf_name="CD36_53820"
FT                   /product="Inositol oxygenase, putative "
FT                   /EC_number="1.13.99.1"
FT                   /function="inositol oxygenase activity"
FT                   /function="iron ion binding"
FT                   /biological_process="inositol catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41760.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019310"
FT                   /db_xref="GO:0050113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG332059"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniParc:UPI000192DC29"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW5"
FT                   /transl_table=12
FT                   /translation="MVNKVSKPTHDKTNNLDKSQTNILDKIDDDILNVNRIRGSLTNKT
FT                   PTSKTHSIDDELKLEEQSETAADENWQIASEYYKNIDTKAFRQYELACDRVKQFYEEQH
FT                   EKQTVAYNIQARINFKTKTRARMTVWEGLEKLNKLLDDSDPDTELSQIDHALQTAEAIR
FT                   RDGKPRWFQLVGLIHDLGKLLYFFDSRGQWDVVGDTFPVGCKFSKRIIFPDSFKNNPDF
FT                   LNPLYNTKYGIYSKHCGLDKVMLSWGHDEYMYHVAKKNSTLPPEALAMIRYHSFYPWHQ
FT                   ELAYSYLMDEHDKEMLKAVKAFNSYDLYSKIDQQYDVEELKPYYLELIDEFFPNKVIDF
FT                   "
FT   CDS_pept        complement(975205..976815)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229178"
FT                   /gene_name="CHT2"
FT                   /orf_name="CD36_53830"
FT                   /product="Chitinase, putative"
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41761.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG397418"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192DC2A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW6"
FT                   /transl_table=12
FT                   /translation="MLSIKTLLAAAVVASSAFASASNQVALYWGQNGAGGQERLAQYCQ
FT                   ETDVDIVLLSFLNLFPDPLNVNFANQCGNTFESGLLHCSQIGADIKTCQSLGKTVLLSL
FT                   GGGVGDYGFNDVASATKFADTLWNKFGAGQDAERPFDDAIVDGFDFDIEHGSTTGYPEL
FT                   ATALRSKFAQDTSKNYFLSAAPQCPYPDASLGDLLSKVPLDFAFIQFYNNYCSVDGQFN
FT                   YDTWSKFADSAPNKNIKLFVGVPATGNVAGYVDANKLSTTIEEIKCDPHFAGVSLWDAS
FT                   GAWLNTDDQGNNFVVQVKNVLNQNTCVAPTTSATTTSTAAITTKSDEIVTSSSSSSSIF
FT                   YGNSTTESSSGIASGTVLPTGSGSGSSNTKSYELAISTVTDVQKTVVTITSCSAHKCVA
FT                   TPVTTGVVVVTDIDTVYTTYCPLTNSQVYVPVKTVICSEEKCVANPTSTALKPKASTST
FT                   QGVKKIVTTSAQTVGSSTQYVTIDITSTITPVPLPTSVTSNGTNGTVPVFTFEGGAAVA
FT                   NSLNSVWFTVPFLLAAFAF"
FT   CDS_pept        979925..981190
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094230" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229179"
FT                   /orf_name="CD36_53840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41762.1"
FT                   /db_xref="HOGENOM:HBG397419"
FT                   /db_xref="UniParc:UPI000192DC2B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW7"
FT                   /transl_table=12
FT                   /translation="MKIFEALLELQNTLLKYYSATIQYLYQELLTLFENKVSIDVEKPD
FT                   LERISFYTSLIEKYQYQIIQLTDFNKGHTIYITLQQIINSGIQDVLGSITALRNSEQKL
FT                   IRASSEALLIQPGIEEKLKWIIDENNHLHKFQNDQDEYQTFLARLKNEINNVPPPQYTC
FT                   QTLNKFVEDIVHEYSLNIPILEIVIEKLNRNYNEEELFLEKLQNSILQLILEQEVDTSS
FT                   VSFTEQEIKVIDIMEILTAHIDFFKRLSKIYIKFDKLLLQKLKLDNLPAPESVDLKTHV
FT                   TKKLDNFIKNLVAGGTVGLSTEQTYLLVFSFIQNIAFQFQTFNENYIGYIPDNRPGRYG
FT                   DDESFWTLVKEYIASLHRVTKFLEDPNGCGHDVNIIMGNAKEEFEQLESEAREYFFALL
FT                   PFERIFECDEKIVNYQLGEKSV"
FT   CDS_pept        complement(981844..982524)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229180"
FT                   /orf_name="CD36_53850"
FT                   /product="t-SNARE syntaxin protein, vesicular/late Golgi
FT                   fusion, putative"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="Golgi vesicle transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41763.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0048193"
FT                   /db_xref="HOGENOM:HBG397420"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniParc:UPI000192DC2C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW8"
FT                   /transl_table=12
FT                   /translation="MDPFNEVKEDAYSSIRALEDIINSRPNGNPPTNEQQQDFENSFQE
FT                   LQEIYRDLQQALTISESQPSKFNLSDIDISNRKSILSDLNNQIQHLEKKWNQKQYRDVT
FT                   TMSNRISQDGQDEDIDPFSGDSAMTSYQQQELIQEQDLQLDDIHRTMMNLNQQAAIMGD
FT                   ELEEQGFMLDELDYEMDNVDNKLQRGMKRINIFLERNKETASNWCIGILVVVLCVLLVL
FT                   LLIA"
FT   CDS_pept        982754..983140
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571440"
FT                   /orf_name="CD36_53860"
FT                   /product="COMPASS/SET1C histone methyltransferase complex
FT                   subunit, putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX41764.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG397421"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="InterPro:IPR013790"
FT                   /db_xref="UniParc:UPI000192DC2D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHW9"
FT                   /transl_table=12
FT                   /translation="METPIPNHDSIKETIEASVNESIDNSNQTEDKPTNGSVDQNQQSS
FT                   SPMEIDTKEDSTKPEINTPTPNENSQLPMHEIVGGSSVRRYLNQHLTKTLLEGLKEVAQ
FT                   IKPEDPLKYLGEFLISKSNESKKE"
FT   CDS_pept        983491..985098
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571441"
FT                   /orf_name="CD36_53870"
FT                   /product="Mitochondrial fusion machinery protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41765.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397422"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="UniParc:UPI000192DC2E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX0"
FT                   /transl_table=12
FT                   /translation="MSSSHPDTQVLRPYYDHDTFNAGYSVIYKKGVGIIDPKTNRPVTS
FT                   NISEKLINQSLNENQGIIRNSFKHGGPVGINATSDKNYVYDLEFNEYFESNNLIEVFKN
FT                   LLWNFVRSYIKVLLTQPLEIVRLVLQVGKFNFSETVSKTTKKLDLSKSKRLLSETEDDT
FT                   EATTEQDEDEYPRPQRSSIYDNVRDDDEDDEDEEPINYFQSQNEQQVWSGHEVGGFNTT
FT                   ATPIKQEKKSYRDGKKRIRNNKIKPKSLHTADILTAIINKDGPFAVFRGINASFIYQTL
FT                   SHTIEAWITGFASPFLGIPDPFFLDLTHSNDPFKSLWLSVTACVLTGIVLMPLDLIRVK
FT                   FMITQFNSKPLNENDTLEEAAEEIVQSTRSVRESIRNFPVYYLLHPSTPIVFLTTLHQL
FT                   STSIFRKMAPYILFIKFNIDSYSSPNIYTFVNLLSLILEFFIKLPVENLLRKQQVQFLL
FT                   TPKREDTKKVITIEDPKKSLIVEFNDSTEDNQDSTFWERLKQLGLFNGWRIGVLNVIGF
FT                   WGYNIIKSDGSELKEERL"
FT   CDS_pept        985692..987209
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571442"
FT                   /orf_name="CD36_53880"
FT                   /product="Xenobiotic compound monooxygenase, DszA family,
FT                   putative"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAX41766.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="HOGENOM:HBG673014"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniParc:UPI000192DC2F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX1"
FT                   /transl_table=12
FT                   /translation="MTASTNSSNDQKNRTPLILNSFCMGCSGLQCPGLWSHPDDKSRDF
FT                   NTIEYWVNLAQLLEKGKFNALFIADVLGPYDVYDGPGNFRSVAKSGAQFPTTEPSAVVS
FT                   AMAAVTKNISFGVTFSTISENPYHFARRLATLDHLTKGRVGWNVVSSYLDSAARNLLNG
FT                   ESLPPHAERYERAQEYIDVVYKLFLSSWSDDAVELKNRVFTNPDKVREINHKGKFFTVP
FT                   GPSITEPTPQRLPVIIQAGTSKAGKEFAARNAEVVFITTFSPEELGKQIKAIKTLAKEK
FT                   YGRPEGSIKFLQLITPVVADTHELAEEKFKELQSYGDLDGAQALFSGWTGIDIGKYDYE
FT                   DNITDKGTNAVKSFLELWNKTSPGEPANVKKTRRDIARQITVGGLGPVFYGTPEEVTDE
FT                   IERWVDISGVDGFNVTYAISPGTFEDFVEKVIPLLQERGLAQEDYPQDLDHPLTFREQL
FT                   FGSERKEPYYLLESHPAYDLRWRAGESKDEFERRLNKKRKSEAQEIA"
FT   CDS_pept        989088..989834
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571443"
FT                   /orf_name="CD36_53890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41767.1"
FT                   /db_xref="HOGENOM:HBG626373"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000192DC30"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX2"
FT                   /transl_table=12
FT                   /translation="MSWKPIVTYIFRGLQTVFCIVVLGLSAGFLADVGYNYDRVTFALV
FT                   VSILNLLYFGYILILMPIFFKNFTFSILIFAAEFIFFVFYLSAMGAIADVVPSGSCGDY
FT                   GSYSSACSILKALIPFTLFNWLLFATTFGLFLGYSFIPQVSSRGFKSIFLPVRFEYGAI
FT                   FTNFLLPFGKRYAVTDPVTDAAVADAEITGNDIENNAPKGASVGDDEATAGLASSEEDK
FT                   YTEPLSGNIDEVTATQEATNQSKPYP"
FT   CDS_pept        complement(990746..991492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229181"
FT                   /orf_name="CD36_53900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41768.1"
FT                   /db_xref="HOGENOM:HBG626373"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000192DC31"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX3"
FT                   /transl_table=12
FT                   /translation="MSKKVIAASIIRGAQTIFALIVLGLSIQELVTLEFYYDKSVYIIV
FT                   VAAINIIYFFCTLLLIPFIFKNWSPSIIPVAGEFILCIFYLAAMAISATDAPTVSCDYL
FT                   YYSEYVSFCHILKALIPFTLFNWLLFAASFVLVLCFTFIPEIKRHGFKHTLFPSQFDFG
FT                   LIFGNDTPASKEIVASYDYRDANAYNESEVGIAPTVHGTNNNGGSDNHQTSVGVNLGES
FT                   SEEEKSIQATPSNFQNENINHSKPYA"
FT   CDS_pept        992825..993466
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571444"
FT                   /orf_name="CD36_53910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41769.1"
FT                   /db_xref="HOGENOM:HBG397423"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000192DC32"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX4"
FT                   /transl_table=12
FT                   /translation="MGFIGFFRIVQFFFNIICFALCASHFRSAKAFALGVSSANMIYNI
FT                   YTLFIVPQMHQKTLAFLIFVAELAFPILYLISCIILVVQINTEYVTSYTVNFTSQYDKY
FT                   KDAPYSTVAMASGIFGLVCSFWFGFTCFAFFKYTFFPIYRNGKGFKSLFEVYVFKFGCV
FT                   VYNKDKSDRDRNSRDLEKNVPQKSIDQEKTLGTVILSSIDTLKVESKSPV"
FT   mobile_element  complement(994058..994315)
FT                   /mobile_element_type="retrotransposon:solo LTR, iota F"
FT   CDS_pept        994507..995043
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382069"
FT                   /orf_name="CD36_53920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41770.1"
FT                   /db_xref="HOGENOM:HBG397175"
FT                   /db_xref="UniParc:UPI000192DC33"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX5"
FT                   /transl_table=12
FT                   /translation="MSTGRVCVGVFFRLLQFVGDIACFATSLRTYRPYNSFIITVTVLN
FT                   FIYNCYIWFGVPILAGKRAYNGILFGGDIMFFLLYIGSSIFQLFTAYTYYWNEYDSGLS
FT                   FSFECYYASWCIGVTCAALYYITFIMYVCWGVIPASKHGFWKRSFEKQPFKFGCLVFDN
FT                   SQVCYESKRDDEIDL"
FT   CDS_pept        995653..996894
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571445"
FT                   /orf_name="CD36_53930"
FT                   /product="Ribonuclease T2-like, putative "
FT                   /EC_number="3.1.27.1"
FT                   /function="RNA binding"
FT                   /function="ribonuclease T2 activity"
FT                   /protein_id="CAX41771.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0033897"
FT                   /db_xref="HOGENOM:HBG738816"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="UniParc:UPI000192DC34"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX6"
FT                   /transl_table=12
FT                   /translation="MKYKLLVILAHLLTSIKATQEVFDLSDLPPDSCPIDSPISCSRNS
FT                   QELDNINSCCYESPAGVILLTQFWDYNPATGPENLFTQHGLWGNMCSYGYPQFCDPSLE
FT                   INPNGDVIRSIIVDQFGDEELYNNMSYSWKDYHGKDSSFWAHEYNKHGTCFSTIKPSCY
FT                   LSNTPKNRNLYDFFKIAIGLFNKLPTYDWLAEAGIVPSNSKTYSLSEIQSALNDKFGAN
FT                   VFIKCDYNHAINEIWYYHHVKGSLLQQNFLPIDSVAYTNCPSTGIKYPPKGKVAHPTLT
FT                   TKTATGTSTSIHNPTGVPARSYVHLSGKSGCLISNGKWYTSGTCATYHFKQTTEESNIE
FT                   IRSSKGICGINGNKEFTCSRAVSGGADFQIKDGKIGYQDTFDWCFGSTTGSGSTAQTSV
FT                   KLADGSCDPFQLLI"
FT   CDS_pept        complement(997365..998717)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229182"
FT                   /orf_name="CD36_53940"
FT                   /product="Adenosylhomocysteinase, putative "
FT                   /EC_number="3.3.1.1"
FT                   /function="adenosylhomocysteinase activity"
FT                   /function="binding"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAX41772.1"
FT                   /db_xref="GO:0004013"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="HOGENOM:HBG352029"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="UniParc:UPI000192DC35"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX7"
FT                   /transl_table=12
FT                   /translation="MSSAPATNYKVADISLAAFGRKDIELSENEMPGLMYIRKKYGPSQ
FT                   PLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVFAW
FT                   KGETEEEYQWCIEQQLFAFKDGKKLNLILDDGGDLTSLVHEKYPEMLEDCYGLSEETTT
FT                   GVHHLYKSLRDGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVV
FT                   AGFGDVGKGCAMALHGMGARVIVTEIDPINALQAAVSGYQVAPMDEVASIGQIFVTTTG
FT                   CRDIITGKHFEQMPEDAIVCNIGHFDIEIDVAWLKANAESVVNIKPQVDRYLMKNGRHV
FT                   ILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFNADNKEFREKFPEFAKTGPFDV
FT                   GVHLLPKILDETVARCHLDHLGAKLTTLTETQAEYLGIPEEGPYKADIYRY"
FT   CDS_pept        complement(999225..1001237)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571446"
FT                   /orf_name="CD36_53950"
FT                   /product="Transcriptional activator of nitrogen-regulated
FT                   genes, putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAX41773.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397425"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000192DCEC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX8"
FT                   /transl_table=12
FT                   /translation="MTTSNSQSKQFETVPSIVDLLYSAKKLLNLQPRIDNLHLRRSSSR
FT                   TQLVMQSQAISANNGKENNQSFSISPVNNQTLGSAHDKVLDLLSPLSIDDLKNNTITTT
FT                   TTTTTSYHQNKLNQRLNGTTNNNPSHITGNNSSTRSTLFKPSSPHSENTSPKNISSSSS
FT                   SSLAPSTKANNLSHNNTTNNHGPSSEIKSSSSSLPPKKVTRCFNCNTTATPLWRRDADG
FT                   NTLCNACGLFLKLHGTCRPLSLKSDVIKKRNSRKANTSSKVGTPTNQFINTSVKGNDAS
FT                   IRMKQTPIAIAPSPSSNSLYGGGGGSANSLPSSQRFKNVLILPKPPSGTNLTASARTKS
FT                   IPIPANNAPSPDGSFSPSLKRKKSEVDVGPRTPTSLSASASASFSMRNRVPSSSSLTGT
FT                   SFSNSIKRNNSFSNRKSSLTSLMQRKNTVGTTPTTTNSLTSSNINILNQRFPQPTYFEN
FT                   FGSSTGPQSPAISRHNSTTTLMNSNQVILENVNTPGSYNSTNSFPSYVPHETPNSIPET
FT                   PLNVNDLLPSSFNRRSSQMSTKQERILEDYRASKPQTMPHKGIDDEMIIMDALNDFPGL
FT                   EAIDMGGNINGMSADDYNNDYGDIFRKFTSLENESFVDQTANSIQDNNFGFQQIPTENN
FT                   FYKVGNNNSGNKNNSNNANNNSGDYKDLDWLKFDI"
FT   CDS_pept        complement(1003101..1004369)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077803"
FT                   /orf_name="CD36_53960"
FT                   /product="Eukaryotic translation initiation factor 4E (EIF-
FT                   4E), putative"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41774.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG397426"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="UniParc:UPI000192DCED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHX9"
FT                   /transl_table=12
FT                   /translation="MSENLKRAESLFNRIMNQTTNNDSSTSSFASQSSTPTTPISESSP
FT                   TSSTTTTNPNSTISGSRKFNSSSYSVPTIPSNIPKLDIEKLTREALASVPESHHTLPYC
FT                   WTIWYHSRNKKKEQGQKVSEELQESIEDQQPEQQQQQQQQQQSAEVDSYLQTTNELEFI
FT                   DFSTGNPIHHIASLEQLWSSFSSIKKTYTLNIGTEFLIFKTGVNPVWEDPINSKGGRWV
FT                   FRFNRKIMDGHNSNNDKKSSKQELFRKRTSLIWERLVLKTLTGSLIPDSNSSEIQELLL
FT                   NDICGLVLSVRKDEDIISLWNSNLNFFGKKDQTKKLTSFQARRIICDSILRVIRECDLI
FT                   NQGGDCIQTIDIGSNERVFGVSFDYRVHADNEREREKSITSNGANGSTAGGSTGNSSGQ
FT                   TYGSHYNRRYNKYNTSKTDSTAK"
FT   CDS_pept        complement(1005157..1006614)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571447"
FT                   /orf_name="CD36_53970"
FT                   /product="Di-and tri-peptidase, putative "
FT                   /function="carboxypeptidase activity"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41775.1"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG690347"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniParc:UPI000192DCEE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY0"
FT                   /transl_table=12
FT                   /translation="MSTSTTYEKLPLQPLFDTIEELKPKFIERLQKAISIPSVSSDESL
FT                   RPKVVEMANFLVGELKTLGFTDIQLKELGTQPPPVQDTNLQLPPIVLGRFGNDPSKKTV
FT                   LVYGHYDVQPALKDDGWNTEPFTMHYDKEKEILYGRGSTDDKGPVVGWLNVIEAHNKLG
FT                   WELPVNLVVCFEGMEESGSLGLDELVAKEAQNYFKKVDQVTISDNYWLGTTKPVLTYGL
FT                   RGCNYYQIIIEGPGADLHSGIFGGIIAEPMTDLVKVMSTLVDGSGKILIPGVSDMVAPV
FT                   TDKEDQLYDSIDFSVEELNAASGSKTSLHDNKKDILKHRWRFPSLSLHGIEGAFSGAGA
FT                   KTVIPAKVIGKFSIRTVPDIESKKLDELVFQHITSEFKKLNSPNKFKVELIHDGNYWVS
FT                   DPFNDSFTAAAKATQDVWNVVPDFTREGGSIPITLTFEKELGVDVLLLPMGRGDDGAHS
FT                   INEKLDVVNYINGCKTLGGYLHYYGKA"
FT   CDS_pept        1007308..1008903
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571448"
FT                   /orf_name="CD36_53980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41776.1"
FT                   /db_xref="HOGENOM:HBG397427"
FT                   /db_xref="UniParc:UPI000192DCEF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY1"
FT                   /transl_table=12
FT                   /translation="MAYIPDNVSVISLSSDSSDEDDMDIMTVISGRKTEGITTYKSTRR
FT                   SSRIHQMNTSNTIPNNTYPSKLSDSKKPFDIQIPSVFKYEANKIHKINTRNENIKQEIN
FT                   KEEKELKEKYEKLQQIKAKLVIELNDNGSDGLLRYDANENSSYIDSLIKQEINDMDKVR
FT                   RNFYFLKNVEDVIFDFEGENFEYIPQSLLFLITADPIKAYNTSPIIKTDLRYFIMRALS
FT                   TVLNPQHLISIIEMIKNVQGNVFTFDELIKFTNKFGGETKLLQNNKMSLKINMFNNHLR
FT                   MQLLRLTLLFNCYLIGDNNDEQNLVGILKLFTYIVSDYNANKREYTTLEYFTVTVFTKL
FT                   IKKYHKPDNNNEFVSQLFEYISGIEVVNYGNLQETDTTKSLELCFNFVRLLNVAFARNN
FT                   DRNITDVIYKLNIMIILNGIPIFDRSVPELVNSLVSYIKLTEIDLKFCYKIKTLNFILN
FT                   GQYMVNQTRDTLNQIKDDIVELKKIFYSSMEKLTTSTEGLDLVMMVQDVFHQLEYLNNL
FT                   IESFQHEDLFYNDI"
FT   CDS_pept        join(complement(1011122..1011157),
FT                   complement(1009723..1011123),complement(1009068..1009739))
FT                   /pseudo
FT                   /gene_family="HOG000093309" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1012362..1013261
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534849"
FT                   /orf_name="CD36_54000"
FT                   /product="Member of the protein disulfide-isomerase family,
FT                   putative"
FT                   /EC_number="5.3.4.1"
FT                   /function="protein disulfide isomerase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX41778.1"
FT                   /db_xref="GO:0003756"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG397428"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000192DCF0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY2"
FT                   /transl_table=12
FT                   /translation="MFFNHLLALVHILILVSAGSQADEYASDPNIFELTPSNFDKVVHK
FT                   SNYTTLVKFYAPWCGYCQKLQPVYHKLGKYINKDAKYSINIASVNCDKDYNKQLCSQYQ
FT                   VRGFPTLMVFRPPKYEKGKQVKLQKHASEVYQGERSVKSITKFLTSRLKNYVKKFHNIK
FT                   SDGVAEWLAEDKPSVLLISNANSVSPLLKSLAIDFLDRVKVGMISKFNDEPHKLVIGDK
FT                   EIEVPSTSKSMLFYFNKEKGELVAYTKSEKLNDKVKITEWIIEQTQQQPAEGPLSKKEN
FT                   KYYYKYRTGKKKIEHDEL"
FT   CDS_pept        complement(1013297..1014148)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229183"
FT                   /orf_name="CD36_54010"
FT                   /product="Serine hydrolase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41779.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG383462"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI000192DCF1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY3"
FT                   /transl_table=12
FT                   /translation="MAPKKNITYKGKILFLHGYTQSSSLFYAKTSALRKKLIKLGYKCV
FT                   YLNGPYVLTPADLPTTDSLSKFGSATTDTEDVTYRAWWVKKDKTNDAIDLDESIATVKD
FT                   YIQKGEIIADNDLEVEEETDEEKKLPIVGILGFSQGAAFGGLIAHKFPQWFETDPLKFV
FT                   VLYSGFKLDTSKKTGNDKYNEYYPQTEDDVKNGGFKYLHVLGELDTVVAEDRGYSLYEL
FT                   TKSSSDILKHPGGHFVPNSKIYVDNVANWIESHQNGSQVKSEKPEDDIDSLLDMMDNFG
FT                   KA"
FT   CDS_pept        complement(1014310..1015173)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571449"
FT                   /orf_name="CD36_54020"
FT                   /product="Pyrimidine nucleotidase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41780.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG502486"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192DCF2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY4"
FT                   /transl_table=12
FT                   /translation="MTVSNSQTVNYINPELTEAENAKPGRHVSLPFGYGPIPKQFQNKR
FT                   IFFFDIDNCLYPRSTRIFEMMQVKIHDYFKKSLSLNDEDARNLHMNYYKTYGLAIEGLV
FT                   RNHQVDALEYNSKVDDALDLHSVLRYDSDLRNTLMAIKESRKFDYFWLVTNAYKNHALR
FT                   VISFLGIGDLFDGLTYCDYSKDPIICKPMPEYFYNCFQITQLDYQNAEVLSEQYFIDDS
FT                   ELNVKEAKRLGVGHVIHYVELPSDIEKLKAKPDFEEFYGTGDNSDPSKIWILDKIQNLP
FT                   TLIGCT"
FT   CDS_pept        complement(1015828..1016361)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382070"
FT                   /orf_name="CD36_54030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41781.1"
FT                   /db_xref="HOGENOM:HBG397429"
FT                   /db_xref="UniParc:UPI000192DCF3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY5"
FT                   /transl_table=12
FT                   /translation="MLLTQLIILFTLVSQVLSVSISDLNNIVSLQLTKRLGGSSGGRSG
FT                   GGSSGSSSSGRSGGSSSSGSSSGSKGGSSSGSSSSGSKGGGSNSGSSSGTRNWGSNQYH
FT                   CSGNTCGYGNYFAPSAAAAAAGYGSASYYAQHHNSTSTDNSTSTRTFSGSSSLNIPSTH
FT                   FYIIGLAAAYSIKL"
FT   CDS_pept        complement(1017403..1017858)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382071"
FT                   /orf_name="CD36_54040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41782.1"
FT                   /db_xref="HOGENOM:HBG397432"
FT                   /db_xref="UniParc:UPI000192DCF4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY6"
FT                   /transl_table=12
FT                   /translation="MSLDRSEIFLNYVENFNKRIGALHKTEEYFRQSSIIEAVSIPTNK
FT                   LGKFLDRKIEEFNNTITQIDRDFLDSLNPDLAHRADYSAARKEIGRELGVQRTELFAFV
FT                   YRAIDNMIEKRSKIEKNYHEDLAAIESEFMDGNIDQTEYINTILGDF"
FT   CDS_pept        1018823..1020022
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382072"
FT                   /orf_name="CD36_54050"
FT                   /product="Ribonuclease T2-like, putative "
FT                   /EC_number="3.1.27.1"
FT                   /function="RNA binding"
FT                   /function="ribonuclease T2 activity"
FT                   /protein_id="CAX41783.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0033897"
FT                   /db_xref="HOGENOM:HBG738816"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="UniParc:UPI000192DCF5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY7"
FT                   /transl_table=12
FT                   /translation="MLSILSTATLFVATVQAADFSSSCPLDSPISCSNSGDTSNSCCYE
FT                   NPGGIILFTQFWDYNPASGPADSFTIHSIWNDYCSGGYPQFCDTSLEIDSTGSTIKSIV
FT                   VDQFGDQTLYDNMNKYWTDINGNNPKFWAHEFNKHGTCLNTLNPSCYSNYKQNENVYDY
FT                   YSLVYQLFQKLPTYQWLASAGIKPSTTATYTLSQIQNALKGKFGAEVYIACDSNNAINE
FT                   VWYFYHIKGSILQQNYLPIDTVSKTNCPSSGIKFPPKGESAGNTLTTKTTGTTTSGSGS
FT                   TSVPATSYINLTGKSGCLISNGKYYTSGTCATYHFTAGSSGNTQITSSKGNCGVDSSNQ
FT                   FVCSSSTSATDFQVSGGNIGYNGNFDWCLGAVAGSGSTAQTSVKLSDGSCSSFQLTLSS
FT                   "
FT   CDS_pept        complement(1020304..1021467)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382073"
FT                   /orf_name="CD36_54060"
FT                   /product="Zinc finger transcription factor, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41784.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397433"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DCF6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY8"
FT                   /transl_table=12
FT                   /translation="MTLSSRRRELRASIRENIRQAENVDKEEDTDKHIDQELRHLQHSH
FT                   PQEHEATTNHDATKSNNTIKKEHDGLEDHNNTYDTTNVKREFDGTQNEDDQEEVEVEEE
FT                   EEEEEYHEENEHREEPRRRGTRSKRQKTGAPNITVAPQTRTIFKQIDNPDSTICEHCGL
FT                   VFRNVIDKRNHRRTHSQPKRHECKTCGKKFSQKANLEIHKTHVHHDLILDGDNVELQNQ
FT                   PAEDNSANVFSNDSNSKPTVNLKDVRVFHCNALQCGKGFISYDKLMDHVTTEHPNFVPE
FT                   VKKETKREKKKTQLPKVHQCTFEGCDKSFAKISDYKRHYRIHTGERPYVCEHCGASFNQ
FT                   RYRLTTHTRIHTGEKPFQCKYCGKTFARGDAVQSHIFSIHRAKGEAF"
FT   CDS_pept        1021903..1022940
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248395" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571450"
FT                   /orf_name="CD36_54070"
FT                   /product="Scramblase, putative"
FT                   /protein_id="CAX41785.1"
FT                   /db_xref="HOGENOM:HBG397434"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="UniParc:UPI000192DCF7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHY9"
FT                   /transl_table=12
FT                   /translation="MFSIRGCHNLASRALVRRNLHTATLLQSPRFVNHNFNNRTRVTKE
FT                   ISPEEVRQFQEAQARAREQGQAPRNPYSRQFNNDPCYSFHLPDNTNGIITPHDPIYDIL
FT                   KEPTLVIERQIEFMNLFIGFEQANRYVIMNASGETIGYMEEKDVGFGKMLGRQFFRLHR
FT                   PFDIDVFNARGELALSIKRPFSWINSHIKALLPGYDHNNEIMYEVVGESVQSWHLWRRK
FT                   YNLFKLEDETTDEYEQFGAVDAPFLSFDFPVKNAAGEVIASIDRNWVGLGREMFTDTGV
FT                   YILRYDPKSFEGMEDAYGTISKQGITLDQRAVILSCFTSIDFDYFSRHSGGHGLFPFGG
FT                   SYDDV"
FT   CDS_pept        join(complement(1023935..1023973),
FT                   complement(1022964..1023866))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571451"
FT                   /orf_name="CD36_54080"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase, putative "
FT                   /EC_number="3.4.19.12"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41786.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG329518"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR017390"
FT                   /db_xref="UniParc:UPI000192DCF8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ0"
FT                   /transl_table=12
FT                   /translation="MSQSGWNTIDSDAGVFTELVEKLGVENIEINDLYSIDSDTLRALQ
FT                   PIHGLIFLFKYSKIDREFANSNQPITGEYDGDYLDHDIFFAHQTIQNACATQAVLNILF
FT                   NLQDVSLGEELNNFKSFVTGFDSEMIGETISNSDLIRSIHNSFSTPHSFVDEDKPAPPP
FT                   DRDDKDDGLFHFVGYIFKRGKIYELDGLKQYPISHGACNGQDEFIQKLPAIVQERISKY
FT                   GNELRFSLLAVTNNKLEQAQAMGDQEEIAHQLHKRELWKKENELRKHDYTGLIVQLLKN
FT                   ISKEKSDKEWDEFLQKGRDKTQHLIAQSIKKT"
FT   CDS_pept        complement(1024278..1025189)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571452"
FT                   /orf_name="CD36_54090"
FT                   /product="Succinate/fumarate mitochondrial transporter,
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAX41787.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192DCF9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ1"
FT                   /transl_table=12
FT                   /translation="MSTAQKQKKGAVDFVAGGVAGLFEALCCHPLDTIKVRMQLYRKSG
FT                   QKPPGFIKTGINIVQKEGFLSLYKGLGAVVIGIVPKMAIRFSSYEFYRSFFLDENGKIT
FT                   TGKTFLAGVGAGITESIMVVNPMEVVKIRLQAQHHSMKDPLDIPKYRNAPHAAYLIVKE
FT                   EGFSTLYRGVSLTCARQATNQGANFATYSTIKAYLQKKQNSELLPAWQTSIIGLISGAV
FT                   GPLTNAPLDTIKTRLQKSKFTTKENGLVRIVKIGKQLVKEEGVGALYKGITPRIMRVAP
FT                   GQAVVFTVYEAVKHYLTNETTA"
FT   CDS_pept        join(complement(1026599..1026762),
FT                   complement(1026217..1026514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571453"
FT                   /orf_name="CD36_54100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41788.1"
FT                   /db_xref="UniParc:UPI000192DCFA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ2"
FT                   /transl_table=12
FT                   /translation="MNGSLENRYFKTSNTSLRDNYRRRFLLGHELYIRLCLLDDIFTYE
FT                   ILDIGTVADIHCKLKKYFTNYREIQFFTIISFDSTIDIILRKYLEFFKVIKPVQNKNNY
FT                   AYTNDESVISIPYLLGDHIRSLVLVGDMYLECVLNTACYRNFNVNLYMV"
FT   CDS_pept        complement(1027120..1027938)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077804"
FT                   /orf_name="CD36_54110"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41789.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397435"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DCFB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ3"
FT                   /transl_table=12
FT                   /translation="MSSVIASNIPSDVSPAKVKEFFSFCGKITDLKPLGDNGKVKKYEV
FT                   VFASPKAVSTALLLSDAELENSFIKVEEVPEITEGETGLAPEQGGAAAAAAATTTTAKD
FT                   IKEEAVLTGDKTYDEVDQEEKPKYAIFAQLLADGYVISDQVIAKGIEFDKKNGVSSRFN
FT                   DFIAELDKKYVHSHDPKSTVNQQLQRAQASYEKSGIDQKLRKYFEDAAKSPLGLKIHEY
FT                   YKSFAKDVADVHQEAVRLANIKKRELEEKKHAESGSTAAETKDTSIPQVQ"
FT   CDS_pept        complement(1028356..1028622)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571454"
FT                   /orf_name="CD36_54120"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41790.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DCFC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ4"
FT                   /transl_table=12
FT                   /translation="MSSVLASNIPSKTTPAQVKEFFQSQAGEVSDLIPLADNGKVQKFE
FT                   VLFKDPKSVSAALDLSDAYIDGVAIRVDEVPELTDGQVGKAPQ"
FT   CDS_pept        complement(1029040..1029993)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571455"
FT                   /orf_name="CD36_54130"
FT                   /product="Arginase, putative"
FT                   /EC_number="3.5.3.1"
FT                   /function="arginase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="arginine metabolic process "
FT                   /protein_id="CAX41791.1"
FT                   /db_xref="GO:0004053"
FT                   /db_xref="GO:0006525"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG391953"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniParc:UPI000192DDA0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ5"
FT                   /transl_table=12
FT                   /translation="MSSIQYKYHPDKKASIITAPFSGGQPKGGVELGPDYILKAGFQKQ
FT                   IESLGWTTELKEPLEGTEYEKMKTNDKDEFGVKNSRIVSESCQKIHDAVKGSLAEGKLP
FT                   ITIGGDHSIGTATVSASLVHDPSTCVIWVDAHADINTPKTTDSGNLHGCPLSFIMGIDR
FT                   DSYPPEFSWVPQVLKSNKLVYIGLRDVDDGEKEILRKHNIAAFSMYHVDKYGIGKVVEM
FT                   ALDKVNPNRDCPVHLSYDVDAIDPSFVPATGTRVEGGLSLREGLFIAEEIAQSGLLQSL
FT                   DIVETNPMLAETEEHVLDTVSAACAIGRCALGQTLL"
FT   CDS_pept        join(1030267..1030317,1030434..1030496)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1031301..1034789
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382074"
FT                   /orf_name="CD36_54140"
FT                   /product="Glycerophosphodiester phosphodiesterase, putative"
FT                   /EC_number="3.1.4.46"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /function="phospholipase C activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX41793.1"
FT                   /db_xref="GO:0004629"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG329172"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000192DDA1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ6"
FT                   /transl_table=12
FT                   /translation="MKFGKTYVTHQIPEWSIYYMNYKQLKKIIKSIDSVANTNVDESKY
FT                   PEIISDTLGSFFYDLDRDIEKVDSFYNTKFKEYNRRLNKIFQVLGYQDGQITHNIDSNE
FT                   ELDEIINILIELRGLFRNLKWFAELNHKGFIKILKKLDKKLTSILQQDGGVTVGDVSNH
FT                   NQEAYMGSRINALPFANGTESTNCLDSIHNILSRIETRNNVVQETIPVKNNENSMSALI
FT                   KNDDFEGLKKHITIKSSQKFLISTLNKAALANSTKCIDVIWSQLDMLYDDSDFNGRNFF
FT                   HQHIISLGKAQFIREEQIVPGEVTNRLIGGDNGPDNSNKNDNPVGLLYILNKLKHKRLI
FT                   LAEDHYHRTPLHYSSQYGLVEVTRYLVEFGIKWGLINTSISIDDVSIWGDQEGLTPLHL
FT                   SIIGKHPKTTETLLSFNKAQTLTCPNLLLLAVRLNSPQILNSLIVEGNIDVNYTDIDHR
FT                   NETALYIASKLNHPDLVEFLLESNANTEIGENVFGWTPIFIAASEGFMTIVKLLKEYGA
FT                   LYDIVDDSGWLPIEHACLRGHLDVTDLLLPKNEKLLLYDMYHPENNLPRIPSLAASPVL
FT                   TGSDDGTVSTSSIDKLPEPQKNTVNQFYKQLKNNSSNNVSRSTSPKRNKRYKPVKSFGH
FT                   RYLNEDESLILLTLGTTDLRDTNVPVELNKVSLARSFATELDTALSLSITCRHKSTNNP
FT                   VEPPVVVDLPLEDFHGSATDPISFKLSNNLTVNDVIITFDIIPTYQVNKKVIGRAIALL
FT                   KDAYTKVGPNLRSLNNSIAIPIIESTNLDILGTIRFEYLQVLPFKHRAMSIARSDTYWK
FT                   QLVSTRVIGHRGLGKNLSGKKSLQLGENTVESFIAAASLGASYVEFDVQLTKDHVPVVY
FT                   HDFTVAESGVDIPMHLLTLEQFMGFNRPTEKPTHTVDDEVLTRGKQRAQSSYQLSNNHN
FT                   DDIDKEFTNQTDERMKFTKTWKNQGYKGNLRGSSVASNFVTLRELFRKVPKNVGFNIEV
FT                   KYPMLDEAQLEDMGEIGVDLNFFVDTILKVIYDENTTGRDIVFSSFHPDICLLLSLKQP
FT                   TMPVLFLTEAGTAPMYDIRASSLQNAVRFSKKWNLLGIVSNALALIKTPRLAQVVKSMG
FT                   LVCVTYGTENNEPELAKIQMRAGVDAVIVDSVLAVREGLREHNETMNELEDSPTE"
FT   CDS_pept        1035012..1036199
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077805"
FT                   /orf_name="CD36_54150"
FT                   /product="Type 2A phosphatase activator, putative "
FT                   /protein_id="CAX41794.1"
FT                   /db_xref="HOGENOM:HBG397437"
FT                   /db_xref="InterPro:IPR007303"
FT                   /db_xref="UniParc:UPI000192DDA2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ7"
FT                   /transl_table=12
FT                   /translation="MSETNNPTSSNEKKPVVFAVPSSSSSSTRRGINAVHVNSAREMVR
FT                   LHTQGRNPPARQDNVISLPSGAGAPSHVSRIGTTELMSSNFPKIQIPLHHDETECKNPQ
FT                   CQHCGQIIIPSPQSSYPIQDKPSITVNGWSIFTTKKPILNSLELDHLAETKFDFPLPEM
FT                   IFGNNNVRIRNDVTGGTIEFNAIDALSSLDPNCPLKVSCHEEWLKSRRSKHASLKQEQS
FT                   LKKDLSEFTENLDGLKPYDWTYSTNYKGTVHNLDLKPSELHEIPINKLTKPDPILFFDE
FT                   AILFEDELADNGISILSYKIRVMPTCLLLLCRFFLRIDDVIFRVRDTRCYIDFDTNELI
FT                   REYKVQEQEYDQVMSLVKVKNNKDPKKLFRDSNWVSQNIHVLSKEIDISVVDIQK"
FT   CDS_pept        1036429..1037217
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248397" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571456"
FT                   /orf_name="CD36_54160"
FT                   /product="Superoxide dismutase, putative "
FT                   /EC_number="1.15.1.1"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41795.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397438"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniParc:UPI000192DDA3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ8"
FT                   /transl_table=12
FT                   /translation="MFNSISRGVFASSTRFARVARFLHQVPKLESHEAWTQEGIPGLLS
FT                   PKGYNLAWTDYQNYLLTNLTLLTNGTSSEYKTPYQTLLHTAKQTTQQHVFHYASMAHNN
FT                   HFFFQQLDTKENASKTKPSRFLMEKLMHEDILDLDQLRNKLLTMAENTYGQGWIFLVET
FT                   EDKNLKFINCHNDGTPYYYAKQQLLDLNGGIDEGNFSYLENLKSRALNNEKDYTLPILA
FT                   INYWDYMYIPDYGVTGKSDYLNKLWDHINWDVVNKRLFQI"
FT   CDS_pept        complement(1037293..1038195)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571457"
FT                   /orf_name="CD36_54170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41796.1"
FT                   /db_xref="HOGENOM:HBG397439"
FT                   /db_xref="UniParc:UPI000192DDA4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WHZ9"
FT                   /transl_table=12
FT                   /translation="MSDELGKVCDQILDETLLMSHKYGIPKVESSSQQSASNVKQLEHK
FT                   YYHLYKQLNHKLNHLIYLNKLQELNQKSTQAELDTQLKTIKDQMGIESNQELLDFLKLQ
FT                   NNEIKTEKLLLQYLLMIEPILNSTHRSDLNQSEQRISKMLNELYNDDENDTGLVFQRIA
FT                   NRKNQNELQAGNYNLIKNVVKPIIDGLGELNKTLMTLNKQYVNKKQSQMEDDPEEGVKR
FT                   KQYYELVRKWKELQDMVIEIPSLISDLPINWYDDPTLLQIMQEVDEIQIKLNTYQSIIN
FT                   EDTISAYTTTELLALEFPC"
FT   CDS_pept        1038455..1039363
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534850"
FT                   /orf_name="CD36_54180"
FT                   /product="Uncharacterized protein yjr088c homologue,
FT                   putative"
FT                   /function="binding"
FT                   /protein_id="CAX41797.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192DDA5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI00"
FT                   /transl_table=12
FT                   /translation="MSSDPILVKKKLLQIASTGKYATFTPEQSYTHYEELQDFLVLNQD
FT                   SLLDSIELFNLYELQFYLSILTLHDIEAKNVLDKICDQFDFKDSNKNKGRSQRIKILQS
FT                   VYAESKGEIETASKLLSEDPDELRLSRRLTTLSRHDKNLTKYINNLIYYLNLQPSDLIA
FT                   WAELSDQYQKLGNYDKSVYCLKEVVLQNPLAYPIFYKIGLLYYYLFLQQEGNLKTDKKD
FT                   KLFELMKILINSRDNYLYSLEINDKYEKNWVGLKTIVSLPFNDKLKKISESSKEIKDYL
FT                   NHNEKLKPIVDRKLKELNISI"
FT   CDS_pept        complement(1039568..1039669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077806"
FT                   /gene_name="CUP1"
FT                   /orf_name="CD36_54185"
FT                   /product="Copper resistance-associated metallothionein,
FT                   putative"
FT                   /protein_id="CAX41798.1"
FT                   /db_xref="UniParc:UPI000192DDA6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI01"
FT                   /transl_table=12
FT                   /translation="MSKFELVNYSSGCSCGADCKCASETECKCASKK"
FT   CDS_pept        complement(1040861..1042582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571458"
FT                   /orf_name="CD36_54190"
FT                   /product="CTP synthase, putative"
FT                   /EC_number="6.3.4.2"
FT                   /function="CTP synthase activity"
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="CAX41799.1"
FT                   /db_xref="GO:0003883"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="HOGENOM:HBG597806"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000192DDA7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI02"
FT                   /transl_table=12
FT                   /translation="MKYVVVSGGVISGIGKGVLASSTGLLFKTLGLRVTSIKIDPYMNI
FT                   DAGTMSPLEHGECFVLDDGGEVDLDLGNYERYLNITLTRNHNITTGKIYSHVIERERKG
FT                   DYLGKTVQVVPHITNAIQDWIERVARIPVDDTGLEPEVCIIELGGTVGDIESAPFVEAL
FT                   RQFQFRVGNENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCQEELEH
FT                   ATIEKIGMFCHVGPEQVIAVHDVNSTYHVPLLLKQQKVMNYLTKRLTIGEIDKQSLAKG
FT                   EALLSKWRHLTSSHDKSFETVTIALVGKYTHLHDSYLSVIKSLEHASMRCNRRLKIEWV
FT                   ESSDLEEDTKKENLSKYHKAWHFVCQADGILVPGGFGSRGIEGMVSAAKYARENNVPYL
FT                   GVCLGLQIAVIEFVRSVLGVSHSTSMEFDSNIEEKDASVVYMPDVDQVKLGGTMRLGIH
FT                   QTKFVKDSEWSNLRKLYGGADAVYERHRHRYEVNPLLIDDIEKQGLKFIGKDETGKRME
FT                   MIELKDHKFFVGTQYHPEYLSKVLDPSRPFLGLVAAAAGILEDVLSRDDLNYKGEF"
FT   CDS_pept        complement(1043296..1043886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191978" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382075"
FT                   /orf_name="CD36_54200"
FT                   /product="Vacuolar protein-sorting-associated protein,
FT                   putative"
FT                   /protein_id="CAX41800.1"
FT                   /db_xref="HOGENOM:HBG603893"
FT                   /db_xref="InterPro:IPR008570"
FT                   /db_xref="InterPro:IPR014040"
FT                   /db_xref="InterPro:IPR014041"
FT                   /db_xref="UniParc:UPI000192DDA8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI03"
FT                   /transl_table=12
FT                   /translation="MTDPVPQFEFPKIYSFPPFYTQQPNTTVLNQQLDSWISIILHYCE
FT                   YYRITLLSIEGIPKHSQLEIPLSSLSSIFINKTINRQVNSDFQKLIIKHLIHNKKAEFI
FT                   NPKKPELGVFIYWRSIVDWGDLLYQYVDDTGQKGTVLTIYELTKGEETTVPQDLHNLDE
FT                   SFLVKIIKDYLIKQGKAQLLIDENNDIGGVKIV"
FT   CDS_pept        join(complement(1044890..1044891),
FT                   complement(1044241..1044517))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571459"
FT                   /orf_name="CD36_54210"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41801.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG610728"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000192DDA9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI04"
FT                   /transl_table=12
FT                   /translation="MTKRTKKVGITGKFGVRYGSSLRRQTKKLEVQQHAKYDCSFCGKR
FT                   TVQRGATGIWNCKSCKKTVAGGAYTVSTAAAATVRSTIRRLRELAEA"
FT   CDS_pept        complement(1045350..1047704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229184"
FT                   /orf_name="CD36_54220"
FT                   /product="Component of the SCF ubiquitin-ligase complex,
FT                   putative"
FT                   /function="ligase activity"
FT                   /protein_id="CAX41802.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397441"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000192DDAA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI05"
FT                   /transl_table=12
FT                   /translation="MSSPTSLDDLSNIPETGNTIKTLHELKQESSPDSNNEMNIDGEIS
FT                   NDNSHHSDGNHKTHTYGADFVMDNEYNDYEELRKSLVNKRRLSSIKRPHGPFFDHNNQI
FT                   DKRSLLRLPTEILLQIFHYLERRDWYSLLTTCSEIADLIIEMLWFRPHMQNDSAFKKIK
FT                   EVMEINKSVTHWDYRQFIKRLNLSFMTKLVDDELLSLFIGCPRLERLTLVNCAKLTRYP
FT                   ITQVLHGCERLQSIDLTGVTDIHDDIINALADNCPRLQGLYAPGCGNVTEEAIIKLLRS
FT                   CPMLKRVKFNSSTNITDESILAMYENCKSLVEIDLHGCENVTDKYLKSIFLDLTQLREF
FT                   RISNAPGITDKLFESIPEGHILEKLRIIDITGCNAITDRLVEKLVSCAPRLRNVVLSKC
FT                   MQITDASLRALSQLGRSLHYIHLGHCGLITDYGVAALVRYCHRIQYIDLACCSQLTDWT
FT                   LVELANLPKLRRIGLVKCSMITDSGILELVRRRGEQDCLERVHLSYCTNLTIGPIYLLL
FT                   KNCPKLTHLSLTGISSFLRREITQYCREPPSDFNEHQKSLFCVFSGHGVNQLRNYLNQV
FT                   VEERTYQIDQGDIHTLFNERRRRFLNGDFDMDEEEMNIWERRRGLGVTADLGHPDMAEI
FT                   NREIFRELNEGNMGPDEMREHFQRLIRNHHQQRLLEHQNRLNQQLVQQRQQQQQQEPQL
FT                   EQANTQNRGQTETQAQDQLQNEVQLRLQPPLQQQQQQQRAQNTIINNPQNAPQIEQPAV
FT                   FPNGGNQTLPLVLNEDEDVDMEPVDLFPRNT"
FT   CDS_pept        1049231..1050565
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382076"
FT                   /orf_name="CD36_54230"
FT                   /product="Cop9 signalosome complex subunit, putative "
FT                   /function="binding"
FT                   /protein_id="CAX41803.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397442"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192DDAB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI06"
FT                   /transl_table=12
FT                   /translation="MSGLVNYVHEFGTALKEENSKALTKCLTISPTITIANTRKDFPEP
FT                   SDVDLFHIPEKFRPVLKCHIQLMKAVYNEKSLDKAFEVLNQLILNLIMASDFLTNWINH
FT                   PLIKSLSELIAIYKTKESRNPEDLDSFIEDDTDAMDGTQSQKSCLETLVITFRKACQLS
FT                   LGDKNLDWKLSKRNDVYYFLANFVKYCFKLGKLDLAKSVTKAVKNISDRLPALDSSVKT
FT                   KKYGVIYLYYQALMALDDGDYVESEKNLDYALKLMDDYQDLKSNQLGQILLVLIPLKLY
FT                   NHGQFPSKKIWLKYPVLRALYRDNFLKAILEGNIARFNQSLEKFQTILLKKHLYVLIEM
FT                   LRPLVHLQLIKKTYNLNMELNPDSKTKHVIPIRAFQLALEYSTFNKNYKCDFNFAGDHL
FT                   YTISKFETECIVGYLITKRRIKAYLSVSKEGCVIFAKTDVFPKPS"
FT   CDS_pept        complement(1050703..1051698)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077807"
FT                   /orf_name="CD36_54240"
FT                   /product="Mitochondrial inner membrane protein, putative "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41804.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG397443"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI000192DDAC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI07"
FT                   /transl_table=12
FT                   /translation="MFSNRINRLGPLVLRSSSYRHPGVRNFSIDHNAIVNTMTSTFQTV
FT                   HEFSGLPWWILIPLTTFTLRSVWTLPLAILQRKRIQKQSELRPLVSAMNPILKLNLARR
FT                   VQSAKKKLENSPNNKEDVTSISASSTLSNMKYEQILLLSAKESRNRQKELFAKNGVQLW
FT                   KNFILPTFQVPLWIMMSITMRDLSGWSSWDNTHNKALDPSLYEEGILWFQDLSIADPMH
FT                   IFPVILGITALCNIEWTLKTLELSRLTKKLKFRPTLTDAFGNLTKMSIVFMMAISLHAP
FT                   AALTIYWISSQFYSLLQNVMMDLMLPISFTPKKRFNYAKIKNDDAVNVIN"
FT   CDS_pept        1051925..1052263
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571460"
FT                   /orf_name="CD36_54250"
FT                   /product="Transcription elongation factor, putative "
FT                   /function="translation elongation factor activity "
FT                   /protein_id="CAX41805.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="HOGENOM:HBG623003"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="UniParc:UPI000192DDAD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI08"
FT                   /transl_table=12
FT                   /translation="MSSRSERACMLCGIIQPMKAFIDYGCPNCESLLHYQYNDNKQVQD
FT                   CTSPSFEGLVALGEDNKGSWVARWLRIDSFTAGLYAVKVNGKLPPSIIAELEEQNVIYR
FT                   PRDGSAED"
FT   CDS_pept        complement(1052382..1056293)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571461"
FT                   /orf_name="CD36_54260"
FT                   /product="Member of CDC48/PAS1/SEC18 family of ATPases,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAX41806.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG756787"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000192D2DC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI09"
FT                   /transl_table=12
FT                   /translation="MGRRGRQRKVIHDEDDDLDHAYDELPSRRATKTVSYKETDEDEDV
FT                   DEELDGIKGLPDGTVSQDNGMQATELNNEEALDDDAYGEEGQDDFPKSRGRRGRRKRSH
FT                   IESDDDEFKEDQVEESEDEDLVLSADDEEFIERKRTDNFIVKDDNEWGEDDEEDDGEYG
FT                   VKPKKRKTSRTRRTKSTSNSTGSRRATRSGRVLDDPDTTLADGTVESEGELDIQKEIAE
FT                   LYDSSPIHGDVEQPHKLRQRTKVDYTIPPPITADFQLEREFRPATPTNVRSRRGRTGAP
FT                   KSEFRKILYPTAGPFGGSDVISLFGKNIPPGGIPIPGMTGAPNMTAIGQNFSDSDSSED
FT                   EIAPINGEATISKKQPKAKKQNIGGPKLITGGSDDSSGKKKKSTLSDTDPLGVDMNIDF
FT                   SVVGGLDNYINQLKEMVALPLLYPELYQNFAITPPRGVLFHGPPGTGKTLMARALAASC
FT                   STSERKITFFMRKGADCLSKWVGEAERQLRLLFEEAKNQQPSIIFFDEIDGLAPVRSSK
FT                   QEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAIDPALRRPGRFDREFYFPLPDLG
FT                   SRKEILKIHTRKWNPQLPDIFLDRLAQLTKGYGGADLRALCTEAALNSIQRKYPQIYGT
FT                   NEKLKVNPSKVKVVAKDFMKAIEKIVPSSARSTSSGSAPLSEHLKPLLQSEYQEIIEKL
FT                   NQLLPNTVGLDGKKKFTALDEAKYLDPTINDEDGGFAKQQLLKNLENSRICRPHLLISG
FT                   NEGNGQQYLSAAVLNHLEGFQVQSLDLGTMFGEPTRTPESTIVQAFIEARRHQPAILFI
FT                   PNIDIWFNVLPDPARATLTSLLRGLKSNEKVLLLGISETPIEDLSHEIKLVFGFQSATN
FT                   NVILHNPQRSDRTEYFATLKKTLLMKPYEFVNDLENRPKRKLKELKVVQNSVDMSNDEL
FT                   NKKKLKEQEYKDTKLKNVLKLKLAGLMDLFKVRYKKFRKPIIDENLLAHLFEPSILENN
FT                   PFNNYVVQYVRSEDPAHPNMIQELATGKYYYNMDLDLIEERLWNGYYSEPKQFLKDLKM
FT                   IVKDCIVSGDRERILKANEMMTNAQFGVDDFSTPEFLQACKEVRERDLLKQQKLLEEHK
FT                   KLQEEWNKKQEELQAQQEEQQQQSADAPNGVLPVSELMNGTTDNPISTNPEAVDENKEP
FT                   VLENTTENIIEGEQKVISKEAKVEMQENETNVEKDTNGKDISLSLDNVDESESESESES
FT                   EAEEELNIDSTREVEIDLQELDSITTELLDITEDYNVERLEVCMARLMDIIWKDRNNWN
FT                   KFGTLENLKQTIKSLEITL"
FT   CDS_pept        complement(1057213..1058946)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571462"
FT                   /gene_name="MSM1"
FT                   /orf_name="CD36_54270"
FT                   /product="Mitochondrial methionyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.10"
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41807.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="HOGENOM:HBG721667"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI000192D2DD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI10"
FT                   /transl_table=12
FT                   /translation="MRFQIKGPFIQFRYKSTKPFYITTPIFYVNAAPHIGHLYSMLIAD
FT                   TRNKWEKLNPSKESFMLTGTDEHGLKIQSTAEKLGLEPKTLVDKVSQNFSKLAEQFNVN
FT                   YDRFIRTTDDDHIDLVRYFWNLMMERGFIYTDTHSGWYSISDETFFPETQIEEVVKNGK
FT                   VVKISSETKNEVVYQEETNYFFKLSLFQKQLIQFLKQNPEFIKPTHRYQFILKELEDTK
FT                   LPDLSISRPSSRLKWSIEVPNDNTQKIYVWFDALLNYLTATEFPQDFEVKDSKYITPEN
FT                   SIWPATHVIGKDIIRFHCIYWPIFLMAAGIELPKQVIVHSHWLCDGFKMSKSLGNVVDP
FT                   MEISEYYGVDPVRFFLVENSNIDDDCKFSEELLQRSRDAVLGKYCNLISRIGGKNFSIE
FT                   EAVKSCAGGEFNNIREIIETCTINKDSVDGLLSSSSKLTTDLNDLYNQMDHYFTNFEYI
FT                   RAIQSWWSVINQANQIFQNAEPWTYVKLINSPDTPAELKEKYRVLTNYFVYLCGETARI
FT                   SSILIQPVMPQLSKKILDRLDVSGRTSDFATLGADLKYGSGANSKSHKVPLEKLAPRDI
FT                   K"
FT   CDS_pept        complement(1059104..1059859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571463"
FT                   /orf_name="CD36_54280"
FT                   /product="Vesicle transport protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41808.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniParc:UPI000192D2DE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI11"
FT                   /transl_table=12
FT                   /translation="MAYYQQQMGNPQNMQFYQSNYTYQQPSNAQGTSGMMGSMDSNFGS
FT                   NIDVSGVMGNGELTPGLLAAFGTSGYPGEPPLLEELGINFQHIRSKTLVVLNPLTKDIP
FT                   SDIMADSDLAGPILFVLLFGTLLLLAGKVQFGYIYGVGLFGIIGLHYLFKFMSNETTID
FT                   LIRSASVLGYCLLPLVLISVLGVVTNLDNLAGYILSAIAVMWCTYSASGFFVSVLKLHN
FT                   VRPLIAYPLCMFYTVFALMAIFVENVEEK"
FT   CDS_pept        1060352..1061959
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382077"
FT                   /orf_name="CD36_54290"
FT                   /product="Signal recognition particle (SRP) receptor
FT                   subunit alpha, putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="receptor activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="CAX41809.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000192D2DF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI12"
FT                   /transl_table=12
FT                   /translation="MSQSLIIFKPSGKVEYQLNNKIHPFNEFISSIVNETYTTISLNFT
FT                   TKTLNNRRFYCYNKDNVYVALYFDSITTIDNDQIKQTLTGILKTFNKLEPESDGDKLKK
FT                   LVDMQFNNLMKLKQQEKVQEPNITSPVRSGSSTPKKIESKQPANSKKMRKWDNGEIVEA
FT                   NDGKALDYSANQGTIGTEFLPELKIDKSAFTKERDLVLVNELNEILNESDDESESPDQT
FT                   SGSVGNGFFSKIGSYLGGTINVDEVSKKFREQLISKNITPGTATTIIDKIKTKLSTNKK
FT                   VTMAVYKQALTDELTKILTPNVSTDLLHDIKRNAELNTRPYVISVVGVNGVGKSTNLAK
FT                   LAFWFLQNNLNVLICACDTFRSGAVEQLKVHVNNLNRLNEASTNTKSRIDIFEKGYGSG
FT                   DHVVQTAKQAIQYAGENNFDIVLIDTAGRTHSNAKLMAPLKKFGDAASPNKIIMVGEAL
FT                   VGTDSVEQATNFNKAFGNKRTLDFFIISKVDTVGDLVGTMINMVMATNVPILFVGTGQT
FT                   YTDIKRLSVKQVVEMLMK"
FT   CDS_pept        1062682..1065894
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382078"
FT                   /orf_name="CD36_54300"
FT                   /product="Phosphatidylserine decarboxylase proenzyme,
FT                   putative"
FT                   /EC_number="4.1.1.65"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="CAX41810.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG324187"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI000192D2E0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI13"
FT                   /transl_table=12
FT                   /translation="MRSSGYLNSNNGSSTSLESNNVNKSTDKNQLYLKVVCNCATDLVP
FT                   QGITGTGSESKKTYSSSKSINPVLVVQLNNTIKSTSKKLNTNQPSWNDELYMPLKHQDD
FT                   SSLLIFSVWDKHTRYKNYLGELRLNVRDVFVDNGNFVDKTELKWYHLNSNTKYHSFITG
FT                   SILVGFELVIKNKKKRFHSSYNDKFQQLSIDSDVESAFKSWLSNLTKPTIYSVNNKINP
FT                   NDQGFYDDELVNEADLESVLTDKSKKSHLNVPGVNGLLSVPGDDSNDAGSFSDTSFLSD
FT                   GGYASDASANLFDHREALPDSKKSRIKSKMRLRRSKQEYENFELASRQVLGVVFIEIVS
FT                   CEDLPPYKNFTRTSFDMDPFVVVSFGKKTFRTGWKRHTLNPVFNERLAFELLPHESNFS
FT                   IQFLVLDKDHFSFHDNVAHISLPLRTLTEYATAKPTEGENSDVNTSDSNSNSQIGNGFT
FT                   TEDTEFPENDSVQIIENETPSNKQSRKRYLSRKKVVKTHLDLKKFKAMSLSLQLHDQKY
FT                   IGKYAPKLKIRVRFETYPELRKKFWRVLLEESISTPDNRDSCDYIELISLLDTLGCVNS
FT                   DELVELFYSNLGKSSWGGDLLFFDEIVDQMETYINQNADNGKVKIFEFEKCPICNQKRV
FT                   SKKQDLDIITHFAICASKDWSVVSKLLSSSYVTPTQATKKWFTKALIKLTYGKYKLGGN
FT                   SANILVQDRMTGIIVEEKMSVYVRLGIRLLYKGLDKARSKRVRILLKNMSIKQGKKFDA
FT                   PQSKSDIASFIRFHKLDLDECEIDDPSQFATFNDFFYRKLKPGAREIEDEKNSKIVTSP
FT                   ADCRSVVFESIDKATQLWIKGTGFTIPKLIHNDHSMRISSYTLGIFRLAPQDYHRFHSP
FT                   VDGVIESIKHIDGEYYTVNPMAIRSELDVFGENVRTIVTIKTKDFGNIYFIAVGAMMVG
FT                   SIVLTKDTGYEISKGEELGYFKFGGSTVLLLIESDKFKFDTDLVKNSSSGLETLLRVGQ
FT                   SIGHSPDIDEYKRDHISFDKLDKNKQLRLIRVLTGGDLKDKHMLSNWEATKIDMEDFQA
FT                   IEDEETFDEDILDEDASIKSED"
FT   CDS_pept        complement(1066970..1069216)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229185"
FT                   /orf_name="CD36_54320"
FT                   /product="Methionyl-tRNA synthetase, cytoplasmic, putative "
FT                   /EC_number="6.1.1.10"
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41811.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="HOGENOM:HBG721667"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="UniParc:UPI000192D2E1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI14"
FT                   /transl_table=12
FT                   /translation="MSLEVYGVKGNTLLALANNLKLSIALAAFQPKVELALNEVESNLS
FT                   LKDKKSGFELVEPNAIVKYLANDFNTTEAIQFEEEVLYAAIKSNKKDEIAKITGLPKFA
FT                   KEELTPSQIIVFASLYPAFKDNKENEWFIKFSQLPEVATGIKNALEITPVEREKETNTG
FT                   KQNVETGHLVKKQANKILPKSDERNILITSALPYVNNVPHLGNIVGSVLSADIYSRYAK
FT                   NRNYNTLFICGTDEYGTATETKALEENVTPQQLCDKYHAIHKEVYDWFDIGFDYFGRTT
FT                   TPLQTEIAQDIFMKLHNKGYLEEKTTEQLYCEHHKSFLADRFVEGTCPKCDYEDARGDQ
FT                   CDKCGNLLDPLELINPRCKVDGNTPVVKESTHIYLKLNDLEEPLKEWVLDSSAKGAWSK
FT                   NSKNITDSWIKRGLEPRCITRDLIWGTPVPLKGYDKKVLYVWFDATIGYVSITANYFKD
FT                   SNTDDYLKWWRNPENVDLYQFMGKDNVPFHTVVFPASQIGTGDKWTKLHHLSTTEYLQY
FT                   ENGKFSKSRGVGVFGNNAKETGVSPSVWRYYLASNRPETQDAHFSWDEFVAKNNSELLA
FT                   NLGNFVNRIVKFVIAKYNGVIPKFDTKNIPDYGKFETDINSLLASYIDNMENVNLRKGL
FT                   ELAMAISSRGNQFLQDNKLDNSLYANQPAKSDAVVAVAINLVYLVSAIIYPFMPETTAK
FT                   IDQILNAPALSITNKFELVLLPGHCIGKAQYLFTRIDDKKIDEWRKLYGGQQKK"
FT   CDS_pept        1069444..1070796
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571464"
FT                   /orf_name="CD36_54330"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit,
FT                   mitochondrial, putative"
FT                   /EC_number="6.3.5.-"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="transferase activity"
FT                   /protein_id="CAX41812.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000192D2E2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI15"
FT                   /transl_table=12
FT                   /translation="MRKTVTPIRLLSDGIRVKDKWNSLISNLEIEPTNSAGPLSGTTYI
FT                   VKDNIVTNHGYTTAASKILSNYESPFNATILDLLSNNGSKLIGKSNLDEFGMGSANYNS
FT                   YFNKVINPYDDTKVPGGSSGGSAASVAGKMCSFSIGTDTGGSVRLPASYCNVFGFKPTY
FT                   GRISRWGVIPYAQTLDTVGIIGDNVNIIKRVYDVLNRCDNKDPTCLPEDVRKKIPTTEK
FT                   KILTIGVPNEFVLKELSADVREAWEYALTKICELGHSVKPITIKTIKKALPSYYTLATA
FT                   EAASNLSRYDGIRYGYNTNEMVHSPIELIATNRSNGFGSEVQRRILLGNYTLSSDSGDH
FT                   YLRATQIREELCAEFSSVFNNSHVLLQDEQSSNNVDLIMSPTSTSTAPTWDEYVSANEK
FT                   NFLNSYVNDVLTVPASLAGIPAISVPVNGIGIQLMGQFGDDDLVLQLADQI"
FT   CDS_pept        complement(1071087..1071929)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382079"
FT                   /orf_name="CD36_54340"
FT                   /product="GTP cyclohydrolase I, putative "
FT                   /EC_number="3.5.4.16"
FT                   /function="GTP cyclohydrolase I activity"
FT                   /biological_process="one-carbon metabolic process "
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41813.1"
FT                   /db_xref="GO:0003934"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="HOGENOM:HBG370191"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniParc:UPI000192D2E3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI16"
FT                   /transl_table=12
FT                   /translation="MSNPSHNPKHHLREEDANGTQEGLKSTVPIKRSKLVASSNLVSPN
FT                   FLPRDLIETPLQTRAASPLILNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIASAV
FT                   KVILEELGEDTSREGLLETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRD
FT                   IEIYSLCEHHLVPFFGKAHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMAL
FT                   SEILKPRGVAVVIEATHMCMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEFLTLLGRK"
FT   CDS_pept        complement(1072365..1076186)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571465"
FT                   /orf_name="CD36_54350"
FT                   /product="Exosomal 3'-5' exoribonuclease complex subunit,
FT                   putative"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="CAX41814.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG397445"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="UniParc:UPI000192D2E4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI17"
FT                   /transl_table=12
FT                   /translation="MSSSQDYNNNNNNAPARVSSRKGKNLHVAHRRSPSELTNLMVEQY
FT                   NLQRQLEEVQAQQKLLEEKQKQQQQQFTYPLAQGSSELAPPPISSGYGGNRSSHSRSSS
FT                   INTHRRTGSGSGGTAHGHSRRHSLGLNEAIKAAANQKQSNRNSLSPTIPSEVKVDSSDD
FT                   IGSFKFPPSSGDQGDSSGQSSSHNRSRSLAYGQQSFKFPPTPDQSNDNRGNSLLPPNPN
FT                   FTVTQSPDRGHNRRSSHFRTASRGSGNNNTDGINSNWRAQQQSPQQQQRSGGLLEPPQV
FT                   GFTPGHKPRNSSYGGGSSVSSLQQFLPNNGGSNNSSQQGGHQGGGNNGRKTLFAPYLPQ
FT                   SSLPELINEGRLVTGTLRVNKKNRSDAYVSTDGLLDADIFICGSKDRNRALEGDLVAVE
FT                   LLIVDEVWESKKEKEEKKRRKDNTLNSRPLTDDIHNDATSAPNTAEGSVTGTSKEDGAG
FT                   SNEEETGGLARRGSLKQRPTMKKNDDVEVEGQSLLLVEEEEINDEIKPLYAGHVVAVVD
FT                   RIPGQLFAGTLGLLRPAQAAQAARDKKNGKESTVQNPKAPKIVWFKPTDKKVPLIAIPT
FT                   EQAPKDFVENHEKYADRLFVASIKRWPITSLHPFGTLVSNLGPIDSPETEIDSILRDNN
FT                   FLCDEYPDDDDENDIVSVNAYDLPPIEPEFEGAQREEYLNDYIIAFTQNGEFVDHALHV
FT                   KRISNTKIELGFHAADIAYFIKPGSSLDRKSKKRSSSVFLPQKTVNLFPKQVNKMVSFK
FT                   ENEKNLAVSVVFEIDTSNFEVEDLYIHESVIVPKQLVTYDAFDTILSGQSVDSISSATS
FT                   DYVKTFSLIAKEFRRHRLSNRSLGITPNLTLLDQLDDEKVRLDLNIFKDSLAFDVISEI
FT                   SHKVNSAIAAKVHAGLGDQAILRRHPLPTLQKMETFVRKATSLGFKIDTTTSSTLQNSI
FT                   LKIDDPVKRKCVETLLYKCMSRGKYYVAGKQDADSYAHYYFNLPLYTHFTAPLRRYADL
FT                   IVHRQLKAVLNKQVEDKDLDSLKAITDYCNFKKDCAASAQEQAIHLLLSQTINEMSETA
FT                   GQLLCMGTVVQVYESSFDVFIPEFGVEKRVHGDQLPLVKAEFDKGERILELWWEKGVDS
FT                   ATYIPPDEKSSLSYRNSIKNKYRTSALQAAKIQSKTALEKSTTPADSVAEKLSKLNLEP
FT                   PKLTVPSLKGNELNAVEKDETRSMPSSPTQAEIPKNIRTNSSSRISASGNTFSLEPYLQ
FT                   NTITRVEGDSYIQVIKELTQVPVLLRAEIGMALPCLTVRVLNPFAEER"
FT   CDS_pept        complement(1077644..1079068)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571466"
FT                   /orf_name="CD36_54360"
FT                   /product="DNA polymerase III (Delta) small subunit,
FT                   putative"
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAX41815.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG324241"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI000192D38B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI18"
FT                   /transl_table=12
FT                   /translation="MSSSQYYNKEVDESVVSRQTIEEFTKRNEFFLKPGSRKYAKQYFS
FT                   MYQYRLKNLRDRAHKTAMEKWGHGTKKINGNMIEKQDKILDIASGKLCWVIGTVFCDAK
FT                   YKLDILNDVEKGTDDVLPLEPVTYVDKNEQPIVMLEDESGRAILNNDNFLTKNLLVTGC
FT                   IVAVLGIEVQAGIFEIMDIAYPDCAPQKPLTLGENKRGKIALVSGLSIGGEGQYDLKLE
FT                   LLKQYLLGELGNAEDKLNTSQISSLIIAGDSIMPISNLRAEMDLKNYVTTNNYGSKNIS
FT                   KYNANSFKKLDEFITDIIVSLPVAVMPGKNDPAEICLPQQPLHRSLFKNNSSLLNGDRL
FT                   NRLTNPQWIDVQTVKILGTSGQNVDDIKKYIAPQNDHQFTSIEIMENNIKWQNFIPTAP
FT                   DTLYCYPYENYDPFIFCDDLPHVYFVGNQQSYDSKLLQYDGVNIRLISVPKFKESGQFV
FT                   LLDLDTLETEVVTIEI"
FT   CDS_pept        complement(1079323..1080993)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571467"
FT                   /orf_name="CD36_54370"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41816.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D38C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI19"
FT                   /transl_table=12
FT                   /translation="MAKTSKSKGNHKKSETSKVSRKRSHEDSESEVEDNEKVVEELDAD
FT                   FDEVAGLLGDDIEDPESKSQSKKEKQKAKDEAKLEKLTKPQVSKEITEDDSENVLFENA
FT                   DLSEPTMRAIKEMGFTKMTKVQAKTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLYS
FT                   LKIKPRNGTAVIIITPTRELALQIFGVARELMQFHSQTCGIVIGGADRRQEATKLSKGV
FT                   NLLVATPGRLLDHLKNTQFVFSNLKALVIDEADRILEIGFEDEMKQIIKVLPNENRQSM
FT                   LFSATQTTKVEDLARISLRPGPLYINVVPEKDVSTADGLEQGYVVCDSDKRFLLLFSFL
FT                   KRNVKKKIIVFLSSCNSVKFYSELLNYIDLPVLDLHGKQKQQKRTNTFFEFCNAKQGIL
FT                   VCTDVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTARGTQGKGKSLMFLTPSELGFL
FT                   RYLKAAKVPLNEYEFPANKIANIQSQLTKLIKTNYLLNQSAKDGYRAYLQAYASHGLKT
FT                   VYQIDKLDLKKVSASFGLDQVPRVNLSIGGTKTKKQKRS"
FT   tRNA            1081699..1081771
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        1082045..1082923
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077808"
FT                   /orf_name="CD36_54380"
FT                   /product="Uncharacterized mitochondrial protein, putative "
FT                   /protein_id="CAX41817.1"
FT                   /db_xref="HOGENOM:HBG397446"
FT                   /db_xref="UniParc:UPI000192D38D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI20"
FT                   /transl_table=12
FT                   /translation="MFCRSRTISVKHLQSFRSFATRSSFDSPFDHLPKLNNRSWFNWKT
FT                   TTAFFLLGSYLAYNETLFNYYEKYTEIDEKDPNIKILPMQLEYKLKNLPIYQQLAHPKN
FT                   SHQWYKLQSWENLDRNILDNQTKVKKQDEYQEPTLTNQTLNKPGGILIKPVIFHNIETD
FT                   EGVHIVHAGYRLCGYPFIIHGGIIATLLNETFKRNASLSKYTTSNLKDDFKVENLIINY
FT                   KRPTLANQFLIVKTKKKESPENDNRTIVLESVIEDSKGKVLVKSEALLHDTGRATNRIK
FT                   QQTENSKKSWW"
FT   CDS_pept        1083222..1084622
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094242" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571468"
FT                   /orf_name="CD36_54390"
FT                   /product="Subunit of the COMPASS (Set1C) histone
FT                   methyltansferase complex, putative "
FT                   /protein_id="CAX41818.1"
FT                   /db_xref="HOGENOM:HBG397447"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI000192D38E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI21"
FT                   /transl_table=12
FT                   /translation="MNKETSEEPSIEPQVQGNESIEETQSEHTYSTRSKERKREEELQR
FT                   KSQLKQKQHNVIIHPRLKPVPFKNSDLIPVSLPEPNAATTINEIEFFQTEDLPLNKRGF
FT                   KYKHCRPNPNFPSNLYSTTDVPPYHVCTSLFDRSSGVLFSNDLKSITTSQGWRSARTNV
FT                   CIREGSYYFEFKILNSNEKSHVRIGIGRKEASLEAPVGFDGYSYGLRDVDGQFMTISRR
FT                   QKLCVENGFKTGDVIGFLIQLPSLEEHRRAIEEFVNEKSQLQPEQKLKKRKKKKIENDI
FT                   KDNVKFIEHGNIVRDQIPIKYKNGLYYEQYEYTTTKTMEHLLNPVTVFGEKAIIEMDDK
FT                   RKNIPVIPNSKIRLFKNGVEQESIIDLYSFLPTNIEDHEDINLGPNTKQQQNPNYRNTD
FT                   DGTLGYYPMLSAFQYGVVNLNAGPNFEFPPSEPVKPLSDRYNEQVVEQFYWDILDEVEA
FT                   EYLDSFDL"
FT   CDS_pept        complement(1084617..1085351)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094243" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571469"
FT                   /orf_name="CD36_54400"
FT                   /product="DNA repair protein, putative (Subunit of the non-
FT                   structural maintenance of chromosomes "
FT                   /protein_id="CAX41819.1"
FT                   /db_xref="HOGENOM:HBG397448"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="UniParc:UPI000192D38F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI22"
FT                   /transl_table=12
FT                   /translation="MYSEAHRLLLTYIRSVRYVEAGVLLEAFKFMIEKLQLEIQASKNI
FT                   LDQYIAEINSKISGQNFKIERKTHEITGDLYYIFINTLSDEIVQESSVYTTAELTVIKY
FT                   LIRNIIEASDYRCSLARVNANQTISTNTNKNLMEADSMVDRLIDDGWFISTIDDRLMLS
FT                   IKTLCELKEYLIETYGVNDDTDADGKVLLCTQCKEIVTLGWIIPSGKPFHKKCYDVYCR
FT                   TNQIYPEDESDLLRVGPDPSTL"
FT   CDS_pept        1085765..1087330
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382080"
FT                   /orf_name="CD36_54410"
FT                   /product="Cell wall glycosidase, putative "
FT                   /EC_number="3.2.-.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="cell wall"
FT                   /protein_id="CAX41820.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="HOGENOM:HBG397449"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniParc:UPI000192D390"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI23"
FT                   /transl_table=12
FT                   /translation="MYKSIITFLILFLRYVLSESIDNLYEEKEEDDDNDGYDDNNSDYD
FT                   GQRQKCNPYRDKSCLANDEALGRKIFESFAEGTKYFTITSSTRGIRFGAEGLALTIQDE
FT                   FDNPALVSSFYIMYGKVEAEIRGAAGKGIISSFYLQSDDLDEIDVVEIFGSDPYEFQTN
FT                   FFIKGNTTTYDRGRYHEMHPSPLSEFHKYGIEWSPDLITWYLDDKPVRMLGRRNKHGLP
FT                   CSPMFLKFSLWSVEEDDEGTIAWAGGAAKFSEGPFTMHIKNLKVQDYSKALSYTYGNLH
FT                   DGNWLDLRADGGYLYEGHKYCRPPKMLEKSKPTSKTATGEKQVFTSSKLQKIVTTAINK
FT                   ERITSLSYIPSATNSPTTWDQLSEWETEEDEMGMGTGTGTGTDGTDENEESDNDDNEES
FT                   ITATPRKVSTRRLNILTQSPQLSQNESKVATKITNTTTKNIHNTTISVKISKIDSKKIE
FT                   ATSIYYSSSTPQPTSRARMPYNIFFNYPGKENSRFKSGVSSILSTSFTGVVIAEILVIV
FT                   VLLL"
FT   CDS_pept        1088060..1091056
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077809"
FT                   /orf_name="CD36_54420"
FT                   /product="6-phosphofructokinase subunit alpha, putative "
FT                   /EC_number="2.7.1.11"
FT                   /function="6-phosphofructokinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="6-phosphofructokinase complex "
FT                   /protein_id="CAX41821.1"
FT                   /db_xref="GO:0003872"
FT                   /db_xref="GO:0005945"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG324640"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniParc:UPI000192D391"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI24"
FT                   /transl_table=12
FT                   /translation="MPSPDAINRISYISLVTSDIDKFNQTFQFYSQLGFRLTKSFSKIS
FT                   SYGSGLGDNHPEFQLGVSHDSLKEAWLESYPLQNIDNNGNLRPWQEMEIYDGDNCQRLN
FT                   ESTVIKIRLLNEKFFLNSSIPQQKQFVFFTTQLNQIENILNNLNIKYGKIIDNVILTED
FT                   PLNNIISFSNTENELCKTRYLSPEDFVEKTTTEILTKRKKLQLDSKYGSFEEISSTEVT
FT                   NGGNGGNGGNGGGGRKKKIGVMTSGGDAPGMNPAVRAVVRAGIYYGCDVYAVYEGYEGL
FT                   VKGGDLLKKMEWSDVRSYMSLGGTSIGTARCKEFRERTGRLQGAYNMIKNGIDALVVCG
FT                   GDGSLTGADLFRSEWPSLVKELVDSGRLTKEEVSPYEHLTIVGLVGSIDNDMSGTDVTI
FT                   GAFSALERITEMVDYIGATAASHSRAFVVEVMGRHCGWLALLSGLATGADFVFIPERPP
FT                   KAGLWKEQLKEVCLRHREYGRRKTTVIVAEGAIDDELNPITSEEVKQVLVDLGLDTRNT
FT                   ILGHVQRGGTAVAYDRRLATLQGVEAVKAVLEMTPETPSPMIGILKHKIVRIPLVDAVK
FT                   QTKAVAEAISNKDFDKAMGLRDNSFYDDYRYFRDISIYDDGSKQLNEDKRLNIAIVHVG
FT                   AASAGLNAATRAVALYSLSRGHKLYAIQDGFTGLVKGNLKNLTWMDVEGWHNLGGSEIG
FT                   TNRSLPSQNFGQVAYNLQKYNIQGLLIVGGFEAFTSLHELSQQKSNYPIFEIPMVVVPA
FT                   TVSNNVPGTEYSLGSDTCLNQLVSYCDAVQQSASSTRRRVFVVEVQGGHSGYVASYCGL
FT                   ITGALATYTPESNINLRELQGDIDLLQKVFATDRGEDHNGTLIVRNEQASVVYSTELIA
FT                   NILKENANKRFETRTAIPGHVQQGFTPSANDRVMAVKFSLKAMEFIETRNGCYDKQNRK
FT                   FSDEEISEHSQVVIGIHGDVVKFTCIKHLYENEANVILRKGKTVHWTDMIDVANILNGK
FT                   SLLKKQERY"
FT   mobile_element  complement(1093726..1093931)
FT                   /mobile_element_type="retrotransposon:solo LTR, tara F,
FT                   partial"
FT   CDS_pept        1102959..1105658
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534851"
FT                   /gene_name="HSR1"
FT                   /orf_name="CD36_54430"
FT                   /product="Heat shock factor (HSF)-type DNA-binding protein,
FT                   putative"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41822.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG398557"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000192D392"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI25"
FT                   /transl_table=12
FT                   /translation="MSKKKNPGDPRIKKNAFVHKLYTMLHDPSLNHLIWWTNSNGEENT
FT                   FALCPGKEFANCLTQYFKHGNVASFVRQLHMYGFHKVSDPSSNTYSTINNNNNNNSGSS
FT                   SSNKDVPPVWEFKHSSGRFKRGDENSLIYIKRRSSSNHNSRLGTYSETIHHPLLSNPFI
FT                   NQPQLIYQDYSMGTPIEVQPFYNNQNQPPMYYQPPLPPLPPQQQQQQQQQVIATPQYHQ
FT                   YNNYHMQPLQQPLQPTNALFDYQQTIIQPVPTPHQPGSFVQQIPAPPAPAPPALAPSSL
FT                   DQSQSQSQSQQYIPQLQYRQNPYPQPLSGTQPQQLQESHSGSLIYQPIPHYSTTPPPPP
FT                   PPEPPAPPKDTIHNHNHNHTQLQTTPITIATKINGNLSRPSSSSSSSSNSLSNSAAVAV
FT                   HEQNSYLKFRKIWHNEINENNENNEKINNLKPRNPSLMFDPLIQVDCNSNSNCNSNCNS
FT                   ERSSKTIQQNNSNSIISILTNKENNLKSSPSPSPSTSTTRATTTTNSIITLPPPSVIDR
FT                   SVSIIGSSNPFDISLRINNNIQQQQQQQKQQQKQQQKQQQLFNGTPLTQNGRLPKIASP
FT                   LMTCNTGSRSVSVSGSPTMIIGNGNGDVDIGNNSGSRNSTSININNFGSKKFSIFSNSL
FT                   QERLRPSIFEFHSINNHNNNNINNSNNNSNNLSKELNTTIVTIPKINSNSNFNSNSNFN
FT                   SNSGSSRTTSQSSISSLSISGLSSKKSSLSSISSSNTNTNNLSILNSINYRNNNSNNNS
FT                   NSNNSISTISPKLSSLLHHQQQQHLEPEPEHENESQNQNSVVITNDTNIHSLVPCSSST
FT                   TTTTSTDHRQVSNSPISRQQQQQQNSGTNNNNNNKKVSVTSLLLPNQGYVPPPPPPPPP
FT                   PPLYKSSIITEEENSTTSSNNSSSTGGG"
FT   CDS_pept        complement(1108223..1108918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077810"
FT                   /orf_name="CD36_54440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41823.1"
FT                   /db_xref="HOGENOM:HBG397451"
FT                   /db_xref="InterPro:IPR022592"
FT                   /db_xref="UniParc:UPI000192D393"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI26"
FT                   /transl_table=12
FT                   /translation="MSRRTEIKQKQELQARFQLAISANHQKALNWLPPLKSAAAAATTT
FT                   TSASSNSNDINSSTSDDSFMDLQIIPQGSSLSKLDNLQKIGDFINSKDITKMKQSTTTI
FT                   TTNRAPKSKPMLALMNKMRDNNRKNIRQTHHHHHHNHQQSTSNINKNKNKNKPVIPNKS
FT                   KPSLQNYNANEKDQDEDEDDDDEDSRAMRSRTVKKGSSLLLENKLNRHNNNNNNNNGTK
FT                   MKKNNIRPF"
FT   CDS_pept        1109164..1109910
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094246" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571470"
FT                   /orf_name="CD36_54450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41824.1"
FT                   /db_xref="HOGENOM:HBG397452"
FT                   /db_xref="UniParc:UPI000192D394"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI27"
FT                   /transl_table=12
FT                   /translation="MTNIIIDHSSTFTAYILALSIYFKYHHLRNLKIIIIENEISQSLH
FT                   TKPWCGISTLNNFKLSNQEFINYLIQFTIPLGKVSIQPISPNPDIPIKEIMNTIIDSKN
FT                   YVALLYHPIDLMNKIRFVMFRSGRVSFISPNINIDQRQLHQSIPGIKVINTKRNHHNIN
FT                   SLIYHSNIIGTRCHNGNLPSQILWIPKFSSKKFVNCTINNLQIMLDSNIDPHANIDLNY
FT                   ALKQCDMVLDTIDKLMGNSIPLNNRL"
FT   CDS_pept        join(complement(1110581..1110605),
FT                   complement(1110079..1110476))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000035939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382081"
FT                   /orf_name="CD36_54460"
FT                   /product="Golgi transport protein, putative "
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="CAX41825.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG592905"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniParc:UPI000192D395"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI28"
FT                   /transl_table=12
FT                   /translation="MIWLSERQKFGVSFTAGGIFFFIFGIMTFFDSSLLALGNLLFIIG
FT                   ITLIIGPQRTITFFSRPTKLRGTICFILGILLILIKRAFIGFILESFGILGLFGDFFGT
FT                   IIQFLRSIPYIGDVLSHPLIAPTIDRLAGISNTLPV"
FT   CDS_pept        1111168..1111968
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571471"
FT                   /orf_name="CD36_54470"
FT                   /product="Uncharacterized protein ygr268c homologue,
FT                   putative"
FT                   /protein_id="CAX41826.1"
FT                   /db_xref="HOGENOM:HBG397453"
FT                   /db_xref="InterPro:IPR017987"
FT                   /db_xref="UniParc:UPI000192D396"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI29"
FT                   /transl_table=12
FT                   /translation="MTNNNDFDLPPSYDEAVNSSSSSNSNSTRPNQSSSQPPAPPARPQ
FT                   TNRPQPPPPSSSSSSNANLYTNNLNLPFTYKRGYYCSKCKNSGYKKNGDICHKCWDTLY
FT                   LNQNAYNPNQTNLPFTYPKRYYCCKCRNTGYKLKNGKTCQNCWESFGPRNSYSFVNTNY
FT                   QPSYFGGTTFIPSTMGPPIPNAKRVAPGSPELGGILCGNCRGQGMVHFLFDTDLCPVCG
FT                   GLGRVFTGPPRPPPPHPPPPPPPMPQTPYMPQYQPQYMNYGPKR"
FT   CDS_pept        complement(1112215..1113981)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229186"
FT                   /orf_name="CD36_54480"
FT                   /product="Delta-1-pyrroline-5-carboxylate dehydrogenase,
FT                   mitochondrial, putative"
FT                   /EC_number="1.5.1.12"
FT                   /function="1-pyrroline-5-carboxylate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAX41827.1"
FT                   /db_xref="GO:0003842"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000192D397"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI30"
FT                   /transl_table=12
FT                   /translation="MLRSTTRNTLRLATKYVKISPNVVRHTLPKVSGVRFASQLAHVKT
FT                   PPNLQNEPVKNFGFKDTKDWDLLRASLTKFTDEGVLKVPLVVGGKKIYRDETKTQVNPA
FT                   KHSQVLADVSQATPEDIIAAIDAAKAAKAKWAETSWTDRAAIFLKAADLISTKYRYDML
FT                   AATMLGQGKNVYQAEIDCVAELIDFFKFNVKYAEEMYQQQPIQTSPGVWNRAEYRPLEG
FT                   FVYAVTPFNFTAIAANLVGAPALMGNTVVWKPSATAALSNYLLLTILEEAGLPAGVINF
FT                   IPGDPVEVTDIVLNDKEFSALHFTGSTDVFKKLYSKISENVSSDKYRDFPRIVGETGGK
FT                   NFHLIHPSASINHSVLSTLRGAFEYQGQKCSATSRLYVAESLWPEFKDQLIGAMSQITI
FT                   GNSSESENLNTFMGPVIHEQSFQKLSNAIEQAKSDPELEIIAGGSYDNTNGFYVQPTLI
FT                   KTTNPNHEFLTKEFFGPILTTYVYPDDEFENIIKSIDSITKYGLTGSIFARNRDAIRIA
FT                   EENLRYAAGNFYINDKSTGAVVGQQWFGGARASGTNDKAGSGNILSRFVSIRNIKENFY
FT                   ELTDFKYPSNYQ"
FT   CDS_pept        complement(1114393..1115424)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571472"
FT                   /orf_name="CD36_54490"
FT                   /product="Subunit of the dynactin complex, putative "
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="dynactin complex"
FT                   /protein_id="CAX41828.1"
FT                   /db_xref="GO:0005869"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG397454"
FT                   /db_xref="InterPro:IPR006996"
FT                   /db_xref="UniParc:UPI000192D43D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI31"
FT                   /transl_table=12
FT                   /translation="MNKYSDLPDIDNEGQEVFESSDVESEIELPIETTNDPDVEVSSIN
FT                   VDQSKELFARNEIVDTTGFDFSGNLSRLNGYSVTQVEETTEEKLSRISRELEEIKLQDH
FT                   HTVSQQPDQLLTILSELKSENTIIKPLRSEQLKIDSLFKHIESDTPVASKSFDRLIDLE
FT                   NRLSKLESVVGTEDTTTSVQLTINDLSRKISIVENPEYDFDKIRNEVGKLTKELEELDL
FT                   KRKVLDLDDDSTKTITKQDKIDELYEKLPNINKYNQVAPMLLTRLKTLNSIHQEMKNNI
FT                   DLSNGIDQILNDVQLDLKNWDQTITKLNERINDYEDNFEKNSKTVQERISDLILKVDSL
FT                   STD"
FT   CDS_pept        complement(1115594..1116700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382082"
FT                   /orf_name="CD36_54500"
FT                   /product="Uncharacterized GTP-binding protein, putative "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41829.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI000192D43E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI32"
FT                   /transl_table=12
FT                   /translation="MGILEKIAQIQEELSRTQKNKATEYHIGLLKGKLARYRRELLEPQ
FT                   PGQGSSGGGQGFEVAKAGDARVSLIGFPSVGKSSFLSKVTNTKSEAANYEFTTLTSVGG
FT                   ILEYNGAEVQIVDLPGIIKAASQGKGRGRQVIAVSRTSDLILMVLDATKGGDQREILEN
FT                   ELESMGIRLNKERPNISIKVKKTGGVKMNSITPPKYLDEKIVTALLKDYKIHNADVLIR
FT                   DENVTIDDFIDVINDQHISYIKCLYVYNKIDAVSLEECDRLAREPNTVVMSCELDLGIE
FT                   DLKEEIWRQLDLLRLYTKRRGVQPKFDDPMVVRNNSTILEVCDSIHRDMKNQFKYALVW
FT                   GSSAKHSPQKCGLTHPVHDEDVVQIVTK"
FT   CDS_pept        1116927..1117631
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21077811"
FT                   /orf_name="CD36_54510"
FT                   /product="Uncharacterized protein ygr272c homologue,
FT                   putative"
FT                   /protein_id="CAX41830.1"
FT                   /db_xref="HOGENOM:HBG397455"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI000192D43F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI33"
FT                   /transl_table=12
FT                   /translation="MPKAAKKPRHKSRGAPIQVAESIGSGSAKIKKKIRDIERLIKKNP
FT                   NLPADKKIEYDRALKALKVELQNSQVQNKAKVLAKKYHMVRFFERKKAVRKLKNLRKEF
FT                   EEISKAGVRKDIKKARKQLRHGEIDLAYVILFPKTEKYISLYPSPNDEDQTDPNVIKGL
FT                   KITEERRREFRKQVEKLMEEGKLPFSIDDALEGKNVRLDNERNQKAVLTEEIDAPEQKQ
FT                   DEQQEEQDDFFE"
FT   CDS_pept        complement(1117831..1123611)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229187"
FT                   /orf_name="CD36_54520"
FT                   /product="RNA helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41831.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG736699"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D440"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI34"
FT                   /transl_table=12
FT                   /translation="MASYTVSSTKSYMQAMQPMIDALNRINTGNKQQKIPNIDNENAKI
FT                   SPIDKILDKFANVTIDSLNHIGNKNINNDVVIHEIEDACNNISKQRGLEESEIYTLVKS
FT                   LLLQSPTDEELQSSLFDILGFDEFDLISKIIQNKQSFSTRESSALMSPEERAQQVIDNH
FT                   QRTKNQSLLPKSTHQKYPNVFKNPDVGNIISITGKKFSLPQGTTRDSYATHEELVIPYP
FT                   ENKPNKWISEKNLVKISDLDFLCQGTFKSYKNLNKMQSLVYPVAYNTNENMLVCAPTGA
FT                   GKTDVALLTILHTINQFVTETVTDDGNVSVDIDYDEFKIVYVAPLKALAAEIVEKYSKK
FT                   LKWLGINVRELTGDMQLTRQEIINTQIIVTTPEKWDVVTRKSTGDSELVAKVKLLIIDE
FT                   VHLLHEDRGSVIETLVARTLRQVESTQSMIRVVGLSATLPNFMDVADFLGVNRNVGMFY
FT                   FDQSFRPVPLQQQILGVRGKAGSKLARENIDKVSYEKLADYINQGLQVMVFVHSRKDTV
FT                   NTARTFIRMAVEYGESDIFNCSEADSYEKFKREASNKNRSKELKELFVHGFGVHHAGML
FT                   RSDRNLTEKMFESGAIKVLCCTATLAWGVNLPAAVVIVKGTQVYDSKAGGFVDLGISDV
FT                   IQIFGRAGRPQYEKYGTGILCTTSDKLDHYVSLLTQQHPIESKFGDKLIDNLNAEISLG
FT                   TVTNVEEAVQWLGYTYMMVRMKQNPFAYGIDWKELQEDPTLTNRRREMVFTCAKRLHHL
FT                   QMIIFDENSEAFTPKDLGRIASDFYLLSNSVEIFNQMMNPLATEADILSMISMSSEFDS
FT                   IKFREEESKELKQLVEEDAPCQVAGDIDSPQGKTNILLQAFVSQAHIKDSALISDSNYV
FT                   AQNSARICRSLFLIAMNRRWGKLMKIMLSLCKSIDKRIWAFEHPMTQFELPQPVLRNIK
FT                   AKNPSMLTLRDMEAGELGDLVHNFKMGSILYKLIGKFPFIDIESEIFPITTNVMRVHVD
FT                   LQPDFVWDEKYHGNAQFFWLTVEESDRSEILHVEKFILHKKQLHSPHEMDFMIPLSDPL
FT                   PTQVVVRVVSDSWIGSETVHAVSFQHLIRPSNETIKTDLLRLQPLPVTALHNPDVEKIY
FT                   SSKFKYFNPMQTMVFHSLYNTNSSVFVGSPTGSGKTVVAELAIWHAFNEFPSSKVVYIA
FT                   PMKALVRERVDDWRERICKNTSHRLVELTGDSLPTIQEVKEADIIITTPEKFDGISRNW
FT                   QTRKFVQQVSLVIMDEIHLLASDRGPILEMIVSRMNYISSQTKKPIRLLGMSTAVSNAF
FT                   DMAGWLGVKNGLFNFPQSVRPVPLQMYIDGFPENLAFCPLMKTMNKPAFMAIKQHSPNK
FT                   PVLIFVASRRQTRLTALDLIHLCGMENNPRRFLKISDDELQDILENVKDDTLRLSLQFG
FT                   MGLHHAGLVESDRQISHKLFEQGKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEA
FT                   YRDMDLTDILQMMGRAGRPAYDTSGIAIVYTKESKKVFYKHFLNLGFPVESSLHKVLDN
FT                   HIGAEISAGTITTRQEAMDFLTWTFLYRRAHNNPTYYGIEDISQYGISQYLAKLIDSTI
FT                   ENLVESKCVYTGGSDELHATPFLEISSYYYLSHLTIRNFVNTVTPDFEFRDCLRVLCQA
FT                   AEYNELATRHGEELINMEMSQSMRYPAEDLNCEFIWDPHVKAYLLIQAFMSRVELPIAD
FT                   YAQDTISVLDQALRILQAYIDAAAELGYFKVVMSFIQLMQCIKQRYWYDDDPVSALPGL
FT                   KLVNEGKTKHTLKYLGSMKTGQLFGLAKKLGVSGENIENQGNDYHEVNDEEAKKKFVKI
FT                   ASHLPTGNLEIKQQEQNLIKVVLIHDNYPLNNDFKVYCPHFPKPQRESWFIILHDEKEL
FT                   HLLKRASPRLSNKKGIIVCDLDIPDDLFGKELYLECVNDGLDIAYSEKISLL"
FT   CDS_pept        complement(1124075..1125838)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571473"
FT                   /orf_name="CD36_54530"
FT                   /product="Maltotriose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41832.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D441"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI35"
FT                   /transl_table=12
FT                   /translation="MTIEEYRPDQKNVSTPSIVSVDDKTTNASHISNAGQDNVDDYISK
FT                   FLDMSNTAKAEDERDKTMPLKECIRTFPKACFWSVVLSTALIMEGYDTNLLASFYAYQG
FT                   FAKKFGRYYEDLGEYQVPAKDQLGLSMCYQTGQLVGVYIGAHLVDIIGYRYTLIPALAS
FT                   SIGLIFIQFFAPNVSVLMVSYVLLGINWGSYQTVCVSYAMDIAPTTLRLYLTTYINCCW
FT                   VFGQLISSGVVKAVSEMTDPHAYRIAFAIQWIWPIPIMTGIFFAPESPWFLARKGRLEE
FT                   AKHSLERLLSQNKHIPDKSIVSQSMLTKIQMTIKEEDAVSAGSSIIECFKGTNFRRTRI
FT                   AAFTWLIQNITGSSLMGYSTYFYQNAGVPVSMSFNFSIIQYCLGILGTIGSWFLSQKCG
FT                   RFTIYFYGLCTMTLLLLLTGGMGTSDKKSLSMAVGSMLLVYTFVYDLTIGPMCYCIVGE
FT                   MPSSKLRAKTVMLARNLFNIAGIIIAIVTPYMLNPTQWNWKAKSAFLWAGFAILSAIWV
FT                   YFELPETKGRTLAELDKMFEDKVPARKFKYTTPNTFDAGEMMEKMGNTGLKSIVLDTEH
FT                   VEEASHIESKV"
FT   CDS_pept        1128415..1130154
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571474"
FT                   /orf_name="CD36_54540"
FT                   /product="Alpha-glucosidase (Maltase), putative "
FT                   /EC_number="3.2.1.20"
FT                   /function="cation binding"
FT                   /function="maltose alpha-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41833.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0032450"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG669028"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192D442"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI36"
FT                   /transl_table=12
FT                   /translation="MTIEYTWWKDATIYQIWPASYKDSNGDGIGDIPGIISTLDYLKEL
FT                   GIDIIWLSPMYKSPMEDMGYDISDYESINPDFGTMEDMQNLIDGCHQRGMKIICDLVVN
FT                   HTSSEHEWFKQSRSSKTNPKRDWYIWKKPKIDSKTGEKLPPNNWMSYFSGSAWEYDELT
FT                   DEYYLRLFAKGQPDLNWENEECRQAIYNSAMKSWFQKGVDGFRIDVAGLYSKDQSFKDA
FT                   PIVFPDQTYQPSGDLTSNGPRIHEFHQEMYREVTSKYDVMTVGEIGHCDRDEALKYVSA
FT                   KRKELNMIFLFDLVEVGSNDQDRFRYNGWNLIDFKKAIKNQSDFIKGTDAWSTVFIENH
FT                   DQPRCISRFGNTKSLDSSVKTGKLLAMLQTTLTGTLFIYQGQEIGMTNLPRSWSIDEYK
FT                   DINTINYYKDFKKRYGNEPDFKQREEKLLDVINLVARDHARSPVQWNDNEPYAGFSTHQ
FT                   PWTRVNDNYKQINVANELKDPNSVLKFYQTLLKLRKNYKDLFIYGSFDILDFNNEKVFT
FT                   YIKQHQDGSLPKAYVTLNFANESIPFKPLIEGEFKLISTNVQQSEYDTSVLSPYEGRIY
FT                   IVE"
FT   CDS_pept        complement(1130300..1132471)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534852"
FT                   /orf_name="CD36_54550"
FT                   /product="Uncharacterized protein ygr266w homologue,
FT                   putative"
FT                   /protein_id="CAX41834.1"
FT                   /db_xref="HOGENOM:HBG397456"
FT                   /db_xref="UniParc:UPI000192D443"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI37"
FT                   /transl_table=12
FT                   /translation="MPSSTNPTQTNDNWFNPIPIEDYYKINEQARANVPTSPPNDETLG
FT                   NYTISCGPILRLVGTWENNESNEDPNYRASILLVIKDTEATPNETGPAITYKIGPSSSS
FT                   TTAASAKFSTGEFPGVKFYQEHDYSFYRYSIELTLTENEQKVEYFIDNHFKPNFQFYLP
FT                   SKTQSMNVISYSCNGFSLGTDANEYKSSLWLDVLTKHSKQHYHVMLGGGDQIYCDAIKL
FT                   HSERLKQWTEISNPIKKKSFPVDDEIINEFKQFYLNHYLGWFGKGYWKGTNSSVLESLF
FT                   PLSSAQIPCVNIFDDHDIIDGFGSYHDSTMNAPIFTAVGNVAYKYYMLFQHHINPEEKL
FT                   HLSDPSWVLGSTTGPFIKQKNHSVFMRLGKEISLLGLDCRTERKLKQIVDPSTYNIIFD
FT                   RLKKEIGSTSDTKHLLVMLGVPILYPRLVWLEKVLTSTALIPIRKLAQKGVIAKGLVNE
FT                   FDGDVEVLDDLNDHWCSKHHKAERNRLIKRLQEFGAANGVRITILSGDVHLGCIGRLKS
FT                   KFHSHPNAHQFLHDGDHQSTEKLNKDVIETPEYDPRLLFNITSSAIVNAPPPDAMATLL
FT                   NKRSGIHHFNRDTDEDILPLFIKNLDGSNRDNKQFLNERNWSDLILAKQSIIYKDNVSS
FT                   NDQEEEEEPIRKFPQPVLDGSNTDLLKDQTVDSRHVKYPLYSDSLVTTLRFEKDKSDLS
FT                   SPSVGYEVLIPKLFGKYKLDPAPVKHVDQ"
FT   CDS_pept        1137038..1139455
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094248" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571475"
FT                   /orf_name="CD36_54560"
FT                   /product="Uncharacterized protein ygr237c homologue,
FT                   putative"
FT                   /protein_id="CAX41835.1"
FT                   /db_xref="HOGENOM:HBG397458"
FT                   /db_xref="UniParc:UPI000192D444"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI38"
FT                   /transl_table=12
FT                   /translation="MTTFLTTTSITNNNLTNTLTTTTSNTNNSSTPRTTTATNSTNNDK
FT                   ENLNSTTPTKDFLAKYPNFSKCVSFNNLHPPEYESDFPYTTPIYNLNNPSQQHHHLFDS
FT                   NYTFGSSSGSGSTPKIFIPFQDFNFGNGSNNNTSSSGTSRRHSSSAGTTSTGFTKRKRL
FT                   KLPPPPAKSILKNKVSQQQVEYNNMFENISEATIEYHKQEREQQEQQEQQDEQDEDSQS
FT                   GSGSGNSSVNSSPLLTATNISTPINDLKETQQLPTPRRKSLVGLTDEELMALDPQFQTT
FT                   KSKNNDLDKFKFDNQKTYYLSPSTRKGSTSDGATGANGNVATGVKRQDYPTSNENNYKS
FT                   ISLTVRYGETTHNDYTRTLLTIISGRRHTWHSLDWLFHIKQDLQNQPTLLADGDYLVIA
FT                   GLIPIKFIKDYNNSNKKKKLSVEDYLYQKCCNLLNYLMEYISQLNLKLKITVEFVIDYE
FT                   NENESLVVGGGGGDSSKPLKGEKYMIDHLFKQYQPNLIIIGNKSSNLNFKYPVKMNKLN
FT                   NLYLIKLSSYIVKYSTIPVILVGLLIGFNDDTTNTSSSSSSAVKFNKPTITFSISKTPS
FT                   SELTPKHSQTTSCNKSSSTPDLSDDHDADDNSSIESIESLTPKEYTDDKKRQEMFNEKM
FT                   TEINNTPFNSPDKYFDWIQTISDNSLQASKNYLIGIKSKDDSIIIDDKIHAIYKSQTWN
FT                   VNSGSMSHDDLSDGNGGNGSMYKVKSLISIEDDEEVKRKQEELRMKKRNKRNSSVKSSG
FT                   SVGGFIHSIKSNDNNSIISSGDKNTDKNKNNSTDKSTKRKSSIWKKLGFSKG"
FT   CDS_pept        complement(1139914..1142298)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229188"
FT                   /orf_name="CD36_54570"
FT                   /product="Zinc finger-containing transcription factor,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41836.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397459"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192D445"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI39"
FT                   /transl_table=12
FT                   /translation="MSESSPPPQKKHKPTSSKLTRAISACKRCRTKKIKCDQKFPQCGK
FT                   CEANGVECIGVDSITGREIPRSYIVHLEERVKFLEEKLKLQGEIGGIDDDINTPGGSSK
FT                   NGDELVSDKPSIKKENPLINSKHDSIAFSKLMSTAVRVQNRLSDPNIKTGYLGQNSAHT
FT                   TTTDTGIDDTNCSIAPAVLPPKSTAMQFLRVFFHQCNSQLPLFHREEFLRDYFIPVYGE
FT                   FDESISLASNTTSINKSFFKNMDKTSYWFDIYKSKIQQLLSESSTKDIQSIANNIIPPI
FT                   KYRKPLYFLNLLFAVATSANHLRYPIHISESFRLAAMRFSQDVDNSIDPLEHLQGILLY
FT                   AGYSIMRPTNPGVWYIMGEALRICVDLDLQNELKTKSKQNFNIDNFTRDKRRRIFWCCY
FT                   SMDRQICFYLDRPFGIPDESINTPYPSVLDDSKIIPNDNTTDYYNCGDDDENFSYKNVS
FT                   ISFFKIRKIQSQVTKILYTNAEIPREYKDLNHWKQSIILQLTHWKQELYSDSTMKRMNC
FT                   DFNNIFFQLNYHHTLLYIHGLSPKNYKLSLIDYENLTNSSIQVINCYTELLKTKSINYT
FT                   WAGVHNLFMAGTSYLYALYNSKEIRLINSIEQVQNITNNCLLVLQSLIGRCDAANYCCE
FT                   IFHNLTMIILNLKYSPDNKGLITSTTTTINNPSSASKVSRESLYRINNGNVHSNLFHLV
FT                   TELDHLNPLTKVVNSNDQDNISNATDVMSSPLMDPSLLPLNQQTILQWNDEDLQNFLNE
FT                   LNQSNQSSPSNSSIRDEKKTFELIHDMPNEIIWDEFFANKQ"
FT   CDS_pept        1143548..1145188
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571476"
FT                   /orf_name="CD36_54580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41837.1"
FT                   /db_xref="HOGENOM:HBG397460"
FT                   /db_xref="UniParc:UPI000192D4F5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI40"
FT                   /transl_table=12
FT                   /translation="MYKLKLLYAFGLLVNSSLSLTIHSTSSSIVPPSVAHPLDDNTYFY
FT                   PHPTPVSNCELTFSTDEYTTTVAFSYGCPTGSVTPPPNFPPTVPYGCTYFASRTYCPYN
FT                   CDTSLVHYYDYLVQVTSCPEQSCIFDKSGGRPSFKCEPTTSTDSWSSYIPSEVSNEVSA
FT                   TPDLDSISHDNSTWHDSGSTDRTTYYPKPEHPMTTKMPVTCELKQTSSQGNSWNDVSCN
FT                   YFPTECTKATTFNVHNQTVTYIWCPSTTIELFSSGETTTTFCPFNTCYDYSDHTDNSGN
FT                   TRVDNSGFEVHTTRATLAATVTANAGTVAITKTAATIDTICTETKTMDDRVVGGHGHAQ
FT                   GSFDYTQNIINTDNIPIYKTKEDTDTDCYIITTCPTPVTLTVTHEITRTETVTEYKTLT
FT                   ANDHGDICIVSTTNEVNPTRTSYRNQAIITSQAVNGDFYHGYPSKPNYPDTWKQHGTEK
FT                   ATTTETPETSVEKPLDESETSGEKPADKPVDESVDKPADEPIVKPNHKPTDNPIRTTEP
FT                   ITSTIGNYSIDYRSTTWRNSSTLVTTVVN"
FT   CDS_pept        1145449..1145922
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094251" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534853"
FT                   /orf_name="CD36_54590"
FT                   /product="DNA-directed RNA polymerase III subunit, putative"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41838.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG610205"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniParc:UPI000192D4F6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI41"
FT                   /transl_table=12
FT                   /translation="MKVLTERDSFLSNYEVLQHLQNIKKKYNWSFNPDDEKFLKNKKNK
FT                   HHFTGCGINLEIITRDVLSCLENNDSSLIQSQESFKQLMEFLNQFELMKVEKLQIVNSL
FT                   PRSLVVLYALVEECEDRFGEETSEKIIEKINELFPIEQEEEGEDAQEDEEINE"
FT   CDS_pept        complement(1146062..1148314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17571477"
FT                   /orf_name="CD36_54600"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41839.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG397461"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI000192D4F7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI42"
FT                   /transl_table=12
FT                   /translation="MSESSSETEISKIPLAMTKEQLDNIEHKILFRQVKSVKAGDIERF
FT                   RIHFTPHAEGDEVIIPPTLWVKIRNTEPVSKRAIYLAGPYILYVDCRSSDYDPNVKYFV
FT                   TADQPVFEPQLLAGQSFYIQLSCHTLKKDYSWIVDVVPQIIFNTTISIDFEIMIGTSKQ
FT                   ILHEASFPEKSVPMSDKIGCFNELLHVYNWDTLDLWNLPVLNPDKPKHLVILTHGLHSN
FT                   ASSDMLYLKEQIDRIAELRNDNEEIVVKGYFGNIGKTERGIKYLGSRVAEFIIDLVTEN
FT                   ESFNNGKVKKISFVGHSLGGCVQTFAIAYLQVNFPWFFEAIKPINFITLASPLLGVVNE
FT                   NPSVVKWVLSAGFVGNTGQELGLKYLENGAKPLLLLLPAGPTHEVLKKFVRRTVYANAI
FT                   NDGIVPLRTSSLLFLDYKGLAEIINSEELAQSDETGKIPESVESANKFSAVQTFLSYLM
FT                   PQKQASEEYRRFQTQDDKVVETNKSDGKSIPNSTFLDSAASLILPPLPSMKYIVDPSTR
FT                   ENIVIHDKVYYEKDLPERDLDVELDSFEWLEEEIAREYHKNMGWRKVVVKMKPDAHNNI
FT                   IVRRRFANAYGWPVIQHLVENHFGPNRTVDLKSIDSSIMDSVSTDSLDEENGLTRIISR
FT                   DLISRQNKEIDENVTEEQRLEDYPHEWINSEHNGDSMFAVGVTGLLGEVADMVGGFRDQ
FT                   ITKYSLNPPTLPIIGEIPLPAALMAPTNTNNGNTKSEEELNKDLKLSNNGVMNDFI"
FT   CDS_pept        1148677..1148991
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18534854"
FT                   /orf_name="CD36_54610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41840.1"
FT                   /db_xref="HOGENOM:HBG397462"
FT                   /db_xref="InterPro:IPR020515"
FT                   /db_xref="UniParc:UPI000192D4F8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI43"
FT                   /transl_table=12
FT                   /translation="MSGNLHSDLHQIELTAHALLSGSLDNLNENFESLNQSQLILLTRL
FT                   KIIEERLNNFKSIINDNIINEKELEEQFNKVKQLRKRLERCLKVTESIEMRVDKLENQP
FT                   "
FT   CDS_pept        complement(1149078..1150103)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382083"
FT                   /orf_name="CD36_54620"
FT                   /product="Dolichyl-diphosphooligosaccharide--protein
FT                   glycosyltransferase subunit, putative "
FT                   /EC_number="2.4.1.119"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /protein_id="CAX41841.1"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="HOGENOM:HBG397463"
FT                   /db_xref="InterPro:IPR006844"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR021149"
FT                   /db_xref="UniParc:UPI000192D4F9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI44"
FT                   /transl_table=12
FT                   /translation="MKISVILFMVTLWSLVLGGLTNNELLKIVKNRRNKVLELNDENFE
FT                   NILNGQRDYHLIALLTSEAPNLNCVLCRELAPEYSVVANSWFQDHPNGVAEVELTEQEE
FT                   KDGKKQPKNIYFFKSEFKDSRKLFSILQLQNIPKMFYFPPTKHLGPNNYLKEKVEYQFF
FT                   QGDHKELLKNWLIEVTDHRFNLYIPVNKTKIAINAIGTFITVLLLRVFSKQVIQVITSR
FT                   VIWCAGSIISVILFTTGYMFNQIRGTPYVMEHRDGRTEYFAPGQQAQFGVETQIMSFLY
FT                   GFLSILVIVLVKRAPEVKNQSANLILVATVSSLIFVLFSLLLSIFGVKGLGFPYRFINF
FT                   F"
FT   CDS_pept        complement(1150290..1152434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572489"
FT                   /orf_name="CD36_54630"
FT                   /product="Calpain-like cysteine protease, putative "
FT                   /EC_number="3.4.22.-"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41842.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG397464"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="UniParc:UPI000192D4FA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI45"
FT                   /transl_table=12
FT                   /translation="MPLPCLEQFLYHLERSYLYLCIDNTKLSKKECLESIKILNSIAKT
FT                   TSSPQIKVLSQYTLNHYESLDKPITVSDKLEWISSKLTPETFFPPVIWFNETVTSHSEL
FT                   FIDTESIIQDSNNTAFEKLPNKLAKFKYIEISNWNNEITHLKNLYQDILPNCSFVSSFL
FT                   AIVDANIPIIDTITPQTSSQKYKVSLRFNGVLRNVTVDSNFPVMPNSRNLIIKSYSDTE
FT                   LYWPALIEKAYLTVMGNGYNFAGSNMANDAYVLSGWLPQIIKLSNGQLPSNIDYLWRLR
FT                   KQNKVTMGIGTGTLSKQLSSQLNLVSGHDYVIDNIKDGVITVKNPWLDPTDRVVEIKDF
FT                   NYFKYLYVNWKPNHKPFQHNFLYQAKPNTYNQPQFTIKCIEETWVLLERHLPETSQSHW
FT                   MDMNVFETQNKVITPSQYKKHLSVETNNRLQLIKLKPGIFTIVVSSNKPCRFTLSSFNA
FT                   IFSKSKYKHEYTETLNDEWSSDTNGGNWAMSTYINNPQYDVIVKQTTDLIIGMYGQGQI
FT                   NFHLFHTTSDSLGERIQNFDKTKLINYQNYNAFYQSSSYSLTPGHYKLVVSEYNRGLGD
FT                   FQLVLNSSEPITISKVPPYLGLYNITKLFNWDNTNRFKLNFETTGYNSVVKIKIGYFNG
FT                   ESDFELQTSYRPAMRASLFNSQTKQPIQINEQFNDSLYGVFLHEVLPQPQEYILLIERF
FT                   EIGFGRCIVEIGCNNKVILK"
FT   CDS_pept        1152566..1154017
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572490"
FT                   /orf_name="CD36_54640"
FT                   /product="GPI mannosyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAX41843.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG397465"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI000192D4FB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI46"
FT                   /transl_table=12
FT                   /translation="MTKSTLLSSYKLFAFICIFRLLNSFAIETFFQADEFFQALEPAHH
FT                   FVYGYGYLTWEWKQQLRSAIHPLIYALGYKLVGDNTTLVRICPKIINALIATIGEYNLY
FT                   KFIIVYDSEKLAWITLMLSLFNPFNWYVITRSFSNNLEMVLTVLALRFWPWNKKINGRW
FT                   YISLGFGFVSCIIRPTNILIWIPLGIWLLINVRINFKWVVTSLMEVVLILLTNTALDYY
FT                   FYHQMTFPLYNFLEFNVFKNLSIFYGTAPWHFYLFQAIPLMLMLYLPLMIYGLKKNILL
FT                   FTGLFYVIGFSLIQHKEFRFIYPIHPILLYFTARGYVRLRPKFVLLGILLNVCIGLFFT
FT                   NVHERGVIDLTRYLAAQSTPSVGFITPCHSTPWQSYFHSPNLDINSWFLTCEPPLHLNK
FT                   PSLEEIKRYRDQSDQFYDAPKSFLQMHLGKDLPMTEQLVIFEPLEQLIKDELGNGYHEC
FT                   KRFYNSFFHWDNRRNGDIIVYCRNE"
FT   CDS_pept        1155670..1156722
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382334"
FT                   /orf_name="CD36_54650"
FT                   /product="Alcohol dehydrogenase 1, putative "
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41844.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D4FC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI47"
FT                   /transl_table=12
FT                   /translation="MSEQIPKTQKAVVFDTNGGKLVYKDYPVPTPKANELLIHVKYSGV
FT                   CHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGMGENVKGWKIGDFAGIKWLNGSCMSCE
FT                   FCQQGAEPNCGEADLSGYTHDGSFQQYATADAVQAAKIPAGTDLANVAPILCAGVTVYK
FT                   ALKTADLEAGQWVAISGAGGGLGSLAVQYAKAMGLRVVAIDGGEEKGEFVKSLGAEAYI
FT                   DFTKEKDIVEAVKKATHGGPHGAINVSVSEKAIDQSVEYVRPLGKVVLVGLPAHAKVSA
FT                   PVFDAVVKSIEIKGSYVGNRKDTAEAVDFFSRGLIKCPIKIVGLSDLPEVFRLMEEGKI
FT                   LGRYVLDTNK"
FT   CDS_pept        complement(1156822..1157307)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382335"
FT                   /orf_name="CD36_54660"
FT                   /product="Autophagy protein, putative "
FT                   /protein_id="CAX41845.1"
FT                   /db_xref="HOGENOM:HBG397466"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniParc:UPI000192D4FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI48"
FT                   /transl_table=12
FT                   /translation="MSSNQELSQDILNQLNLRDSREKNHKIDAKYFNAFQQLSQKLNKL
FT                   STTTNTLLQGQSHNSETLTSLINSKEIENLKLENTELITNLNNLIINNEKLTQTITAKD
FT                   QTIKSLTKLNDKLNSKIEALNLEINEKNKTIELINDEVLTNQIQLNVLQSKLESLEK"
FT   CDS_pept        1157570..1159894
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229432"
FT                   /orf_name="CD36_54670"
FT                   /product="Uncharacterized protein yml020w, putative "
FT                   /protein_id="CAX41846.1"
FT                   /db_xref="HOGENOM:HBG448729"
FT                   /db_xref="UniParc:UPI000192D4FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI49"
FT                   /transl_table=12
FT                   /translation="MTSLEAEATDPPRNDNDNNTDIVLRSHSENTSNVNSTPNGNDTPT
FT                   ETQQHNRLYETFFFWNSSTTNIEEQRELSIAQESTETPQLQPEQISEESTQELEVSNNQ
FT                   QQSENTTTWWNFSSYSMVSYFKPTQTISDEETPLLMAPSTSQTTSTKEDSNHTIPQTSW
FT                   WDWLVGSTTPTDNGEDDEDESHTSNLELYKRAKLAIETSKEEIHYVFKKSISIDSDISN
FT                   KVELSVYGTLTEETPVEYNCSKRKNPLSPNEILENLTNNKEFNSTSNRNNMPGIDGVSS
FT                   NSTIIPSFDDNYRDITTMTRLRILLKTYIICDGITDTINLPNENHLYKESQKHVLYLKK
FT                   KKLKKITIIGVHSFLPNKLVRSLMGNRSSGNSNTFVETATSSVLSWLKENDNNDNNDID
FT                   INDYDIETLSVEGQGKINERVEKSYQLIIKNWSHILESSQFIFFVSHGIGSVVAINLFS
FT                   KLLTEHDSGITSRNKFLGALCMNGGFLGPFKGLNSRLIIRAFTSIENEIINEVFQYQNT
FT                   KSKLSMQLNNAMDNLIENNVKIVFSGVINDPFIPLFSSLALQFSHPNITRNIYYNDNNN
FT                   NNIYNISNCEVVPFVSQLLKIICLMKNLGYDQDYDLVRDLSDKFDFLTSTDMGYSISGA
FT                   SANTTAPFTGFENYTGATNNSNTKCNSTIFNDEKLYKEAIRFSLETTDLIGKQRDLVIT
FT                   DYNMIEGSSNEGNSNFYNMLPWNMRSLLNDFIQVKHIKSYQLIEQLISQFNNEWDPTSK
FT                   TWKDIKYCLGGLEDFHVDELI"
FT   mobile_element  1161982..1162229
FT                   /mobile_element_type="retrotransposon:solo LTR, iota C"
FT   CDS_pept        1166795..1168798
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572491"
FT                   /orf_name="CD36_54680"
FT                   /product="Homeobox transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41847.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG397467"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI000192D4FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI50"
FT                   /transl_table=12
FT                   /translation="MSLDSISSSGNQELSTPTPPTSLSSTNSNNNNNVSSGQKRIRATG
FT                   EALEFLISEFERNPNPSPERRKFISDKAQMNEKAVRIWFQNRRAKQRKFERQMLKKERD
FT                   SPGNYAGIYNTYTPNTTGVASTNMTNVNTNGTGTTTDFNNKLNNISSIPVEVNEKYCFI
FT                   DCRSLSVGSWQRIKTGFHESNLLSNNLVNLAPVTLNQVMANVDLLIILSKKNLELNYFF
FT                   SAISNNSRILFRIFYPLNAVVKCSLFDNNYYQNNNNNNNNGNTSSDDNSISEIRLNLCQ
FT                   KPKFSVYFFNGSNTNNQWSICDDFSEGQQVSRAFAANENNLPSNEPQQSLSSTVPHVLV
FT                   GNTSSLQYLSQFILQHQQRQKQQSQNQFEFNSQSFDTIPTSAINNSFNVNKTISASGMQ
FT                   GFVPGDFQELPAIYESISNNNQPTTTDSKDSNKHTPSSTTFTPQNSNGNNHSNANATYT
FT                   NFYNESPFSIASTATTINNNNNKNRSNSQSHNPIFSDQLFYESSESASTNSPQFSIKKL
FT                   NSETKLYINGNVSSNSSTNGPPLDDDNNLFDGVTRFTTTETSPDDDILGMFTDQTQEPS
FT                   TFEMANGGTSNGSSYTHIKNGSLTKSDKTFTGFNETNNNNNNGISFVDEFHVGNEFGDF
FT                   DFDHHYSQDHQQHQQNDNNGNTNLDSFIDFEN"
FT   CDS_pept        1169275..1170537
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572492"
FT                   /orf_name="CD36_54690"
FT                   /product="Mitochondrial inner membrane protein, putative "
FT                   /function="binding"
FT                   /protein_id="CAX41848.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG397468"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192D500"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI51"
FT                   /transl_table=12
FT                   /translation="MLRQFLRNASSNPTKVTASITSTLSPSTNNSHVNTSKTQRPELLT
FT                   ILPSKRILNRILFDIDSQLTYKQMMPILNHIYNNLSTPESINLTQLKIQSSSYDLMKFK
FT                   KLLQEIRKVTNSINVHLLDLENELIEQSAELGNNDAISILAFETIRKRQILKEIVDEED
FT                   YKHANELIKQLIDINHPLVFKMAGDLSWELNQPNQAIEYWQNYIDLVNKDKRGGGGDDY
FT                   DDHLCQIYYNMGYYYFTYLKHPKLSLAKLNFQKCINHGSSNVSGSSTGSNSNEFIVKSH
FT                   FYLGQLYVNNNPKLSKYHWEIASSSGLKDSIINLGFLEMNCFQNYHLAIEWFKLGMELN
FT                   PSEVQCLIGLFDAYIALQNWKSANIYLSKLNKLFETIAEKKKTSELPENIKSSIIYNES
FT                   MLKTFHQTRLNDIKLVTSKIV"
FT   CDS_pept        join(complement(1172269..1172289),
FT                   complement(1170632..1172197))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078035"
FT                   /orf_name="CD36_54700"
FT                   /product="DNA damage response protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41849.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397469"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI000192D501"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI52"
FT                   /transl_table=12
FT                   /translation="MSLIRKRKLDELEQEQQCGSKTQDKPVLENSMTKLIGRLYNVNEK
FT                   GTNLDIPKKPVVIIGRSSSCDIRIQGIDVSSKHCQLNIIQTTNKHINTRNEYLSLTDLS
FT                   SNGIKINDEIMNKRTSVILKTGDKIAFAKTGGSYIFRYIISDEDAEEDGDESVQAKKKK
FT                   KYASFFDDYILGKQLGSGHYAVVKEAKDKKTGQAVAVKIFHPNKSGLVNKANSAQQQQE
FT                   ELKLQQEMNLLLSIDHPNIVKFINHYVEPINNYSVNTYLVLEKMNSGELFQRIINKSKL
FT                   RIDETKAIFRQILSGLKYLHDHDIIHRDIKPENILLDITPKTSPHQKSMGPWDKDEFDI
FT                   KVKIADFGLAKFIGELKFTNTLCGTPAYVAPEILKPNCRKYSTKVDLWSSGVLLYVCLC
FT                   GFPPFSDELGPPNMKEQILTGQYAFYSPYWDEISDVVLDLISNLLIVDPNERFNVEQTL
FT                   NHFWFNEKEQDSLDHSEGAEESQMVEESSCFSSSSQPSSMINGTKRLMIRSNTQPITLK
FT                   EQHESHISFKT"
FT   CDS_pept        complement(1172883..1175243)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535105"
FT                   /orf_name="CD36_54710"
FT                   /product="COPI vesicle fusion protein, putative "
FT                   /protein_id="CAX41850.1"
FT                   /db_xref="HOGENOM:HBG397470"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniParc:UPI000192D5A6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI53"
FT                   /transl_table=12
FT                   /translation="MDDNYINFNFNTLDDLCNITSKLQELNELQLQLNDIAESKTAGKK
FT                   GSVAGSITKVNQEEFDSAIKNLTSDVSKFDIIGEKDHLKECDELLEKYGQLPVLLELRT
FT                   HLETRSNVSLTIDRLRKLQAIDTRLDRDLSLTELKNMYQEINSLNEKDNLLEKFNNKFN
FT                   TKRDELMKQFQETLTTNKWLSNTSIPNEALTLISRQFNELICLQSIVSIPSYPETWWGL
FT                   NLLLEPIITRFNYHFNSVNKETNKLSKPEWALDFLETFLHDNLGLLCIIVDDTFKALNR
FT                   IGTYEVITCLLIPLRSKIENMIDLINERVADNDNTVSLEKNGRILSHLVFELSSFDQRI
FT                   KAKYKYNPFIIDFEHVPENKWLGITSDILLNDSNHAAKNWLEFENKLALKRFNNEIINA
FT                   PDAFIIDHDYQGLNHEKEISLHILKPTYSAYGLVKLINNLNSHFQTLNIVKYQLQFVSR
FT                   IQLGLIDKYYDIIKKHYKEFNNKYSFKNALNMIPGSMVDESINKNKNGNDNTINEHIKN
FT                   GITFLTEIFCSTKYISNELENWSNQLVFIQLWSTYTGLSSELSEDRSIFDSALKQYDDL
FT                   VNKILKSYDELFKSEIKQLLKKYVNLSEWDSPSATATQSPDKNSELEPSVYLTPLISLL
FT                   PQYLDIISRSVSQLDYFIISDNTVSTLCQILFEYVLTNNEFDRNGINQLLVDFGYIVKF
FT                   LQYSLNLNTSDTYSDAFEYSNDTNSDYVKIVQAIDLLDSVDHDVITNFNQEKLDHNSAK
FT                   LNEFVTKLRLKYQHELKELTNYDIQNLLSRVVY"
FT   CDS_pept        1175527..1177116
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226732" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572493"
FT                   /orf_name="CD36_54720"
FT                   /product="Cytosolic chaperonin complex subunit, putative "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41851.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000192D5A7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI54"
FT                   /transl_table=12
FT                   /translation="MSIQAPVVYLNTSTQRQQGRQAQIANITAAKAVADIIRTCLGPKA
FT                   MLKMLLDPMGGIVLTNDGHAILREIDVSHPAAKSMIELSRTQDEEVGDGTTTVIILAGE
FT                   ILAQTFPYIEKNIHPVIIIKALKQALKDALEIIHEVSTPVDIKNDAAMLKLIKASIGTK
FT                   YVNKWSTKMCELSLKAVRTVMVEKGDYKEIDVKRYVRIEKIPGGEVTDSEVLDGILLNK
FT                   DVVHPKMKREIKNPRIILLDCPLEYKKGESQTNIEITKEEDWNRILQIEEEQVKLMCDQ
FT                   ILEFKPDLVITEKGVSDLAQHYLLKGGASALRRVKKSDNNRIARATGATIVNRVEDLKE
FT                   SDIGTKCGEFKVELIGDEYFTYLVKCENPQACTVMLRGASKDILNEIERNLHDAMAVTR
FT                   NVMFEPSLSPGGGATEMACSVRLAEKAKTIEGIEQYPYQAVADAFEVIPRTLIQNCGGN
FT                   PIKVLSQLRAKQAQGQYTYGIDGENGKVVDMKDYGIWEPEVIKQQSIKTAIESACLLLR
FT                   VDDIVSGVRQSQ"
FT   CDS_pept        complement(1177168..1177893)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572494"
FT                   /orf_name="CD36_54730"
FT                   /product="Dephospho-CoA kinase (DPCK), putative "
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41852.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI000192D5A8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI55"
FT                   /transl_table=12
FT                   /translation="MLIVGLTGGIACGKSTVSKELKDRYGLTIVDADLIAREVVYPNKP
FT                   AFNKIVTTFGDEVPDLISEDGNLNRAALGQAVFGNKEKLATLNSIVHPAVKWEIFKQII
FT                   RAYFSLQKLVILDVPLLYESGLSLLCGLIVTVSCERGVQIERLLARNNELSESDANKRI
FT                   ESQMSNEERNYRSDIVIDNSGSLDTLKESIKYLIPEIKPNLIWYLLDLFPPFAVTSALF
FT                   TFTIRRIADRFKGTKPKAD"
FT   CDS_pept        1178035..1179093
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572495"
FT                   /orf_name="CD36_54740"
FT                   /product="2-dehydropantoate 2-reductase, putative "
FT                   /EC_number="1.1.1.169"
FT                   /function="2-dehydropantoate 2-reductase activity "
FT                   /function="NADP or NADPH binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41853.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008677"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397471"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D5A9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI56"
FT                   /transl_table=12
FT                   /translation="MSGTILKNQIKVHILGAGAIGSLVAHDLKQKFPNLLKPVVLLKPD
FT                   SLVEPSTNHQISVTRLDDDNQEFISKAEVQAIKPQHVKDTIENLIVTTKSYQTIPAMQP
FT                   YLSHILPNTNILFLQNGMGVTSTLVNKYWSHQIRPNIYEGITTHGVYVNNGIVHHVGRG
FT                   QIALSTYPGKSDIDDFPALIQCILDTPYLNATRYEYPKFLLMQLEKLIVNCCVNPFTAI
FT                   FDCRNGELLYGNKLTFIWKRIISEAKNVFVKEYTILKSMPESESFLNTDRLLKSVIDVC
FT                   KNTAKNSSSMRQDVRNLRNTEIQNLNGYISFLGRKLRIGTPINDMVTNMIDGKISIDRG
FT                   IDRQAADSLSKF"
FT   CDS_pept        complement(1179082..1180389)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572496"
FT                   /orf_name="CD36_54750"
FT                   /product="Ribosomal N-lysine methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAX41854.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG397472"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR016852"
FT                   /db_xref="UniParc:UPI000192D5AA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI57"
FT                   /transl_table=12
FT                   /translation="MIDNFELKLETLLDWVKNTDDEKKISNHTYISPQIDVKDVRSSGR
FT                   GIYAVRPLKKAELILNIPHSFLLNFTTVMAHIAKYNGMTIDSHIHVPFDKHKDEYTEIY
FT                   RMLTKEEILDLSSFQLLSLYLTFERRRSSKSFWKPFLDMLPSMEDFELMPIDWPHEIYT
FT                   LLPSSTGVRNRKVRSRFENDYRVICELIKTKIDKAGDVTTLLPRQEVLLSWLCINSRCL
FT                   YMDLPTSKNSADNFTMAPYVDFMNHSCDDHCTLKIDGKGFQVRTTSQYNIGDQVYLSYG
FT                   PHSNEFLLCEYGFVIPENKWNDLDISQYIVPLLKPLHVDFLKTFDYYDNYTMTKEGISF
FT                   RTEVALATLQESDPQNSRKLLALINGYTDGDIFKEHSNVLLSVILNKIIHEAEKQQHLQ
FT                   YDDDKRKKVIGALYHDIKSIASNVLTYIQEKSSSEF"
FT   CDS_pept        complement(1180593..1181114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572497"
FT                   /orf_name="CD36_54760"
FT                   /product="Calcineurin subunit B, putative "
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX41855.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000192D5AB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI58"
FT                   /transl_table=12
FT                   /translation="MGANASILDGFIEDTNFSIEEIDRLRKRFMKLDKDGSGQIDKQEF
FT                   LSIPGISSNPLATRLMDVFDKDGDGSIDFEEFITGLSAFSGKSDNLNKLRFAFNIYDID
FT                   RDGYIGNGELFIVMKMMVGKNLKDEELQQIVDKTLMEADLDGDGKLNFEEFKNAVNTDT
FT                   IANTLTLNMF"
FT   CDS_pept        1181640..1183721
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572498"
FT                   /orf_name="CD36_54770"
FT                   /product="Poly(A)-specific ribonuclease subunit, putative "
FT                   /function="ATP binding"
FT                   /function="nucleic acid binding"
FT                   /function="protein kinase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41856.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG315011"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000192D5AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI59"
FT                   /transl_table=12
FT                   /translation="MNINLDTAKDTLCKNILIYGYCKYENKGCAFSHNRQQPTQQQQAT
FT                   NTSNNSTSVITPNSANSTASSTDLSLKKKFNLNTPSFQPSINNLSNKFSTLSPKLKEIP
FT                   VFKPENGVSEPEPVDSPTIQRPFTSKRFNVSTPSFTPTNFDFANNTNADGNRGGASTPI
FT                   GISSAPLIQNQQQQQQQQQQQKQPLAVPSPLATGAQPPSLQHRVLSMGASQSSPSTNPY
FT                   FANNLDMSAPTPGSETPGPVLPGSAGAAANQPMYPLQYHLYAPAPPPRLTIPLQPYESN
FT                   SQTMFIPNDLREYLHKKNEASLQSLGHSNLPEHVNQYHSLVPIDKSYEPVSKLWLGKNS
FT                   LIFKCLDNIDGNLYVMRKIEPCNEIVNDKPFKTVKRWKSIKNANIVGLKDAFTTMAFNG
FT                   NQSGNTALCIIYDYYPNSISLLEHHKKGLRVEPVNETLLWNYLIQLINAIMVIHEKGLS
FT                   ASSTIDLSKIIVTNKNRIKLSSVGISDILEFNDDETKQDIKIRQLQDIQKVGKVLMELA
FT                   ILLLPANMRQSNNVYNSLKASTNLSEDIVNNLRELNDLDTASEEFDLSEFSKRLTPKMF
FT                   SIIDSLQNSSDFIEGQLTSELENARLFRLMTKLNYLIHDNSNTENDKIIKLFLNYVYNC
FT                   YDSNNKKVINLNKVLTNLNKLDCGIDEKILLVNNDECIIISYKELKEIIDTKFRLMRE"
FT   CDS_pept        1184915..1186138
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229433"
FT                   /orf_name="CD36_54780"
FT                   /product="Esterase/lipase, putative "
FT                   /protein_id="CAX41857.1"
FT                   /db_xref="HOGENOM:HBG396385"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI000192D5AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI60"
FT                   /transl_table=12
FT                   /translation="MISLRALFDLATLPLKLLIVLLKYPIFGGVNKRYKNDLANSLKVI
FT                   LCRSLINFPVKDTPIFATTPTGDMINKGIGKSYPHRTRLPHFGEKFDKQSYWLVESKNR
FT                   KPNDPVLIYLHGGGYFLDVAPQQIETLLSIYHLLEPAKKQRFSILVLNYNLTSKGYPVP
FT                   HQLAQLVETYTSLVKGGAENLLLMGDSAGGNLAVTFTQYLRLNKTGLPYPKSIILVSPW
FT                   VKLIPEVYQNTPGHSYYNYSANDVVQYDRFSSAEVYEGTLGDTKLKLLTVSPGNCPYDS
FT                   KDWEDIDTFKKPGYSVFVLAGEHES