(data stored in ACNUC8465 zone)

HOGENOMDNA: CANDC_6

ID   CANDC_6; SV 1; linear; genomic DNA; GRV; FUN; 1073895 BP.
XX
AC   FM992693_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
DE   chromosome 6, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; mitosporic Saccharomycetales; Candida.
XX
RN   [1]
RX   PUBMED; 19745113.
RA   Jackson A.P., Gamble J.A., Yeomans T., Moran G.P., Saunders D., Harris
RA   D., Aslett M., Barrell J.F., Butler G., Citiulo F., Coleman D.C., de
RA   Groot P.W.J., Goodwin T.J., Quail M.A., McQuillan J., Munro C.A., Pain
RA   A., Poulter R.T., Rajandream M.A., Renauld H., Spiering M.J., Tivey A.,
RA   Gow N.A.R., Barrell B., Sullivan D.J., Berriman M.
RT   "Comparative genomics of the fungal pathogens Candida dubliniensis and
RT   Candida albicans.";
RL   Genome Res. 19:2231-2244(2009).
XX
CC   This Genome Reviews entry was created from entry FM992693.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1073895
FT                   /organism="Candida dubliniensis"
FT                   /strain="CD36 = CBS 7987 = NCPF 3949 = NRRL Y-17841"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 6"
FT                   /db_xref="taxon:573826"
FT   CDS_pept        join(complement(11559..11744),complement(11023..11559),
FT                   complement(10458..11015),complement(10043..10216))
FT                   /pseudo
FT                   /gene_family="HOG000094271" [ FAMILY / ALN / TREE ]
FT   mobile_element  13162..13408
FT                   /mobile_element_type="retrotransposon:solo LTR, iota P
FT                   (subtelomeric)"
FT   mobile_element  13899..16493
FT                   /mobile_element_type="retrotransposon:LTR"
FT   CDS_pept        13899..15488
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382340"
FT                   /orf_name="CD36_60040"
FT                   /product="Tcd3 retrotransposon gag protein, putative "
FT                   /protein_id="CAX40955.1"
FT                   /db_xref="UniParc:UPI000192D719"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI93"
FT                   /transl_table=12
FT                   /translation="MSQTNKSGPKSPSPSSSDTSTAATTDTSTNATNLAFQASVEASVN
FT                   KQLQAFQEQMMEMFNQFASRYEQQTAQGINQTREQEARDFQKFNSAGMKLESHVQEVEQ
FT                   ETHELEKEVGAFEEAYNKRVRFEDERFQQASNVMAQAQDKESDLQEQIIALRDQMAELS
FT                   SNQSATSANVPKPVFVTTDDIAIQIKRIFPSADLTNTDWEQTTNKFPTFMEAYVIDSSD
FT                   DDTMVTKIHQIQNYFHGNKLNKSAWPYAAQPYLRGDLANGYRYAQLNPLNANFQWIDIL
FT                   NVIRESRNWDIYNIQSTVKYQLYVPQPGQRVTEYVQQFRNLASSTTSFKNQFYDVKATL
FT                   LGHLSKYFQSDIIRHNLTTINNAQTFFTTVNSIFIGVHFPATSSSDNSVAQIETNTDGN
FT                   MDVNYLNKFSKKPGNYRYNNNSNFKGKQQYQGNFTPNGYKSNSNNYNKSNKDYQGYKRD
FT                   NNSRRFKKIYEVILSENESDTSDIDANLSELSSPAENNNDVNEIAELDIDDFDFIAKHR
FT                   LCIYFRYGSFKS"
FT   mobile_element  complement(16512..17400)
FT                   /mobile_element_type="LINE:6A, Zorro1-like"
FT                   /note="partial ORF1 (subtelomeric)"
FT   CDS_pept        19941..20270
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248268" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229437"
FT                   /orf_name="CD36_60060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX40957.1"
FT                   /db_xref="HOGENOM:HBG447538"
FT                   /db_xref="UniParc:UPI000192D71B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI95"
FT                   /transl_table=12
FT                   /translation="MPTAAGLLLSSVFGASARLLQTAMSGSPSKLSSKIIGYSTFMGFS
FT                   TAIYLLVIDPTIQNTNSLFERRLTLLREQREKRAEFYDFEPATKQHPYKRGAFTQLLDK
FT                   FGAKY"
FT   CDS_pept        complement(20267..21439)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535110"
FT                   /orf_name="CD36_60070"
FT                   /product="Regulator of Ty1 transposition, putative "
FT                   /protein_id="CAX40958.1"
FT                   /db_xref="HOGENOM:HBG398629"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="UniParc:UPI000192D71C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI96"
FT                   /transl_table=12
FT                   /translation="MDSAWVRELPTELQNEIKAVVEKDGASFIVFEKLYEHLSGSTKKR
FT                   KLSSEIASEMIIFEINEISFYSPVRKRMNLTLHLVEEGGNPSPALSIVNPSTNVPEMTF
FT                   TELDQTVKLCLLLPILGNTTNTQKKAICYLCFWMHDGTDPIICQMNLDAVKKSMIKSGK
FT                   LPADIESKFVTARGSLPLNPIQERIIDYFKRQFKLCGIEMMNYLPCVSIFRNTFSLNND
FT                   NAIAMNTDGASEPTLVMVNCHKGAKEGVLILLQANKTNPAYFIFGFKKPILVYEASQVL
FT                   HTSYSNITRQTFSLNMTVLNKKREERELEFGMIDEKFYRVIDEFIKMQYIQDSTFKGES
FT                   DDSVEIVHEHNGNVEDDDEEEDDDFESGEEESDVEEEYNSDLNEESPREN"
FT   CDS_pept        21511..21963
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382341"
FT                   /orf_name="CD36_60080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX40959.1"
FT                   /db_xref="UniParc:UPI000192D7D3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI97"
FT                   /transl_table=12
FT                   /translation="MDELFDANATILQLLPSTLPGLIEKPSIERSFNHDKAAVLTMLLG
FT                   SKFTNALDLALSSQISGDLSNLTFTQAGLQLPTHTDMTNWYCNCIEYQSCYTSNMDITT
FT                   IAGTSWIHQILGTHVLSPIPICSHILAILIIKYNPQLDLSSCVGQT"
FT   CDS_pept        22059..23978
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572516"
FT                   /orf_name="CD36_60090"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase, putative "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAX40960.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000192D7D4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI98"
FT                   /transl_table=12
FT                   /translation="MTSSSSNSGSSRFRGDAASFSPSQYPNYQQQFHPQQYMAQQIPAQ
FT                   QQFYYQFPQTYPVMMNQMYPVFPYPPDPFFQQQQQQYMMQQQYIYHQPPKPPKPTKPLK
FT                   VPPKEKPDPPKFPLYINTTKSEFLQRFSITQEARSIDELQKANTLPHENGLTITTNTFQ
FT                   VIDSNDHNTTLIKEQPEEPAKAPAPPVPTTNWASFLQSTAPPPPKKVAKPKPPTTHTTP
FT                   VQPPAAKFDINTESAQPLGVLLLKIMFDTNYSVFTTLPTFDIKPRGLTNTGNICYMNSI
FT                   LQILIHCDPFSRLLKLIETKSIGSLGPSSTPLLDATIAFFNQFQDTSKGAVSAEPFYTH
FT                   LTKLDKFSHLKWGQQEDAEEFLGYYLDALNEEFLAAIKQLNTPQVDSLIQAYAQDHDAE
FT                   AVATFKFNVKSTIKRIKNDTDQDTDGEWSQVNKKKNSSTTKIEIDPTPLNMIFGGEFKS
FT                   VVTIPKQSSSFQKSITLDPFQHVQLDISSVDTIEDAFKHLNESEIISYTNNNKEIQVKK
FT                   QTFIEKFPNVLIIHLKRFSYLKDHEIGVEKLRKKVDYNHDLIIPKEVMAKDTGVPIRYQ
FT                   LVSVVYHHGSSADAGHYTSDIYNVGQWWRIDDTAVKQINNEEVLNAGTEENIKNAYILL
FT                   YRRI"
FT   CDS_pept        complement(23975..24274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229438"
FT                   /orf_name="CD36_60095"
FT                   /product="GPI-anchored protein, putative "
FT                   /protein_id="CAX40961.1"
FT                   /db_xref="UniParc:UPI000192D7D5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WI99"
FT                   /transl_table=12
FT                   /translation="MFYFILLSVVAASNTTTWSLVTDYTTYCPESTEITVNDEVVTITG
FT                   PTTLTLTGECTLDYVATVEAVPSSVANVSVIESNGAKRLGMGCAAVAGVLVALI"
FT   CDS_pept        complement(24450..25295)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20229439"
FT                   /gene_name="ARD1"
FT                   /orf_name="CD36_60100"
FT                   /product="D-arabinitol 2-dehydrogenase [ribulose-forming],
FT                   putative"
FT                   /EC_number="1.1.1.250"
FT                   /function="D-arabinitol 2-dehydrogenase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX40962.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192D7D6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA0"
FT                   /transl_table=12
FT                   /translation="MESAYWSYENIVPSFRLDGKLVILTGGSGGLAAVVSRALLAKGAD
FT                   IALVDMNLERTQQAARDVLQWGEEQMKGKYESPIGQVSAWSCNIGDAEAVDMTFKAINE
FT                   HHGKISSVLVNTAGYAENFPAEEYPAKNAENLMKVNGLGSFYVSQAFARPLIQNNMTGS
FT                   IILIGSMSGTIVNDPQPQCMYNMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLT
FT                   RNVISGHTEMKAEWESKIPMKRMAEPKEFVGSILYLASESASSYTTGHNLVVDGGYECW
FT                   "
FT   CDS_pept        25835..26341
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382342"
FT                   /orf_name="CD36_60110"
FT                   /product="N-acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAX40963.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D7D7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA1"
FT                   /transl_table=12
FT                   /translation="MAHLGPPWPTSFFFIYPPPMSFTIRPIEEKDKPEWLHLWTSYIEF
FT                   YNSLDKITPEISSTTFARFLDADEPVYSVVAVDSTSKIIGFANYLTHRNTWTIEDALYL
FT                   NDLFVSSENRLHGVGRKLIEYIYTEADRLNCKKCYWSTQFENHRAQLLYTKVGVKSGFL
FT                   LYRRP"
FT   CDS_pept        26445..28691
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535111"
FT                   /orf_name="CD36_60120"
FT                   /product="Vacuolar import and degradation protein, putative"
FT                   /protein_id="CAX40964.1"
FT                   /db_xref="HOGENOM:HBG328372"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000192D7D8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA2"
FT                   /transl_table=12
FT                   /translation="MNFIKKFIGTTTTDEVASIPSGKLYLTRSKQSPKGAIECLYNDAF
FT                   ASIKRTTSPHYYQLCITKVYQEGESDFNRFDDSEEEYDGDDLAPASDTRRQSKDEWIFP
FT                   IADELKIHVCEKEDGSRAIAWKDLNGDLGDKFEFVIDEEVRGSEVDAFRMTIYKCLFEN
FT                   KYQTEYSKANDLNEFIYNPKGELLTFDELKDLNDLEEFDDETDEYEDCDETLPANKDAP
FT                   KGETKYVNTDVDLHLYDTRTGTFIFQLSKPEVKLVDLGNWEYTLYVHGESTRINTTLSK
FT                   NMNPTFNYQHLSFIFNDYTVDEDGINAHSWLLKFPDYNDLSKFQTVFLGLMYEALNKRK
FT                   WGETEQDYFVDAFSKISINKDAKELESEEEEEEEESEDENQGDGPVKWESKQNEKNSNL
FT                   TVGYAKDRSYVVRGDKIGVFSEDDAGQLNFQTAITNVADLKGNHFTPEKMLLHQQDQYM
FT                   IISNPQFDDKALYKMDLTRGKIVEEWEVSKDLPVKSYAPTSKFAQLTDEQTLTGISANG
FT                   LFTIDPRLSGTKLVNDKTYKAYKTSNNQFQTLATTDKGYIALGSGKGDIRLFDRLGVNA
FT                   KTALPSLGDPIIGIDVSKDGRWLLATCETYLLLIDNKIGDGQKNAGKLGFTNYFDKDKK
FT                   PTPRRLALKPEHEAYMVRENGGKPLAFTPAYFNTGRDSKETTIVTSLGKYIVTWSMGKV
FT                   LLDKPNPYLVKRYTQNVIADNFKFGSNNEVIMALQDDVSMVSRRSLANPKNVFN"
FT   CDS_pept        29178..30023
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572517"
FT                   /orf_name="CD36_60130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX40965.1"
FT                   /db_xref="HOGENOM:HBG398573"
FT                   /db_xref="UniParc:UPI000192D7D9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA3"
FT                   /transl_table=12
FT                   /translation="MDDLELDFTDIIPPELSAQPRQSRISLPPDYTTTNHITNELFQVT
FT                   SSLREKNRQNPKRLNNDKIQKMIQDLEKTDYELDDVVRTRVFKGRLKNRHSFTQVRPDL
FT                   NEYFDENKENRDKPSKVTKKKSPVPILQPITNTIKRSPKRLCLPKHSVIAPRKPALKAD
FT                   RASSIFLMESSSGLVNDATKYATELNSSQCDDFPLPEHENEVVQIPTNEDDNPKMAIIR
FT                   MFKTKRFDTKAEGEASGFYNEKEFQKYKGEQDNGVSVVSQSVNGPTAKKTVKWATNLEW
FT                   "
FT   CDS_pept        30128..30724
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572518"
FT                   /orf_name="CD36_60140"
FT                   /product="Glycolipid transfer protein, putative "
FT                   /function="glycolipid binding"
FT                   /function="glycolipid transporter activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX40966.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017089"
FT                   /db_xref="GO:0051861"
FT                   /db_xref="HOGENOM:HBG713459"
FT                   /db_xref="InterPro:IPR014830"
FT                   /db_xref="UniParc:UPI000192D7DA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA4"
FT                   /transl_table=12
FT                   /translation="MSSTFFDEMTKSFADVKVSDGKIDTADFLLASESLVKLFDLLGSS
FT                   AFTVVKSDMTGNITKIRNKLLEDPANSSTLQDLVLTEAKTKTKTATQGLLWLSRGLQFT
FT                   AQAMRETVDAPSKELTVTFTDAYTKTLSKFHGILVKPVFKLAMKACPYRKDFFEKLGAD
FT                   QTKVAEQLQKWLEALEGIVKIIMDFFASGNYGKGL"
FT   CDS_pept        complement(30748..31119)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229440"
FT                   /orf_name="CD36_60150"
FT                   /product="Acetate non-utilizing protein, mitochondrial,
FT                   putative"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX40967.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG716384"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniParc:UPI000192D7DB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA5"
FT                   /transl_table=12
FT                   /translation="MRPTLVRLVKPRRPERNTSPILPPLPLYRAILRAHHRKLPQELRY
FT                   LGDQYVKKEFKDHKKIDNPLHIVGFLTEWQDYLKQIDGGSWSHGKLSKDDLDKMSPEQI
FT                   GQLHELMEATKKIGKESIE"
FT   CDS_pept        31506..32660
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535112"
FT                   /orf_name="CD36_60160"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX40968.1"
FT                   /db_xref="UniParc:UPI000192D7DC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA6"
FT                   /transl_table=12
FT                   /translation="MRSSLLILLASVAIAAEPSVIPVEAVSDLQIKASVSDEAIVPTTD
FT                   KASGTVVPPTIATTDAAAAAAATTSGSLLGDLVDGLFGGNAQNSSVKATPTTTTAAAAA
FT                   AQSSGGFLDGLFGDLLGGSSSASNSTVTPTSGSSDGSLSDLFDEWFGPSNYTKTTDAAS
FT                   STGSVLDGLFDDLFGDSGSTNTGSTSSSGSWIDDLLNEFLAPSNSSDSTTPSFDGSDLL
FT                   NDILGIGENLADDLFSNIDGKSILTGVLGFAGEIFDDLFGSFGGSSASSSGSSSASSGG
FT                   FLSSLLDSIFGDSGSSGSSSLPSTSISDIVSDVFTSLFGGILGGSSGYTGSTNKVCTLK
FT                   KRSLEKKEIRKLVRKSVNKVIARRQQVIAEKKQANAKRAESLLV"
FT   CDS_pept        33086..35827
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535113"
FT                   /orf_name="CD36_60170"
FT                   /product="Hyphally-regulated cell wall protein, putative "
FT                   /protein_id="CAX40969.1"
FT                   /db_xref="InterPro:IPR021642"
FT                   /db_xref="UniParc:UPI000192D7DD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA7"
FT                   /transl_table=12
FT                   /translation="MKVTTVSSVLLTVTAVTNATEIDKRSFFGDLFSGLTGSKAAAPAA
FT                   PAAAVPAAAQSSVSSAQPTTTAAALQPDAQNNVLLDSSNSTSIQSSTKSSTTTHSTAGL
FT                   LDNLLGSSSESITHSSSDLLGSSSATATRSSTGLLDSLLGSSGPTSSESSEASSEYLSS
FT                   SSSTTKRPTAAAKGFFDDLFGTQASASETDDEDCVEETESPTSNNIGSKTKTVSPTQSS
FT                   NNVGSETETGSSTTTSGGGGFPGILSDLFPGNSKSKSSSVPSSSAEEDDEECEDPTDSV
FT                   ASNSNPTGGISFPSIPIPSLPFPHSEETGVLSSQTGVPKSTSSEEDDDETDCETETPII
FT                   PTIIPTGSVLPTIIPTGSILPTGSILPTIIPTDSVTLPYNSSSIAGTSSVSSEEDDDET
FT                   DCETDIPTGTATVIPTGSVTIIPTGSGSITVLPTKSVPTSSEEEDDETDCETDIPTGTA
FT                   TIIPSGSVTIIPTGSVTIIPTGSGSITVLPTKSVPTSSEEDDDETDCETDIPTIIPTRS
FT                   VTKTFTSDGVPTTQTLTTKLPGTTNQHTETEVVSITYTGGGQTFTTYLTQSGEICDETV
FT                   TLTITTTCPSTTVAPGGQIYTTTVTVITTHTVYPDDWEDDGYEDEGGSSGGSSGSSSGS
FT                   SSNNDDDEWEWYEEDDGNCVPSGGSSSGSSSGSSSGSSSGSSSGSGTGSWWGSGAGSGS
FT                   SSGSSSGSSSGSSSGSSSNSGSSSSSVSGSSSGSGGSWWGGSGNDYVCPGEDGYDDEEP
FT                   DNGGSGSGSSSGSSGSWWGSSGSSSSSGSTSVTGGSSGGSWWGGSGNDYVCPGEDGYDD
FT                   EGEDDHPTTTAAPEDCEDEDDSWDDDEDDCDTQAAKEVVNSVTVAAESVYPSSTAANSL
FT                   TTSWISSQVTNQSVTQIENIGAKVHTGGLFVALLGLLTLLLI"
FT   CDS_pept        36818..37810
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572519"
FT                   /orf_name="CD36_60180"
FT                   /product="Diacylglycerol pyrophosphate (DGPP) phosphatase,
FT                   putative"
FT                   /EC_number="3.1.3.4"
FT                   /function="phosphatidate phosphatase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX40971.1"
FT                   /db_xref="GO:0008195"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG398596"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000192D7DE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA8"
FT                   /transl_table=12
FT                   /translation="MVRDWAFTINRLQFSGLTTISYVFDFVFYLTVLILSATLGRTLPP
FT                   RYHEFSLYDITLRYTHFPENAILVRVWLLILISAGIPFAQFLLFTIFIVLPIRRRIWDF
FT                   FAGCLCLLGAMATQLLVTVLLKNIIGLPRPDFIDRCEPMIQNIPITSLSTVAICTQPDW
FT                   NLVQEGFRTFPSGHSSTVFTGMTIAALNFAARLQTFDNRNNSFKVFITILPWLIAACIA
FT                   STRVSDNRHFLKDIIAGAFIGTFIGSAFYLQYHPSIFNLANAGRSFPPRRFGIQRFFHN
FT                   IGGFWKLEGENSDRVLGAEDLEKLSNEQLGQPARITSMADNIEIVNKLL"
FT   CDS_pept        complement(37805..38698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572520"
FT                   /orf_name="CD36_60190"
FT                   /product="Vacuolar morphogenesis protein, putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX40972.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG398597"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192D7DF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIA9"
FT                   /transl_table=12
FT                   /translation="MSTIITIPHEVEVGGSTYYQINIKLPLRSFTIKKRYSEFQQLVLD
FT                   LSRNLGIDSRDFPYDLPGKRINWLNKASIIEERKVGLAEFLNNIIQDSTLQNEREVLSF
FT                   LQLPSNFRFTKDMLQNNRADLDSVQNNWHDVYRKLKSDILNESSSSISEKIHIRDRISR
FT                   VYQPRIVDLVKTIGTGDEAIKKKQLIAQLQESIDNLLAQEVPKSKRVLGGAIKETPETL
FT                   PLNNHELLQHQIQIHQNQDKELNQLRALIARQKQIGELINAEVEEQNEMLDRFNEEVDY
FT                   TSSKIKQARRRAKKIL"
FT   CDS_pept        38867..40507
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078040"
FT                   /orf_name="CD36_60200"
FT                   /product="Uncharacterized vacuolar membrane protein
FT                   YNL115C, putative"
FT                   /protein_id="CAX40974.1"
FT                   /db_xref="HOGENOM:HBG398598"
FT                   /db_xref="InterPro:IPR019431"
FT                   /db_xref="UniParc:UPI000192D7E0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB0"
FT                   /transl_table=12
FT                   /translation="MTNYNSTQDEQSNNTEERRLNESPVPSSEVPADDRESTQLESQPL
FT                   LDPDDPRVSPLKLERIRLLKVIATALVYINLALFVVLLVSQFFAIPGFNNRGKSFLGLD
FT                   LALVSLFINLTTNWFFAVPAYYERILGYVTSGLLFIDFIVALLVSPVRHSLGFLDLSLI
FT                   VWACLNSLFSSLIGYWVEEGKHYQEIRLTGRIEKRKTISELVIIFFKVLGEIVILWIVW
FT                   CISLTLWINCFDTHEQPWGKLVPVNNSQFRVHLACFGDVHAKSDQPIVLVEGGQSTSSE
FT                   AFQEWIEELHHLNKVERYCIWDRPGYGFSDSAPPPESLGIVTEYLTEALRKEKIEGPFA
FT                   VVGFDIGGLYARMFASRNRAKIQSILFVDSWSPDLLKKWPFSGSGRKNESTKVFKKSLE
FT                   VMDNITGFKLWLRGFVSPLGIVPNLHWFLHPMRFSSKSRVFGRDMVYSSKYIRARCQEQ
FT                   LVSGILSYNEVMDADINDLNVGVISSDFMIKKSLNWGKWQNEISKLSRKTSEWVIAENS
FT                   DHFIWTSSKGRKELQQLLLRLIGEQEYVR"
FT   CDS_pept        40693..41868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535114"
FT                   /orf_name="CD36_60210"
FT                   /product="Protein involved in regulating spindle position
FT                   and orientation, putative"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX40975.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398600"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192D7E1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB1"
FT                   /transl_table=12
FT                   /translation="MPESSSNMIGREAAPSNRRTLSSKSNNSTPPINSSGSSRPSSPLE
FT                   PPSQQQQQQQQQQQQSQQTSRRPSFGLNFLNNFTMRSHSSETASQPLMSNSPTLGNVHS
FT                   HTQDEVSGNSQSFHEVAEESPLEEEEEASQENGQPQNPASEGLPPAQDATYIDEEAKGG
FT                   LDKDGFFSVRLTPLIDHSSTSSGLYFSPIIRRLPPKTSINIGRYTEKNKAAAHAPQGSS
FT                   APIVFKSKVVSRTHALFFCNEDGQWFLKDTKSSSGTFLNHIRLSPASQESSLMPIIDGD
FT                   IIQLGMDYRGGTEEVYRSVKMRCHFNNSWQRKMNPYNIEMFKKLQIGDKQATECSICLN
FT                   AIQPGHPLFISTCGHWWHYRCIHPLLQKSYPSFSCPNCRYVCDLEYFSESE"
FT   CDS_pept        42105..42800
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572521"
FT                   /orf_name="CD36_60220"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX40976.1"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniParc:UPI000192D7E2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB2"
FT                   /transl_table=12
FT                   /translation="MSAIKTKPNPTITNARRIIILVTILLVLPFAGYYYLEHSTTSSVF
FT                   IEEPIFQQVHVSIVSDGNKKIDLGIESLFDEIIPAEFKDRLGITTNIQNNIELFKSNSS
FT                   VLEPSEIPYLINLDELYSTNNLNYVIFLPQNGLTIKDSTTNSFTVEGFGTIGILNDWSL
FT                   QKKDLLPLLNIFKSNLIRTLKQSQSATPKGVSTEITSFTPMDHKLAVFLPILGPIGISI
FT                   LNGLANFSK"
FT   CDS_pept        44916..47522
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382343"
FT                   /gene_name="CPH2"
FT                   /orf_name="CD36_60230"
FT                   /product="Myc-type bHLH transcription factor, putative "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX40977.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG398603"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000192D8A6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB3"
FT                   /transl_table=12
FT                   /translation="MLSQYNEQLAAGDNVDGFNNGKQANATLYSFDFVDADDFLDSISG
FT                   ALPNSAHNNVSVNTSNTNDITFEDMNIMNPNIYSPVSAASGDDYAHTSGQPMVSEGSNY
FT                   TGQNFTDYLSDNSLEGYDNKNVNHPLNGVDIVLSNKRSNSTSTGSLSHNEEITPISHYS
FT                   VDSIVTSPEPPMSKQGEFPPIKRSTTVNSTNSITNTKKSSKVTKPKSKDKNSHNMIEKK
FT                   YRTNINTKILALRDAVPALRIAAGCDDVSIADLEGLTPASKLNKASVLTKATEYIKHLE
FT                   SKNSVLKQQNIELHRLIQHANLNPKSLPPPPQQMPMQTPFPPPPPQQQQPGFGFYPQQN
FT                   QSFNVSPASQYPSPQQQVSPIQQQPAQHPPQPNRYLLGGMAAVMGTSLFGGSGENDFRS
FT                   LGALPFSYLFPNAILNPSPLTIQLWTLTKVLLVVGSLASIFIPMYKQAQLEKDEKSTTV
FT                   PETSLLDWILISIGFKVPAKLSASKRDAILSNLQGGNNWPQLVSDYFYLTGCEINFENC
FT                   FLSLVLGSMIRHRLPRVAKVLNHYLSMKESLLLNLDYKGADKSLKRLNQLVGKVDGISI
FT                   FESTNLTTRLTNVFTNSRINANIVDGQNHVKYIEFYQRNINDYYAIIFNWRLLELIHEL
FT                   NVTYLEELNDDQSQILTDLKIIEVFIGEQDDKLFGYYQLFTSILNANYAPYLFESLKDK
FT                   VESSLEKFRIAYEGIDLTDHEIHNTSSEDEHEDDPVVSKYVPPLKSQKSLISSLNLVNE
FT                   EEFIILTCSLTIYYYKNKEYDRALKILSYLRLDDDAKTVSLLTFTALMTLINELIPGRI
FT                   EDNDNLDSAIKICRDWLENPDLTRYMDENIKHELTKIVVNKGMIVNGIDVNESDEE"
FT   CDS_pept        52871..55012
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248276" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382344"
FT                   /orf_name="CD36_60240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX40978.1"
FT                   /db_xref="HOGENOM:HBG398605"
FT                   /db_xref="UniParc:UPI000192D8A7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB4"
FT                   /transl_table=12
FT                   /translation="MSDSEDSEDLNQYTIDDYYKLVRPLLEANNINANYLDNHKLLRTL
FT                   VDFSLSHSLSLKNLQKRDLEFRNLIPEKINYVDSLIIKTKAYNEPQFSGCFRNRYIEFC
FT                   PHFAIAAYLFSRFHIADEYGAYEFIFTDSIKKISLENVKLLKGNSKHSAISYSQQHKSA
FT                   INALSISGLDYKDVNLTKLLTTHNNNETLENMGRLAKNSVKELSCPLMLALAGFNSFED
FT                   YEIIRNSIDPPQQLLDKIFPFLTNIIDDSTSSKDLLQIKELFSMLRRSLCQDMVIIKKK
FT                   YPYNPLSKSEIFNSPEFSDFVQSIENETPGKLDTIINNSCFIPKDHPMPSGDLLVAGSG
FT                   DNKNSESEMKEPISKDLENQLSILARQQKELDKSFYKFTESQTEIFSQQSELMQKVNNT
FT                   LNGVMILLSAQNKTSIPLLQQAAQETQNYISNVGQSNIERGMNNTAELLNALNSNSGHP
FT                   QSQSQPQSHSSTSLLPSTQAPQPVASSLSNLLHPQASEFPRAALSEPPQVQPLLTQRHA
FT                   MPLQQQQQQQQQQQQQQQQQQQQQQQFYMHTSNSPSIHQSAAMVPMASYPSTTTTSAAT
FT                   VQRQIPAQPQPSSSADIGLTPEQMERQRVLHRRLSRQATTLFEMWDDFKSMEKALQDHD
FT                   ITVTEWLKLHGSSERQFRHTRLKIIRFIEEEAQHRNTSVEIVKELLHNKMRNRLRPWTL
FT                   DEVQRMLTANKRINLDDDS"
FT   CDS_pept        complement(57204..60053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078041"
FT                   /orf_name="CD36_60250"
FT                   /product="Vacuolar ATP synthase subunit A, golgi isoform,
FT                   putative"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /function="hydrolase activity"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, proton-transporting domain"
FT                   /protein_id="CAX40979.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0033177"
FT                   /db_xref="HOGENOM:HBG629705"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniParc:UPI000192D8A8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB5"
FT                   /transl_table=12
FT                   /translation="MAPIRLSETNGLSLNSESNEAIFRSAPMTLVQFYVTIELARDMVG
FT                   VLGKLGNVQFRDLNSKLTPFQRTFITELRSIDGLVSQLEFLHSIMIKQNTIKSDIYVNL
FT                   HADMKPLPTTSEIDDIKTRLNEFYERIKHLDQSYNNLDRKRLKFIENRCVLNSLNDFHR
FT                   SNLVGGYDDQHTEEEGDVDDNAALLNEQRNHSLEIGYEVHNLDDISFNSLAGTIARDKV
FT                   PILRNILWRVLRGNLYFHDIPLDEEFPTTESSMELVYKNVFIIFIHGEFLRTRVRKIIQ
FT                   SLDGILFDNATGGSEARNETLTEINGKIEDLSNVVQTTKDQLVTELMIFQELYPDYCYI
FT                   VQREKLIYETLNKFDEDSTRRCLVGEGWIPTSDFDKIRLALRNLIRQKTRRDGSGNSDR
FT                   DSNESVNISESIATEASLFAIDDSDHELTGFEIEEEEEVGSLIAVVNELATNRTPPTFH
FT                   KTNKFTAAFQSIIDAYGIATYQEVNPGLATIITFPFMFSIMFGDLGHGFIVFLMALYLI
FT                   KNEVRFGAMRDRDEIFDMAFSGRYIILLMGVFSMYTGLIYNDVFSKSMAIFSSGWKYVI
FT                   PENYDSKKGATLVAERITGKVYPFGLDWAWHGTENNLLFTNSYKMKLSVLMGYTHMNYS
FT                   LMFSLVNYLFFKSRVDIIGNFIPGFLFMQSIFGYLALTIVYKWSVDWFGSNRQPPGLLN
FT                   MLINMFLSPGTIEEPLYAGQKYIQVFLVLVAAVCVPWLLIYKPLVLKKQNDRAIQLGYS
FT                   DLRSQRQHSLQLHEEERALAMHDQELNHDAPDDSFELLGGSDEEEQEFRFPNDVEPMFP
FT                   SAGGGGHGGGDDEEGFNFGDIVIHQVIHTIEFCLNCVSHTASYLRLWALSLAHAQLSTV
FT                   LWSMTIQNAFGKTGTVGVIMTVVLFAMWFSLTVCILVFMEGTSAMLHSLRLHWVEAMSK
FT                   FFQGEGYAYEPFTFKSIDI"
FT   CDS_pept        60564..62987
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572522"
FT                   /orf_name="CD36_60260"
FT                   /product="ERAD-associated E3 ubiquitin-protein ligase
FT                   component, putative"
FT                   /function="binding"
FT                   /function="ligase activity"
FT                   /protein_id="CAX40980.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG398606"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000192D8A9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB6"
FT                   /transl_table=12
FT                   /translation="MIVHYIILSVWSLLVLASTSNDAQYNQAIVELEKLAGNFTRPKLY
FT                   NIDNIEGNLYIPQFDQLTNDYKSTQKKPQPPPELTKSIIPLLKKSASESRNVNALVTLG
FT                   DLYLFGNYSLTPDYYMAKKYYQEAISLAPNGHAYFMLGYIYSTGLFGTFPIDQKRGVLY
FT                   YQFAAENGDRNAQMVMAYKNFKGLGVPTDCELALEYYTDLAEQGKDWMSKNDANGQVDY
FT                   NIRISDFNGGLYGEKMSESTSTIEIRSKYFKDLRNTFEEYKLTANEHEYATLFYDALES
FT                   YKGDYFVPKNLTKAFTTFQECVALGEEIYGASDYKNIDGIDKIFLSSCQSKLGRMYLQG
FT                   MGVSQDTRKAKQMLDRSLKVQATPEALGLLGFIEEQGLLGEPNVSKAIDYYVAAVKKKS
FT                   PEANRNLAKLLMRLNGGDPHTSEHHKEIYTYMKDAVYYRDTEALYYMGSFLQSGLSKIA
FT                   DSKNDISCPNIVMYYRVFLERLSSFYAPHLKFAFEELIAGNYQNALIGYSIAAEHGFEE
FT                   AQISTAYLLYQLQPLYSKQPPKTFPPERVEMAVLYLERASKQSNVDATILLGDLYSGQA
FT                   GASHITPDFDRAFNYYRTAAERESSHGAYKLAEMYEYGIGPANNSVDYFMAKRYYDFSL
FT                   KYNEILNHAKSESSSQFISSKTHIDWALLRLRLKYLFNRSAFKQSGNSDGGWLSAFKKV
FT                   GNRVSNEVPQDSNSISRANAHHEGDTYNDDLIEQYDIGDYLVIAMTFIFFFVFFVQNIL
FT                   RQFRRMRNGQRRDEADNNNNNNGDDNDDNQGQNGWNGNQFHFRRGNFEFHFFAI"
FT   CDS_pept        complement(63063..67325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229441"
FT                   /orf_name="CD36_60270"
FT                   /product="DNA replication ATP-dependent helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAX40981.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG398607"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014808"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniParc:UPI000192D8AA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB7"
FT                   /transl_table=12
FT                   /translation="MSGVKEDASSTTKRFKDSNEAINPVKRLKKTMYFPVNNLTNPQND
FT                   QSNVQKPPIRPININSLTTKVNPVQEINKNSTHNSTKVQKQQELNFLQENSDDSFDGIR
FT                   WKESPEIKSSHKQSDIKNSFSGLPSSPLKNINPESENVDDRTSDVLNRYGSNFDNVSKR
FT                   RTPLMTKTRSDITSSSSKHKKQNNEISQLQRAKSGDDYKVKSMSGSITDSFQNTLNNWI
FT                   NKFEADPQDNQNSNLQPGTVDNNETIPENKTLANPNASLQSEDPFSDDDDLFQLLHTQM
FT                   QPQPISEDKVSMKPPSENVLDDGESTDDPFSDDDSELMAVLKTSTPSVTSEYTKSFQQG
FT                   IQNFEKLNIENTHQEEDLEEVSDLVYDRVKTQRFRIVNVIEQYYGRNHEKQFILEVVDS
FT                   MRDKSKILVRGDYCELELEKGDVIHVIVTDSSNPRLIDDMHNLLIWNPDILLSATTIAQ
FT                   QLNCSRKTVILSRYKFPATSTLPIIAGEIVHFIFQECICTEKWDTEFMNQVLDELLSQY
FT                   MLLIFGIQKEVKEVREEVVKHFDYLQTWFNTYYKQPLSRKNLIDETSERDPIMFAVEEA
FT                   LDIEEEIRSPIFGIKGKIDATITAKFENKKMKGQFMIPMEIKTGREYIYHRAQASLYSL
FT                   LFKDRYDMTIDSFLLVYTKEKLTQKCNIRISDLRSLVNLRNKVSHYIKNNLKLPPLVKN
FT                   SNCERCEIRSACMTLNHLTENGTKEESGIEEDLYEAITRDIFENDLYRNYFQHWDELIS
FT                   KEEDISSRAVKDLWTIPAEEKEFQGKCFSDMRITNSNEKESNNFLFSSTHHDKSQNQQF
FT                   MYTFAKAENASKFNLARSLINVNDKVIISDEEGHFALTTGLVKQITKDFVVISTRRKII
FT                   TSDYKLKNYNRANNQVFQSVIRSTQQNTQTTIEKKFRIDKDGMFYGLGLARYNVLSLFL
FT                   PGGASKLRKLVVDLEKPTFGTSSWEIPDAEKFNPDQIAALNKAFSANDYSLIVGMPGTG
FT                   KTTVIAQLIKVLVSQKKSVLLTSYTNSAVDNILLKLKELDIDFLRLGYPQRVHKDIKDY
FT                   IPGFKDSITTYEQYVNTYMRPKVIATTCLNITDTCFNLRRTFDYCIVDEASQITLPVNL
FT                   GPLGFADKFVMVGDHDQLPPLVTHPDKRVKQELSRSLFSLLAKEHPDSISYLTYQYRMN
FT                   NDIMNVCNTLIYNNKLKCGSEKVAQQSLKIPNSEVLNSFLTEDVPSDSQWIHKVFDEKN
FT                   KVLFLDYDAVPAVEETVGEMITNTREALLIQQLVNALVLGGVKEDQIGVMSFYRAQLSV
FT                   LKKNLCNLKDLEILTADQYQGRDKECIIISLVRSNERKFAGNLMTEYRRLNVAATRAKS
FT                   KLIILGSRFTLSTNELTNTFVDYLESEKWYYPLPQSAHKIYEVPKVNGSSTTSQRSHDS
FT                   PILNRNPILKNVVQDLTR"
FT   CDS_pept        complement(67876..69618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572523"
FT                   /orf_name="CD36_60280"
FT                   /product="High-affinity glutamine permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX40982.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192D8AB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB8"
FT                   /transl_table=12
FT                   /translation="MFKKEDQAVSKEVRPEELGSFTGSEEKYSSNEFLNTENKTAFQNF
FT                   IDSFRRKQASEDESAGKQLAKGISKRHLILMSLVTGIGTGLLVGTGQVLRKSGPLFLVV
FT                   GYAIAGSFVYPTLQAAGEMAVNYSELSGGYNSYTRMFVEDSINFAISWNYCIQWLSVIS
FT                   IELVTAAITIEYWISETKVNPDAWVAIFYVVIVVIHFIGSKAYGEFEFIIGSIKVCLLI
FT                   GFIIMGIVLDTGGGPTGEFIGGRYWKNPGPTNNGFKGFCSVFVTAAFSYGQSEFVALSA
FT                   AEQPNPRKAIPTACRLIFWRIIVLFLGSLTIVGLLVPSNSTHLMSEGSSSSNTSPYVLS
FT                   AALHGVKAVPSIINAVILMSVTSVASSSLYSASRTLQSLAEQGFAPTWFNYIDRAGRPT
FT                   RALLIAAIIGLFAFIAAYKKQVTVFNWLLAISGLSQVFTWSGICLSHVRFRQALKYNNI
FT                   STDALGYKATTGVWGSYYALIWYALVLISQFWIALFPIGASKPDANNFFQSYLGAIVLV
FT                   VFYVGHKLYTRKWRLLIPISEIDINNERTIFDEEILNLERQEEQDKWERAPWHKKIVIF
FT                   AFSH"
FT   CDS_pept        complement(71259..73616)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572524"
FT                   /orf_name="CD36_60290"
FT                   /product="Mitochondrial intermediate peptidase,
FT                   mitochondrial, putative"
FT                   /EC_number="3.4.24.59"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX40983.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG562792"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI000192D8AC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIB9"
FT                   /transl_table=12
FT                   /translation="MKAGIPLSRCTQRIPLLAARHVSRNITTTTTISKLSLAPDYNHIR
FT                   KVFDSQKYFNHFTKQGSHATLFSSPQTGLFHNEYLTTPQGLVDFSQQSLGQAKELVSEM
FT                   LSQVNTADGKLKFIKKLDQLSDILCRVIDVAEFIRVVHPSVKWINAAQQTHEMMFEFMN
FT                   QLNTNVDLYSSLRDTLNNPVITEQLTAEEIKVGEYLKQDFERSGIHMDPQTRENFVTIT
FT                   QEISLLGSQFGNQINGLKSYWCPITVSEWESIEDSQLKKEIKNYQSKYDGIREPESIQI
FT                   PLVASIPYTILTNCSSDSLRKKVWIALHNSPDEQIETLNRFISYRALLSKMLNYKSFAD
FT                   YQLEHKMAKTPENVITFLSNLQKSLIKKGVVEELSQLAEIKHDGGNSSNVNDIVNDIKP
FT                   WDRDYLLAKLQSRMQSEVSAGNVKDYFSVGTVIAGLNELFTRLYDISFVPVAALKGETW
FT                   DSHQVRKIKVVDNAANKTLGFLYLDFWSTKVLPSHFTIVCSRRLNTSIGSETIESMENL
FT                   VQLDDDYQLPVVSLVCNFASSGNFSFGRFAGVENEKPTLLTLDQVDTIFHEMGHAMHSM
FT                   IGRTELHNLSGTRCSTDFVELPSVLMESFSKDPRVICQIGRHFDTDEKLPEALLEQAQE
FT                   HRIMLDACETFMQSKMAMLDQKLHNEEMVKLLAKGLYEVDSTKVYHSVEKELRVFADEW
FT                   STWHGKFPHLFSYGAVYYSYLLDRAIADKIWQGLFAKDPWNGEAGKKYKESVLKWGGTR
FT                   DPWECLADALGNDELKQGDSRAMEIIGQNSNL"
FT   CDS_pept        74562..77147
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248279" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572525"
FT                   /orf_name="CD36_60300"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX40984.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG626663"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015746"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D961"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC0"
FT                   /transl_table=12
FT                   /translation="MSGLEHLQNLSIQPSNRSTQQQQIISQPQAQYSQSAAKRRSARDY
FT                   QFGAKIGEGSYSTVYSALDKYTNRTYAIKVLSKRHIVKENKIKYVNIEKTTLNRLGQQH
FT                   PGIVQLYYTFQDESSLFFVLDFAEYGELLSIIRKFGSLSESVSKFYMCQIIDAVRFIHS
FT                   KGVIHRDLKPENILVGHDFNLKITDFGAAKLLGNHEEFNGEKIDYNSVDASPEVSDTDR
FT                   KGSFVGTAEYVSPELLKHNVCGFESDIWAIGCILYQFFHGVPPFKGSTEYLTFEKIINV
FT                   DYSYKSPIPLPPDVIQLIDSILVSEPSARATIPRIMSSKWFSEIPWDDQNFIWHRKVPR
FT                   FEAFGAVTPSPAMPPMMKNGTNRNVNKSNSYHQLQSQISASEFGFIPSIAAKKSYKPPT
FT                   MIKNNVAMPALNQTTYNPNYQQHVPHPPPISSQPVVQQNMPPQIQPQRSGSAQTPQFAP
FT                   VAAPNRPPIASMQVRQAGPQVLVPQKTPPFPKEKNSTPNLRDNTSFAQMTPRRNGEIPG
FT                   QQSPFAKSQQSSQPSPPPPPPPSQKFVYQSQQQKQQEDVTGSRNTSTNAAAAAFATKNL
FT                   PQQTYKTTNDSSISPAMKSKKVQENFIKFSEVSGLLKHDEKILKMDNLIKSVLSKKYLN
FT                   KPEYQVLDDSVLDELTSKYASILKQESKVVITIVTNMARVFFIDASLNVMLVDLKANKG
FT                   ADYSMYDYEFENIVDEDGNLLPKQDEAFGYLIIELIKDGGDLVFLQRISDEQRLKLTNA
FT                   VKVLDKNGEEVVVGASHGWIDCLLIAREISIEQSQDKKQPRSVSSSSNVSINEAKSEKS
FT                   KKKKPSLPNKKPRPKKKGTSSNGTPQTTPTQSQPSNFAFAAAAAVHYQK"
FT   CDS_pept        complement(77314..77865)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229442"
FT                   /orf_name="CD36_60310"
FT                   /product="Uncharacterized protein YBL107C orthologue,
FT                   putative"
FT                   /protein_id="CAX40985.1"
FT                   /db_xref="HOGENOM:HBG398608"
FT                   /db_xref="InterPro:IPR016805"
FT                   /db_xref="InterPro:IPR019171"
FT                   /db_xref="UniParc:UPI000192D962"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC1"
FT                   /transl_table=12
FT                   /translation="MATNQSSKFRAPTDLLTPESCISSSRIRAFLKRSRNLTDDTIRPH
FT                   LNEIEKSKCTQYFEEEIVPQWKIRGEIIDYCSKYSKELRNHTSQGKTVTPTKLSYDLPN
FT                   AEEMTDKFDLRTDPYAYKTYQRRIDEQYAQCDALDNWTQNEKTVEQIIRQQTVEVLNDK
FT                   CFYQNWMQAFKNASDPKKYK"
FT   CDS_pept        complement(78106..79656)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078042"
FT                   /orf_name="CD36_60320"
FT                   /product="Nucleolar protein, putative "
FT                   /protein_id="CAX40986.1"
FT                   /db_xref="HOGENOM:HBG611715"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniParc:UPI000192D963"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC2"
FT                   /transl_table=12
FT                   /translation="MAYVLTETAAGYALLKAADKKIHKSSSLVEDLNTAEKVAEQFKIH
FT                   RFEKFQSAANALEEANAIIEGKVSESLQKLLEDAKSDKKATLIVSEAKLGNAINKLGLN
FT                   FQVVSDAASLDLQRAIKQFLPDLLPGLDDSALKQMSLGLAHSMGRHKLKFSADKVDTMI
FT                   IQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKMITDSVAYARIILTMGVRSNASETD
FT                   LSEILPEEVEEQVKAAAEVSMGTEITEDDLNNIKALAEQIVDFAAYREQLSNYLSSRMK
FT                   AIAPNLTAMVGELVGARLIAHAGSLTSLAKAPASTVQILGAEKALFRALKTKHDTPKYG
FT                   IIYHASLVGQASGKNKGRIARTLAAKAAVSLRYDCFDEERDESDDFGLENRAKVESRLS
FT                   QLEGRDMRTTSKVVREQPKVEITEARAYNADADSTAAAAAAVAPTADSDDEESETEEVE
FT                   EKKSKKEKKKEKKEKKEKKKDKKRKRDDDKEEGSSKKSKKDKKEKKEKKEKKKKKEKK"
FT   CDS_pept        complement(80068..81078)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382345"
FT                   /orf_name="CD36_60330"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX40987.1"
FT                   /db_xref="HOGENOM:HBG398610"
FT                   /db_xref="UniParc:UPI000192D964"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC3"
FT                   /transl_table=12
FT                   /translation="MLRSLSRDSFTTLIEENDDNENDDLQSQSQHENTEELTSDLISLI
FT                   SQETLINTSVQIMNQNVSQFNKHYELPLISSYLHTGVSLYLSFQDLLNNKPPLLTRTSS
FT                   MMNINNLLRRPFRNSSFLTIHKHESMSNKFEFCHVDFKIHSNHITYYILKFPTLDETIY
FT                   LINNNSSKPTVDFEYKKTCFRITGVTGTTSVIGVSPEIKLYVMNPNSKNLLTYNTTVLN
FT                   GKKLQINNGLSKLVNSQDQSRINEMLRNEKPVISIPMGRYLDQGDAKLKLDNSSVNGGA
FT                   TKHKSNVIKHGVIRLFDYKEEEENAESNTVSNDMLVLCCVLLVLREQEYRKFKSG"
FT   CDS_pept        81248..82615
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572526"
FT                   /orf_name="CD36_60340"
FT                   /product="Putative seryl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.11"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX40988.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI000192D965"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC4"
FT                   /transl_table=12
FT                   /translation="MFNTIRRHISTGKNTSTLLRAQIDINDILSRPKEYESSIRRRQLP
FT                   EDLIENINYITSNRPLQSQLFSQINEMKRERDLIAESLKSKTGDLQQFKERLKEIKTAL
FT                   KPLEKQVKTLQEEIYAKAESLPNLIDKSVPADPLKEEVVQFINCHSEEDAKTFKTLSAH
FT                   DHKEIGVSFNILDFNVASKVSGPSWYYLIGDGALLEQALIQYALSKARKRGYLMLTPPS
FT                   VVKSEIVSACGFKPNDQNNEKQIYQLEDEGKSLTGTAEIPLAGFHASSVFPSGTQFPIK
FT                   YVGVSRAYRAEAGASGRDTKGLYRVHEFTKVELFHFTTAEKAAQELEDLKDMQVEIVTE
FT                   LGLSAKLLNMPTSDLGAPAMKKYDIEAWMPGRGSWGELTSCSNCGDYQSRRLGIRYNND
FT                   QEDRLKHVSTLNGTCMAVPRVIVALIEQNYNSEKNEISIPRVLQPFMDGKDKIVPN"
FT   CDS_pept        complement(82661..84007)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382346"
FT                   /orf_name="CD36_60350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX40989.1"
FT                   /db_xref="UniParc:UPI000192D966"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC5"
FT                   /transl_table=12
FT                   /translation="MSNKENIPITPKSKDNRNSVSALSPINNQALRPISPNKENNQIGK
FT                   LNFLETDNLDEHFELVHVTQEEIRQRLHNIELTSKQTSVDLGQLFDRSKNNNENLNKLL
FT                   RNVVSYSEEVMTEGNATKADMEKILTRLDKLNERNSRSDNDVNPKVEITDSSMDKIREL
FT                   IRQVFGDHSKMDGEDEKLNAFKEEVSKIKDIINAHNEVVSFQLKSQDTKQSELTDHLNS
FT                   YFQQSKDGVEMLKKIHSHVEARESDLQQLKEINLSLEDLKAANLALQDKLPPSDLIQKI
FT                   VSPIVAELKSSPLNSSLSTSLEGILEAIDKLKKTIDEGPKSAAVLEKSDRIAEDKNTSN
FT                   TLLEKQEEMESKIRKMEDKYSLLTTKYEEKLEQYKDLSNKYQQLQAQIEDTQVPTNNRE
FT                   SKMEKLRNFHKLKVGEIEQNEFVNERKRIASTPVVQTRSIQFTNNSDED"
FT   CDS_pept        complement(84236..87466)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197426" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572527"
FT                   /orf_name="CD36_60360"
FT                   /product="Exocytosis and cation homeostasis regulatory
FT                   protein, putative"
FT                   /protein_id="CAX40990.1"
FT                   /db_xref="HOGENOM:HBG331004"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013905"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192D967"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC6"
FT                   /transl_table=12
FT                   /translation="MFNKLKSRKAPLSLDSVSNAIKTRGSKSLSPEEINPKHIDLKVIN
FT                   QLGIPQNSIVAVAYDPVQSLLAVSTTSNDVRVYGQLNVEVVFEFNIKNPITFLRFVKGV
FT                   YLVCASPGTGLSILSLHSKKVLGTGSFPGTVTAMESDPSLDWLIMGLSNGSLMFYDVDR
FT                   INLTPFRIDNLQKKIMPKEKMSPVLSIEWHPRDIGTLLIAYQQSAIVYSLASGEIKSIL
FT                   VYQLSKDHRGFQLASHIANGGKKKIFGASKEVIPKLKEAHFHPNGLHAVTVHEDNSIVF
FT                   WDLASGTILEARNVFDVNIHQPGTPLEIPEVFQPIETVQWVCGEDPENTKLIITGGDPN
FT                   SKNAIHVLDFGYTLKYSITSYEKQAEFYAQPQSGQRIIPVTFYLNKTEVEEVITKILPI
FT                   TENGSPYFHGGHDPSFLLLVSNLGRIYFVSFAEHAGGQGSSDLGTVILPTSISFIHPPL
FT                   CSFDVEQVRRIDWYSIMSSRASTGATSKTKEMFFGGASVGLNNVSKPIGYDDSFRNILI
FT                   TGHESGLVRFLDVTKGEQHEVEGIVQIGLRETLFDYGNPKSLRVIFVSCSFENRELLVA
FT                   LATGEVVVCKFGKNNRNAGLSSTKDYSDCGVQHANKNAKLLDISGRISGSLNASSTFLP
FT                   TSLLQIEPPEPISVIKMSNIGFGAVGYKSGRLVVCDITRGPAVILNLDNIKEHLVSVQG
FT                   NCYPTSIEFSIQEYGNDGYSSIVLLVGTNCGGNLVMFKITPMGNGGFEVVFVDKTAHLN
FT                   YRTTDASGAEGSCISQLIPLNSVTGESAVADMSAFNKLSQGIVIPAYVIATSDRDIRVL
FT                   KLPKQKLSHKVVEDSCLKCSVVNYRNKGVVLAILVKSGFVKLCSLPSLSDIANVKLPKE
FT                   VYSQVKGSLESGMATQSDLLRSGELFVRCSKTESVYITTNEKTRHKDETNTDRLFNENA
FT                   IIPPRPTASTLSWAKGQISYVSVDDLALLVAGPNRKSPKNAESQLAYNISPEANAQNNY
FT                   GGYNPQKGRDTNKDKGSSPYDQPVRRGTNNSGGLGSQGFMRSLQNSIQTVEETFNDYAN
FT                   QASQTFTEGLEDQKKSMYSAAVKSKFGF"
FT   CDS_pept        join(87728..87730,87828..88082)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078043"
FT                   /orf_name="CD36_60365"
FT                   /product="Dolichol phosphate-mannose biosynthesis
FT                   regulatory subunit, putative"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="integral to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAX40991.1"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0030176"
FT                   /db_xref="HOGENOM:HBG320519"
FT                   /db_xref="InterPro:IPR009914"
FT                   /db_xref="UniParc:UPI000192D968"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC7"
FT                   /transl_table=12
FT                   /translation="MCADKLIGFGMLGVAAFVFTYYTTWVFVLPFINEDNILNQFFLPR
FT                   DYAIKLPILLLFVAALGVGTFVGKVLIKNQQKQKSKKKAQ"
FT   CDS_pept        complement(88241..89791)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094273" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078044"
FT                   /orf_name="CD36_60370"
FT                   /product="AP-3 complex subunit mu, putative "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAX40992.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG398616"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000192D969"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC8"
FT                   /transl_table=12
FT                   /translation="MIEAVYISDSTNSLVYEYTTSLCIPKFKSLVPKVTSFNDSTTIDN
FT                   KSTTSNKIPLNSKLYLFVHQHQQSALQFFLLCKEIDNANPLLPSIFIRRLIEVMEDYFG
FT                   DLNSVKIEANNEILTLLLYQMLDDGTPYITDFNKLRDLVSYKSLLSKLLSSATTVASKA
FT                   TGTAVSNKGPLDLNRANNHQTTDIPWRRNNVKHTNNEMYVDVIETVNVIIKPTTSKTQR
FT                   HLQSETQNQGFDSAFYSSASNKSFSGGIENHLISGYIDGEINFLSRLTGVPALQLSLNS
FT                   VGTSKIQLPSLHRCIDLDVWNENRGILSFIPPDGKSTLMRYQIDFNKTNQNRMSDKRST
FT                   LSLLKSASIEAEFICHENTPDFEIRLNLSQSISKIDFLSVEIVSEHPDDQIKMNRATHG
FT                   DFSTKGNGKAEWILRQLKPNVFSPVFYGSVISNTENSSDEEEEEGPRYEDSQEQHNKRM
FT                   AKSKPSYLKLSYSHKGPVPSGLKVDSLKIISAKGLGDTVKPYKGVKYMTKSGNYIVRS"
FT   CDS_pept        complement(90354..92219)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572528"
FT                   /orf_name="CD36_60380"
FT                   /product="Iron transport multicopper oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX40993.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000192D96A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIC9"
FT                   /transl_table=12
FT                   /translation="MRMTLSSLVISITFFFSLIAAETHTWYFKTGWVNANPDGVFERPM
FT                   IGFNDSWPLPTLRVKKGDRIQLYLINGFDNLNTTLHFHGLFQNGTNQMDGPEMVTQCPI
FT                   PPGETYLYNFTVDQVGTYWYHSHTAGQYGDGMRGVFVIEDDDFPYDYDEDVVLTLGDHY
FT                   HDYSNEIIPTFLSRFNPTGAEPIPQNFLFNETRNLTWKVEPGKTYLVRIVNIGGFVSQY
FT                   LWMEDHQFTVVEVDGIYVEKNTTDILYITTAQRYSVLITTKNSTDKNYAFMQRVDTDML
FT                   DVIPSDLQLNGTNYIVYNEDASLPDAYDVDSLDDYLDDFYLKPLSKEKLLDDADYTITV
FT                   DVQMDNLNDGVNYAFFNNITYKAPKVPTLLTVLSAGDAATNELIYGTNTNSFVLQGGDV
FT                   VDIVLNNLDTGKHPFHLHGHAFQLIERHEEIPDTEDPVTYNATDHADWPEYPMMRDTVY
FT                   VRPQSYIVMRFKADNPGVWFFHCHIEWHLEQGLAFQLIEDPQAIQKNEKITDNHKQICE
FT                   KVGVPWQGNAAANNKDYLNLDGENLQVKRLPTGFTAKGIVALVFSCIAGFLGMAAISYY
FT                   GMHDIQNMEKRIARDLDVYFDDDEEEDQSITEQDATGSSSSPSNK"
FT   CDS_pept        complement(93820..95694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572529"
FT                   /orf_name="CD36_60390"
FT                   /product="Iron transport multicopper oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX40994.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000192D96B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID0"
FT                   /transl_table=12
FT                   /translation="MRAILSSFVIVITFLSSLISAETHTWYFKTGWVDANPDGVFPRKM
FT                   IGFNGSWPLPTLRAKKGDRIQLYLINGFDNLNTTLHFHGLFVHGANQMDGPEMVTQCPI
FT                   PPGETYLYNFTVEDQVGTYWYHSHTGGQYGDGMRGVFIIEDDDFPYDYDEEVVLTLSDH
FT                   YHKYSGDIMPSFLTRFNPTGAEPIPQNFLFNETRNVTWKVEPGKTYLVRILNVGGFVSQ
FT                   YLWMEDHEFTVVEIDGVYVEKNTTDLLYITVAQRYGVLITTKNSTDKNYAFMQRVDDTM
FT                   LDSVPADLQVNGTNYIVYNEDAPLPDEYDIDSIDDPLDDFYLKPLSKQKLMDDADYTIT
FT                   VDVQMDVLNDGVNYAFFNNISYRAPKVPTLLTVLSAGDAATNELIYGSNTNSFVLQGGD
FT                   VVDIVLNNFDTGKHPFHLHGHIFQLIERHEAVDSKEDPVTFNVTDHADWPEYPMMRDTV
FT                   YVKPHSYMVLRFKADNPGVWFFHCHVDWHLEQGLAIVLIEDPQAIQKNEKITDNHKRIC
FT                   EKVGVPWEGNAAANSNDYLNLKGENLQVKRLPTGFTTKGIVALVFSCVAAFLGLVTIAF
FT                   YGMNDIAHVEEKVARDLDVDLEDENEDEEEAIIVNENSSSCESNSKPH"
FT   CDS_pept        complement(97354..99249)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382347"
FT                   /orf_name="CD36_60400"
FT                   /product="Iron transport multicopper oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX40995.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000192DA25"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID1"
FT                   /transl_table=12
FT                   /translation="MQFIVSSFILFISFLSSFVSAETHTWYFKTGWVDANPDGGFPRKM
FT                   IGFNDSWPLPTLRAKKGDRIQLYLINGFDDLNTTLHFHGLFQHGTNQMDGPEMVTQCPI
FT                   PPGETFLYNFTIDDQVGTYWYHSHTSGQYGDGMRGVFIIEDDDFPYDYDEEVVLTLSEH
FT                   YHDYSKDLMPGFLSRFNPTGAEPIPSNLLFNETRNNTWKVEPGKTYLLRIANIGRFVTQ
FT                   YLWMEDHEFTVVEVDGVYVEKNTTDMLYITIAQRYSVLITTKNSTDKNYAFMNHVDITM
FT                   LDTVPADLQVNGTNYIVYNESAPLPDAYIVDSIDDYLDDFYLKPLNKEKLLDDADYTIT
FT                   VDVQMNNLGNGVNYAFFNNITYTTPKVPTLLSVLSAGDAVTNELVYGTNTNSFVLQGGD
FT                   VVDIVLNNLDSGTHPFHLHGHVFQLIERHKEIPDTEDPVGYNATDHADWPEYPMSRDTV
FT                   YVRPQSYIVMRFKADNPGVWFFHCHIEWHLDQGLAIVLIEDPEAIQKNSSQQITDNHKQ
FT                   ICEKVGVSWEGNAAANTNDFLNLKGENIQVKRLPTGFTARGIVALVFSCIAAFLGLASI
FT                   AYYGMNDIKDVEERVARDLDVNLEGENDEDEDEDEEEAEIVNEGSSSSGSNSKQH"
FT   CDS_pept        complement(100923..102782)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572530"
FT                   /orf_name="CD36_60410"
FT                   /product="Iron transport multicopper oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX40996.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000192DA26"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID2"
FT                   /transl_table=12
FT                   /translation="MRSLSVFSLVFLFFSTLISAETHTWYFQTGWVNANPDGVLERPMI
FT                   GFNGSWPLPTLRVKKGDTVNLYLINGFDDRNTSLHFHGLFQHGTNQMDGPEMVTQCPIP
FT                   PGETFLYNFTVDDQVGSYWYHSHTSGQYGDGMRGVFIIDDDDFPYDYDEEVILTLGEHY
FT                   HDFSDDLHKDFMSRFNPTGAEPIPSNILFNETRNNTWKVEPGKTYFVRIINIGRFVSQY
FT                   VWMEDHEFTIVEVDGIYVEKNTTDLIYITVAQRYGVLITTKNSTDKNYAFMNRVDIDML
FT                   DVIPSDLELNGTNYIEYNSDADKPEPYLLDSIDDYFDDFYLKPLSKEKLLDDADYTITL
FT                   EVQMDNLGNGVNYAFFNNITYTTPKVPTLLSVLSAGDAASNELVYGTNTNSFVLQGGDV
FT                   VDIVLNNLDTGKHPFHLHGHVFQLIERHEEIPDTEDPVAYNSTDHADWPEYPMLRDTVY
FT                   VRPQSYIVMRFKADNPGVWFFHCHIEWHLDQGLAIQLIEDPQNIQKNSSQQITDNHKQI
FT                   CEKVGISWEGNAAANTKDYLDLKGENVQHKRLPTGFTARGIVALVFSCIAGVLGLATIA
FT                   YYGMNDIKDVEERVARDLDVDLDEEEDEIVNDGSSSSVSNSKR"
FT   CDS_pept        106134..107534
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572531"
FT                   /orf_name="CD36_60420"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX40997.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG397787"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000192DA27"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID3"
FT                   /transl_table=12
FT                   /translation="MLILKRLITTSCTLLDTSPKNYYKIITPATFETKKCESYNETHSS
FT                   TTTTEITTTATTVAGTVNEDLTITHKTGRKIISTYKRSTHPTSVPLSKIFSNNFPLSIN
FT                   ESFEDYKHRNNPLKFQHDLLSTLPFYPSLGPQQETEGRSSEVLKIEIDDEGNYINEFVI
FT                   YPENYHPHIVPDEEYHHLIMIHGYGAGLGFFLKNFDDISNFPPNDTQNNNNTNKYIIHA
FT                   IDLLGYGCSSRPNFYPQNLDQVENWFHDSFTTWLHKRKIPSDRTIVMAHSMGAYLMATL
FT                   AINRNLKFCSKLLMVSPGAVIKHQNPVQVPRYFVKLWERNISPFTIVRKLGPLGSKIVS
FT                   GWSSRRFDKLTRQEKKLLHKYSYGIFQSKGSGEYMLNYLLAPGADARHPLVDRGIDKIT
FT                   CDVSWWYGKEDWMDKKGGQICSDIINKKGQFKSDVKVIEDSGHHIYLDNIKRFNSMVLE
FT                   EMKHLINK"
FT   CDS_pept        complement(107693..108688)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572532"
FT                   /orf_name="CD36_60430"
FT                   /product="NEDD8-activating enzyme E1 catalytic subunit,
FT                   putative"
FT                   /EC_number="6.3.2.-"
FT                   /function="ATP binding"
FT                   /function="ligase activity"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAX40998.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG521753"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI000192DA28"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID4"
FT                   /transl_table=12
FT                   /translation="MVFDNVRDISSIEPLISNIGPYNEFPEEYNSDDSFKALQESKILI
FT                   IGAGGLGCEILKNLAMVGFKNLYIIDMDTIELSNLNRQFLFRMKDIGKSKAEIAAQFVR
FT                   DRIDDPSLKIESYFTKIQNKPIEFYQQFNLVISGLDSIEARRWINATLISLVQQGYMIP
FT                   LIDGGTEGFRGQSRVIIPTVTSCFECSLDLLSPKVTYPVCTIANTPRLPEHCIEWATQI
FT                   EWNNKFAGKKLDGDNPEHIEWVYQTALERANEFNIDGVTKHLTLGVVKNVIPAIASTNA
FT                   IIAASCCNEAFKLITDSNPILHNYMMYTGDDSIHTYTFEHSKKLHCICSS"
FT   CDS_pept        complement(109183..110823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572533"
FT                   /gene_name="RAD52"
FT                   /orf_name="CD36_60440"
FT                   /product="DNA repair and recombination protein, putative "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAX40999.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="UniParc:UPI000192DA29"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID5"
FT                   /transl_table=12
FT                   /translation="MNSRPAPAPPQPQPQPQPQSKQPQSNQQTLPFRPGESRPSYFNPA
FT                   IEQHANPTKSSDFVPKEYTEQEYKEIETKLSKSLGPEYVSYREGPSGHRIPYIEGWKAL
FT                   NLANEIFGFNGWNSQIMSCQVDFLDTHGNVGKFSLGVSMVVRLTLKDGTFREDVGYGFV
FT                   NNCKSKATAFEKCKKEALTDGVKRCLRCFGNLLGNCLYDNTLTAQMKKLKEFPVEFDPD
FT                   NYYRDPLLVERERKKKIIENKLEEQKRQQVDVLRSENPGQQQNDQTVVSKGLTTANGPQ
FT                   NYQNNGSDIANLGTNQGNTSTGQIPPLSHHAAAFVTPKSPSKVVSYVPTSKEVEELDDS
FT                   FMFSDDILDGESQSAYHPPEIRDQGLKQQEKEVAIANNEKSERQLQNESVRVNQNPPVV
FT                   VNAFVNAKSAEVLQQSPSVEAATKSIVQFDPKFVSPNMRRTVDPTKSAPIKRSEVRNGA
FT                   PTTPSPLGVNISSNRINKPMIASNNNNNINNMGKRIGMPPQLRSNKRGNLGKSPSPGVP
FT                   HAVSTSVNGTNGVANVGHSSTTATTTVDQ"
FT   CDS_pept        complement(111505..111765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229443"
FT                   /orf_name="CD36_60460"
FT                   /product="Small nuclear ribonucleoprotein E (SnRNP-E),
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAX41000.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000004DE2A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID6"
FT                   /transl_table=12
FT                   /translation="MSSKQTKQTNLPPINLIFKFLQQQSVVTIWLYEQTQSRIQGKIRG
FT                   FDEFMNIVIDDAVELSNGKKSELGRILLKGDNITLISSLDV"
FT   CDS_pept        111973..113817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078045"
FT                   /orf_name="CD36_60470"
FT                   /product="Crossover junction endonuclease, putative "
FT                   /EC_number="3.1.22.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="CAX41001.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="HOGENOM:HBG398626"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI000192DA2A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID7"
FT                   /transl_table=12
FT                   /translation="MSVVNDDFKPLLIEWVEEEAINATRRGSKMVDLYNKILFQLRQYQ
FT                   LPICDLKTLKSIKYVGDKTANQLRKRIAKHCKEKELTLPRGFMDVAEKHRLDLEESNLS
FT                   SSTSTTKNTNKRAKASGNSKSKYVPKHRSGGFAILIALYLYDKDRNGMTKERIIAGATP
FT                   YCDRSFSNNAASKEFYSAWSSTKTLENHNLISTTGRSPKIYFLTDEGVSLAQQLKTAIG
FT                   LSSPAQGNNMDDRNLIIEQSFDNGVRLDTSFELSSPAGRAMLSSSPIRRISNPAHSNRT
FT                   IQKILEKELRSSEPSPSSQHDAGNRIYDGIKYEVWRKEDYEVIVYMDNREIRSRADRDH
FT                   FQNRLQTLGVKCEVKPLSSGDVLWVGRNTSTGTEAVLNYLCERKRLDDLYDSIKDGRFQ
FT                   EQKNRMKKTGLKHCYYLVEDMVSYQDKVSNLMDSIQSSLTQTMTTARLYLRRFKDIDET
FT                   TAFIASNTKVIETFKSDLIVIKPQDIKNQQDYLDILLKFRNKFEKTQPHQDKPDYECVQ
FT                   LFSRFQDMLGKTNQMTVKEMFILMLMTIRGVSLEKAVVIQNRFPTPKSLLEYYHTEHAT
FT                   TEANVKRDLMMNEFKDQIGNKKIGKALSEKIYNVWGKP"
FT   CDS_pept        114040..114945
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572534"
FT                   /orf_name="CD36_60480"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41002.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG398627"
FT                   /db_xref="UniParc:UPI000192DA2B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID8"
FT                   /transl_table=12
FT                   /translation="MGRNVLKYGGKSGILPKVRPIFRKPIRPPTEYEQAKEDSIETGYA
FT                   EGIPLPKINGKEVSRKQPPKKYVTVEQRINQIKFPELTLKQMNELPAEERDAYKRQYYR
FT                   AQFLKEAYLQEEKRLNRIDELKEKVHQQNLERQARLQQEEKLEHQNKTIEGLPTMQALL
FT                   DKGMMRRRTKEEIELLKEQRNLNRKLKELQDKENQAQKVLELYHAAANFITTEEQLEEA
FT                   IHRAFEVDVGVFEGNHTTIEAKLENRSLGYLTAEANEQKIKDAVLGEIDGKPGLQQVKE
FT                   LLSGEREKVKRQAQLNLKNN"
FT   CDS_pept        115246..117234
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572535"
FT                   /orf_name="CD36_60490"
FT                   /product="Nucleoporin, putative"
FT                   /protein_id="CAX41003.1"
FT                   /db_xref="HOGENOM:HBG398628"
FT                   /db_xref="InterPro:IPR019049"
FT                   /db_xref="UniParc:UPI000192DA2C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WID9"
FT                   /transl_table=12
FT                   /translation="MTSFDIEFTKVYNYQSLFNKVLNKRLKYVLNINLILSFILALIYE
FT                   FMPTANSNSDTSHSIWQSIPVLICVKIPIIFCTLSIIRQVRKQFLIVEYSHHKTLGAQI
FT                   YYSILSFQFLINWLGYFVSSWLIFGVVIFSTSKLKFNLSDYYILSKEYRQHPIINDQWV
FT                   YYWYNPVFISFFYTCNQLIFQRQRLNFEIGHTRNKPQNYLFKHLPILLGNSLGLNLFVI
FT                   SLTPITYWLVKYYIYKSFILIILIFRLDSNIIPKNNTNWITYLQLSYLSFFIILSWEIV
FT                   NHVFNVYSTIGCLDGNKPISSYSADPLNCLLSGLRDVDPNYQLSRLAAFQELAYLSTSS
FT                   DKEALKLRLKIFSFRSKKSNAWSSLLEECALVIKETTDRINYRSTSDLNALKSLEITGL
FT                   KGNINNYSNNKQNSDSLFGNSFINTSPIDKKSSELIKKYQSDTSSTTGAKKKSNKVQGF
FT                   FSSIQLFVSQLFGNLQKTIGDTNQLQEKFTKSFNFKDYLQIYQNYKDKFLQTYIGVFFR
FT                   ITIKRDNESRIINPINFCNSVIAISNLLQYSIEEDKYVIISNDDVCKVLNLLEKPIRAT
FT                   TNYIDYLPASVYVPQNSQTKKHSCLMGKLHDLSMHEFYEICIRFNGKLNDLILTPRTYK
FT                   LVKWVIDKEIAIQQEIQKQKHQKINLK"
FT   CDS_pept        complement(117349..119352)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572536"
FT                   /orf_name="CD36_60500"
FT                   /product="Mitochondrial sodium/hydrogen exchanger, putative"
FT                   /function="sodium:hydrogen antiporter activity "
FT                   /biological_process="regulation of pH"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41004.1"
FT                   /db_xref="GO:0006885"
FT                   /db_xref="GO:0015385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG734847"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018408"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniParc:UPI000192DA2D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE0"
FT                   /transl_table=12
FT                   /translation="MSSLTIYAAKILLKRAISGDLEEDTSDLTTPDDAEDSNPVENEIF
FT                   SSWALFILLFLLMSALWSSYFLQQRRIKAIHETVLSIFCGMIVGLIIRMSPGHYIQDAV
FT                   KFNPGYFFNILLPPIILNSGYELHQANFFRNLGSILTFAIPGTFISALVVGIILYIWTA
FT                   LGLDNVSLEFVDALAVGATLSATDPVTILSIFNAYKVDPKLYTIIFGESLLNDAISIVM
FT                   FETCQKFHGQPVRFSSFFQGVGLFLMTFTISTIIGIFIGILVALILKHSHIRRYPQIET
FT                   CLVLLFAYQSYFFSNGSHMSGIVSLLFCGITLKHYAYFNMSRRTQIATKYIFQLLAQLS
FT                   ENFIFIYLGLSLFTEVELVFKPMLIIVAFIAICVARWSAVFPLSRFLNFFYRTRFERYS
FT                   AGNLSTSAGNMINMPDEISHSYQMMIFWAGLRGAVGVALAMGFSGEAKWTLLATVLVVV
FT                   VLTVILFGGTTASMLEILGIKIGCVDESGDFSDDEFDIEAPPPRFPQQSQQSNISTVAN
FT                   KGQNIYGNRRFARSSKLSNYKDNLSAVNLLDQEHGGVPSTGNSSTSNFANVNNDDDDDD
FT                   EIVGSDVDDFISGSLSNSNSNISSNNNNDRGGVLGAILSAEEHAKWFTRFDEEVLKPVL
FT                   LDTLPSTGQSSQNNSTSNLNSIGNGNGKRNHS"
FT   CDS_pept        121264..122838
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572537"
FT                   /orf_name="CD36_60510"
FT                   /product="ER-to-Golgi transporter protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41005.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398630"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000192DA2E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE1"
FT                   /transl_table=12
FT                   /translation="MYQHQDQAQHHHYQSYNSYNPSIEDLIASSDEKRYQNGGVGNSLQ
FT                   RPPVAGLPYVSSQVNPNTSSANLSKLTNNVNNYGYSNNNNNNYIQLHTPPLSSNPSFTS
FT                   FQNLNYPLSPLSKPTSPEPILSAASVTTSKFLASSFFSWFPPINVRIVSFCIGWYLCSI
FT                   VSSNSTKLILNDFKFPVTLTQFQFSASFTFCLVFLNIVKLNPDRISNKLPPGFIPSMTE
FT                   TNRISLTQFITPTRLIIQTTLPMGMFQFIGHITSHKATSLIPVSIVHTIKSLSPIITVL
FT                   IYRFLFGKSYRMRTYVTLIPLCCGIMLTCYKKNHTSNQNNVPSTGSSVINNSLDNINHN
FT                   NNYSTGLIFAFISMIIFVSQNIFAKKRLTVESSSTIPMNTKSTSRINSNKVDKLTILFY
FT                   CSIIGFVLTCPIYFVTEWMNYNAFGAISLLQLNSYVMSLVLLNGLSHFVQSLLAFQILG
FT                   MVSPINYSIANILKRIFIILISFIWESKQFSNSQSVGLVITLFGLYCYDRWGTVSNSSS
FT                   ASNPGNY"
FT   CDS_pept        complement(123075..123980)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078046"
FT                   /orf_name="CD36_60520"
FT                   /product="Mitochondrial DNA replication protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41006.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG330351"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192DA2F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE2"
FT                   /transl_table=12
FT                   /translation="MSKQIEKKPISFANIALGAGLNLAEVTTLGQPLEVIKTTMAANRS
FT                   LTMPQAAKFVWSRGGILGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFKKLGMNNFVS
FT                   GMGGGITGGLAQAYLTMGFCTCMKTVEITRSKQAHTPGVPQQTSFQVFKEIWRKEGIRG
FT                   INKGVNAVAIRQMTNWGSRFGFSRLAEESIRTLTGKSESQRLSAWEKIASSIIGGGLSA
FT                   WNQPIEVIRVEMQSKTNDPNRPKNLSVAGAFKYIYQQNGIKGLYRGVTPRIGLGVWQTV
FT                   FMVAFGDIFKRMLNTDGAGH"
FT   CDS_pept        complement(124534..124860)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(125636..125690,125767..126164)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229444"
FT                   /gene_name="FCA1"
FT                   /orf_name="CD36_60530"
FT                   /product="Cytosine deaminase, putative "
FT                   /EC_number="3.5.4.1"
FT                   /function="cytosine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41008.1"
FT                   /db_xref="GO:0004131"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000192DA30"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE3"
FT                   /transl_table=12
FT                   /translation="MTFDDKKGLQIALDQAKKSYFEGGIPIGSCIISSDGTVLGQGHNE
FT                   RIQKHSSILHGEMSALENAGRLPGKTYKDCTIYTTLSPCSMCTGAILLYGFKRVVMGEN
FT                   VNFLGNEKLLVENGVEVVNLNDQACIDLMAKFIKEKPQDWNEDIGE"
FT   CDS_pept        126311..126742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535115"
FT                   /orf_name="CD36_60540"
FT                   /product="Zinc finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41009.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398631"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DA31"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE4"
FT                   /transl_table=12
FT                   /translation="MSKRVREEEEEEEEEEEAETEAEENSPYNRPTGDQLIFCNYHPCL
FT                   NSAFENYQQYHLHVLSTHEHTCESCQKVFPNKNYLSLHIDENHNPLLQIKQERGDKIFK
FT                   CYTETCKAVFSNTKEREDHLIDVHNYPMNYPFNIVNDGI"
FT   CDS_pept        complement(126753..127844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175900" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078047"
FT                   /orf_name="CD36_60550"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   4, putative"
FT                   /function="general RNA polymerase II transcription factor
FT                   activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="core TFIIH complex"
FT                   /protein_id="CAX41010.1"
FT                   /db_xref="GO:0000439"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016251"
FT                   /db_xref="HOGENOM:HBG737144"
FT                   /db_xref="InterPro:IPR004600"
FT                   /db_xref="UniParc:UPI000192DAE4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE5"
FT                   /transl_table=12
FT                   /translation="MEAISDRLFNENAGAIESGIDDPSLLTIILDLSMKGWYNIKEMIS
FT                   IQDITKSLLVFLNGHLSLNNSNQVAFLVSSSMGSKFLYPDLTTIGNPNVNEHSEHFPGM
FT                   YRSFKMADQSVLRQLNEYIKEIVKFETRNEKRGFNCLTGAISMALTYTNRMLTLDQSIT
FT                   TTTAAAMTTSTLESTSNNNSTSGTGGSSGTSSSTSMKSRILIVSANDDDDLRYIPLMNC
FT                   IFAAQKMKVSIDVAKLGHNNSSYLQQASDATKGVYLHIEDPKGIIQVLSTAFFIEPNLR
FT                   PYIILPTNSNVNYRASCFITGKSVDLGYVCSVCLCIMSQLPQSGKCPACDSEFDKKIIQ
FT                   ELNREPQVISKKKRKLENGTSAK"
FT   CDS_pept        join(complement(128963..128983),complement(128117..128551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180723" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572538"
FT                   /gene_name="RPS13"
FT                   /orf_name="CD36_60560"
FT                   /product="Ribosomal protein, small subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41011.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG747651"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniParc:UPI000192DAE5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE6"
FT                   /transl_table=12
FT                   /translation="MGRMHSSGKGISSSALPYSRNAPSWFKLSSDDVVEQIIKYARKGL
FT                   TPSQIGVILRDAHGVSQAKVVTGNKILRILKSNGLAPEIPEDLYYLIKKAVSVRKHLEK
FT                   NRKDKDSKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVA"
FT   CDS_pept        join(complement(129874..129876),complement(129711..129807),
FT                   complement(129386..129638),complement(129265..129322))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078048"
FT                   /orf_name="CD36_60570"
FT                   /product="Cofilin/tropomyosin family protein, putative "
FT                   /function="actin binding"
FT                   /function="growth factor activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41012.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008083"
FT                   /db_xref="HOGENOM:HBG756690"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="UniParc:UPI000192DAE6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE7"
FT                   /transl_table=12
FT                   /translation="MSSSLYTFSPETLSSLTKFRFQSAKVDKVQAVIYTIDKKSHEIKQ
FT                   EDEIIDSIEELVEELPDTSPRYIILSYPFKLDDGRLKSPLVMLYWIPPTSGQESRMLYV
FT                   GAVEQFRDKAGVSKLIKLEEEEDFDGLKEQLI"
FT   CDS_pept        join(130279..130324,130400..131985)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572539"
FT                   /gene_name="CDC14"
FT                   /orf_name="CD36_60580"
FT                   /product="Tyrosine-protein phosphatase CDC14, putative "
FT                   /EC_number="3.1.3.48"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAX41013.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG398632"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI000192DAE7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE8"
FT                   /transl_table=12
FT                   /translation="MHSSSVHVPLIEFLKNRIYLGAYDHHKRDTEDLAYFTVEDALPYN
FT                   AFYMDFGPLNIGHLYRFAVLLHKKLNEDSTQGKGLVIYSSTSPKERANTACLLCCYMIL
FT                   LQNWAPHQVLQPIAQITPPLQAFRDAGYSSADYEITIQDVVYAMWRAKERGMIDLAKFD
FT                   LDEYEQYERVDQGDFNVISKDFIAFASPQQSKRGGLNEPFQKVLEYFVENNVQLVVRLN
FT                   SHLYDAKEFTKRSIKHIDMIFDDGTCPTLEYVQKFIGAAECIINKGGKIAVHCKAGLGR
FT                   TGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHWLYLHHDDFRSWRHTMIVDNR
FT                   PDPLIGNLYPLCSYEDYKQRLKEAKRKERLQLQQQLTSPLADSSVINTPIRRRKVSGAL
FT                   ASKIQTVVPIESPGQPRKYFEDSDDIEEVDMANNSDDENTMQDIIQSSPARYDSVTPKA
FT                   KDSSDWRVLRSISTNSVSSQQSIHIIKTTTTTKTVNEALSSPPGTSPTNALRVSKARSK
FT                   SRVTSGNSQASRAHSGGVRKLSGKKH"
FT   CDS_pept        join(complement(132687..132689),complement(132133..132594))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382348"
FT                   /orf_name="CD36_60590"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /protein_id="CAX41014.1"
FT                   /db_xref="HOGENOM:HBG398633"
FT                   /db_xref="UniParc:UPI000192DAE8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIE9"
FT                   /transl_table=12
FT                   /translation="MPPKKKTENTGTILKLKRYTSTYIVTIEPSNSLEDIKYQLCNIIN
FT                   NSGGLPTTQDSDVKHEDEEDIEVPKSEYIDDVDEIKEETPDESAITKVSIDDIRLAYPK
FT                   DSTQAYSNSWIELGEDADFAELNLKDFDILAFAYGPEEQFQIVEPAYEEN"
FT   CDS_pept        132892..134418
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572540"
FT                   /orf_name="CD36_60600"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41015.1"
FT                   /db_xref="UniParc:UPI000192DAE9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF0"
FT                   /transl_table=12
FT                   /translation="MNRLISELTYRNDHKQAVCQLYRALLRKTNQLVCIPASINKYELK
FT                   YNIQERFRNNYGSTFQIAEQLFKGITLDEALSLALGGNWGKLKEFIDIQRKEVFSYQRR
FT                   RADYLINKEQIEESAKKTARGKVKRNLLARTKRKTRYFVPDLYIPDNEKQFIKDGLANA
FT                   NYQGDTVLKQFLHKLQSLKKIPDPKLLPYSPESIFTIGDNLDFNHIIRGTTSKSLENFD
FT                   QDILKAIVIPAMEYDINKMYLEQLKNALDNKGPYQATVHEALAGTVPVPYIMQPTKKKI
FT                   GREEIAKLIKKQIFFRRMINIWESQTHLTEENKQKDGSYPIKGSHGFGPDELIYPREYY
FT                   QELYDAEEMYEILLQIHINDYNGKPNEPIDLKQFAWSESLDIASIYLRDAYKQVVQDSK
FT                   IDFKTLQEHLQKSFNNHYDEQVEKYEQLIANLQKHNVFKHSEIVSPPGSRSISDVAAKR
FT                   SINFFPQTEIIGKGKTLGEFMAEPGFKHYKYGYKLTKRIAQIMSKLGKDF"
FT   CDS_pept        complement(134530..135378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572541"
FT                   /orf_name="CD36_60610"
FT                   /product="RNA polymerase II-associated protein, putative "
FT                   /protein_id="CAX41016.1"
FT                   /db_xref="HOGENOM:HBG398636"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="UniParc:UPI000192DAEA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF1"
FT                   /transl_table=12
FT                   /translation="MELLTIEKFIPFLEPFRGKELLTPLECSKLSLIIVEVLVDHYVDF
FT                   KLLKFLSRFLTQELYDELIEERNIEHACGYIKCNRSPKSLVRRLSMNSNGVTQASSVND
FT                   PGASTKYQIYNRKPAMILPNTYLSQYCCKEHYQASIFYRNQLSNEALFSRKNIFTTSPF
FT                   SSDKFNWYENSITCLEEVIAKHKELKQYGKSISEVIAMMNGLTVSDLNNNSELNDETNQ
FT                   LIKLIEDFEIVENNEPNMNGDLEQVNEEGYTQDNEENIHDITNNVEGYVTSNKSFGGYV
FT                   V"
FT   CDS_pept        135942..137885
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078049"
FT                   /orf_name="CD36_60620"
FT                   /product="Uncharacterized membrane protein YER140W
FT                   orthologue, putative"
FT                   /protein_id="CAX41017.1"
FT                   /db_xref="HOGENOM:HBG398637"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniParc:UPI000192DAEB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF2"
FT                   /transl_table=12
FT                   /translation="MRRKRSNGSHSSHSNSRGRTKTTESIINNATDEPFPQLGGKSKTV
FT                   TKEKLKPCKSSDQTPSRSRTNSVFSFIFDKISVHHPRKDGLKGFSLYKLLMLELNLNPN
FT                   DPVTPEKTTNSMNDNHFEELQNMIKIPFCLEKFMIFGLLVCLNSFLSLFTLAPLKVLII
FT                   TFQSAYRFFTTQQNFQFCRFRLIKKDVITLSIIILSIVVLSNRKLDISRMYHDVRGQTD
FT                   IKLYVMFGVLECAEKLCSSIGQDILNVLYESSPNRNIYRFASFYLLSTFYLSFHAYILI
FT                   YQTVSLNVAANSYSNALMTLLLSNQFAELKSSVFKKFEREGLFQITMADLSERFQLSLM
FT                   LGIIALKNLLQLSVTGGLIPNSWKSWNRWVGAVFGPSVVVIGSEIFVDWIKHCFIAKFN
FT                   KIRPKVYKNFLYVSCLDFLEVFKANTKSGNPSHEFTDYIVLTRRIGLPLLASVVCFLRM
FT                   ILADLKHIFVFPVVNSNLYAIITSGLLIVVTFLTLLLIRVILCMLIFKIANVLVTQHKQ
FT                   HQEKLRKKLNDARNVAATRDYFMEGTPSPPENTTNNTSIDINDSTMETYQSSPLGLSFL
FT                   PGSPNTEPSTINPTTRAKLYDADEKIPPTVEEKRNKQLLGGVLNEDSWCSDSGDEGLSQ
FT                   VMRYKMSSKRIW"
FT   CDS_pept        complement(137989..139425)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572542"
FT                   /orf_name="CD36_60630"
FT                   /product="Cytochrome c oxidase assembly protein, putative "
FT                   /biological_process="heme a biosynthetic process "
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAX41018.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="GO:0006784"
FT                   /db_xref="HOGENOM:HBG628966"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniParc:UPI000192DAEC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF3"
FT                   /transl_table=12
FT                   /translation="MLSKTRFFFTKNSLVLNTLKQNKGCKLSIVSRTPTSKLFPSSFKI
FT                   SRIFNNLSKRKYSTISHRVGSSFPKSEFVKSTPPPVIPQKSIGYWLLGTSTLVFGIVVL
FT                   GGLTRLTESGLSITEWKPVTGAIPPLNQQEWEQEFNKYKDSPEFKQLNSHITLDEFKFI
FT                   FGMEWGHRLVGRCIGAFFILPALYFWARGRFTPQLTKRVLGLTGLLGLQGFIGWWMVKS
FT                   GLDEEQLAERKSKPTVSQYRLTTHLGAAFLMYLGVLWTAFEILNENKLANLAKKSPEAV
FT                   QTFLKQLNNPALRKTKIAGLGVLALTFITAMSGGMVAGLDAGLIYNTFPHMGDDWIPNG
FT                   SELMSPVFSRKSDQSDLWWRNILENPTTVQLVHRIFATATFFAVLGAHVYVNRNKGVVP
FT                   VASKRIMHGVMGVATLQVALGITTLIYLVPIPLAALHQAGALALLTASLAFSAKLKKPR
FT                   PQFVQFINANMKSQLLKTRV"
FT   CDS_pept        140002..141903
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229445"
FT                   /orf_name="CD36_60640"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41019.1"
FT                   /db_xref="UniParc:UPI000192DAED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF4"
FT                   /transl_table=12
FT                   /translation="MIEPRDIQKKTNLFKRSPQKPVYKQNLLMDQEEPQYIIDNYKNSY
FT                   LKIGGHGDGLDKSDNTNIIPLAANIKSTHIRTDSDGLILANAFYIFMTIIVLLILVSAI
FT                   LFGIREYSFAFRRRIKSSTSEVVKLDDWNNSKKRANNFMPLCNKTNKVQVREAANIGTN
FT                   NQQDTSMSSKNNAISGMTQFTDKEAKIEKTPQWCYKEESSPSYNMSSSQGKSDKIYYEN
FT                   EYDSGLTDKSITNFTKKQTIPSFVTVPPKSVYSIDMLMALDKTKAMIGGVLNNVFKFKQ
FT                   KQKIPMSCLLSCTINLPPTTFDNAWKAAKVIREAENEIITSTCNVSKKLSLLQILSIGK
FT                   SYELLDNPNIFLEAFNDCIENLVDMGLVFTMMSDSSVALKLLLIESLLTYSWSHYRFYD
FT                   FDMKSNLVKLQFSNWNLPHPIVQTRNTIFKILCNLQLGLDSVFEESKEFENDNELKLGL
FT                   VIRESINHSVCNDYIGYIPMIAQAIDISNIDRNKFFFYEILKLLVSKHGNCCMKEYIQE
FT                   SNIELKTLVQYGLSDDQHLVIQDKAKEIFKMLSHHDEKIFMWFNDSNHSKIHMDSAVPL
FT                   STEHTEKYFSAPLFKQQQQLLEEPSSGSTIDSFSHSWKMGILSTDLKFHKNVNHHQS"
FT   CDS_pept        143267..145219
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000044189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382349"
FT                   /orf_name="CD36_60660"
FT                   /product="Very long-chain fatty acid transport protein,
FT                   putative"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX41020.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG712034"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000192DAEE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF5"
FT                   /transl_table=12
FT                   /translation="MSGLELAVAAVLGSQLLEAKYLISDDLSLASKVARKALPFLWRSS
FT                   RGRASYWYPFEEAALKYSNNRALAFPRPKKNPPKPQVDENGYNIYDDQFDLEEYTYKEL
FT                   YDMVLRYSYILKNEYGVTSNDTIGVACMNKPLFIVMWLALWNIGALPAFLNFNTKDKPL
FT                   VHCLKIANVSQVFVDPDCDKPIRDTESQISEELPNTKIHYIDELALFDRLRLKSTPKYR
FT                   AKDSTRRPQDTDSSACALIYTSGTTGLPKAGIMSWRKAFMASVFFGHIMKIKEDSSVLT
FT                   AMPLYHSTAAMLGVCPTLIVGGCVTVSQKFSATSFWTQARLCGATHIQYVGEVCRYLLN
FT                   SKPHPDQDRHNVRIAYGNGLRRDIWSEFKSRFHIDGIGEFYAATESPIATTNLQYGEYG
FT                   VGACRKYGSIINLFLSTQQKLAKMDPEDESEIWRDPKTGLCTEAAYNEPGELMMRILNP
FT                   QDIEKSFQGYYGNKSATNSKILTNVFSKGDAWYRSGDLLKMDEDKLLYFVDRLGDTFRW
FT                   KSENVSATEVENELMGSKTLKQSVVVGVKVPNHEGRACFAVCEPKDELQHEEILKSIHE
FT                   HVTKSLPTYAQPAFIKLGTIEASHNHKVPKNQFKNQKLPKGEDGKEMIYWLNGDKYTEL
FT                   TEDDWSSICAGRAKL"
FT   CDS_pept        complement(145447..146700)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382350"
FT                   /gene_name="PGK1"
FT                   /orf_name="CD36_60670"
FT                   /product="Phosphoglycerate kinase, putative "
FT                   /EC_number="2.7.2.3"
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41021.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000192DAEF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF6"
FT                   /transl_table=12
FT                   /translation="MSLSNKLSVKDLDVTGKRVFIRVDFNVPLDGKTITNNQRIVAALP
FT                   TIKYVEERKPKYIVLASHLGRPNGQRNDKYSLAPVAAELEKLLGQKVTFLNDCVGPEVT
FT                   KAVENAKDGEIFLLENLRYHIEEEGSSKDKDGKKVKADPEAVKKFRQELTSLADVYIND
FT                   AFGTAHRAHSSMVGLEVPQRAAGFLMSKELEYFAKALENPERPFLAILGGAKVSDKIQL
FT                   IDNLLDKVDMLIVGGGMAFTFKKILNKMPIGDSLFDEAGAKNVEHLVEKAKKNNVELIL
FT                   PVDFVTADKFDKDANTSSATDAEGIPDNWMGLDCGPKSVQLFQQAVAKAKTIVWNGPPG
FT                   VFEFEKFANGTKSLLDAAVKSAESGNIVIIGGGDTATVAKKYGVVEKLSHVSTGGGASL
FT                   ELLEGKDLPGVVALSNKN"
FT   CDS_pept        147739..148593
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229446"
FT                   /orf_name="CD36_60700"
FT                   /product="Hsp70 nucleotide exchange factor, putative "
FT                   /function="binding"
FT                   /protein_id="CAX41022.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG398639"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013918"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DAF0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF7"
FT                   /transl_table=12
FT                   /translation="MEKLLHWTIAQQSGDKAALEKIGEPDQKALSQLFGGPDEATLMKE
FT                   SIKVVESTDVSLEDKEIALENFEMLIENLDNANNIGNLKLWNPLISILTKQDTPIELKV
FT                   LICGIIGTAVQNNPKSQEDFNETEGLSELIKLAQDDKKFELQSKALFAISSFVRNFQPG
FT                   YSKFEKLQGLKLINFDNKNNKYQLRILSLISSILSNGLDEDLKAQFKKEKLPHFLASVL
FT                   NEDSNTSLVDKSLNIVSQLNQLKYDFNLEEKYEINRGIQVVEGLSDKLNIDDLNNAKKA
FT                   TSS"
FT   CDS_pept        join(complement(150363..150479),complement(148627..150273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229447"
FT                   /orf_name="CD36_60720"
FT                   /product="Crossover junction endonuclease, putative "
FT                   /EC_number="3.1.22.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="CAX41023.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="UniParc:UPI000192DAF1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF8"
FT                   /transl_table=12
FT                   /translation="MEPRQIIELSDDDDESHLNLNTTRKPIKLTTNEPEVIESLSDSCN
FT                   EDPPILTSIQSSQTKEFQPSPNQESNHTSISTNYSRSVSKSTYTSTDQVTDVIIIESDE
FT                   EETSIVQKLNETSKISGSTQLPSSPVNSASQQPERTMNDSIIDSSFSFSMDNVVTTIRN
FT                   GGSRLKLSKPVSQPVTTGLGPSSVSNSVSSSFKMPPFVKWLSSDDDDDDDDELDPIVPT
FT                   SQPVAHETVLSAQPAKRSRTVQEPPQQAVKPVKRSKTVDQVIDLPRIDNFQYTSKELKE
FT                   VNRATRKKEELLAEMELHISESVYTRLEDLVKDFQSRVIKASYTLPVIFWKRNINAVYD
FT                   KERDIFIPCHPRRVLEKTFVLYYHASVFFEKLRSSTLKADVSAAKQQALSMTPNEYNVI
FT                   IVVEGYDIILNKIKAYEQRLFKNQVLQGLNVEEQRRRRKDDTEMSKYPSSSEVEHLVNR
FT                   AQIDLKANIFMVRAKQESIMWLNSFTYMISQSLYDKFERNQGLANLGTVKSGADTKSTF
FT                   LQSMKQFNLMTQAKADILYVSHQSLHSMYTKFRSQGTLGKDNLRRNIVPPSVDSSMNKF
FT                   FTADDPDMVIN"
FT   CDS_pept        150777..154115
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248292" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572543"
FT                   /orf_name="CD36_60730"
FT                   /product="Exocyst complex subunit, putative "
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAX41024.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG398641"
FT                   /db_xref="InterPro:IPR007191"
FT                   /db_xref="UniParc:UPI000192DB8B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIF9"
FT                   /transl_table=12
FT                   /translation="MSLRRYSGSSPRINDYDSRTVDESLYSLKEVYNTIKYDWPQMLRE
FT                   DANPIEMAVALLDDTSVGLAHRLQEFNMLKESSEQALRSVVNEHYDLFNKSMASYNTLL
FT                   TTMKTSQEDSLEIKDFLEYSNKEVHDRSAVLGELSSASAKYSEMIEVLDAMAEMNEIPG
FT                   KIDQLVIDKKIHEVYDVISEGYTTAEKYNLWSLPAMNGIKTYLEEQSNKLFDMIIDELQ
FT                   NEIYLKYNRNPQEGAIAWDNIIHSSNPQLTSFVTLLDSKNLEQFIFNSANLDISEVVDF
FT                   LTSPVKNFLVNQLPDLHAHNSKNDGVIDYKILLDSTSNPNTESFYYIYMLLLTASKLNR
FT                   LNQAVEVLLDTNQSELHGLINRTIEAVKSRNGHALSKLSKMQHLDHGSLFDVIVHGSFS
FT                   DSAVVLLQDLFGSIFIRCLATFQRHKVVTQIVTLLQDGKSPSTPKIVAESTPTFDSPQT
FT                   GKPDTFHARNLFTIWNTIQKELKSLMLNYIYDDHNYKLHPLADTTGATNRNKISSALGK
FT                   KELFKFEDVTYNPSNQTSKEILDVLADVFPGYSISDDTKNGSIIETATPYVKHESFNAT
FT                   VEVLVPKNLFNMRIILEFFLIFIDGSQRIFFEFEDERTRGVHTRKSFHFFEDFMKISFL
FT                   SYLRNTIEFNFGEQVGGAYSMKIEQAMPVNSGLKLDLISLSQDSNFKILGNAVSNIESN
FT                   LIIYENAYNFKKMFLELCLILNTSLSYRENFSGAVLKTLENFSNEYNKLYQELLSTGEG
FT                   TNIVRPPSRISKWMKIPVLTEISGKILQRGVQGETAIELEELIESESKVILHDETVTHQ
FT                   EDLLDHEAYAQIVYLLLTTTWILSWLPLVKKESNYSIYDDEQNKTIKVSTVDKLRYNWT
FT                   FLENGRQAINFTPDGTDIVQYNIYLALNSEKIGDFNNVIHNFESIRDKTLLALRYELRC
FT                   KAVYFVTMSFKHVDWCPVTEPGDADHFIVNLNQEIFAMDNKLSKTVSNIERESIFLGFS
FT                   QFLNDLIITRSKGVRKINSNGIKRILLNISTVQQMLRNLSSNPETIDFTKASEYFELFT
FT                   MNEFNLLRFIKSKRDNYTKEAYHTLARLIYSEKLADGKGSQFNKGKYNDLIKKIDGIFE
FT                   QKRET"
FT   CDS_pept        complement(154251..155000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078050"
FT                   /gene_name="CTR1"
FT                   /orf_name="CD36_60740"
FT                   /product="Copper transport protein, putative "
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41025.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398643"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI000192DB8C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG0"
FT                   /transl_table=12
FT                   /translation="MEFLKRHEGHMHMSDPASSMAMSVTSAVMEMASSTMDMAMSSSTS
FT                   SGMAMEGMDHGSSHMAMNMWLTASYKDYPVVFRDLRASTKAQAFGIFVLLFFVAFLARM
FT                   LEFVRNYLEEIVWKNNNYVEVEQGISQHSANLQPPPVKSCCDDTEKEVVSDESIDKQNS
FT                   PQHEETTKPRGTGKSLSLASTISRDIIRLALCIIPDLFAYSLMLAAMTYTLTYFFAVVI
FT                   GSGIGRFVAERLMEHYRIKRGPPRNCC"
FT   CDS_pept        complement(155861..158047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572544"
FT                   /orf_name="CD36_60750"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41026.1"
FT                   /db_xref="UniParc:UPI000192DB8D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG1"
FT                   /transl_table=12
FT                   /translation="MSADYHAKMQQMLFNRYTNPTSNVAHEANVTHMTNQGSNAPIATT
FT                   TTATTTMAPTMNTYYPHPNTNHTSEMNLLTPNIYEYKSNVIDNQGGNDVGYFSTRAAVS
FT                   VPSSRIDSYNSNNSNTFEEEIDRFTKEHDPNVIPIHGFNHHQESFDGQSTIDNLSLQMP
FT                   IPPPPPQLQLQQQPIPTLPQQAALPLPPHQQPMPPPPVQPSQPVMQFYDTTQEFVEPMA
FT                   RPQPHRQNTAPASSLSIQNLQQHQLQHQLQQQQQQQTHYNQHQKRSSIKSSDMGLTNRH
FT                   LNAANDHLHARRESFSHETKPKIKKGRPRKKPVFHLQLDNVKKCVPTITSSQSDSGTDY
FT                   WNRTPSGHVRRRLASTTMANLANGSNLKSNEDDLKIADKDLSFADRNFAIPTFNLTPSM
FT                   DPPGNPNGYFELNNTPGVNENLATSGGYFSPAINDNSVNNFNKTFEDYLQEAEKLSDHK
FT                   GTGDSNNENIANVNQADVVDLQQDTLVTNFTELDIPQNQNMFTPLNFESSIGDDFLSSE
FT                   NEAQLDRDRLYSNEITPQYLTVGSGDEEDDQRSDFRLQLPTLQKTVSSQSGHSPASVGS
FT                   DSVYSASTGFTPPTTSTATATNTATTTLSKPSKKRVSKGAVCSVCDKYISRDIARHMRI
FT                   HDEVGRFQCVYPKSMCNHKTQNFNRPYDYKKHLLHSHFVFDDPKGKTANTLTDKLPIMG
FT                   TCEACGARMIANDWLESHILTKDPKVRCPYSKQS"
FT   CDS_pept        complement(162582..163700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572545"
FT                   /orf_name="CD36_60770"
FT                   /product="Conserved hypothetical protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41027.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192DB8E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG2"
FT                   /transl_table=12
FT                   /translation="METKESPQQSINASSNTIQQKQNQKEQPLQSVQSQQQQKSDNIPV
FT                   PSQVPSTYEYTTTTETLPSSYVMPSSSLPGSSQYQQPVSTDSGIPSGQQSYAQPGPTVT
FT                   QAHASAPLPRQTHSVPSYQHYFGQTIPDDSLHSHSYVHEPKNPPVSLHSSRAYYSSILQ
FT                   PPPPPPPTYSIPETESQQHYVWSSHDNQPPSHPIPPSEITTRNTSSSSTSTTTTTATRN
FT                   TMPFHVTTNIDVNRYPDVTSLVNSNANIVVPLVESRFVDHKICTICGKRITRDMTRHLR
FT                   THQVDARFHCVFPKRQCRHKSGKFNRPYDYKKHLLNRHFTFDDSSIKRLHNLSDKLNHW
FT                   GTCPCGLRFSGKDWLDEHILTDDPTKKCPLIE"
FT   CDS_pept        171285..172547
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229448"
FT                   /orf_name="CD36_60800"
FT                   /product="Septation protein SUN4 [Precursor], putative "
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="CAX41028.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG398646"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniParc:UPI000192DB8F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG3"
FT                   /transl_table=12
FT                   /translation="MRFSQATVLAFAALSLAAPAFEADNKNNKREDCDSTSFHGHHKHK
FT                   RAVVYDYAYVTVTVDGKGNPVTTVSPVLSIESTVSSQETSSTSTSISSTTTIVQNDSLT
FT                   SDEPKTLSLPSGTIKPSSSATESQSQSQSSSTGGSGSGSGSSNGIAGDLAAYEDPTEEF
FT                   QDGVLSCDQFPSGQGVIALDHLGFGGWSGIENSDGSTGGNCKEGSYCSYACQSGMSKTQ
FT                   WPDKQPSNGVSIGGLLCKNGKLYKSNSRSNYLCEWGAKKANVVNKLSQTVAICRTDYPG
FT                   TENMVIPTVVDGGSTSVITVVDQSSYYTWRGGATSAQYYVNNAGVSWEDGCVWGTEGSG
FT                   IGNWSPLNFGAGYAGGIAYLSLIPNPNNHDSLNFKVKIVPKDGATVSGSCTYENGKFNG
FT                   NGNDGCTVGVTSGEANFVLYN"
FT   CDS_pept        join(complement(174566..174771),complement(174447..174496),
FT                   complement(172916..174354))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535116"
FT                   /gene_name="CAN1"
FT                   /orf_name="CD36_60830"
FT                   /product="Lysine/arginine permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41029.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192DB90"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG4"
FT                   /transl_table=12
FT                   /translation="MTLLNEKDQSVGTDSENSLYKDIEQSPTDKNEIFIDQINNDEHVI
FT                   EYDSFGEVKRDLKARHVSMIAIGGTIGTGLFISTGHLLSQTGPVMSLISFLLVTTICFS
FT                   VTQSLGEMATYIPISGSFAQFVTRWVSKSCGAANGWLYGWSWAITFALELSIIGQVIQF
FT                   WTDAIPLAAWISIFFVLLTALNLFPVKLYGEIEFWMASIKVIAVLGWIIYAFIMVCGAG
FT                   KTGPVGFRYWRNGYAWGDGMLVQNNGKYVIAFINGLINSVFTFQGTELVAVTAGEASPR
FT                   ALRSAIRKVMFRILVFYVLCMLFIGLLVPYNDPKLTEDGGFTRNSPFLIAMENSGTKIL
FT                   PHIFNAVIVATIISAGNSNIYAGSRIFYGLAQSGVAPKFFLKTTKAGVPYITVLFTAAF
FT                   GALGYLVVSNDGMVVFNWLLNISATAGMIAWGFISVSHIRFMQVLEQRGISRDTLPFKA
FT                   FFMPYSAYYAATLVCTVALIQGFTVFWDFNATDFFTAYVSLIVFVVWWIMFHFLFFGFG
FT                   RQAWKWSNVLIPLDQCDIDTGVRDINDIEFDVPPPKNLWEKFWSIIA"
FT   CDS_pept        177930..178421
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572546"
FT                   /orf_name="CD36_60850"
FT                   /product="Peroxiredoxin, putative "
FT                   /EC_number="1.11.1.15"
FT                   /function="glutathione peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAX41030.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG648990"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192DB91"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG5"
FT                   /transl_table=12
FT                   /translation="MSEFYEFAPNDIKGSPYSLKKLQGKIVLVVNVASKCGFSPQYKGL
FT                   QDLKQKFADQPVEIIGFPCNQFGHQEPGTNEEIEKYCREYFGVTFPVLSKIETNGKNAE
FT                   PVYKYLKSQKPGLLGLHRVMWNFEKFLIDQDGNVVARFSSFTKPETIGLQIEEMLKHQA
FT                   "
FT   CDS_pept        179924..180409
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17572547"
FT                   /orf_name="CD36_60860"
FT                   /product="Peroxiredoxin, putative "
FT                   /EC_number="1.11.1.15"
FT                   /function="glutathione peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAX41031.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG648990"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192DB92"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG6"
FT                   /transl_table=12
FT                   /translation="MSKFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGL
FT                   EELNKKFADQPVQILGFPCNQFGHQEPGTNEEIGSFCSLNYGVTFPVLDKIEVNGDNTD
FT                   PVYKYLKSQKSGVLGLTRIKWNFEKFLIDQNGKVIERFSSLTSPESIGARIEELLKK"
FT   CDS_pept        181813..182508
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535117"
FT                   /orf_name="CD36_60870"
FT                   /product="Peroxiredoxin, putative "
FT                   /EC_number="1.11.1.15"
FT                   /function="glutathione peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAX41032.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG648990"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192DB93"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG7"
FT                   /transl_table=12
FT                   /translation="MVKSNIESTWETMESTFSEIQNKFHEIYKPIETNEPEPEEDNRNI
FT                   KSESLDITDDSTLSVSPITQLLYLARSKFYDLTPLDNNKSPYPFKNLRGKVVLIVNVAS
FT                   KCGFSFQYNGLEQLNKQFANDEFVLLGFPCNQFLWQEPGTNDQIVTKCKKKYDVTFPIL
FT                   DKINVNGEQADPVYKYLKAQKEGLWGTNRVKWNFEKFLVDKNGRVVERYSTFTRPLAII
FT                   PKIEQLLKS"
FT   CDS_pept        complement(182807..184009)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000016231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078290"
FT                   /orf_name="CD36_60880"
FT                   /product="Ketol-acid reductoisomerase, mitochondrial,
FT                   putative"
FT                   /EC_number="1.1.1.86"
FT                   /function="coenzyme binding"
FT                   /function="isomerase activity"
FT                   /function="ketol-acid reductoisomerase activity "
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41033.1"
FT                   /db_xref="GO:0004455"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG286525"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016207"
FT                   /db_xref="UniParc:UPI000192DB94"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG8"
FT                   /transl_table=12
FT                   /translation="MSFRTTSMRMARLATAKATLSKRTFSLLANATTRYTAASSAAKAM
FT                   TPITSIRGVKTINFGGTEEIVHERADWPKERLLEYFKDDTFALIGYGSQGYGQGLNLRD
FT                   NGLNVIIGVRKGSSWEAAVEDGWVPGENLFEVDEAISRGTIIMDLLSDAAQSETWSHIK
FT                   PQLTEGKTLYFSHGFSPVFKDLTHVEPPSNIDVILAAPKGSGRTVRSLFKEGRGINSSY
FT                   AVWNDVTGKAEEKAIAMAIAIGSGYVYKTTFEREVNSDLYGERGCLMGGIHGMFLAQYE
FT                   VLRENGHTPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPRFKDAL
FT                   KPVFEDLYESVKNGSETKRSLEFNSRVDYKERLEEELETIRNMEIWKVGKEVRKLRPEN
FT                   Q"
FT   CDS_pept        184960..186099
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204332" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573516"
FT                   /orf_name="CD36_60890"
FT                   /product="Peroxisomal targeting signal receptor, putative "
FT                   /function="receptor activity"
FT                   /protein_id="CAX41034.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="HOGENOM:HBG523770"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192DB95"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIG9"
FT                   /transl_table=12
FT                   /translation="MLSFRTKGYNGYGIQYSPFFDNKLAVATAANYGLVGNGRLFILNI
FT                   EPNGTVSNQVSWETQDGLFDLAWSEVHENQAVVASGDGTLKLFDLTVPNFPVMNWKEHS
FT                   REVFCVNWNLVDKTNFVSGSWDGNIKLWSPNRPQSLLTLNSHVIDYSTRVAPNTSSASV
FT                   PLSHQPAHQPQSQQQQVNTANCIYSAQFSPHSPSMIVSCNGGSQVQVWDIRSPNPLQLK
FT                   FTAHGGLEALSVDWNKYKSTVIASGGTDKSVRIWDLRSITKIDQPIAQSPMASGHIRGP
FT                   TPLNELIGHEFAVRRVQWSPHNPKELMSTSYDMTARIWSDESDERARFLNSRVGGLKGV
FT                   FGKHKEFVIGSDYSLWGEPGWAATTGWDEMVYIWDSKRL"
FT   CDS_pept        186938..189214
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573517"
FT                   /orf_name="CD36_60900"
FT                   /product="Uncharacterized protein YFL042C orthologue,
FT                   putative"
FT                   /protein_id="CAX41035.1"
FT                   /db_xref="HOGENOM:HBG398648"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI000192DB96"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH0"
FT                   /transl_table=12
FT                   /translation="MPDLTPLEVDEEEEDAWSYSFPPSNESLPISQQSQSKRSVTQPSN
FT                   FNSNINSTFRTSQNGDNSSNNSQMKLSIDTTTTSSKSSLPFPSTIQKSTPLDPLTTKED
FT                   ANSVISKDSKGNALNEASQSDDKPKFMKDLEEYGSTRNISNSPLSQQSTNEASLLPSPK
FT                   FISYRKSKRTVSEGTFDSILDKSPMSPPASRYDTKLYVDEFYKDSKFRYATIKRNIDFH
FT                   NNFHSLDLTDRLVDDFACALSREILLQGRIYLSESYICFNSNLLGWVTNLVIQLEEVVK
FT                   IEKRSTAGLFPNAISIETVDGTLHTFASFLSRDQTHELMSTLWKGKTGKSNNDSTLTSE
FT                   DELENGAIDSPNKHIESYILSLDGDDDDNESRSLDGSNEDGDESGLDIEEVLSTKLIKL
FT                   KSESLYTNNGPDTHAPTTPNYEKLDAEIELVDEVIDAPMGIVFAILFGPYTKFQTNFLE
FT                   THDGSEISEFGDFRPSEEDPAVLERKYIYRRELGYSIGPKSTKCEVTETIEHLNFADYI
FT                   VVVSTTVTPDVPSGGVFSVKTRYVFSWANENHTNLLIYHHVEWTGRSWMKSVIEKSCLS
FT                   GSTTTTKEMIKELKEEIVQQTYFIDGPPAVKQPLKKKVKKVEPELKNEQPKMEIKPSTT
FT                   AVDVSSCLQQNITTAFFILFTIVTIIFFMQIRLYGLLRKSNTIAETQLLLTLQLSDLQQ
FT                   KPQVEVQDNVFWNLIHSKLGRKLTSLEKLQFLTYQLQAIHKEKTDDGNTNGLIGSIPKY
FT                   IRDLI"
FT   CDS_pept        complement(189290..190183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535367"
FT                   /orf_name="CD36_60920"
FT                   /product="Uncharacterized protein YGR053C orthologue,
FT                   putative"
FT                   /protein_id="CAX41036.1"
FT                   /db_xref="HOGENOM:HBG398649"
FT                   /db_xref="UniParc:UPI000192DB97"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH1"
FT                   /transl_table=12
FT                   /translation="MSILRSEGALRVSRYTLRNAPLTIVTPINQPSVVVRRDLDSSQPS
FT                   SLITHTQTTRLVSNPRYMKFSRYPTLRNEHPEIDKKELQRKINVNKVIDQLREYVPDIL
FT                   ETSLPKSIISKDIYLRICPSQFDENYLPKLNGLVTYYTTCKAIQLFLTSVMLSPKVKLH
FT                   IQSIRVSRGPDPQCMFNDTTKIFLRWSTCPDGCSHLDAQGTSQAHLGTHKWSEEDTKKI
FT                   FDNHKSLSTLVSKLPGTIMGLTKEPKKLERVISGLFIFELSEDNSKILVHTIENMEIIE
FT                   RFEPETQPNVNALRVC"
FT   CDS_pept        complement(190648..193326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573518"
FT                   /orf_name="CD36_60930"
FT                   /product="Uncharacterized protein YFR016C orthologue,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAX41037.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG626698"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR006993"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000192DC36"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH2"
FT                   /transl_table=12
FT                   /translation="MDIEERLEKAEQSDSPSLVGSSIRSADDSTHKNYIHPEKYKSSKD
FT                   INKLKRYSKLNSSITASLDDLINEGALLGSEADFDKFLDQDGGVKTDAQFTPEKKVTSE
FT                   ETNDVTDTKGNEDEVLKISPEKKQVQDVQVAESSPEKSSETESLVIESEPESSTENTAG
FT                   KTDASSFYKQEDYSTPNLSEFQLEHDIKDHNDLIDHVQSYDLQKLPNSNSNFNSKFRND
FT                   EEVVAATSSQPTLLSPAQQQRLEGGLHTPYFHTERPRSRSRSANPTSRVRERSSSRNST
FT                   GAGKPHLARGDSYKSTHEEEPSKYELPADLTQEVDEANEEEPDERRSRQSKPTMGESIA
FT                   AAEAKAEALGKAADPAFEADTPLTRDPSLVTTGDYTNFEVDTPKREIPLSENFYTARSA
FT                   SATNYLRSISRSRSAARNANSVVGKDEKNDSSTDALVREGALINDDPYSTIEQLDTMVE
FT                   EVLQISDNTLVSDKKSSDTKESDKEKSLQKSQDVDKKKELEAKTSKKTEEGKELAAEKS
FT                   KDVDVDDEKENQIEKAKKAENKDDAKTGEKPITHEELIDEDIEKAKHHSNEKDDANTDV
FT                   LAEEGALVNEDDYDLVDKEELAKEGIVTSDSLEEEEAPLNVKEKKSQKTVDEDAPEDSI
FT                   KKDYENPVLDVEAKEIKKVVSDDDITSSEKEIVSEQPLVDVVEKSTKETEKEETDEPTK
FT                   EELAAYTKLEEPETSSTTVKSETEELEKSLAEEQPLDIKKKEVVETKDELAPKESKDVK
FT                   AASADVTSESKEAAKAEVSKTKEPKTAIEDDDLEDLDISPEEIRKHLESQPVYIFTSLA
FT                   GGMQIILRTNNLAAILQGNGIKFEYRDLGTDEEAKKIWKRQANGKTLPGVVRGDDYIGN
FT                   WQEIEDANEEYRLRELLYETL"
FT   CDS_pept        194933..195388
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078291"
FT                   /orf_name="CD36_60960"
FT                   /product="Mitochondrial intermembrane space cysteine motif
FT                   protein, putative"
FT                   /protein_id="CAX41038.1"
FT                   /db_xref="HOGENOM:HBG526063"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniParc:UPI000192DC37"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH3"
FT                   /transl_table=12
FT                   /translation="MPRQRRSAPAPRQQTRSAHTAAAPAHHAPPQTYPSAHPAQPVQTQ
FT                   SSQPGLFGQMASTAAGVAVGSTIGHTLGAGITGLFGGSSSSAPAEAPAQQQQVAAYQQQ
FT                   QTQEQAKHCDADARNFTRCLEDNGGNMQICDYYLQQLKACQEASRQY"
FT   CDS_pept        complement(195590..196291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094276" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573519"
FT                   /orf_name="CD36_60970"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41039.1"
FT                   /db_xref="HOGENOM:HBG398650"
FT                   /db_xref="UniParc:UPI000192DC38"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH4"
FT                   /transl_table=12
FT                   /translation="MIRNSIKSIKFNPIVVSRTTRFVHSSSRTFAKGDSSTIDSYRLPS
FT                   QTSINEWEFKYDFIPKTSEPKVPPLTKEAVKQDIAHEKAKSVEREMFAKESNSSIKVEA
FT                   NDAKVVHGGESVTAEPVLKEDTGSAPIDVSKPNINSTKPKKSANHEKYVQSSINPDINS
FT                   GNVVNLSEGEVDHKTESVDKQSPVVEDIEHDNLTNQGETKKESSGAGLGIFALLGLGGA
FT                   GYYYYSSTSKE"
FT   CDS_pept        complement(196909..197820)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573520"
FT                   /orf_name="CD36_60980"
FT                   /product="Conserved hypothetical protein "
FT                   /protein_id="CAX41040.1"
FT                   /db_xref="UniParc:UPI000192DC39"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH5"
FT                   /transl_table=12
FT                   /translation="MITVILTLIAKHVAGVTFDPHHHHHHHMHSNSITSLSITPTLVAR
FT                   DATEDSMPTLSTGEPTLSITHIPVSNNPYVYVSNLPSNLVFIVIGAIFGAILLSIILYR
FT                   ITTHFKYNRQAMNEKETYYTNLNEILNYKSPYSRNSSILDLNNNTDLSTSSTSSNQGRS
FT                   YRDSILGNNKPIMKKTPSTSRNSMFISPTMDFKTFELPLYQKQHNASSASLILRYNNNN
FT                   NNNNNNTDSSTIVSTAFDEKSRITTTTVADGNESSINGSTINGSFLDGGKLAPPKRVVR
FT                   APSLYLEDLLNDKSKEDKEEGV"
FT   CDS_pept        complement(198686..201019)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573521"
FT                   /gene_name="TOP1"
FT                   /orf_name="CD36_60990"
FT                   /product="DNA topoisomerase, putative "
FT                   /EC_number="5.99.1.2"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAX41041.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG521929"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="UniParc:UPI000192DC3A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH6"
FT                   /transl_table=12
FT                   /translation="MSSSDEEDIALTRLAKKSSSITSASTYEDDDEDDIPLAKKSRKKR
FT                   VESDYEEDYEDDIPLKKRKLSNGRAKQVKKEPKTKSKSTSTKDTKVKKEKTTVKKETKS
FT                   KKESKTASSTKVKEEPKSQSDSQASVKSETPEEDQGYKWWEANEETDDIIKWQTLEHNG
FT                   VIFPPPYEPLPSHVKLYYNNKPVNLPPEAEEVAGFYGAMLETDHAKNPVFQKNFFNDFL
FT                   EVLKECGGCGVEIKDFEKLDFSKMYAHFEKLREEKKAMSKEEKKRIKEEKEKEEEPFKT
FT                   CYLNGRKELVGNFRIEPPGLFRGRGAHPKTGKLKRRVAPEQVTLNLSKDAKIPEPPAGH
FT                   QWGEIRHDNEVTWLAMWKENISDSLKYVRFANNSSVKGQSDFKKFETARKLRNYVDDIR
FT                   KDYTKMLKSEKMQDRQMATAMYLIDVFALRAGGEKGEDEADTVGCCSLRYEHVTLKPPN
FT                   KVIFDFLGKDSIRFYQEVEVDKQVFKNLRIFKKSPKQPGDDLFDRINPSLVNRQLQYYM
FT                   KGLTAKVFRTYNASKTMQDQIDLIENEGTVAEKVVKFNAANRTVAILCNHQRTVSKTHG
FT                   DSIQRINDKLKEFMWQKIRLKKMILQLEPKLKKKDPKYFEEIEDLIKEDIEHIHHTIIK
FT                   RQREQVKKKLERDNEKLKLEGKPLLTESDIKDKLDKIDELEKEYKKELKTGKPIITKNA
FT                   TVEKLKQQIETLENRILNVSFQLKDKEDNSEVSLGTSKMNYIDPRLTVMFSKKFDVPIE
FT                   KLFTKTLREKFNWAIESTDENWRF"
FT   CDS_pept        203181..204896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573522"
FT                   /gene_name="CAN1"
FT                   /orf_name="CD36_61010"
FT                   /product="Lysine/arginine permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41042.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192DC3B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH7"
FT                   /transl_table=12
FT                   /translation="MSEDYEKYRMGSSNETHQRSIQPITSSISKSNEKTKQQTDFVQDS
FT                   DIIETSSINDEFGEVKRDLKARHVSMIAIGGTIGTGLFISTGSLLHTTGPVMSLISFLF
FT                   VTTICFSVTQSLGEMATYIPISGSFAQFVTRWVSKSCGAANGWLYWFSWAVTFGLELSV
FT                   VGQVIQFWTDAVPLAAWISIFFVILTIFNFFPVKFYGEVEFWIASIKIIAVFGWILYAF
FT                   IMVCGAGKTGPVGFRYWRNGYAWGDGILVNNNGKYVAAFVSGLINSIFTFQGTELVAVT
FT                   AGEASPRALRSAIRKVMFRILVFYVLCMLFMGLLVPYNDPKLTEDGGFTRNSPFLIAME
FT                   NSGTKVLPHIFNAVIVTTIISAGNSNIYSGSRILYGLAQAGVAPKIFLKTNKGGVPYFA
FT                   VAFTAAFGALGYLACSNQGNKAFTWLLNITATAGLISWGFISVSHIRFMKTLQRRGISR
FT                   DTLPFKAFFMPFSAYYGMVVCFIVVLIQGFTVFWDFNASDFFTAYISVILFVIMWIGFH
FT                   FFFFGFGKDSFKMSNILVPLDDCDIDTGVRDINDAEFDVPPPKNAWDKFWAIVA"
FT   CDS_pept        complement(205028..206209)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573523"
FT                   /gene_name="HAL21"
FT                   /orf_name="CD36_61120"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase, putative "
FT                   /EC_number="3.1.3.7"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /biological_process="sulfur compound metabolic process "
FT                   /protein_id="CAX41043.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0006790"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="HOGENOM:HBG599916"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000192DC3C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH8"
FT                   /transl_table=12
FT                   /translation="MKSFFLLTLSILLISLLVTYKPLTTKLNLFTRFISMSHSTHPYQK
FT                   ELEVATLAVKRASLLTKQLSDSIVQTAKSGTLTKDDKSPVTIGDFASQAIINHAIKLNF
FT                   AEDEIVGEEDSQELQENSSLADQVLNLITKIQQETSGYNDIVGTLTDKKKVFQSIDYGN
FT                   SQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDGEVVLGVIGCPNLSEHIVSNEEH
FT                   SGIVGGLYSAIKGVGSFYSELFKEGAEPLSQQRPIKMQNHTHPNQLKVVEGVEKGHSSH
FT                   STQAEIKGKLGFDPTTVANQTINLDSQVKYCVLASGQADIYLRLPVSDTYREKIWDHAA
FT                   GNILIYESGGQVGDVTGAPLNFGKGRTLDSKGVIAANKEIFAKVIDAVTEVRK"
FT   CDS_pept        complement(206509..207966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573524"
FT                   /orf_name="CD36_61060"
FT                   /product="Nuclear fusion protein, putative "
FT                   /protein_id="CAX41044.1"
FT                   /db_xref="InterPro:IPR007292"
FT                   /db_xref="UniParc:UPI000192DC3D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH9"
FT                   /transl_table=12
FT                   /translation="MIISLFIYCLAFINAQDLQLLGDFKFELSENWRNDCAKMALEPII
FT                   NQCAEGIETISPIQQKSIAIQLSICEFENAEISYPSECKSHNFDTCILLLEKSPQYWTT
FT                   FSGYYREIRNICHQISLPFAKDQILQVYENVTEFYRTLMEEITNSNKYTEKMQNELKTK
FT                   FDKLISVIDLILADREKNREDLKSSFNMFKNNFEKSLNNALVVMKHSYEDTNSNIEELE
FT                   RHLNYFLNDMSQVYVLINEKTLEVLSQQDEIRGNYDGILEQMENIRKKIVEMHEGTSEV
FT                   QITNNRLVNDVQNNFEYSLFTVSKLNSYLQLSINDFIEQNEDIRNQARVIFEEVFGLFR
FT                   SHLNESGQMAMNHVESALSSSLNRLQQKMNQTEDSIEKLHSKVSTLFHFAESTKEIASS
FT                   ILNVPNYVRTSVNHRIKQVKDFGNAIVMGGVFISVVAILFVLSLLKTQFTKMLRFAFIC
FT                   FPMITGIALALFILKFLTIPMEVVDID"
FT   CDS_pept        208335..209594
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382592"
FT                   /orf_name="CD36_61070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41045.1"
FT                   /db_xref="UniParc:UPI000192DC3E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII0"
FT                   /transl_table=12
FT                   /translation="MLETNILRALPQVRRYSVKHSRSPFSFLPNETKHIFDEEKLTPEE
FT                   NKAAIPLKPNYENLEKIHHEVINPEEISDLVVKFNSNDILVSILSNDGCLFGDKNYLLT
FT                   GTTKPTRFKATSILNSWCRIFNNQIKDLKEISPMQFWDPVVSPQISKAIDEYGDNFEKL
FT                   FKETRALKNSKLKKHGDIPPSELVDMITMDNLSLYVLNQLSSIESLAAFVAFMRNHIEY
FT                   YTVEGLSEILAKLTDICYRLHGDIDYELYLSVKQKYPGVIQKLPSDTVDKLANLLASKN
FT                   WELSKELIQVLIKRDVCPSETTMNEFLLNFVNSDPETKLKELSFLKSAIFSRGVNELSL
FT                   QILLSTIRNIHEFSKLIELIKTSSQCQLILSKYQHILFATLKRVSANLPLQKAQFVRVL
FT                   TEKNVQVDNDLMKILKKPTS"
FT   CDS_pept        complement(209658..210686)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573525"
FT                   /orf_name="CD36_61080"
FT                   /product="pH-response regulator protein, putative "
FT                   /protein_id="CAX41046.1"
FT                   /db_xref="HOGENOM:HBG398654"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI000192DC3F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII1"
FT                   /transl_table=12
FT                   /translation="MFKAFIALLILLVVCWVIQLLPVIAVPFTPPDANIYLSYYDNYKF
FT                   GVFGICNVERHICSKPSIGYPSTNSTFYAYDNEDSFGTGGIVLPSDVRYTISKLLVVHV
FT                   VAFCFSSLLLIVIFGLITILFFKYIKTKKELEGIQLSDTSHDTTIQTEEEENNDNANNN
FT                   NQGASLTINKTIFDLTPFLNLMLVFTFFSVLTTLLAFLADILLFTPNLSYLGWLQLIPI
FT                   VSMALVTSMLCFIKRSISSRKFFESEYRYANDDMRIMRKTYVDDFWNDNASDDGFYVYT
FT                   DGFYTRNGDDVQQPTSNTAGSLLSEHNDDSIVAPRDFISNDDSRRGSSPHEFIELQNLR
FT                   PT"
FT   CDS_pept        211302..212354
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573526"
FT                   /orf_name="CD36_61100"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX41047.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG398655"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000192DC40"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII2"
FT                   /transl_table=12
FT                   /translation="MYLGLVLSLFVSQILHQVSAHPINSDNSVFIDNRDPTTPIDPEIY
FT                   SNLYTYAHLIDISYCISEVNRIEEPFKCNLNCEKRFPNISLVYQFYFDESVTGYIAKTT
FT                   SNIFRYNETISEDIKTIIVALRGTRSIFDTLTDLKVDMIPYSNSGTKLPLCGYDCKVHR
FT                   GFHDYYTRTLSIIHPYIIEELNNYVGVDNYELIILGHSLGGSIAYLLGLYYLDMGFDKL
FT                   TLVTMGQPLLGNENFVSWGDKVLGSVNEAKHNEFKRKFLRVIHKNDVITTLPRDQNIFN
FT                   RYCQFNNQIYLNCSESNTRPSIDEVIDCYDGTNNQCIAKDFPFLVFERRNYLQIHINYF
FT                   RQMGLCGILK"
FT   CDS_pept        212491..213672
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573527"
FT                   /gene_name="HAL21"
FT                   /orf_name="CD36_61120"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase, putative "
FT                   /EC_number="3.1.3.7"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /biological_process="sulfur compound metabolic process "
FT                   /protein_id="CAX41048.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0006790"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="HOGENOM:HBG599916"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000192DC3C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIH8"
FT                   /transl_table=12
FT                   /translation="MKSFFLLTLSILLISLLVTYKPLTTKLNLFTRFISMSHSTHPYQK
FT                   ELEVATLAVKRASLLTKQLSDSIVQTAKSGTLTKDDKSPVTIGDFASQAIINHAIKLNF
FT                   AEDEIVGEEDSQELQENSSLADQVLNLITKIQQETSGYNDIVGTLTDKKKVFQSIDYGN
FT                   SQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDGEVVLGVIGCPNLSEHIVSNEEH
FT                   SGIVGGLYSAIKGVGSFYSELFKEGAEPLSQQRPIKMQNHTHPNQLKVVEGVEKGHSSH
FT                   STQAEIKGKLGFDPTTVANQTINLDSQVKYCVLASGQADIYLRLPVSDTYREKIWDHAA
FT                   GNILIYESGGQVGDVTGAPLNFGKGRTLDSKGVIAANKEIFAKVIDAVTEVRK"
FT   CDS_pept        complement(213725..216211)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078292"
FT                   /orf_name="CD36_61130"
FT                   /product="Probable ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41049.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192DC41"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII4"
FT                   /transl_table=12
FT                   /translation="MTDQVKGDEHNQVNNGKKRKRKRNKNKKNDNKTLVENSQPIPTHV
FT                   YEDDIHRQNKKFKFDDEGEIQKPQESREQEQGSVSDQEENYTEEPFQQHEVFEEIEVTD
FT                   EVGQPEEPDLPAKNKQEKHYIDKSNFKQKPKSKRKTVIYKDDEDDEEENNTFNFSQNSF
FT                   QLAATAKQLLQIREKLPIYHHKDKIIEYINNNQVTIVIGETGSGKSTQIPQFLMPENQK
FT                   MIAVTQPRRVAAASLAARVSEEYGCKLGQDVGYQVRFTNMTNRQTKLKYLTDGMLLREI
FT                   MLDSNLTKYSTIILDEAHERTILTDLIMGFLKQIITSGRRKDLKIVVMSATLNAELFSN
FT                   FFDNAPILYIEGKMYPVSQFYLDAESEDIVDTMIRSVIQINLNEPEGDILCFLPGQEEI
FT                   DNCVKSLEQLAPQLPKEAPLIVPLPLYAALSPGQQSKIFENLPKGRRKIILATNIAETS
FT                   ITISGVKYVIDSGLRKIKVWKHNLGLSTLLTTPISQASARQRAGRAGRESEGKVFRLYP
FT                   ESTYLALPKQQESEIKRNDIILPVLTLKKLGVDDLLNWSWLEYPGQDAILSALNTLYTL
FT                   GALNDSGKVTTLGYKMSILPLPPQLSVVLITAAEFGVLSPVIDIASCLSVDNLITNVTG
FT                   EARDEINFKRRQHCPLGNTHGDLIALYEYFQAYQAQGKEWCKELAFSFKGFKNVEKIKY
FT                   QLQEYMMTTIKQDDSLTNVEKDKQLAKLKAQLDNEETDKQLDVPSILKSFLKGYIINTA
FT                   VGMPDRSFRTFNTGQLISVHPSSTLFGKPNMDAIMYIEYVFTTKGYARNVSAIELSWLQ
FT                   EIAPHIIGGVKVNIND"
FT   CDS_pept        216435..217940
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000242790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573528"
FT                   /orf_name="CD36_61150"
FT                   /product="Tyrosyl-tRNA synthetase, mitochondrial, putative "
FT                   /EC_number="6.1.1.1"
FT                   /function="ATP binding"
FT                   /function="RNA binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41050.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG288125"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192DCFD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII5"
FT                   /transl_table=12
FT                   /translation="MLKGRTKSIPLTRILIRFNSTSARDPVTIIPTVYELTEAKDLTPE
FT                   TNPDNSLLEYLQSRHLIESITDDSLYKLTKRGTNHKFKLYCGADPTASSLHLGNLLPLM
FT                   VLLHFKMSGNDVVGLVGGATGLVGDPSGRKTERNKIDEVEVEDNVTKIQRQISTFLSNG
FT                   IEYAKSRQFPMTEKLGETTSVNNASWWENVKMLEFLAVYGRHIRVSSMLARDSIQSRLE
FT                   SGGIGFNEFTYQILQAYDFWHLYKDENVNMQVGGNDQWGNITAGIDLISRLRKFHDKKH
FT                   EAYGLTVPLLTTSSGEKFGKSAGNAVFIDSNLTTPYQMYQYFINVPDDIVGKLLKVFTL
FT                   LPLNVIEGELLPKHNSDPGLRIAQRVLAREVVDLIHGVGVGDEMAFITGFLFPTPDQPF
FT                   NDNVSADKLIENFKRSGILFKRDKPSPEEEIKLSALLADIVGKSKSEMRRLIKAGGVYM
FT                   GLDRNQIEDPDDVILFDVDNHLIDGKLLLVRVGKQNYYVVEFV"
FT   CDS_pept        complement(218080..219786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573529"
FT                   /gene_name="CAN1"
FT                   /orf_name="CD36_61160"
FT                   /product="Lysine/arginine permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41051.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000192DCFE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII6"
FT                   /transl_table=12
FT                   /translation="MFEVNEKYPVESTSGSSNDIESHGVQPIISLKDNKSIGFIDKDDD
FT                   ISSQQYSTCDEVKRDLKARHVSMIAIGGTIGTGLFISTGSLLHTTGPVMSLISFLFVTT
FT                   LAYSVTQSLGEMTTYIPISGSFAQFITRWVSKSCGAANGWLYWFSWAITFALELSVVGQ
FT                   VIQYWTDAVPLAAWISIFFVILTTFNLFPVKYYGEVEFWIASTKVLAIVGWLIYAFIMV
FT                   CGAGKTGPVGFRYWRNGYAWGDGMLVSNNGKYAISFINGLINAVFTFQGTELVAVTAGE
FT                   ASPRAIRSAIKKVMFRILVFYVLCMLFIGLLVPYNDPKLTEDGGFTRNSPFLIAMENSG
FT                   TKVLPHIFNAVIVTTIISAGNSNVYSGSRILYGLAQAGVAPKIFLKTNRGGVPYCAVLF
FT                   TAAFGALGYLACSEDGNKAFTWLLNIIATAGLIAWGFISVSHVRFMNVLRKRGISRDIL
FT                   PYKAFFMPYSAYYAITIIFIVVLIQGFTVFWNFNASDFFTAYISVILFVILWIGFHFFF
FT                   FGFGKDSFKWENILIPLDECDIDTGVRDINDAEFEVPPPRNIWEKFWLLIA"
FT   CDS_pept        complement(221406..222305)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078293"
FT                   /gene_name="CIP1"
FT                   /orf_name="CD36_61180"
FT                   /product="NmrA-like negative transcriptional regulator,
FT                   putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX41052.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG398656"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192DCFF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII7"
FT                   /transl_table=12
FT                   /translation="MSKVSIAIIGLNGFLGKPVLEAINSGIFDDKINFPIKAITRKEPE
FT                   TKNEKIEYIVSEINEESIKTTLNEKLSGTDVIIELIGPNPVAFANIEKLVGTIKPKLFI
FT                   PSQFGTDIPKVDEYAPGFLSIKTQHSENVRKLGVKVVDIVNSLFAVPGAFLYEWVGSTG
FT                   INAEDKTVKLIGDINQQLDISKLEDVGKAVLSIATNPNPKELPDTIRIASDRITVKDVI
FT                   DRYSKDHNVELKIVSEQSAADAKKEFAESLKAGFDGNKFSWYLQVISAQGLDKGLLSSK
FT                   LDNELVNPGESLWKWGKY"
FT   CDS_pept        join(complement(225563..225598),complement(223500..225500))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573530"
FT                   /orf_name="CD36_61190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41053.1"
FT                   /db_xref="UniParc:UPI000192DD00"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII8"
FT                   /transl_table=12
FT                   /translation="MWITYHKDDPRGEYKHLSPETNYTVGRDENTDIKFWSPKVSRELI
FT                   ELITGPNITNTQLSSSSSSPASTSAVGDKTLLIIRICSRAKTIINGKTYKLLSKDSKPE
FT                   EIDFTNETKLKIETISQIDKQTGQIITQDTPLFIEWVPLRLYISSNDKYDQIHYKTIIK
FT                   NHGIDIQIVDNVMDATHYYYDNDIINIEQEEQKNEFKSAIIKGIPILNSQWLQMVLGHE
FT                   HDNEHYRNTTSVKDWLLDIDYPKYLPNNDYVPKNNRLKLFGDIKLVSLEKIDWLETIII
FT                   DFTLLIQQEGDPKNQDYLQSKIGDNQFILIASTPMTTTMNRHNFQTITMDQLWQSIKTN
FT                   SISDLPKNSLKQLKRTSTTMLSTDKSAATATTSPEVVAPPGRKRRKYEKVDRLHFFSLA
FT                   TAPTTRDSSPKVSILDTNNKSISPESTSQKNTSGDNDSITQEITQLSDPIKKIPTLEQK
FT                   RKVLNSSQTINLNQNDVLISSNDSNLSIPLPANQLALQSKSNSKSQKSSLNSGSNSSSI
FT                   NTEEENPSIGFKRKNKDKDDDVIVDRKSFKIPKITPKVSLVDAVLKVQELNKPQNFESD
FT                   FEINENLKNLAIVEVVELVNRRNRNRNRNKGTDGVGNVESRYTGRKNFKKFKKNAPSSN
FT                   NNRRRIGLYTVEDNLEEEEDEDEEEDGDHNDTTRDDNYYEVYF"
FT   CDS_pept        226250..227827
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573531"
FT                   /orf_name="CD36_61200"
FT                   /product="Protein transport protein, putative "
FT                   /protein_id="CAX41054.1"
FT                   /db_xref="HOGENOM:HBG398658"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI000192DD01"
FT                   /db_xref="UniProtKB/TrEMBL:B9WII9"
FT                   /transl_table=12
FT                   /translation="MGIKKMFQKKEPTEQEIREELSRVGISTRSNNTRQEKFGAFKNYA
FT                   QERANMKPQLGPVGGNPYANINPGNNNNNNSNPYANNSNDSGNGNNPYGGGGSSSTSST
FT                   NNNPYGSSGGNGNGRGSSSSSPYASTTSTTTRSSNPYGNNNGSRSSQNASSPYAKSTNN
FT                   SSYSNSPYSGSTVNNSNSSGGTGTGTVGNPYAGGRSSSSQKPRDNVYNATRTSTRQTQG
FT                   YGGDTDSTLDLNAIPSHQMFDNKKPIKRNQQQQQPANDYNLDLNDEYGGDGEEEEDLNL
FT                   DISEVPEEQQEINSEDEEVEAIKQDIKFTKQESVQSTRNTLRMAQEADASGTNTLGMLG
FT                   SQSERLYNAEQNLLLAETQTQIADEKVKELKRLNRSIFIPANGNPFNKKSRLRQQEEKI
FT                   KNQKLQEKYIRETNRQEMFASEQRIKQGITNNSTNNDIYNKYQDEKNLSAAKRYQFEND
FT                   SEDDDMEKEIASNLNQIDQYAKKLKGLANTMGTEVDNQNTRLKKIEESADKLDINVHMN
FT                   TTRLNNIR"
FT   CDS_pept        229996..231297
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229726"
FT                   /orf_name="CD36_61210"
FT                   /product="Delta 12-fatty acid desaturase, putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41055.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559049"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000192DD02"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ0"
FT                   /transl_table=12
FT                   /translation="MTAATTSFSSGFNNNPNNDSTDSSATISKSGNIASFTSTSSSYQT
FT                   NLTAIDTYGNEFKVPDYTIKDILSAIPTHCYERRLLQSLSYVFRDIFCMIVLGFIANNY
FT                   IHLIPNQFIRFLAWTSYVWCQGLFGTGIWVLAHECGHQAFSDYGNINDFVGWILHSYLL
FT                   VPYFSWKFSHGKHHKATGHLTRDMVFVPKTKEEFLQNRGVKDLDDLLGDSPMYSLLTLI
FT                   FQQTFGWISYLIANVSGQKYPDVSFLKVNHFNPNSLIFDKKDYWYILLSDLGILLQFFN
FT                   LYIWYQNFGGFNLLINYILPYFLVNHWLVFITYLQHSDPQMPHYEASQWTFARGAAATI
FT                   DREFGFVGKHIFHDIIETHVLHHNVSRIPFYNAREASEAIKKVMGIHYQHSDENMWVSL
FT                   WKSARWCQYVDGNNGVMMYRNVNGFGVDPKKQTH"
FT   CDS_pept        complement(231625..232428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078294"
FT                   /orf_name="CD36_61230"
FT                   /product="Protein-S-isoprenylcysteine O-methyltransferase,
FT                   putative"
FT                   /EC_number="2.1.1.100"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41056.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG737603"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI000192DD03"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ1"
FT                   /transl_table=12
FT                   /translation="MTLSTIFSKRNLSRYNPEKVNLLKIVLKSFLLGSLFTINLYNLLF
FT                   TFNKFWYQINLFIIFLIIFHNLEFINTVLFNNSQVDDDSFILEDKEMFIINLLSIIEHI
FT                   IIHNYDYFNLKFYTDSKFVYGIGLILIIIGQFIRSLSMYTAKSSFNHYIQKEKKESKTS
FT                   SSVALEQIDNTDDNNDVDADDDMGHKLITTGIYSIFRHPSYFGFFIWFLGLQIFLNNII
FT                   VLIIGGIILWKFFNERIQFEEIYLVKFFGIDYINYRNKTKTWMMI"
FT   CDS_pept        232795..233556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229727"
FT                   /orf_name="CD36_61240"
FT                   /product="Protein-S-isoprenylcysteine O-methyltransferase,
FT                   putative"
FT                   /EC_number="2.1.1.100"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41057.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG737603"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI000192DD04"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ2"
FT                   /transl_table=12
FT                   /translation="MTPLTYNPKDNNLLEIFLTCFIMGITFTISIILLLITSFSFSNNK
FT                   YIWLIIYSFLLHGFFLMEFINTSLYQYNSVTSKSFLIYGNKGNKQFWNLQLLTIWEYLL
FT                   LRLDKFNWIIINYLPNNNACCWWYLVIQILGLSISLLGLFIRHLAMKTCGLSFNHYLTT
FT                   TFNNKQHDKLITHGIYKYIRHPSYLGFWLFCIGIQLMLLNIGNLILSIYILNWFFKIRI
FT                   QYEENQLIIKYGDKYINYQQTTKSKILIPFI"
FT   CDS_pept        complement(233562..234122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229728"
FT                   /orf_name="CD36_61250"
FT                   /product="Subunit of the ARP2/3 complex, putative "
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAX41058.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG320336"
FT                   /db_xref="InterPro:IPR007204"
FT                   /db_xref="UniParc:UPI000192DD05"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ3"
FT                   /transl_table=12
FT                   /translation="MPAYHSTFLAEEQNQSINSGIRTIGNLSLLPFHTNFRGPIYPPQT
FT                   NSSDNDYDIIEEILDLFRANSFFKNFEIKGNSDRLLIYGILFINQCLTKLTKFTNAKEA
FT                   TKLLINLSVDNFHLPGDIGFPLNSLYIAPANKNEYELLKNYLTQFRQELSDRLIKRIYK
FT                   DDPNVPSKHWLAFTKRKFMNKSL"
FT   CDS_pept        236008..238116
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229729"
FT                   /orf_name="CD36_61260"
FT                   /product="APC/C activator protein, putative "
FT                   /biological_process="cell division"
FT                   /protein_id="CAX41059.1"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DD06"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ4"
FT                   /transl_table=12
FT                   /translation="MSLVSPNSKPTIFKNNNILLKNDSIDPPTKSKSPTRKPSNVSLSA
FT                   APSANNASISPSKRHYLQQMSPNISNRTVHLPNDTPLKQQSLKRSSISSSNSGAGVGAS
FT                   AEVAADSSSTTTIKPIAKPTSKFQRPQLPPSLRPPINGRSKTAILPSLSKSTSSLTTTH
FT                   SSTQSLSNPFILRRANSLISQGGSSSLSDLHQQQQSSTTSSDRFIPSRYNSVTGKLDTS
FT                   NEVPLPNAAPEVHIKAQTSKIYQHHVAEACGLEMNSRILLYQPLPPERKKPVNLVRQLS
FT                   NQSSSLTPGASNIPNSQLFRTSFLTKSGTLTPSAAAARANKIPNAPERVLDAPGLIDDF
FT                   YLNLLAWSSTNLLAIGLEDAVYVWNASTGSVGLLCELADKTLVTSLRWSQDGSYISIGK
FT                   DDGLIEIWDIESNSKLRTLNCDNHLTRIASQSWNQHVLTSGSRMGHIYFSDVRVANHLV
FT                   NKNQEAHSAEICGIEYRPVGTTTTTTTPTSINDSLQFASGGNDNLVCIWDARNVTTPIF
FT                   SKSNHKAAVKALSWCPYQSTLLATGGGSTDKTINFWNTTTGARVNTIETGSQISSLNWG
FT                   YANGTGLEIVATHGFPSNSISLFNYPTLQKTGEIINAHDTRILNGCLSPDNLTLATVAG
FT                   DENLKFWSLFDLYKNNKRDYNHLRHGQDRDNDYDDDDGVSDVNGLNNDDNDGGGHDSKR
FT                   IKKMMNLR"
FT   CDS_pept        238837..239418
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229730"
FT                   /orf_name="CD36_61270"
FT                   /product="Calcipressin-like protein, putative "
FT                   /biological_process="calcium-mediated signaling "
FT                   /protein_id="CAX41060.1"
FT                   /db_xref="GO:0019722"
FT                   /db_xref="HOGENOM:HBG448280"
FT                   /db_xref="InterPro:IPR006931"
FT                   /db_xref="UniParc:UPI000192DD07"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ5"
FT                   /transl_table=12
FT                   /translation="MPRKPTNTLIITNIDDSLLSNPQPIISILGDQPYMIELIVLMKFK
FT                   RILLYCQTSKIATKTKTFLLNQWETTIGGNTISISYSLKDNSRILNSDDDEEEEESHGV
FT                   GGRFLDIPKDLEIKRFLISPPASPHSEWDDWDKVEEGPNETNIHDYLWEKLKTHENEEK
FT                   ERSINDDDDDECDNIEQMELPKIVLNATDN"
FT   CDS_pept        239742..240827
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078295"
FT                   /orf_name="CD36_61280"
FT                   /product="Proteasome-interacting protein, putative "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="proteasome complex"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41061.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG398563"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="UniParc:UPI000192DD08"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ6"
FT                   /transl_table=12
FT                   /translation="MAKTRSKSAAAATTTAAKASPTAAKVTKSKVIKPSSSPSKTTKNK
FT                   SVKKTTTKKTTPKQEEEKKEEIVETVTENSSLIPEEITEKAISELKKYITRQSQQEIES
FT                   KDSKKSKLFDEDEDDEDDKQNESFYLTIDSKKFWSSKPQFKPKSIKLTKPLYENNQNST
FT                   SNSNNDIIVDNNICLIIRDELIKSIDELNELDNSQSLSQISQIIPLNSIKTEYKSFEKK
FT                   RELYHQFKIFLIDEAILNIMPNTLGKVFYSKGSSNDKIPIPIKVTATKTDSESQSNGKQ
FT                   LSIVTLTNQLNKVLNSTYYLPPIGNNITIKIGKIKFDNNDLIANINDVVKSLDLDTIKS
FT                   IHVKTSTSPAIPLFYTKSLSQ"
FT   CDS_pept        complement(241060..242280)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535368"
FT                   /gene_name="EBP1"
FT                   /orf_name="CD36_61290"
FT                   /product="NADPH dehydrogenase, putative "
FT                   /EC_number="1.6.99.1"
FT                   /function="FMN binding"
FT                   /function="NADPH dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41062.1"
FT                   /db_xref="GO:0003959"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192DD09"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ7"
FT                   /transl_table=12
FT                   /translation="MTIESANSFVVPSDTKQIDITPLGSTKLFQPIKVGNNVLPQRIAY
FT                   VPTTRFRATKEHIPSDLQLQYYNARSQYPGTLIITEATFTSEQGGIDLHVPGIYNDAQA
FT                   KSWKKINEAIHANKSFSSVQLWYLGRVANAKDLKDAGLPLIAPSTVYWNEESEKLAKEA
FT                   GNELRALTEEEIDHIVEVEYPNAAKHALEAGFDYIEIHGAHGYLLDQFLNPASNKRTDK
FT                   YGGSIENRARLLLRVVDKLIDIVGGNRLALRLSPWATFQGMEIEGEEIHSYILQQLQQR
FT                   ADKGQQLAYISIVEPRVTGIYDVSLKDQQGRSNEFAYKIWKGNFIRAGNYTYDAPEFKT
FT                   LINDLDNDRTIIGFSRFFTSNPDLVEKLKLGKSLNYYNREEFYKYYNYGYNSYDESEKE
FT                   VLGKPLV"
FT   CDS_pept        complement(249752..254338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382593"
FT                   /orf_name="CD36_61300"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41063.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG398564"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020647"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000192DDAE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ8"
FT                   /transl_table=12
FT                   /translation="MGQKLSLLAPSAPTVAVSSYVDALQNYQYVEVINNSRFLKTIKAI
FT                   DKTTGNLVIIKLLIKPASPNYSIQLQQVIELMVKQSSLLYPFKNALPWHKLIETDRAGY
FT                   VIRQMIKTNLYDRLSIRPFLEPIEKLFITFQILKIVNEIHSLNIHHGDLKLENFLITSW
FT                   NWLLLSDFSNLLKPTYIPEDNPNQYSFYFDTSGRRLCYIAPERFYNSQDHPQHISNFND
FT                   DGSFTMKNSVTDAMDLFGTGCVIAELYNDGEPTFTLSQLFKFMKNEYAPDFSGIYNKDI
FT                   VSIIEKLIKLDPNERLSAREILDENKGTCFPEFFYDFLYDFMEMLNNQENFSLNSNNDN
FT                   LSISDMKINYIYDNFGLISKSLKFEYSIDESNLSPDDILPMKLNLETMPFNYRIKQSKF
FT                   IDDDSQEAALILLNAVTSFSQTLRQVNSKIKCCELIVALSERIRDESKLDRAIPYLCLF
FT                   LDEYIDGVFHQQEGVNIAAKVVCVALYSLTSLLMSCSYINPINMLIFPEYILPKIYNLV
FT                   TVKSDSNSQRLVNCAVAVCLPYLAATAKRFWIMSKAFKNSNNALSTLVSPEDAMQSFSN
FT                   LSLTKDQLDSKFKEITILLLTDSETPVKISLLNNILPLCQFFGQDKTNDIILPHLISYL
FT                   NDTDQELRLAFLSSVLQMGPFIGVLSFEQYILPLLVQTIGDGEQFVVLKVLEIFNMFVK
FT                   ERLINPRTEFNALDVYKELLSNSINLLLHPNEWIRQSVINLIIYISDNLTDADRYCFLY
FT                   PLIKRFLSYDLSIIDWNTLYPCLTKPLTKQIYDLAITWSLNSTSKSLFWQQKSFSMLMT
FT                   KQSGNTIKKKKLISFNKDMGKSVYLPQMMSELSFANGSNKKGNSTIPLSSEDKQWLLKL
FT                   KSIGLDDKSLWKILALRDYIFHVGRSPTSTINKRLKSSENENLSILPRNIFFTVVYRSE
FT                   PLSISGGTREQKILGTNAEETVSIRTSSRRGSNSLILPQLERVTASVQTVEANIMGEME
FT                   THNSGVTKDAWFNDSNTSHKVFSVSNSGIIVSHIKHTYTGENPYILNFLKNPKFQPNLS
FT                   DFEEFGKTIIRHQHKQQQQRNENIDMLAPMNVLVASFRSSDKENRLEEITTLAVCPTSE
FT                   FFVTGSSTGSLKVWDSLKMEKLVTVKNANLSVELNSSICSITFLPNRFVVIVTTDDGTI
FT                   RLFRIDVIRNNKSKKIVRYLKMHLIRQYIHEESNDNNNKTHHHHYPIEQIKFLQDNYII
FT                   GIDAIEQKIIMLDIITMTISSELQHPLIYGIINTFIVYKDYWLLVGTDKGVLTLWDLRF
FT                   KIIVKSWHVQNNENNVKLDSINNLELLSSLNSIKLFETKKNDGGGSNTSSAYFALSGND
FT                   DISIWELPSLECKAILRTSNSAMMNSSTSNIMKYSLIEYKDHDGGDDNGFFIEKIIDDI
FT                   QLDIDHEYDRKLDLNVLTMKFFQFNTNNDYLMCSTGSNRVILFNLSSIKDSVILKSEKA
FT                   TFNTRYYNNVVIIDPVFTNDQTSSNGNTTTNTTYNVVKLIDHVFEPFHMIITIDRNNCV
FT                   KLYKSAND"
FT   CDS_pept        254520..255197
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078296"
FT                   /orf_name="CD36_61330"
FT                   /product="Pre-mRNA-splicing factor, putative (Bad response
FT                   to refrigeration"
FT                   /protein_id="CAX41064.1"
FT                   /db_xref="HOGENOM:HBG448467"
FT                   /db_xref="UniParc:UPI000192DDAF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIJ9"
FT                   /transl_table=12
FT                   /translation="MSFDNEEDLLYAQKQALPISKESGDPISEYLLAVRKESLAGPPVT
FT                   FITNRPTSSIVPTPKSSPEIDRTQISEHWSSELMIQFLFLKEELSKIQHSSPTANPYVP
FT                   ETTANWRKFFLEPPPEISYFFIVIDRQTVFRLLVYITRWLSITSRPTLSQWIWKLFLRI
FT                   DNVLDANECSIIRDLGKKARIIKSKQLKDENKSTVDSISKYTTDMILIIVGNYYGQWDL
FT                   LQG"
FT   CDS_pept        join(255315..255349,255420..255732)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573532"
FT                   /orf_name="CD36_61340"
FT                   /product="Uncharacterized protein YPR063C orthologue,
FT                   putative"
FT                   /protein_id="CAX41065.1"
FT                   /db_xref="HOGENOM:HBG398565"
FT                   /db_xref="InterPro:IPR005351"
FT                   /db_xref="UniParc:UPI000192DDB0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK0"
FT                   /transl_table=12
FT                   /translation="MAPKIREDLVIPYKHVPAKPRKDSTGVIAQSLPMAAMFMRNKVLS
FT                   WSSLFLSVQSYLNEPINKPDSDDASQPPFMKIVFAFVAVLTCYMDVFFPNTNPALRMAA
FT                   KVATETPAASK"
FT   CDS_pept        complement(255859..257574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573533"
FT                   /orf_name="CD36_61350"
FT                   /product="Histone deacetylase subunit, putative "
FT                   /protein_id="CAX41066.1"
FT                   /db_xref="HOGENOM:HBG398566"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DDB1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK1"
FT                   /transl_table=12
FT                   /translation="MSLTSKELNYLIWRYLQESGYDLSAYALDQQSQCSEYENNPTTQE
FT                   LIQKIKPGCLVNLIQKGILYMVAEQEATDSANLSLYGALIQDDLKNLQDNNSSNGSNGT
FT                   RFALKSEIEANGKIKDPAETPNDDVTQDIEMTDDMDQEIHQKSIIEFETKLLLPQLTFA
FT                   PSLTCDWHPTSEVFAYGKDDGSATINALKDGKIIETRTLTHPNLLNIKNQINIVSWSPQ
FT                   GNLLITCGANSELRAWSPDGKLKNIASTIADEVISLESTTKLTSIISSLSWSPTGKFLL
FT                   SIDSRNQVCIWDGTTISLIKQIKNLEINDDSVVCFCWLSEDKFAVTTNTNGIKIYDILA
FT                   PSHFGSQLDVHPIGLLNGHKHDISLMKLNPKTKLLATCSDFDYSIKVWSSSSSQECLDL
FT                   NINPEKKYTLKLHSAPMIGLIWLPDTNSNERSNLLLSVSMEGALNIWDAQTSESIKSSE
FT                   LFNNKDNFTDEMKDVHDTIKDVLVFNAVLSPDGKYLALGDDYCRVTIWDVDTTHYLDEP
FT                   KDFVRCKAVYKPELSPEDKLKATIGICDMKWDHESKSICVSYNGMESVIINITT"
FT   CDS_pept        257841..260210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535369"
FT                   /orf_name="CD36_61370"
FT                   /product="Exocyst complex component, putative "
FT                   /protein_id="CAX41067.1"
FT                   /db_xref="HOGENOM:HBG398567"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI000192DDB2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK2"
FT                   /transl_table=12
FT                   /translation="MENPESNSSLQVEKLRNRKSRAVWQNNNTNVHNNPYANLSTGERS
FT                   RSRRNTGSSYVSPYGIGTGDENVYTGNSNNNNNKPSTGGNLLQVPGAHGDLNSNKKQNR
FT                   RLSIHVSARQHGRSISQVGPIDMANLPALPKLGSEAMAKSKSTDLTIEQKIFKELSQGS
FT                   AAEVDDYYKTLLKQKNLITRDIKDNINQNQKNILQLTKDLKETQEELIELRGTTKELYE
FT                   VLGYFKESAQRRLELEFEPETQKELHSPQKSNQLGIPNNKKKDRSSIMVLKKMWDSQLQ
FT                   SLFKHVDGASKFVQPLPNRHIVAESGRWFEVNVGNWKSSYPTHLFIFNDLILVAIKKSS
FT                   STTTTTTTTAQETTATSGGSKSRLQAVQCWPLTQVSLQQIKSPKDNDDKMYFINLKSKS
FT                   LSYVYSTDRYDHFVKVTEAFNKGRNEMIQSERLLDSRLSSPSNNNGESKEEKRQLRESL
FT                   RNSGTYKEGVIDDSSGGGSGRKSAGTPNRNSNTDYVLHDISARVHSRNRSQDIGNNFNK
FT                   LANNGKSQFFNEIKTLEDRLDDVDVEISHNQYAEAVELISIIESKLRNIENALTTTQRN
FT                   KNVNIADELLLLDVSKLKIKNRKENVSNGLIFDLQHNIAKLKQDDIDNILTLFDSLEQL
FT                   DRGVQGYLDSMSAYLSTTVSKLIVGLQGSTKIDVVNYLSNLMVINVSIVKRTIQTYEQI
FT                   IAPILKRRHGDVDSSGLINWCIDEFTKLCKQIKKHLYGTLLISSGINMETDEPIYKVKE
FT                   KTLYNNFLKIMQPQLEELKSVGLNVDYIFESILNIE"
FT   CDS_pept        complement(260339..262369)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229731"
FT                   /orf_name="CD36_61380"
FT                   /product="Uncharacterized transporter of the major
FT                   facilitator superfamily, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41068.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG324539"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192DDB3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK3"
FT                   /transl_table=12
FT                   /translation="MSHHSPNLSPQTSHDNIDVDATSLASTETQQNIQHSQIHPIGHHG
FT                   REHSEEPQTTTTTPHHTTVDPDPDLGPLGELERDLSSLESQQEQYLSQKPTSTSIKTNK
FT                   VPLRQRRGLLAQIVLIPEYEDARDYPNKIKYLIVFIIAFASLAGPFGTSVMLPAIDDIV
FT                   TDLNTNVSTVNVSVGIYLLSLGIFPLWWSSFSERFGRRSVYMVSFTLFVAFSIGTALSP
FT                   NIASLIILRVLQGGSSASVQAVGAGTIADLFIPQERGQAMGLYYLGPLAGPFLAPILGG
FT                   AVSQAWGWRATQWLLMIISACSFILITFFLPETLRRVDTIQIAKDLIKSQDNEKPPNDD
FT                   DDDDDDNISGDEVLPGTELHQVVSNLSRRSSSARSIVTYMEEQENEGPIVDPVMPSISR
FT                   LTTNKSAYSQRVHQNYVSDELRKTASNLTETKTPQDNKWSSVKTNCYDLLIRPLHSIIL
FT                   LKHPPVVLVISFSAISFAAIYFFNMAISYEYARSPYNFSSVILGLMYIPNSVTYFMASI
FT                   IGGKWNDRLLNRYAQKHGELLPESRLSWNIVVAIILYPMACLIFGWTIHYREFWVVPLI
FT                   GTALFGFASMLVIGATVTYLVDSLPGKGATGVALNNLIRQILAAIATFIIEPLLRAIGA
FT                   GVLFSIIAGILLVSSLVLLYLKKHGAYYRENYDVMDLYAKL"
FT   CDS_pept        263919..265154
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535370"
FT                   /orf_name="CD36_61400"
FT                   /product="Uncharacterized acyltransferase, putative "
FT                   /EC_number="2.3.-.-"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAX41069.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG398568"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI000192DDB4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK4"
FT                   /transl_table=12
FT                   /translation="MSSRHSLPIVILRTAFITPLFILGCLSIVVTQFLTLLIFKTNPDV
FT                   KQAIINNTKNHFVILLTYITTIVNPCEIELTIDESTVPNFDHFTVDGSNNLHTMFQPNS
FT                   ILISNHQIYTDWLFLWFLTYTSKFGNSVFIILKDLSKIPVLGYGMKNYNFLFLSRKWEK
FT                   DKIVLTNQLLEIDANARGLGPANGVELVSTTEKEFTKWPQGSNTNKIWPYELILFPEGT
FT                   VPSDRTTKKSAEFTASRGLPPLKHVLLPRVRGLFLALKKLKNSVEIVYDITTAYSGLTE
FT                   DQYGEIEYSLKNFYVKGYGPPKINYYIRGWKLKDIPLGKDVDDIDNIPEEDLKKFEDWL
FT                   LKLWYDKDRLMNNYYKFGNWDGTEEPKYKTKSIIGGFKLRNQFEIFLPFLVTIATILFL
FT                   RIAYILIRRIIV"
FT   CDS_pept        265471..266256
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535371"
FT                   /orf_name="CD36_61410"
FT                   /product="Integral membrane protein required for mating,
FT                   putative"
FT                   /protein_id="CAX41070.1"
FT                   /db_xref="HOGENOM:HBG398569"
FT                   /db_xref="UniParc:UPI000192DDB5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK5"
FT                   /transl_table=12
FT                   /translation="MILPLKFTIVFTIFIQFIAAALLSFLLLGCIDTSSNYSNVYLLSY
FT                   KFNQSSPLYDYLSTTTVSTNSSSSTNSTAIDELLSVKIGYMGVCLSSSQKDISCTTYTQ
FT                   LDSFPKFSISILSGHLDLIQLAQSFSSNICHPRILLTTIILTLINLLLLCYCVIPIVPG
FT                   KSFMKKINTGLSFILLLLWGLGSMLQHQAVISSVEMMHQSSFQLIIGSKGGRAEAMTWT
FT                   AFSFILIVFLSACLSLWMEVRGRIDQKSPKTHPIFDAKV"
FT   CDS_pept        266740..278115
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573534"
FT                   /orf_name="CD36_61420"
FT                   /product="Subunit of SAGA complex, putative "
FT                   /function="binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAX41071.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG330287"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192D2E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK6"
FT                   /transl_table=12
FT                   /translation="MPYTEQLDAFVTRLNESGSDYTKKHSILSELLDTIESFNGATEYE
FT                   YFLKNLVPIFIKDLEQVPISFISSSPQHKLRNSILEIIHRSILNDTFQPFSESILDALV
FT                   KTLVEENEDNGVLCMKIITSLHKAYKNKLNEKVQPFVDIIGSIYDNMDKTVHDVFGDDD
FT                   NNTAETSTDAKEDSPAATTTTTGFNEETPTKKLNKAMFSFKTLAECPITMVSLYQSYKQ
FT                   LVATSLPKFLPKIIHILELQVEKQKQFREESENKIVTSISPEIKNRQSFSDFILGQVKA
FT                   ASFLAYVFIRGYASQHLKPEESKCVPDVILRLLQDCPAELSIARKELLHATRHILSTPF
FT                   RTQFIPKLELLFNEKILIGDGLTSYETLRPLAYSTVADFIHNVRNELTPAQIWSTVNIY
FT                   CDLLKDDSLALTVQIMSAKLLLNLVEKIMKLPNKLEGRQLFLIIIDSYAKRFASLNRKY
FT                   NYIITKHNEFENKKASKERKAKKAIERYSSKIEPEVEEQKSDNANEDMMDIDKPNQDNK
FT                   EEEVSEKPEPPLDMFNIDTHSPIAAIPVSNNTDVLKDARYLFRTLMTFLKSVIFGLKNC
FT                   NPPVPPQPTPSDPNKPGQQVNYDKWNDSAKLIAFEEVNILRALFRGGISCLRFFSITKS
FT                   KPPITNKTIDFSTGGPNLPITSSKEEKDLMEIFATIFIHIDPASFNEIVSSELPFMFES
FT                   MLENAALLHLPQFFLASEVTSANFSGILISFLRENLEQLGEADLIKSNILTRLFKLCFM
FT                   SVNIFPTTNEGVLLPHLNHLILESLRLGTKAEEPIVYSYLVRILFRSISGGRFENLYKE
FT                   IMPILPVLLENLNKMIANARRPYERDIYVELCLTVPVRLSVLVPHLNYLTRPLVYALNG
FT                   SQELVSQGLRTFELCVDNLTAEYFDPMIEPVIDEIMAALWKHLEPVPYHHQHSHTAIRI
FT                   LGKLGGRNHRNFKPCNKLVTQSDLDQEVKALFEIHGLKDSVPVSITPGVESAVKLLEDP
FT                   RLKIHYKISAFKYLANILKLLINTTPIPDNFPQYISESIEFLKQEKIKDIHIELSPSEI
FT                   KDSEKLDRQQQLFSKLLEILFFSVSIPDLKEEASELIDGITTHFTFLRLTTSVIEKVKK
FT                   ERQFSINENEGKAYINENVFFNALNYALSFWDKNVRQKGIDCIKKIYDTTVVIFGSEEN
FT                   ALYSPVFRSMFYKFTHCCYNEYYHAKLGGVLGLKTMFQDLKIPPSWFSKRQFELVRSIF
FT                   FILRDTPETAPFEVRESAKTLVLDLLKACNTDVTKETVTEKSFQTLVGAFVYDLASPTP
FT                   MVREVAQNCLKVLSETTGVGIATMIDPCKHLLLAPIFGKPLRALPFPMQIGNIDAITFC
FT                   LKLPDTFLTFNEELNRLLLEALALVDAEDESLANVHRLSEYRTSKQLIELRVVCIKLLS
FT                   LALTKPDFSLGSLAEARIRILGVFFKALCNKSTEIINAAHHGLAASLQENAKLPKELLQ
FT                   NGLRPMLMNLSDHKKLTVSGLEALARLLELLISYFRVEIGRKLLDHLMAWAQINTLRQI
FT                   AGQDLTNNHTVQIVMAILNIFHLLPAKAYTFMEEIINTLQYLEGHLDRHKDSPFRQPVS
FT                   KFLNRFAENCIGYLIANFKNRKLGNMLAAITGMDGCENLRKISREKLTVFIDDVKNESD
FT                   KEIKIIKFANLVDLIDAISKHEHSWFDEQKPLLLLLSQTVEEISYTRTTAEFSSVHFQS
FT                   DQAIEKLHELIVGFLKRNPKEVDLMFAVVNRDCKLKLQVPAVIEDYLFNNIVSSSEIDI
FT                   REEYLKKTIDFANDDISNLKAKIFFLKKVFNPIFIYESVMRGSVDSFFTSTKPEWLEKL
FT                   DENIWKSTTDIITNHTSGSMDSYRYALLEVTALLLKLASKYIGDLRKDIIKFSWNYIKL
FT                   EDNITKQVAYVTTSYFISVYDTPAKLTTQVFVALLRTHQTDSRYLVKQALDILAPVMSE
FT                   RMNDADSSDNWLKWPRRILSEDGFNVTQVLNVYQFIVQHPDLFFVAREHFVSNIITAMG
FT                   KLTILANPAIENQVLAIELAELILYWERKAKGSKEEVQTIQEDENIEDDKEETIPKEEE
FT                   EEEVKPESDFTTSPNYSIPFGQREACVTFLIRYVCISPQRASESELGQKALGILYDLLS
FT                   PEHWSEVSVKLTFFEKFLLAQDINSSNLLGYCLNALEVLGVVLEWKKPEWIVSNLSYLQ
FT                   KLLEKCIKSDNHDIQEVLQRVLSTILKAITDQKTTEEEDEEEDDVKEFFNLLTTTVTED
FT                   LGDTSSVPAGVTLFWTLAHYKPSTLDNLLPTIMKTFSKLCKDHITMTHQGSQTSTSKDN
FT                   ASSEFEAKMTTRLLEKILKLCASRISNLGDQRRIFLSLLAQLIERSLDKDTLEKIIKIV
FT                   KNWVFSRTDLFPTTKEKAAILSKMMVFEIRGEPTLSKEFYQIIVDIFEDDTFSCTELTV
FT                   RMEQPFMVGTRSVDVSIRRKLMSILNNSLEKDIAKRLYYVIREQNWEYLADYPWLNQAL
FT                   QLLFGAIDFDQEIRLVDEENKLAPVKALSFPESDKMEVDNTSNNNEKLNELLKKHSEFM
FT                   AAAGIIKAGDILEPLIDMFYQSGETIHRTWSSFFPIAFSSLPHSETLDFTRFMVILLSK
FT                   DYHTRQVDMRPNVIQSLLEGVSRCEDLQLPPFAVECLASNFDAWSQGIHILENIDEKLV
FT                   NANVEVREVTEDALAKLYATLKEDDMFYGLWRRRAKYSETISALSFEQLGLWDRAQQLY
FT                   ETAQIKARSGALPYGESEYALWEDHWILCSEKLQHWDILTDLARHEGFSDLLLECGWRV
FT                   ADWYNDRETLDQTVKNVMDVPTPRRQVFETFLCLQGFGQEKETLQDLSRLCDEGIQLAL
FT                   RKWHGLPERFANAHIPLLHTFQQYVEFMEASQVYASLVTTNAQNLDMKSQELKRVLQVW
FT                   RERLPNVWDDINIWNDLVTWRQHAFQVINKVYMPFIPVLQQNSTGSNANSYAYRGFHEI
FT                   AWVINRFAHVARKHNMPEVCIKELTRIYQLPNIEIQEAFLKLKEQVKCHYQNSNELNTG
FT                   LDVISNTNLVYFATQQKAEFFTLKGMFLNKLNQKDEANKAFATSVQIDLNLPKAWAEWG
FT                   MFNDRRFKENPNDMVYANNAISCYLQAAGLYKNGKTRKLLARILWLISLDDASGTLAQA
FT                   FENFRGEVPVWYWITFIPQLLTSLSQKEAKLAKQILIRIAKNYPQALHFHLRTAREEFA
FT                   AQQRHIADLARQQAAQSAAQATQAAAAAAASSSSSPNESNGNNGTNQQSKLNGSSPGNG
FT                   ARTQQSPVSQPQQPQINIPNSIRQPLEHIDEIMAILKTAYPLMALSLESLVDQINQRFK
FT                   CTADEDAYRLCVALLNDGIQYLNKLGNPKEDAKLPTITEANITRFAETVLPKQIRAEFE
FT                   KDLVISKPNLETYISKLRNWRDRLEDKLDRRFSQVNLENLCPHLSEFHHQKFEEIEVPG
FT                   QYLLNKDSNAHFVKIERFLSTIDLARGSSACYKRLRIRGHDGSLHTFAVQFPAARNCRR
FT                   EESVFQLFRIFNDSISRKVETRRRNIQFTLPIAVPLSPHIRIVNDDTRDVSLQKVYEDF
FT                   CKKNGKSRDEPFIYTVEKLRAAYDQRLPKPDIASVKVEILSAIQSLLVPSTVLKNQFIN
FT                   LYSNFEDFWLFRKQFTSQYASFIFTTYMMCINARQPQKIHVNKGSGAVWTSDMLPYRIS
FT                   PRNPNENTQIKQSPIFVNTEQVPFRLTPNIQKLIGETGLEGILSVYVLCIARALLEPES
FT                   DLEQYLTLFVRDEVMSWCLQNDKTALSNEKQLSDIVRLNVESIIRRVMTMGHISSANGV
FT                   ANQHVLELISQAVNPRNLASADSLWMAYF"
FT   CDS_pept        join(complement(278751..278993),complement(278231..278647))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382594"
FT                   /orf_name="CD36_61450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41072.1"
FT                   /db_xref="UniParc:UPI000192D2E6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK7"
FT                   /transl_table=12
FT                   /translation="MVHNVLFDPPLPDGQRINVGNNTIIENLYSIYNLAIFKNIFRTYL
FT                   TFLLIQYILIYICVPLDDIENRPPICIISTAYTLIMFVINASVLPLCSGTIPTILSLRC
FT                   LFSSFILEFISLILNIIAVIQSIQIGPMYEIERERGKVITKTRVDKYIIFFQIISMVFS
FT                   LLSTICVFILMIICEKALEYIGNKVDRRVLKRNKKIRIGTESIDDYRYRLDRYYSV"
FT   CDS_pept        join(complement(280019..280234),complement(279525..279926))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535372"
FT                   /orf_name="CD36_61455"
FT                   /product="Uncharacterized protein YHR100C orthologue,
FT                   putative"
FT                   /protein_id="CAX41073.1"
FT                   /db_xref="HOGENOM:HBG398571"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D2E7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK8"
FT                   /transl_table=12
FT                   /translation="MFNLNLSATLNVSRLLYNPSLCLPHITVKSFDQLVLPFTIPTAPN
FT                   VTIKGIVLDKDNCFAKDHDDKVWPEYEQTWKRLKEIYSKDHLLIVSNSAGTDDDINHIQ
FT                   AKTLESNTGINVLRHSIKKPGCLNEIIQYFAKLNIKPNEIIVIGDRLFTDMVMANMMGS
FT                   WGCWISQGVELSLKILPKLERDLYNRLVVNRPDNPYYPPTPN"
FT   CDS_pept        280512..282653
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248301" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229732"
FT                   /orf_name="CD36_61460"
FT                   /product="RING finger-containing protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41074.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398572"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D2E8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIK9"
FT                   /transl_table=12
FT                   /translation="MSIPQDLKNTTSTTTTTTTTTTKRSRVSRGGSKQNTTSRRGGERG
FT                   KGYKKNINLDENSQSNQQVEEIPEDEQCIICAERIKYAALTPCNHTTCHKCTFRQRSLY
FT                   EKTTCLICRSENDKIIITELINKNYDEIFDNDIIGFNEKYKIKFTKDYIEKDTLSLLKN
FT                   TCSICQETFSEFKLLIDHGKEIHGKYYCLICCKFKKVFKPELPLYTYKQLQRHQIDGDG
FT                   DGNGNETGFTGHPECKHCHGKRFYSEDELNVHIRDRHERCYICDQNNPKTADYYKNYDT
FT                   LYIHFTKVHYVCTVASCIEKRFVVFRDDLDLTAHMLKEHGGITRNGNTNNNNRVIIGSN
FT                   SHHFSQLSTFNEGNSRRNRDRNRDRDHGSAIGWMGEDDEILQQSPEIKKKRFEERAKHY
FT                   LNYNQIKIKEFHSLNNNFKNKNINANELLLIYKRDLFIHQTQEELNILIKEFSEFFPNN
FT                   SELYKDLISIIKDNNNNNNNNNIFEFDSNTPHYEQFPILGGMKANSNIMNSNWVNTRNG
FT                   SSSPSSSSSTTTTINEKFPALSKPTKKNYVNPNNQPIKYTTVLKPQPNKKKTVLNISQS
FT                   SNDYIPNYLNNINKASSFSSSSMPILGNSNSNSINSGGGGSSNSSSLVSSRNNSSTTLD
FT                   DKKFPTLQKKQTKKIIIPRVNQIKVIDPNTWGKQQFQSIKKSTNINNEVDNGNGIEIID
FT                   KRKQKMKRKQDKLLFSNAI"
FT   CDS_pept        284851..285189
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573535"
FT                   /orf_name="CD36_61470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41075.1"
FT                   /db_xref="UniParc:UPI000192D2E9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL0"
FT                   /transl_table=12
FT                   /translation="MNIKITKFINKLKKGYNLFYYSSPLPVLSNGESLIFHLINLIILF
FT                   ISIYYTIFYIPKLLIHSMEKIVYYLTGQHIYIFGLLQTGLKLVNHATHNNNVTTFSSSI
FT                   GSLTNNHF"
FT   CDS_pept        286556..288049
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535373"
FT                   /orf_name="CD36_61480"
FT                   /product="Component of glycosylphosphatidylinositol-
FT                   mannosyltransferase, putative"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAX41076.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG398575"
FT                   /db_xref="InterPro:IPR013233"
FT                   /db_xref="UniParc:UPI000192D2EA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL1"
FT                   /transl_table=12
FT                   /translation="MRQRTTIYNPYSSHDGIIINLNRTNFQLSSIPNYPFIIENKYTIK
FT                   QSQESYENKLYSTIKQLRIQTKFINKSGSPIFSFNYQSGLNIYVVPYFNVDKLKFWKQV
FT                   EQLIEKLLNIKIDQKNWIQNGNSFYYYDIQPIELKEINFNLNSYSNSNSNLNLNSNSNY
FT                   DYIYDEDKIIIRELLTDIEKIEFNLDNSGIYKEIGLFLIDKKITTTNDDLNLSGLRVIF
FT                   DGSNNTEGNDNNDNNKEEQEVVQESIHKTMFHIKPRHRILSSSESNSKIISQGLHHILN
FT                   TKINISLPIDDDIDNIKECKFYYYLNLNKSLIFDQFQDIPIGSKLIINNGNKNLELPEY
FT                   KINQWGNELLFEFNNSILYNDNLEINLTIHSRYQLPKNGNNNDYQFSKIFNSLPKLFIG
FT                   CNINKESNLLDKSPFDTKRDIKIGDNYEIYFTENTVFYHLQQDINTNTNKLLEINIPHG
FT                   KTTFDRINNITTFGLLIGILMILYGILTKIFTIKKLKRD"
FT   CDS_pept        complement(288055..288687)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573536"
FT                   /orf_name="CD36_61490"
FT                   /product="Nuclear import protein, putative "
FT                   /protein_id="CAX41077.1"
FT                   /db_xref="HOGENOM:HBG739096"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI000192D2EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL2"
FT                   /transl_table=12
FT                   /translation="MTTELYGGAITITKLPDSFIDISQIRQVPDTQEVFINQLTSNSES
FT                   FDQSFIIDLLERVDCIDYQEAINLHLQDIVPPNVYNHPIEEKINQDGIIRYFSFVKFIP
FT                   HYNNKKINSNNLESPKQIITLICLIRLENVDTDVLLQYIIPLKDDLDHDNGDDNGDGDG
FT                   EGNADEEEEVSFEKFGSTKVDKIVKESYKLFKEIALSFTIKNWNLFA"
FT   CDS_pept        289052..290236
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573537"
FT                   /orf_name="CD36_61500"
FT                   /product="Glycosyltransferase, putative "
FT                   /EC_number="2.4.-.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX41078.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG332675"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000192D2EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL3"
FT                   /transl_table=12
FT                   /translation="MSKYTTTSSRRSGFRRHIPLILTFTILGLLLTFFGFSSFKGAKDI
FT                   QEVISNLPNDKILGLSNILTTENSKNQGELLIKIEKLHNKYYKDQEERLKKIEKQNNEI
FT                   LQEIHLLKSPPSYASIRDKLTFVYPYDAEVRFPAYIWQTWKHGLNDEKFDEKYREGERQ
FT                   WAYKNPGFVHELFNDDTAHTMVKYLYRQIPEVINAFESLPEVILKMDFFRYLILFAKGG
FT                   VYADIDTYPIQPIPNWIPENVSPLDIGLIVGIENDSNSPNWRSESVRRLQLGQFVMQSK
FT                   PGHPILREIIAQIVLYTKKLEVPELNGNPNAKAISIMKWTGSGRFTDVVFQYLNDYILS
FT                   SIYESINWQHLHNLQVPKLLGDILVLPKMSFSAEDEKNPLSFVKHYGDKIYKQV"
FT   CDS_pept        291531..293555
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382595"
FT                   /orf_name="CD36_61510"
FT                   /product="Azole resistance protein, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41079.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG395756"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D398"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL4"
FT                   /transl_table=12
FT                   /translation="MSNQENLHPYLKRPSIKRPLNLLVRLSANFSEIRLPYLDDVSLPK
FT                   SPLEKDKTIHQCEPVDIKSDYDIEGCTVGRNSFSYELEEIDATSSYYDYDDDDDMKSNN
FT                   ISISQTTLAMSTSTTTATLTEMGNSSTIKNFKPKEYYYEADAGDGTHAIDQYVTGFRLG
FT                   LTLFSCIISLFLVVLDQTIVTTIISDVGNKFKSFDKIGWLTSGYLLPMACLSLLNSKIA
FT                   IIFGRKNCLLMGILIFEIGSLIAALSKNMSMLIGARVIQGLGGGTIQSMISIILTESVP
FT                   ISKRSLSYALLGITYSCSFLGPIIGAAILTHLNWRWCFYINLPIGGTAFIVLLIGFNPP
FT                   KVTGNIKDKLKKIDYMGIFLLTTGLVLILLGLSFGGSKEFKWNSGYIIQNFIVGGFSIM
FT                   AFLIWTFKYSPNPMILSIFIKKFTILCACISAFTNFAVFIALITYLATYFQVVFNKSAF
FT                   KSSIAILPMIVSVVIASMLNGPFIRRTRNVKIPMIISGIFAPVGATLLLMLDKDANNSK
FT                   QIGCQIVIGVSIGLQFQPSLLSAQLELPKDVEGSLIMITVFMSFLKSLGGTLGVIIAQL
FT                   VYNNSVSVNFKNLLNDLDTTSIQYKTISRFNANEIVATPDLLWSAIPDSNIRGLVLDKV
FT                   IVHALKNVYYVSIGLGVVCAIASLWTTNKKVPKDEDVRK"
FT   CDS_pept        complement(293818..295026)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573538"
FT                   /gene_name="EBP1"
FT                   /orf_name="CD36_61520"
FT                   /product="NADPH dehydrogenase, putative "
FT                   /EC_number="1.6.99.1"
FT                   /function="FMN binding"
FT                   /function="NADPH dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41080.1"
FT                   /db_xref="GO:0003959"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D399"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL5"
FT                   /transl_table=12
FT                   /translation="MTVDNEGIAINPLGSTKLFQPIKLGTNTLSQRIAFAPSTRYRATK
FT                   DNIPTDLQLQYYSERSQYPGTLIITEATYTSRQGGLSPFVPGIYNDTQTKSWKKINNEI
FT                   HANKSFSSIQLWYLGRVANPKDLKNARLSFVAPSTVYWNEESEKLAKEVGNELRALTEE
FT                   EIDHIVEIEYPNAAKHAIEAGFDYIEVHSAHGYLLDQFLNLASNKRIDKYGGSIENRSR
FT                   LLLRIIDKLIDIIGADKLAVRLSPWATFQNVKVEGEEIHKYIIDQLQERANCGNELAYI
FT                   SLVEPRVQASWDIAKENQIGSNEFVLKHWQGKVIRAGTYAHELNKINEDINNDRTLIAF
FT                   SRFFISNPDLIKRLHDGISLTPYERATFYNHDNYGYNTWLKHGENKVFNEEEERGRLGK
FT                   PLA"
FT   CDS_pept        complement(295404..296645)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229733"
FT                   /orf_name="CD36_61530"
FT                   /product="NADPH oxidoreductase, putative "
FT                   /EC_number="1.6.99.1"
FT                   /function="FMN binding"
FT                   /function="NADPH dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41081.1"
FT                   /db_xref="GO:0003959"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D39A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL6"
FT                   /transl_table=12
FT                   /translation="MTNSSPLKDSLVFQPIKVGDKTLSNRIVYCPTTRFRAAKGNEEPT
FT                   YRHVPSDLMLKYYSDRGQYPGTLLITEATLISNRGGGYDGCPKISTQEETKSWKKIVDG
FT                   VHDKGSFLSCQFWFLGRVGYPKLLKHRKLDYLAPSPIYENETHKTQAEKIGLPLREVTE
FT                   QEIHDIIHKDYTIAAKNAIAAGFDFIELHGAHGYFIDQFLHECSNQRTDKYGGNIENRC
FT                   RFVLELIDHLITIVGAHKLAIRLSPWAEVQGIIEEESPIPTFSYLINELQKRAEQGNQL
FT                   AYLSIVEPRVQGTINADIKTMKGNNKFVGEIWKGILLRAGNYTYDAPEFKEIMADTANN
FT                   RTLVGFSRFFISNPDLVSKLKNNPNSLIKYDRKLFYEQFNWGYNTYGQDQPVDEEKERK
FT                   KFPKIIGNIDEARL"
FT   CDS_pept        complement(297673..298467)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229734"
FT                   /orf_name="CD36_61540"
FT                   /product="Ammonia transport protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41082.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI000192D39B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL7"
FT                   /transl_table=12
FT                   /translation="MSISSEPSNDKTQYSNHSNITSPVQAISYAGEGDEYVILNNKKYY
FT                   RHELMTAFLGTFNPGYAPYPKHEFGNASALGLASFALSAFVLGLYYAGAKGISTPNVIV
FT                   SLAVFYGGLAEFLAGVWEFFNGNTFAFTVFCSYGAFWITFGCMNVPSFAILSAYDEDPI
FT                   MLGNALGFFLIGWGLFTFLMLLLTFKATVVFVLLFTTLDIGFFILAAANMTGNTTCTKV
FT                   GGIFVVISSICGWYGMISGMADRFNSYFTVHPLPIPQFGKKV"
FT   CDS_pept        complement(300219..301055)
FT                   /pseudo
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(302205..303242)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573539"
FT                   /orf_name="CD36_61560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41084.1"
FT                   /db_xref="UniParc:UPI000192D39C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL8"
FT                   /transl_table=12
FT                   /translation="MPASTFTITSTKPISPRPTTIKGTTTTTTTTTTTTTITPDLHYNS
FT                   LTPTPRSTPFTLEQFGFEEYDENESIVSDLDLLLLEQQDFIPTQPPQHHHQPHQPHQPH
FT                   LHVSKPHGNTNTCSPHKILSQYFATELFYANNLLQISNHFINREFDSFSNELILNPTIP
FT                   KTNHLELINQLTIMYNEAMKLIETIEQFNNELDDITIVVDGGGGGGGGYTIHNLQKLKM
FT                   SYNEKLDIYLNVPIHEIIDKIIDGLYQYNLTVEDLLQNENENENENENEQQYETFNKEN
FT                   NIQNIEEQIKLFDKIKIYHEKILSILNLQDEKLTIEKVEKFHNILQYEIIENKDWQIVV
FT                   KLCPL"
FT   CDS_pept        complement(305532..306701)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229735"
FT                   /orf_name="CD36_61570"
FT                   /product="DnaJ-related protein, putative "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAX41085.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000192D39D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIL9"
FT                   /transl_table=12
FT                   /translation="MKTSFIIGILFFCLTSFSIAKKDFYQVLGVEKSASAKEIKSAFRQ
FT                   LTLKYHPDKNPNDTEAHDKFLEIGEAYEVLSDPEKRRNYDQFGDPNGQPQGGGAHFDFG
FT                   DMFGQFFGGHGHGHGHHQQQQRQQPGKRKGDSAQLGLNIPLTDFYNGKIVEFDVEMMND
FT                   CEYCDGTGSKDKQRKICDRCQGTGHITVTHQLAPGMVQQMRMACDQCGGIGKVVNDPCN
FT                   HCHGQGISRGPRHYEIYIKPGQPRDSPHVLEGEGDKNPNWIPGDLIILLKEELDKSWGY
FT                   RRIGSNLYRTEALTLNESLYGGWERKIAFLDNEEPELTLSRDQGVPVSDGEVEVVSGKG
FT                   MPIVTDHDEEERFGDLFIEYKVIIPGGGGAAAAKGKNSNTKRNAEKDEL"
FT   CDS_pept        307552..309153
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573540"
FT                   /orf_name="CD36_61580"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="CAX41086.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI000192D39E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM0"
FT                   /transl_table=12
FT                   /translation="MRFQYNPVIIRYQDKKEIYASSGIHLIIKPNKPSPENVNDNNSII
FT                   DEFFLTINHIPDLSRFQILISENYLPTTDKTVDQVVWYKGKLDKVYDLPFDKFTGFNVF
FT                   PFDSFNHTLQQKINLIKIQCTNINNLSIPMNQFDISENINVGDKINIICQPFILTNSLI
FT                   FQKFKCQSDIIGKLFIKDSIDDNFHYLLSDLKYLDDIHGGIVISKSNEKIIGLVFGNLR
FT                   KLNGDGDLTVIIPIEKVMELIGLPNPTTSFKSSSLSSQIYSSVIQPKINPSRDTNITDY
FT                   VMPLLITDSRGNNTWGSSVLFQNNVLITNQHVIQPYMDDINNGQCVVKPQTTSLFTLGK
FT                   KDKIIVPILGIDLVFIFLNKSIDSKSGSVKNCHQYNQGDSVYSSSFGLIYTGVSGNIQN
FT                   PIKSYGIINQIIKLSIQQDLKQVMNCMLISSSNCWNGSSGGGLFKLKTNEFIGLICSNA
FT                   NIKSPLPFNKNDTIKLDKFEKVPSFSFILPIQIIEYCYYMILCNQDTTQINLEGLINLW
FT                   NLNPQHQDLLLESSKL"
FT   CDS_pept        309871..310401
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248491" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573541"
FT                   /orf_name="CD36_61600"
FT                   /product="Rho GDP-dissociation inhibitor, putative "
FT                   /function="Rho GDP-dissociation inhibitor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41087.1"
FT                   /db_xref="GO:0005094"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG395769"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000192D39F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM1"
FT                   /transl_table=12
FT                   /translation="MTIVTHPDFQIIKLTVTIINDTNKNNVNNTIDHPLIEVPVKDAEK
FT                   IHIVIPNGVQYQFTLYFQVKNKSYNNVHYKQVVKKHGITMRTRELEIGSYDPSPKIEKR
FT                   EEVNEQEEEQEEKEEEQEEEQVVTYIKEFPIDETPSTRFSRGFYYCTSWYYVGDEKDPI
FT                   ITTDWTLEIVAKT"
FT   CDS_pept        complement(310610..314161)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573542"
FT                   /orf_name="CD36_61610"
FT                   /product="Uncharacterized zinc finger protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41088.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000192D3A0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM2"
FT                   /transl_table=12
FT                   /translation="MVAQKKYICAFCARAFTRSEHKQRHERSHTNEKPFHCLHCTSSFV
FT                   RRDLLQRHCRTVHHTNLNPSMLPSNKSLKNPTTTPLDLSNSEGTTTSTKSGSKKNSNSK
FT                   NGAKNDKSTNQNPIINNDDNRSSVGDITNQLPFHVQFNNQLQYQQQPQQQQQYPILQNQ
FT                   GIPMKQSFSMESDQHSLTTFDSPTSSLGVSMTPSGSTNSEITPQQQQQQQQSTKRRKRS
FT                   QENNSNNNTKLITKELNHDLVHLLSITKKLTTLLQHYDNNKVNITDSFLIGYVHIQQQA
FT                   KNFTIFEKMLKDLVYYLNTYHINTLQQQNQFQPSQQQNHYTINHFKIGISYCIVALGFL
FT                   IDHKPNRAIQFFKKSWNLLIRTLIPQYNSNNNLLDQIEILYNLFLLCYVYLQFNLETFD
FT                   INEKHHEHHSYERGEEQEDHQEQVYINNQVILNYLNDISFIIASNLKDVATNNLIDHNL
FT                   NLFWNIYILLSTYITKEPPKIHQILLNKNLKSNDTLTSLMQKFSKSYINMDMDDEQLKL
FT                   VVVAALNNELKLYFNDNVDEFEPENSKTKKDFIYDNRNVLHNAIILINKSINFYNPSTN
FT                   FVSDTKIFELKLFELFKKNLIINSPLKYHELFNNYIFIPQHYYHWQLLTLTLKEINQNN
FT                   VIFNQIHSILTTTTGSNVCFSFIDFENLLKNSFLNYKANPIIINNNLLIISYPIIFLSN
FT                   YLNLDNLMTSTGQMNQLQFINLNIFIIEWYLIMMKVLIIIWDDTLIDFEDNYILQTLMY
FT                   ILLDNKSCLLKRLNIDTSKLEYDVNCERLSFNQKWFWIIKLKFDSIFENWMNFLKNKNH
FT                   NVTNNSNVTNTSTTGVTNTNHDHNDSYLHHFNVNVSNFKFNLNKYLNEYFVTGDFKFRE
FT                   QQQQQQQLDQNDPDQFQSSIGAMAIDEEQDFTTAMQTSQTINSFMPIHNNNNNNNNSSR
FT                   NQIYQQQQQHNHDNPMNNRRDSTNTNENNNLSTSGFISNTNYQGNNGNTIINYNEFQDR
FT                   NYKRSSSITLGILAQTVAENSGIANGGIVSPQLVSQNSSSTMNGNASSSVKAPRSYSQS
FT                   QTLQFSYQAMQSQPQPQQQQHHKHRHRHSQPSMMQQSTSQEGFSQPVPPQLQQHHQSIN
FT                   GNDNGVHNSTYSSYSVYPPPPPILSSMSNTNGHTNSATTTTATATTESTVQSATGITTS
FT                   TTHEPNKADVLLPPIRH"
FT   CDS_pept        317780..319003
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573543"
FT                   /gene_name="EBP1"
FT                   /orf_name="CD36_61630"
FT                   /product="NADPH dehydrogenase, putative "
FT                   /EC_number="1.6.99.1"
FT                   /function="FMN binding"
FT                   /function="NADPH dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41089.1"
FT                   /db_xref="GO:0003959"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192D3A1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM3"
FT                   /transl_table=12
FT                   /translation="MTIESTNNFVVPAGTKQIDINPLGSTKLFQPIKIGKNILPHRIVH
FT                   APTTRFRAAKNHTPSDLQLQHYKTHSQYPGTLIITEATFTSEQGGMDLHVPGIYNDVQT
FT                   KSWKKINDEIHANKCFSSIQLWYLGRVANPKDLKDAGLPLIGPSTVYWNEESEKLAKEV
FT                   GNELRALTEEEIDHIVEIEYPNAAKRAIEAGFDYIEIHSAPGYFLDQFLNPASNKRTDK
FT                   YGGSIENRARLLLRVVDKLIDIVGADKLAVRLAPWSSFLGMEIEGEEIHSYILQQLQQR
FT                   TDNKGQQLAYISLIEPRVIGIFNASLKDQKGRSNEFAYKFWKGNILRAGNYTYDAPNFK
FT                   TLINDLDNDRTIIGFSRFFTSNPDLVEKLKLGKSLNYYNREEFYKYYNYGYNSYDESEK
FT                   QVIGKPLA"
FT   CDS_pept        319731..321434
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573544"
FT                   /orf_name="CD36_61640"
FT                   /product="Uncharacterized membrane transporter protein of
FT                   the major facilitator superfamily, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41090.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG626269"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D3A2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM4"
FT                   /transl_table=12
FT                   /translation="MAILSSSSYKESLNGFPIRKMLIICIIRFAEPLAFTSIFPYIYFM
FT                   IRDFQISKHEQDISQYSGYIASSFAFCQFLFAIHWGKMSDKLGRKPILIIGLLGTSISL
FT                   LLFGFATNYYWALFARCLAGILNGNVAVLRTMIGEIAVEKRHQPLAFSTMPLLFNFGAI
FT                   IGPAIGGSTYLTKPKEKSPYDNDNGDNNNNIYWMDNWDIYQIYQRFLNKFPYALPNIVV
FT                   SLIIWFSLSCGILFLEETHEIHKYRRDYGVDLGDWLLNKIGISIPTRPWHNCNQIIYDN
FT                   DNININETTTLLQEIEGEDVFPEANPDPDPDPESILSPQPPPPPQENNDGESQPLIKSK
FT                   SIVFTPKVIGVIIGNFIISLHSVTYNEFLPIFLASRFQPQSLKFPFQIVGGMELNINYI
FT                   GTLFSSTGIMGILIVLILFPLIDCKLGTIGGYRLSVSIFPLIYLIIPLTIFTLHQYNHW
FT                   FPLWITPSLLYLLTSLKTLASSTGMPQITILNHRVAAKQHRAYVNGASMSFVSLSRFCG
FT                   PMIFGYLMSLGEKYQIGWLIWWIMSGLAVIGMIQSYWIEEEEDDDDDESD"
FT   CDS_pept        complement(327311..331300)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573545"
FT                   /orf_name="CD36_61650"
FT                   /product="DNA polymerase gamma subunit, putative "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="gamma DNA polymerase complex "
FT                   /protein_id="CAX41091.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005760"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG315217"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002297"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="UniParc:UPI000192D446"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM5"
FT                   /transl_table=12
FT                   /translation="MSSKRFLLRRMSNIHRSFVTSLRRRQQQSSSSSSLSSQKFIEKPR
FT                   VNQLGIQYLSNDLHKKVFPTTSTQDYLSPQYPQLLEISKKHLQENELLGKKTQITEPIT
FT                   INNFPPLVGKSMDEHFNKLGQKSSDPYLTMATNFLKKELPSKPSKSQWKFQSGWTRYTN
FT                   DGNPPQQVPYPLEDTLVFDVEVMYKISNYPVMATCASNEAWYGWVSPALLDWGKQINIT
FT                   TDKIDWNHLIPMNCAKKPKVIIGYNVSYDRARILEEYNIKQTKAFYLDGMSLHVATSGI
FT                   CSRQRPKWAKYNKVKKLSQEDVDEIEGTLEEEEEQLSNDTNKVSDYGKLLSDGFQVAVE
FT                   LEVADDPWLLMGAPNSLANVARFHCNIHLDKTDRDYFATEDPNLIIDNFSKLMDYCAKD
FT                   VDATFEVTKKLFPVFIQRVPHPVSFAALRHLGTLILPTTTKWPKYIDSAESLYESNRQE
FT                   VTSTLQQLANDLVAHIKHKNRKKPNYETDPWLSQLNWQLKEARLKKDGTPYKKSAYMTG
FT                   YPEWYRELFKTSKGEEMNLTLKTRITPLLLRLKWEGHPLFWVDSQGWCFKVPFDDDNEI
FT                   SRLTEKKYVQPKLTEEEINQTRDVLLTKGKSYILFKVPHPNGPSSRCTHILSKLYVRNF
FT                   EDGTLTSEYDYATKILNLNNEASYWLGNRNRIKDQFVVYNQLGKNKFFDTIKESKEHSS
FT                   MGIIIPNLATMGTITRRATENTWLTASNAKKNRIGSELKSLIEAPKGYCFVGADVDSEE
FT                   LWIASLVGDSMLQIHGGTALGWMTLEGEKSQKTDLHSKTASILGISRNDAKVFNYGRIY
FT                   GAGVKFATRLLKQFNGNITDEEADKVARQLYDSTKGRTAMTKYLPSKIYYGGTESIMFN
FT                   TLEAIAQQEEPKTPVLGASITDALNVKNLNTNQYMTSRVNWTIQSSGVDYLHLLIISME
FT                   YLIEKYGIEARLAITVHDELRYLVKETDKYKAALLLQISNIWTRAMFCEQLGIKEVPQS
FT                   CAFFSEVDIDHVLRKEVSMDCITPSNPTPIPFGESLNIGQLLLKCQHGDILVDKNIKPL
FT                   TLRTMKYKPRNPIINELDGDLSIIEKIAKIELQTSIDKDEWKKNLYNFIKISRNNKQNG
FT                   KIIKSIDKSQRVMKKKSIIEFDLQQDNKKKKEIKYRKDIPKMKISPTTTTTSSSTVTST
FT                   ISTNSRSINPKNETAIKADKSNTSANILNWESNGKSYNSNNGKIIYRKTSSKINSFNKS
FT                   SNGSTTTTVPQTTINNNRQQIFLQQQRHFKTSTRLQSIMNEDYSLRLPSSPSPPSPRRR
FT                   RWRNPNLISEQKLMVSTDLSIMNMMMKKIELNSRRRRRQEQEQEQ"
FT   CDS_pept        333272..334384
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229736"
FT                   /orf_name="CD36_61660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41092.1"
FT                   /db_xref="HOGENOM:HBG626616"
FT                   /db_xref="UniParc:UPI000192D447"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM6"
FT                   /transl_table=12
FT                   /translation="MSQQQQQQQQSQPEKSPFRSYTKEELYNLLTKLELPVKAKTTKKA
FT                   MVEIIDDFVEKNPEQLNIIEKLLQADDDEEEEEEEDDDDDAIVEVVNIDGEEEVEEEGD
FT                   DDDEEEEEEEEEEEGDDDEEEEEDADEDDDDKDYEAPPPLNLKEWVVDPIIAQSETVIE
FT                   KFYEFTDNVGITYLNQSEKLRDQLSSIVTLNYLQIIIEFLIFIYTFIQLVPLNENNLIH
FT                   QIFHDNIPYLSTITWPSLEISSIFQYKSIITFIIWSITSIIIPSIISYFINFTSRVIEI
FT                   EDDEYLFRIYSFDPFIFALSKILTFYFINNQFPLIEFATYECFISGIFNKILLNIGLYQ
FT                   SFATNNLGTLPYVLGGVNVLIALYAQFEEY"
FT   CDS_pept        complement(335354..338344)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382596"
FT                   /orf_name="CD36_61670"
FT                   /product="Putative uncharacterized protein "
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAX41093.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG448435"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="UniParc:UPI000192D448"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM7"
FT                   /transl_table=12
FT                   /translation="MDHSKVPVFKRPTKLPTREELAAIFTSPKQRKLSSDSTPRIIEQS
FT                   QVSLNLPSLTPTQKNINTSSNSSSSSSSTTRFIQPPHLLPPNGPINNPILNSVPENIIP
FT                   IVHPPAIVSDFFSDLTTDLTNNKLSNQINGILGKFPPPIPPENPSSSSSSSSSSSSSSS
FT                   QHPRSANIVSEDFTLERGGMMVPFIYPPPPIVNPNQLPYSLASYKEKFDNLYYQQQQQQ
FT                   QQTPIKPSKGRPHGKKKSKTPDSFSTTIKSPLSDNNNNNNNNNNITNDNQIYVEAPPLP
FT                   FPPPNYMPYPLSSDKSTLTPSEVFGVFLNANSQLPRVDMVVASAAGSLFDMKSSANKEG
FT                   FNILDYELGKLNGHKHKKQKIGLKGFDQEGTKNDNEIDDGKNRQEQDNQVVEEQEKEKE
FT                   KEKEKEGGEEEEEEEEEVDEDTRNDSETVEELEEGEGEGEGEEQKQKNNQDGEIEDDET
FT                   YFSKIDTKEYYDFYATTDNNKSKSIIDNNKVEINMINPNFEKISSKLSNVKNKPTMEQT
FT                   ITNNRTTELPSPPLPPLSPPPAIDDVYSYPQEAISNLYRLDRNQFFPNNRQTKEISYIS
FT                   GLNHEKRRIELSKSIEIIEDFEIRHRDDLFKVKKYHLLNKLNNLQSSKISFSLMDNNNN
FT                   ENNNENKQFLKIKDDELLNIAQDLSLKRDLELLHLKLLENYELLKNSLNFYQNSHKIYN
FT                   HLNYILINKLEKLKIFFEIQKNLFLEYINNDNNGNNNGNGNIFDINEKESSKLFIGISN
FT                   HDYSNEIKDILKNLIVNDIQQSNNNNSIDSLQLPDLSLSPSSSPPQQQQQSEQQPILIH
FT                   DFMPLITSQEFNLITGELNHKSLKNYVTTKYTTTTTNHNNNINSHNKRMISNSIYEKMI
FT                   TSGSDTNLSDSGSNSTTTTTTTTPNTFKGSKRRGGRRAAATTSNNATTTGTGTGNINDK
FT                   TNQGIINGGSSSGGSNFKENFDHKYSEATLLAKIMKQFSGPQMAKSDELNHDLQLMGIK
FT                   TKWPITK"
FT   CDS_pept        341776..343272
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229737"
FT                   /orf_name="CD36_61690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41094.1"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI000192D449"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM8"
FT                   /transl_table=12
FT                   /translation="MPPKKSISAKLAFQPRQRVFAKMPGFTAWPAFVVPEEDIPEDVLG
FT                   AKKRNNKTPYCVIFIPDGDYYWMSDKGLTELTDENLSNALKEIPLDIKKKMKNLKGKIP
FT                   GKQSSYKQAIAATDGLDYDTFRDFLIELNGAEEEEEEEGEEEEEPEVEPEEEPEEPEPE
FT                   PELEPEPEPIKKQKIIVRSKNNKRDYDDEAEDGDVEESYEDEDSVQLKKQSRNGGRRSR
FT                   ASSVSTKTTSTTATNGRRKRRLTDDNSDNTKGIITNSIDSNNISTPSMKKIKSETSDDD
FT                   NQSHTSSIAASVASASKNKSTISDKEKNHQLWLCRVKLQKTLIQRNQATTPKDTTGLKP
FT                   PTADELSTARLILHRLQDFPITVELLRKSKLHKVLRCIIKDPTLKYPESFKLHDRCQEV
FT                   LDVWKEPIEQLKLEKQLEYEDNKNNPSHHSNSHGHNSDNRKAIHNQDDSEVSGLEQSIP
FT                   ELEAHGKKSEDLKPKKSASITTTITTTTTTTGPPSPPAES"
FT   CDS_pept        join(344654..344668,345442..345903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573546"
FT                   /gene_name="TIF51 (ANB1)"
FT                   /orf_name="CD36_61700"
FT                   /product="Eukaryotic translation initiation factor 5a (EIF-
FT                   5A), putative"
FT                   /function="ribosome binding"
FT                   /function="translation elongation factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="positive regulation of translational
FT                   elongation"
FT                   /biological_process="positive regulation of translational
FT                   termination"
FT                   /biological_process="translational frameshifting "
FT                   /protein_id="CAX41095.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006452"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="GO:0045901"
FT                   /db_xref="GO:0045905"
FT                   /db_xref="HOGENOM:HBG526951"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniParc:UPI000192D44A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIM9"
FT                   /transl_table=12
FT                   /translation="MAEEEHTFETADAGAALTYPMQCSALRKNGHVVIKNRPCKIVDMS
FT                   TSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQEYQLLDIDDGYLSLMT
FT                   ADGDTKDDVKVPEGELGDKLQDEFDEGKDLIVTIISAMGEEAAISYKEAPKGSA"
FT   CDS_pept        348876..350831
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229738"
FT                   /orf_name="CD36_61710"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41096.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398580"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D44B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN0"
FT                   /transl_table=12
FT                   /translation="MSTTIPTSSSLLQATETISHISSSYSSTIPVSTTTSNDFGSQNTT
FT                   IGSTPSTVLFFLALAVGVLIALIFVFFTIRYFVRAKYGVNYIGITRRGLYGYNHNHHFN
FT                   NNNNANQSSNIINEHTFAQIFTTTEVQDQLDYIRQHHYLRGEIIDRRLNQEDGDSSTET
FT                   ARQRQQQQQQRRRRRQRRRRRRRRGGRFARMKKLTAEEVELLFPKKTYHQWLNGGKEED
FT                   VENREDLFCEVKEEEDEHQEHQEQNNNTNGQSSSDDNHNNHNNHNNHNNHNNIDGNVAV
FT                   VVDDENHNCYCQTEDNESSNTLFTARTSDMTNTRNTTTNTNNINNNNDNNDNDEIEMKE
FT                   LNLTEINSKNDSNDSQISLHFDSGSCAICLEMIEDEDIVRGLICGHVFHAECLDPWLIR
FT                   RRACCPMCKRDYLFKRDYQNHNGNNNPSENANNQNQNQNQNQQANNSHNNDVNEDNNND
FT                   DNDNDVDDVDVDVDDDDDDDDLRTIDLDIEEIRNNPSLQMMLQELIPPGERVRILLEDS
FT                   RYRDLNFEERGHEMAKRKYNNIFKIIWWKIMGISKLDFYHWAVLKLIEKYHHDHPEGIE
FT                   SIIESNSPQQNTQQQNIEVEQDQDQDQDQEEAEVEAEADTASNSRNINEVRNSGSMEEV
FT                   SEVSEATRMETVMNRV"
FT   CDS_pept        351532..352878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573547"
FT                   /orf_name="CD36_61720"
FT                   /product="Eukaryotic translation initiation factor 4B (EIF-
FT                   4B), putative"
FT                   /function="nucleotide binding"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAX41097.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG398581"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D44C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN1"
FT                   /transl_table=12
FT                   /translation="MAPPKKNVKMDLGSFLADDTFGGGSWADEEVDLNTIGVSLETSNF
FT                   AGSTAAPIGNVGGSGGINNTTSTGFGNDEFKRERKEFPIPDQPPYRARVSNLPWEVEED
FT                   IVIRHFEDRMQAKDIISDIVLPKDRETGRLRGFAFITFNDRGLLEESLNLSMTEFQGRK
FT                   IYVNVAAPPKGEDGDWRAGRSGSNRRGGEGREPAPELDWGAARNSQAELPPRQRSNRVG
FT                   SGSGPSGESTRPSRRQEAELDWGSARTSRDGLPPQRERSNRTPRKQEPEFDWNTARNTQ
FT                   AELPVRERPQRDNFDGTPRDNSSRQSSKRQEPEFDWSSARNTKANLPPRERLNRTGSNN
FT                   GKKSIEPDFDWKRGQSLPSRNVSRSTGNQRNVKKDEQQNQPQKPQKSHFSVLNVEGEDD
FT                   EDEEQEQEEEQEEQVQKSKQQIDNLQQATSKLTVSEGQEDGEGWEVVRK"
FT   CDS_pept        join(354128..354184,354256..354705)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094279" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573548"
FT                   /orf_name="CD36_61730"
FT                   /product="Subunit of the RNA polymerase II mediator
FT                   complex, putative"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAX41098.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG398582"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI000192D44D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN2"
FT                   /transl_table=12
FT                   /translation="MTSIPNSTQSNDYYLINPEDIYKSPKPTPKDNLIKLYGLIPVTKS
FT                   LTRTNPDGSKGVKLRKSYKNHIQDLPGKHQISPAKPIPPGLLDPLIEQHPDIIKPLDPE
FT                   LLNKALKFDRTPINGIPGFNSSDLAINDQQTLMRGDDMGDDEHGKKIKRKKKIQNGGDP
FT                   KRQHI"
FT   CDS_pept        complement(354835..362559)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573549"
FT                   /orf_name="CD36_61740"
FT                   /product="Uncharacterized mitochondrial protein, putative "
FT                   /protein_id="CAX41099.1"
FT                   /db_xref="HOGENOM:HBG398583"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019439"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniParc:UPI000192D502"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN3"
FT                   /transl_table=12
FT                   /translation="MYINQYINIDKLIFYLSCIIIGWVSFWYIIFKLTGFHLSTITINN
FT                   GISFNGISFHTKRYLISIGSLRFRLWGNSKMTIIDDLTIKLMPNANNNQKQHSQEKRND
FT                   HSFKDPSAPVVNIFPQNRIGKSVVSKLIRHVPKLNLELRQTSIITPSQNKTIIEYLKFT
FT                   TTSKYSKRSNEKITFKAGLYINNVLHHLKTQGDVIKPFQVGGAGFETKFSINFETGVLD
FT                   DLRTRANINDSDFSVFNAIKYYFILQDSQEIEKNDNNKSTLSQAEIDAKQEHKLQRLEN
FT                   AFKVIHAIVSEINLHIENVKISEIPFVTMENNPDFKEYFNDVRPATCLEMMTKSTSFNF
FT                   SRMYSDAAGFEVLFNSKRDRPYHLTCSVQLLKVFFASRVVLPTGQVDNNTDEIINVPNF
FT                   ALTYKTNILDQVVRARGFKNCVVEIYFSASTPILDLDTHQLSSLLYNLVLLKKWKTIKK
FT                   LIKVLKTTPTSSSDSPDDDFDDSEMSKLEIHPGSPHHKEKLNARIWRYLTDYYPRLDIK
FT                   TVVEQPRLVLRHCEPNKNTQILTFSYSLLNFTLSTTETRDYTSSCQLLLPLITYYEKPF
FT                   SDVSDLHGKELVTKQVAHTSYIDIKLEIFKNLTVKLLVDVDKVTLDLTNLDIFTGIHNL
FT                   LLDVTQIAETDLEVGVINKMLNLQFLQLRHELQLRQSSYFKKQAKPTLEQKLFRYLPKW
FT                   LTRVDLNVTYLNIALGSRSVLIPKKDLSRTESPEFDFDFDDDHELKQIDFKFDSLSIGV
FT                   AKNSQKSGESTPSTVASCASSETLTNSNNDAVYWVVNTTLEKLKLSALTDLNGKFSRLL
FT                   EIPSIKTNVSAVFDYYGNNKLITEVKVGNILVDYNRYKLYTLIGSIYLIREFVIAPIKL
FT                   IKSKLNKDLTKFNNNLSPDPNAVHKSPSILDFLHLDFKLDYSDMILCLSKDFKVRLQLK
FT                   AIQAAYRDRTADFSITFLRGLAESPLVANKWCRLLCLDTLKFKTEISSSIKDLNIELDS
FT                   DAVRFIQPHQFVVYKFFDNISITVKLVKHLIALLKDESTKKDLNIVHPNLQRAKLLPFI
FT                   RFKSKSLKFSMEDDPFETELGMIYQLGKVEQRKRLELYNLFETKANASHVDTEDYFDNL
FT                   SRLNRTISNSWIRKVNVYKSKLRNEIIANKEYLLGNEVKLDESLNDDVVTYVYASPLFS
FT                   VYMDKFQLDISKPKFNIDEVANFIYDFGQGVPKNTEYTLLIPMYMALQLGELRMHLRDY
FT                   PLPLLHSPRNKDMDETSFKLNGHLVITEAFVKAIEHMRQIDVPLVPEHKNKHKQLNKFE
FT                   SLVMEKTLASVKLYTDLECVFNSNYPTRIVWGASYNFGIQQMMANFDRFSKPPVDPSTK
FT                   LGFWDKLKYILHGKCQIRTRKSLEVAFKGSRDPYDLFTTAGGFVLSFRKNVVWDINKND
FT                   NSKNYFDITADKLSWYIPNYLAGPLLAWTRSSKNSIYLPNSPNVVNSCFAYYLQDFTGQ
FT                   ADFDHATRVFERNVVNLSGGIHFQVGFLLERKDTNGKRTDEFKPHYEVQLFDPKYCEKG
FT                   HDSYAGFRSQFIHMAISLESTSNSSYNTIHLSPGTFQQFFDWWKLFASNMQLPVRRGKM
FT                   FGEAKESVKFSQHLFTNKFSFTLKSLFIAHVYRDEIVDINNDRIECIGLRAKVDDFMVD
FT                   LHQRKEPATLYHEELSKNEKVMKMNFDLGEVVLSGIDLRVMHVSFLQNLYTQSHSNSSD
FT                   TKSTYNIYDNDHRWFDIMDFQEAFLTSIKDCVRTVDIYPLMYLQRFFYERDTHGGKPEN
FT                   ENAFGKEVIHKCNLGAMNPLETKLNVLNKRLNALQEQVKKVSKTSAPEPVADLKKRILF
FT                   LQKEISTTKAGVKSKMRRTSTLNGMNNSENYHNKFTFYNMLLKWNFNCRNLTLKYIHFV
FT                   KLKSQLRKYLSHQSIETLEKMMDSVNAFNDKDDLSSTSEIIRRFTSEGIRSQASTNKDI
FT                   TSQQKLDNFNTILRETRPDEKVVEDYLIDVIAPQIQLQSEDYPDSVVLISTPSIKGKIL
FT                   SIMDSKNNANQILLETRYGILLKEANVFVLNKEDIVGCPDMLSISNPYGAKSNWPPWLG
FT                   TEITQNGKWAGANNLLIEKLSVMTMCYESEILSSKLSANAQDMEQEEQENDNSDNAKQA
FT                   PLRLGIDMPSVVITSTSSQYFTLYVIIVSLLFYSEPMSKVIHKKIEKMKFSIDFEDLGA
FT                   ITSRLTKMQQHHKLLKLLLNNYSFRQGKLNNEDLNNYLQVNLERGEIASDIYLLLRTLL
FT                   TGDFASDTSNNLSMSWLIRADEIILQILEDDRTPIMDLALAQGMYTRKELESGSNINKL
FT                   HIGTMRGFNLIESARYPDFIKPINENSSQNLIEFSWTMNKSVGGIKIIENVFVNAAPLN
FT                   IKLDEITGDKLMKFITYSNSGNLEDSKIIAVSNEKNKDNIKDNSEEEDYGLITENEGIN
FT                   KGPKFEEMSQSSNMKRSLTMLSSKKSSSSASASGSASSNDEINDNEDVEKMIERSKKYF
FT                   SVVSLNVNAISLEVTLKLNKGFKRILNVNDFRIDLPEFNITNEIVSYRDISKMLQSMIT
FT                   KMILGHVGRLLGNKMKAKKGKSKKIIKKRERIRSISDVRKEIHISSQKVEN"
FT   CDS_pept        join(complement(363352..363375),complement(363320..363352),
FT                   complement(363229..363321),complement(362996..363226))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        365209..367092
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000042487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229739"
FT                   /orf_name="CD36_61770"
FT                   /product="NAD-dependent malic enzyme, mitochondrial,
FT                   putative"
FT                   /EC_number="1.1.1.38"
FT                   /function="NAD or NADH binding"
FT                   /function="malate dehydrogenase (oxaloacetate-
FT                   decarboxylating) activity"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41101.1"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016619"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289821"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D503"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN4"
FT                   /transl_table=12
FT                   /translation="MLKVARPQIRFNSTTAAAAAAKTAQVRTRTVKTPVGIKAAIESLK
FT                   PKATRLSMDGPVECAISGFSLLNSPQFNKGSAFSKEERESFNLTGLLPSQVNSLDEQVE
FT                   RAYRQFSYLKTPLAKNDFCTSMRLQNKVLYYELVRRHIREMLPIIYTPTEGDAIASYSD
FT                   RFRKPEGCFLDINDPDGIDKRLSAYGEDKDIDYIVVSDGEGILGIGDQGVGAIRIAIAK
FT                   LGLMTLCGGIHPARVLPIALDVGTNNDRLINDELYMGNKFPRVRDEKYWDFVDKVIQAI
FT                   KKRFPSSVLHYEDFGVSTGRDLLYKYREELPSFNDDIQGTGAVVMASITAALKYSNRDL
FT                   KDIQVLVYGAGSAGLGIADQITNHLVSHGATEEQARGRIHCMDRYGLITDESTNASPAQ
FT                   LKYADPSSEWDGVDTKSLLACVNKIKPTVLVGCSTQAGAFTEEIVKEMYKHNPQPIIFP
FT                   LSNPTRLHEAIPSDLMKWTDNNALIATGSPFEPVDGYYISENNNCFTFPGIGLGAVLSR
FT                   CTTISDTMISAAVDRLASMSPKMENPKNGLLPRLEEIDEVSAHVATAVILQSLKEGTAR
FT                   VESEEKPDGGFVEVPRDYEGCLKWVQSQMWKPVYRPYVKVEYVSEIHTYQY"
FT   CDS_pept        complement(367300..368385)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229740"
FT                   /orf_name="CD36_61780"
FT                   /product="Arginase, putative"
FT                   /EC_number="3.5.3.1"
FT                   /function="agmatinase activity"
FT                   /function="arginase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="polyamine biosynthetic process "
FT                   /protein_id="CAX41102.1"
FT                   /db_xref="GO:0004053"
FT                   /db_xref="GO:0006596"
FT                   /db_xref="GO:0008783"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG391953"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="UniParc:UPI000192D504"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN5"
FT                   /transl_table=12
FT                   /translation="MKLLVFLTLISLVISINVEEKWGGLWPFQGIATFAHLEHFQCLIE
FT                   SEKQFDIGIIGVPFDTAVSYRPGARFGPRAIRDASQRQNNLRGFNPKALFDPYQSWAKI
FT                   IDCGDIPVTPMDNSAAYKQMSEAFKDLTNKKSLNNTEIPPRYIALGGDHSVLLPHLRAL
FT                   HRIYGPLNVIHFDAHLDTWKPNKYPTSEKNDINHGSMLWKAYEEGLTTKHNIHVGVRTR
FT                   LSGLEDLQDDDEQNFVRIEADDIWLKGPQWVVDKILTTIPKDTATYISVDVDVLDPGFT
FT                   SGTGTQEPGGFLPRELIYLLRSIEGLTVVGADVVEVSPAYDIAEITATNGAQIAYEILT
FT                   SMVKRGNVDKSLVKSVVHVFD"
FT   CDS_pept        368732..370936
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573550"
FT                   /gene_name="ENG2"
FT                   /orf_name="CD36_61790"
FT                   /product="Endo-1,3-beta-glucanase, putative "
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAX41103.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI000192D505"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN6"
FT                   /transl_table=12
FT                   /translation="MGLRDLKNVFKRKEYDRPPAPPPPGSQPSEETNRDSNPAPTSIQP
FT                   VNGKDILSNPIATGEPPSLFKKVKHQQQPIGCCCDEKDAPIHTNNFYNNLTTGDQTMPI
FT                   WPLPYSMWYTIDPDQDHGLAFNHTDASQRVFGPEPDAPVAQYYFNPPKIKSFVLSAENF
FT                   DGNKLTLSDHRALSVTATLQKGDSKIILPIVQGMGFITAIYENAKPVIASQVGVQEFKK
FT                   QDKIGNVQKYTAMLFNQVTWSVYSTSELSLKDPNHIVGNGPGIIQIARGDSKYYDDTAG
FT                   GYIDHAELSASADGDTGEYKFSYTIKGQSRSGKTLVWALPHHQEVITNVKATDLNLDSP
FT                   TKGVMKSYVTNELVMQEQLPVDIMWDPWATFATKANYSDNAKEIIKQAAIEEVKQDVVG
FT                   MADIDSMYTSGKILDKFAHIAYVCHFILQDGSLTNEVVPKLKQAIEIFAQNKQKFPLVY
FT                   DCSWKGLISSAEPGADFGNSNYNDHHFHYGYHIHAIALLSHIDQNWLHANNDLIFNYAN
FT                   TLIRDIASPQADQYFPQFRSFDFFHGHSWAHGIFPSGDGKDNESSSEMYHFARAIKLYG
FT                   NVIGDKNMQQRGDLMLAIMKRSVNMYMLYTSDNKIEPPNFIGNKVSGILFENKIDYATY
FT                   FGRGTIGDEWIHGIHMLPITPVSSYFRSSKFVKEEWDEKLGAIVDQIPDGWKGILMLNK
FT                   ALFDPKSAWDWFARKDWDPVLIDNGMSRTWSLAYIAGIMN"
FT   CDS_pept        join(371535,371986..372380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573551"
FT                   /orf_name="CD36_61795"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41104.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG497568"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="UniParc:UPI000192D506"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN7"
FT                   /transl_table=12
FT                   /translation="MATSIPHPKIVKKYTKKFKRHHSDRYHRVAENWRKQKGIDSCVRR
FT                   RFRGTIPQPNIGYGSNKKTKFLNPAGYKVYLVKNTKDLDVLLLHTKSYAAEIASSVSSR
FT                   KRVEIVAKAKKLGVKVTNPKGKLNLEA"
FT   CDS_pept        complement(372690..375134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248311" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382597"
FT                   /orf_name="CD36_61800"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41105.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG398586"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000192D507"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN8"
FT                   /transl_table=12
FT                   /translation="MTKEHSIRNIFKKDKTPDTASTTSTASASHTGLSKLFHKESKPIT
FT                   PPIKRTPSISSLKRRNTNPTQTSGISLNNHNHHHHQDSQNNNDTATNGNTHSSSKPVNR
FT                   SRSNSDRLGHVPPTGRKVLSKAETFAHLQQLDTRNAAKQQLRNHRVPSNHLSSPLSAAP
FT                   HSDKIVYNPYGLNKTATQERPKNTSFYLSGVNDGERVLSNPVASPNDYLPAELHQQHVN
FT                   LLEDFEIDVHTKKLGDGGSSDVRIINSCHHKKDLYALKKFTLLSKETDEDFYKRVSEEY
FT                   KIHRKAAISRHVVNAFAILRIQSQSNLTRGWGMVMEFCGGGDLFSLIVKPGWKSTPLVE
FT                   KYCLFKQIAYGVKFLHDHDIVHRDLKPENVLLDANGLAKLCDFGVSEFGHEIPEDFSSP
FT                   VKLSTAYVGSPPYAPPEVMLLKEKSATEIKAFAYDPFKMDCWGLGMLLFCLVYGGVPFQ
FT                   QSSPNDHAFRDYKFSHKRFCTDHHNFKSNQGYPRGPGSEFKLAAKFENNGASRVAWKLC
FT                   DPSENTRYTMDMLFDDPWFQSVEMCIYESLDQEVNPFVLPGTGENIDTHSVSGYSSVNN
FT                   SQAPSRRGTFTSRPIGSGAGSGYNSHDESSNGLSSSFRSMLDLKDVQQKITRTDEPIPS
FT                   NSSVHSNESSSARTKSKLDHPSSPGSLLSPGTPTLQSIPADRVAQTTSPINASLPAVEE
FT                   SDIEHESESDIQPDETENSGLQILPPIDDVVVASPSSLTHEPQEQEVLDSAESCISLPP
FT                   NRDQVFAGKDGEMCSLADLRPAALKSATDLQLSADGMCDLGYKIKKHHHTEVSNVSNSS
FT                   RR"
FT   CDS_pept        complement(378698..379510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535374"
FT                   /orf_name="CD36_61820"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="CAX41106.1"
FT                   /db_xref="HOGENOM:HBG398587"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI000192D508"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIN9"
FT                   /transl_table=12
FT                   /translation="MKVVFTFFNLFFLAGTVLLLIFTVLSGSSKHFPLNKFYWLEADTS
FT                   GIKNAPADRSAWTFWGVCDKADYSNCLLGPAYPLSPEDNFGTTDNIPTDFIDNENTYYY
FT                   LSRFAFAFCLIALAFSGLAFIIDILGFCFEIIDKVVIFLITIGLLFLAGFASMQTAVVV
FT                   LAKNAFKNDNKYAHIGAKSMGIMWAAFACLLICWLLIFAGTISNSYKKHIARVKAEQGN
FT                   YSQPTHGPAGDESSFTRAAPPTKEDENTGGIRFFKIKRNQKVSDDESV"
FT   CDS_pept        join(380518..380580,380580..380639,380641..380703,
FT                   380705..380824)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(380988..382781)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382598"
FT                   /orf_name="CD36_61830"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX41108.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG398588"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000192D509"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP0"
FT                   /transl_table=12
FT                   /translation="MTLEKNKQVKRGTCWTRIIYKFVVGVITVAVLFIFITQTQILQMQ
FT                   NKLRVEQQTLTNDHDTLQLKHIFHHGTGPKNYRLHRRLDITPEYLAKHEPYFTTLTQQL
FT                   SEPGLEETIKSDNLDEIYQQSDWPEIHKGKNPFSIELPFRKTDSEATRLKERNTPNFIE
FT                   SYLNYARDIKGNAQILNRINLDWIHDEIKVPNVTDRDTVVTLATISSNAYVRYPKDDDE
FT                   KKKSDWIDLGDWDPNREDGDINFGWEDIGLRGHVFVSKDNKTVVIGIKGTSGAGLPGGG
FT                   SDETGGNDKTNDNLLFSCCCARISYMWTTVCDCYEKTYTCNQDCLERELRKEDKYYQAV
FT                   LELYRNVTDIYPPESTDIWVTGHSLGGALASLLGRTFGLPAVAFEAPGEMLATRRLHLP
FT                   SPPGLPQHMENIWHFGNTADPIYMGVCNGASSTCNLAGYAMETTCHTGLQCVYDVVTDK
FT                   GWSVNLLNHRIHTVIDDIILTYNETAPCVPSPPCRDCFNWRFVAHDDNEKDEPKLPNPL
FT                   RSSKSTMSTKKTSLKSSSTNSGSTSTSTVAKTTQTSPISSASPTDQDPPQKCLKRTWYG
FT                   WCTKWGYDDNNDDDDGSSKRR"
FT   CDS_pept        complement(383082..383969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078297"
FT                   /orf_name="CD36_61840"
FT                   /product="Bud site selection protein, putative "
FT                   /protein_id="CAX41109.1"
FT                   /db_xref="HOGENOM:HBG661459"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="UniParc:UPI000192D50A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP1"
FT                   /transl_table=12
FT                   /translation="MKSLLSISSHVVHGYVGNRATVFPLQYAGWDVDAINTTNFSNHPG
FT                   YGSLSGTASTPEAIQDIILGLKQILDFNNVYDIILTGYTPNAEVLKIIKSEIEQAITKS
FT                   RNKPHWIVDPVLGDNGKLYVKENLIPVYRGIFASGLVELTTPNQFEFETLSGVTIVDWP
FT                   TVKNAIHEFRRLYKVNNIVISSVSINGHLYCVGSSKESIFYISIEQIGCSFNGCGDLFT
FT                   ALLADEYYNEEYVLSPQMLSKVLYRLHKILEFSYNDILKRIGQIPTVVKDIRVVAAKEF
FT                   LTTDYKLDTDVVYL"
FT   CDS_pept        384393..386909
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573552"
FT                   /orf_name="CD36_61860"
FT                   /product="Guanine nucleotide-exchange factor, putative "
FT                   /protein_id="CAX41110.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000192D5B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP2"
FT                   /transl_table=12
FT                   /translation="MAPKDSASIDVGYPIMGIKFLNNKTILVAGGGGEGNNGIPNKITA
FT                   IKSSFKVKDPNRKLQRFREITLPSNEDSPQCIDTAKLVGENKFNVILGCNQSSQLIKSM
FT                   NINNNIRKYEYTNEEHLRFIDAAQFEAEINGDADDYPKIVRLAQSNNVGCFMTSSVPSS
FT                   IYIFNPESLELNYKFIPDKNIEIKDFVLSPNDGNSLCYITSNSINVVATNNTSNVVLSS
FT                   ISIPNLDKQLKGYMLSKVRYINSDELLLAATLAGKKGAVLLRLSIPNKKIIQTQAISNK
FT                   GVIVSMDVSPTKVAVATNDLALTLINLSNLKVLKTFKNLHSWAITSVSFSPSGDKVASA
FT                   SASGTLVVSKISSTGTSGGSGWFLSVFLALIFGIVAIIAAVFPELVTQLTGESSLMDYA
FT                   SFDFAGPVSILAEKYSSIVSQFLETKSTEYSSVESQTLDSTPSVEIPTTESTFLQSVNH
FT                   QDPVIDSSEAEFAVVETTVIEVVVEETLPVESSSVETSIITSEVTEAHIEQSSSVEELH
FT                   VSSTVIESDVVSSIETSSSSVESSEKIPVIESSVEPSSAVESFAVEPPVVEESFSVQSQ
FT                   YSKSTTESQIVQSSVIESVEEESPVTGSTIKESQSVVPPVVESSLSETSSVESYPSEST
FT                   SVESSPTESSFLESSSVKVPSVESLFESSSFIESISVESPSSQSSTVESPSSESLSIKV
FT                   SSVGSPSPDVPTIESAILESSSAETPSAETPSAETSSTETPSTESSSVETLSVESLPTE
FT                   SLSVETPTVDSPSSQSLSVETPSIEVSSVESPSVESHVTESLSSQSSTIESDTVPPPIT
FT                   SSTSKKSRVKRTITKKVTRTIKKDEL"
FT   CDS_pept        387219..388325
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573553"
FT                   /orf_name="CD36_61890"
FT                   /product="Postreplication repair E3 ubiquitin-protein
FT                   ligase, putative"
FT                   /EC_number="6.3.2.-"
FT                   /function="damaged DNA binding"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41111.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG448432"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192D5B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP3"
FT                   /transl_table=12
FT                   /translation="MNLKDITDPSDFKTTKLPALAELDILKRCYICKDLLNAPVRTQCD
FT                   HTYCSQCIREYLLRDNRCPLCKTEVFESGLKRDPLLEEIVISYASLRPYLLRLLEIEKV
FT                   EKQVKDCGESANNSTVNGKKTINNDVDETVRVRYQSIADEQGQAQDETQVNGQTTEVIS
FT                   LLSDDEDNSSDNLVKCPVCFERMELDVLQGKHIDDCLSGKSTKRTPTDILSPKAKRPKQ
FT                   ITSFFKPTIDTKTPSPPASKVSTPTTTTLKTNNTSPSLVVQSTAHKGKPLPKLDFSSLS
FT                   TQKIKAKLSDLKLPTIGSRSELEARYLHYYVIYNANLDSNHPVKESALRQQLKQWEMVQ
FT                   HQPSFGDAEWKGAETGNWKELIARARSN"
FT   CDS_pept        complement(388610..390013)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078298"
FT                   /orf_name="CD36_61900"
FT                   /product="Formate/nitrite transporter, putative "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41112.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG398590"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI000192D5B6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP4"
FT                   /transl_table=12
FT                   /translation="MDDNLYLTTYEAALAVVATAMKKARLRIDVLIINSLMGGMLFTTG
FT                   GMLYDLVRAGFSGINETDPGIINLLQGLCYPLGLFYVVILGVDLFNSNILFFSTALCRG
FT                   AISFLDLFISWFVSWWFNLVGNIFVCYIICYYSDVARTPLMVVGSVEVTVQKAEATFVE
FT                   TLLKAIAGNFYVCLAIFLQLMAKPLHVKFLMMLLPVFTFVAMGFTHSVADMFLVTMGLI
FT                   NGAPVSVGEVAWKVFLPGAIGNIIGGSFFGVVITWYLHIYVVERDRAALNLPQYELRDE
FT                   QPELNQDSRVVRKKNSRMEDEMADASKLNDSEESELIQPPEDFYPTPVYDETSIQSYKL
FT                   THRKTRDSISSLRTTRRSPKNVFPVYGMGAPLKRERTIAGEISTPAEPMDEKSEEEAEY
FT                   IGTRLRKAISNRSKMSDLEANKSHSNNGSRRPTPRSSFSGRSSNVGISKLSGGPDPTDS
FT                   NIDLADIRE"
FT   CDS_pept        join(complement(392399..392476),complement(390899..392338))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229741"
FT                   /orf_name="CD36_61920"
FT                   /product="Transcription factor with zinc finger DNA-binding
FT                   motif, putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41113.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG448146"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192D5B7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP5"
FT                   /transl_table=12
FT                   /translation="MSIPVTKEKKRRSRGGCMSCKKLKIKCNEQKPICEYCRYTKRTCV
FT                   YPILERLKGYRRKTSRSPQKNADEKVPTTYSTTTAISPISLTSTSNKSNNLYVSNNEAP
FT                   DIHPYNYDKLSRDLVLTNSTSMLGITKFELRLLQFFDQECINFFSFGVNKSIHNTWKYK
FT                   VPYLFLESELVRKSMFALSAMGLSTTLDLDVLQSIDADGDDESLVNIYNTNVGESDNIF
FT                   ENTTKYFMETISKTKHIIGSTEDNSDSTSFDNPKTAKELLVSSILVFSYLGVHPHRLLP
FT                   LIDFTREQTDLIQISKGVRYTIMSCAPTILKSDMSALLFFRGIEKMQTPTFEQCQYPII
FT                   QDLRNDVDEFSDGEVGLEVSEELSIIRDVIARLMMCINGCKFFKFPIPLFRFLMLFDDR
FT                   FRDFLYSKHRLALRILYVYSALCSISRFQFYDECNVWKDYMTWYRDYAAENFDKHRNEM
FT                   DEYLYFLVVVEHFHWDDFTNFDKFNPKTEFDRVVQKSKYKKQPLLAS"
FT   tRNA            393009..393081
FT                   /gene_name="tRNA-Ala (TGC)"
FT   CDS_pept        393277..394851
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078299"
FT                   /orf_name="CD36_61930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41114.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000192D5B8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP6"
FT                   /transl_table=12
FT                   /translation="MGGIILLTVLSPIVALAGTILGAMLVVPTLLFKPLFDITLLLTLL
FT                   SPIGVILSPLLIIPALLVKPVFDITVLVTLLSSIVATIGTIFASLVALPTLLVKPVFDI
FT                   TVLFKMFELDSVVLILILIYLIVRRSRENSEPTHNTITNNSSKLLSLPDELFIEIMSLL
FT                   NQLDKMSLSLVNKRLNSLARVSLLRVIYVNNGGPRILIRREFNTLFYLNHTIITEMQFK
FT                   ELLNSDKIHNVKKIEFFSDIVSYKNLELLSKSNVVVTFEHKEGTTLTNLKGKLSANGFS
FT                   VLDVNDFLLKEASTSTNLSIDCSGITVFRKISPKLILKSLKLRHINLANLLLYHNFEPI
FT                   DVKKVFLGFEEKTPSIIPVAKIFKLNKIESLEISFETKPSEVEMSQFMSQLVSLKHLSI
FT                   MSQNFRFDRALNSLEPNSLESFHVIVMGRYDTFSAQIVAEILKNQSESIGRICWSNRRL
FT                   NVRQKTYGLNDFERVYNVDAVAKDQDIAEIRTLFSNGFSHLKNVISNESHYKVDRKDSH
FT                   IDVVLIN"
FT   CDS_pept        complement(394918..395964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573554"
FT                   /orf_name="CD36_61950"
FT                   /product="Formamidopyrimidine-DNA glycosylase, putative "
FT                   /EC_number="3.2.2.23"
FT                   /function="damaged DNA binding"
FT                   /function="oxidized purine base lesion DNA N-glycosylase
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="base-excision repair"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="CAX41115.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008534"
FT                   /db_xref="HOGENOM:HBG690070"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="UniParc:UPI000192D5B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP7"
FT                   /transl_table=12
FT                   /translation="MHDPLLFPVLKDTNEPEKELDKMRKNLTNAVVTSVGRHGKYFWIR
FT                   LHNHNTCNVLLMHFGMTGMVKLRNVQSHLSFMENGGDKKVLEMLERFKYKDSKIEPDAE
FT                   VKQEWPPRFTKFDMELENNEKKLEFAFSDPRRLARVRSLSGLEVSADESLLKLSPLNVL
FT                   GPDYSKPDVPPKELEKFVFGDPDSDNHGRPRLPIDEFSSLVLSKKKPIKSLLLDQAYFA
FT                   GVGNWVADEVLFQAHIHPNEIISSKIPNDLDYIHPVLQKLYDSLIYVCEEAVRVEGDVT
FT                   KFPDDWLMLHRWGKGRKEKRKTPNGLILDHITVGGRTSCYCPALQKLLKAESTTTTATK
FT                   TKRRKIKK"
FT   CDS_pept        396266..396922
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573555"
FT                   /orf_name="CD36_61960"
FT                   /product="Vacuolar protein-sorting-associated protein,
FT                   putative"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAX41116.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG715765"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000192D5BA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP8"
FT                   /transl_table=12
FT                   /translation="MNRLFGTKNTAPKPSLNDAIKGIDERVGSLDVKLSKINSELSTYQ
FT                   QKISRMRDGPGKSALKQKAIKLLRQRKQIEAQKDQLENQSWNMTQASMTTDNLQNTMVT
FT                   INAMKTANKQLKQTYGKINIDELEDLQDEMLDLIDKSNELQEALSTSYDVPDDISESEL
FT                   DAELEALGEEIDFENEMAESGIGAPSYLNDVEPATADKLPTFIDEQPEEAQKIAN"
FT   CDS_pept        complement(396968..397915)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000278064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573556"
FT                   /orf_name="CD36_61970"
FT                   /product="Hexaprenyldihydroxybenzoate methyltransferase,
FT                   mitochondrial, putative"
FT                   /EC_number="2.1.1.114"
FT                   /function="2-polyprenyl-6-methoxy-1,4-benzoquinone
FT                   methyltransferase activity"
FT                   /function="hexaprenyldihydroxybenzoate methyltransferase
FT                   activity"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAX41117.1"
FT                   /db_xref="GO:0004395"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0008425"
FT                   /db_xref="HOGENOM:HBG738842"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000192D5BB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIP9"
FT                   /transl_table=12
FT                   /translation="MKSIHCAPLVRRLVFSRSFHYSKILFQNARGLTSTSESEMSHFNA
FT                   LASSWWDVNGPQRILHKMNLLRMDFIHDTIRQNLKLNENTDDEVYIPPFNVDLLPQGIK
FT                   NKIDEDQEMRRDEILNGSSLTVLDVGCGGGILSESMARLSFVSSVKGIDLSADVLEAAR
FT                   LHKQKDPMLKDKLWYALNAIEDIPETEKFDIVTMFEVLEHVDYPSRVLLEGLKRLESGG
FT                   WLFLSTINRDFVSWFTTIFMGEHVLRIVPVGTHTLEKYINQSEIKDWLQQDLNRKTEFR
FT                   VADTKGCVYLPAYGWKFTSCPDVGNYFMAIQRVK"
FT   CDS_pept        398118..400403
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573557"
FT                   /orf_name="CD36_61980"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41118.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG398593"
FT                   /db_xref="InterPro:IPR008895"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniParc:UPI000192D5BC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ0"
FT                   /transl_table=12
FT                   /translation="MSDSEEGEVFESLIATRSRRSNAGLRLKQLIELEEQSNEITATTQ
FT                   FLTEDDENVNLLFQEDGEDEEFIDEEIDNANLDGIDEESEESGTENENVARKRKHTSSD
FT                   DEGEEDEISNINADEILSDSELSATDSDESEGEKELLKQEKLKKKRLKKQSLIPTIKQP
FT                   SVKSSSMKKKQKRTPLVTADSLLMTNRRSSSRAAAVESKQALVDKLKESEARRAKYVHI
FT                   ERKQQVELTQEERLAEAVETEKANVESLNRFREQEIVKKERQRQLLLSKRMKLHNVIRL
FT                   VSSETFVKPIEEVKDARRQYEQYMKIKKKLGKKKKNQLAEMDFPTRMPFTIDYDSPYQR
FT                   KLLEEKKAQQQQIEIEKLESMNEELHELLKNADEKKNDNNAENAESTQPNNVHEENHNN
FT                   TESDSIKLENNTEEIKADEKEKIAKVNEKAESLLSEATPSDETESTKQQTISDHAVNEE
FT                   LEITNQTEHDILTHDDSSEVKKEEYEQANENEKTLVDSEKPDLQSSITDNPLDETKNTE
FT                   TIKRVKFADEIGESSKEPTPAVESTHPQDEEIFEGPVQRVSRNLIYMIEFDEDEKELRL
FT                   NPSNIKRILFGKQSLLPASRRFKDVKTILKIGKPENPYAVVKDQKQSLFDPASNITEDD
FT                   PMFDDLKKLPKLGVKQDVVEIVEDKEETESANIVLKTEAPTGLYLPNGNKKSCMISGTE
FT                   VKYFDPSTGIPYSSVEAYKILKSIESGHVPWLSLTDESNDTGNVELYLGCRDGSVRHAE
FT                   GVPEGFDG"
FT   CDS_pept        join(complement(400993..401018),complement(400475..400907))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535375"
FT                   /orf_name="CD36_61990"
FT                   /product="Hsp90 co-chaperone, putative "
FT                   /function="ATPase activator activity"
FT                   /function="chaperone binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41119.1"
FT                   /db_xref="GO:0001671"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG398594"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="UniParc:UPI000192D5BD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ1"
FT                   /transl_table=12
FT                   /translation="MVVHNPNNWHWIDKNCLPWSKDYLKENIIDTAYEDDSFRFVVTAV
FT                   DSVSGDCDVTQRKGKVLCIYDMRLQFSLSGAIKKGNDEEEEETISATIVIPEFVHDQGE
FT                   DEYIFEIESASQKSEIRKHFVPILKEKLMKFQPDLLEAHAKDVQHATD"
FT   CDS_pept        complement(401236..402768)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382599"
FT                   /orf_name="CD36_62000"
FT                   /product="Membrane transport protein of the major
FT                   facilitator superfamily, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41120.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192D5BE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ2"
FT                   /transl_table=12
FT                   /translation="MEEIEKEKNKDLLEESTFTDNRDVIESEIINKTSDPYLVTFDGND
FT                   DKEDASRLSRVHKWTIVGIISIGSVCVTCISSSVALATPQIMEHLNVSHEVAILNISFF
FT                   ILGLGTGGCFLSPISEFHGRRIVYIGGLTSMIAFEFLTAFTSNIGAMVFGRFMSGFCGS
FT                   SYMSVASGSFADLFKARKKEGKDANKELSLALILYSVAPFLGPSLGSLISGFINTHLYY
FT                   RWTFYVFIIWSGVLLLAVIFFVPETYEPVNLQRKAKRLRKTTGDDRYYAAADKQTTTLY
FT                   ESVLTSSKRPILLLLRDNMTALLNLYTGFTLAVVYLFFVAFPYIFSTVYHFTISEQGMS
FT                   FLGLVVGMVSTCLISPYFIDKGYVALLGKNNGVAKPEFRFIPLMVGAFVVPIGLFIIAW
FT                   TSYSHIHWIAPIIGSAVYGSGTILVFNSIFAYTVEAYRLYAASAMATNSLTRSVLSCIF
FT                   PLFGLQMYKGLGIQWATTLLALFACLMIPIPFLFFKYGEYLRSRSPYAWSID"
FT   CDS_pept        403664..404293
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248314" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382600"
FT                   /orf_name="CD36_62010"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41121.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398595"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000192D5BF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ3"
FT                   /transl_table=12
FT                   /translation="MSLPFAKEKVDADLEKSMVVDSKNYHLHPTSLAILKKLLFALTIE
FT                   IIISCFVYYYYDRIGLIHPMLAPAMLGCFSGALAQSLNQYFKRKFNLNKIFKFMVWGFI
FT                   NGYFTSAWISILVTRVDNLLYRILLDQSCGTPMFQLIFNILNSLWDQGEVFSSTTRIAF
FT                   FKSLKYSYCFWPFFSIISFIFIPESLMFPSNCLANLFWNLILSKIA"
FT   CDS_pept        complement(404413..406125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000253015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078300"
FT                   /orf_name="CD36_62020"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41122.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG559320"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D5C0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ4"
FT                   /transl_table=12
FT                   /translation="MSTSASSSYLDDETTWDSFNLDPRLLQAIDQLGFSNPTLIQSSAI
FT                   PLALEEKRDIIAKASTGSGKTAAYCIPIVNNLLTNDSTQGIKSIILVPTRELSNQVFQF
FT                   IEKLLIFSNNKINILNLSSSYSDQVLNSLLVNKPEIIISTPAKLIQILEKNEKNIDLTT
FT                   VKNLTIDEVDLVLSFGYLDDLKKLESYLPVKKNLQTFLMSATVNDDLDDLKQRYCTKPA
FT                   ILKLNEDAASQNKLVQYYAKTTEFDKFLLAYVIFKLNLIKGKTIAFVNNIDRGYRLKLF
FT                   LEQFGIRCCILNSELPINSRLHIVEEFNKNVYHLLIATDETNELNEEQDEDDDDEGEGE
FT                   IETKSKKSKKSKFKQDKEYGVSRGVDFRNVACVLNFDLPTSSKAYIHRIGRTARAGKAG
FT                   MALSFVLPLSEFGKHKTASLPSAKKDEKVLRRIVKQQSKNGFEIKPYQFDMKQVEGFRY
FT                   RADDAFRAVTQTVVREARVKELKNELINSEKLKRFFEENPQDLASLRHDKELHPARIQS
FT                   QLKNVPQYLLPESARSDVKNIGFVPFHKNKIHKHRKGKGKGRKKVDPLKSFRK"
FT   CDS_pept        complement(406356..407078)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382601"
FT                   /orf_name="CD36_62030"
FT                   /product="2-deoxyglucose-6-phosphate phosphatase, putative "
FT                   /EC_number="3.1.3.68"
FT                   /function="2-deoxyglucose-6-phosphatase activity "
FT                   /protein_id="CAX41123.1"
FT                   /db_xref="GO:0003850"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000192D5C1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ5"
FT                   /transl_table=12
FT                   /translation="MTESIIINTNVLLFDLDGTLVDSTAAVEKTWENQVNQHNQEFPDK
FT                   FIDLPTLLNVSHGSRTIETFTAYFPELKADRDSVYAWEMGIVQNYGHLGKAINGSVQTL
FT                   ETLNEKNIPWAIVTSANPDLAAFWLDKLFHGVKKPDVFITASDVSKGKPDPEGYCTAFE
FT                   RLKKVYNLDGSSKGVVFEDAPAGIKAGVNGGFTVVGIASTFPKEVLLQAGATYVVEDFT
FT                   KVKINQSGETVQLVLEIL"
FT   CDS_pept        408037..408786
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382602"
FT                   /orf_name="CD36_62040"
FT                   /product="Adenylate kinase cytosolic, putative "
FT                   /EC_number="2.7.4.3"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41124.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000192D666"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ6"
FT                   /transl_table=12
FT                   /translation="MSIEDLKNTVTKLQERIQELEKKAGIIPDVPKSVRMVLIGPPGAG
FT                   KGTQAPNLKEKFCACHLATGDMLRAQVAAKTALGVEAKKIMDQGGLVSDEIMINMIKSE
FT                   LENNQECSKGFILDGFPRTIPQAEKLDSMLEARKTPLEKAVELKIDDDLLVARITGRLV
FT                   HPASGRSYHKLFNPPKKDMTDDVTGEPLVQRSDDNEGALKKRLVTYHKQTEPIVEYYQK
FT                   TGIWSGVDASQKPAKVWSDILKCLGQN"
FT   CDS_pept        complement(408976..410550)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078301"
FT                   /orf_name="CD36_62050"
FT                   /product="mRNA 3' end processing factor, putative "
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAX41125.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG397606"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR021605"
FT                   /db_xref="UniParc:UPI000192D667"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ7"
FT                   /transl_table=12
FT                   /translation="MTDILEAYQQGLSELTFNSRPIIDNLTVIAKENPNVADGIIDLIT
FT                   QRIYKTIPDQKLFALYLLDSICKTIGSPYNILAGNGIFNLYSHVFQLVNETIRNKLVNL
FT                   FETWKISKTRGTNDPLFPKTQLDKIESFLKKAGYPKPKTNSGAMSQQSLVNDINQLIPI
FT                   FENKVRTNPNSKLQDRLKALNQLRLILSSQVMKANELQAIQNQLQNIKEQEISSSSSSA
FT                   SKGGTPIPTPGPTPATTPGLSSIPSVPKVNPAFMIFNDLVLSGLVKKDQEPIPGSKPVY
FT                   SLVFPQNKYVPSAGGLGSNSTLEDLLLSSSSIQRSDYDKLKFTEMVKVSKSSFNNLQDF
FT                   IKNNKPTTKLRDLLYESKPSKCSICGKRFASDKEGADKKRLHLDWHFRINKKLSNKGSN
FT                   VQSRNWYLDDYEWVHFNENDLLEYSTDVKIPDIIQDTDDTVSTESQYVIVPSTETNMNN
FT                   KCLICREQIKATYNDEIGEWCWYNCIRQPGEPRNSRKIVHVSCFNESRKKRARDHDLLP
FT                   HNKREKF"
FT   CDS_pept        411292..412206
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229742"
FT                   /orf_name="CD36_62060"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41126.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG323910"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192D668"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ8"
FT                   /transl_table=12
FT                   /translation="MSPAAHSSSDKKQSGVARVLGSATAGIAEIGVFHPVDTISKRLMS
FT                   NHTKVTSLHELNKVIFRDQASQALGKRLFSLFPGLGYAACYKILQRVYKYGGQPFANEF
FT                   LTKNFKDTYDAAFGPKTGKALMSATAGSLIGIGEVVLLPLDVLKIKRQTNPESFRGRGF
FT                   LKIIQDEGLGLYRGWGWTMARNAPGSFALFGGNSFAKEYIFGLKDYSQATWTQNFITSI
FT                   FGASASLIVSAPLDVIKTRIQNRNFENPESGFTILKNMFKNEGITAFFKGLTPKLLTTG
FT                   PKLVFSFALAQSLIPAFDKLLSK"
FT   CDS_pept        complement(413288..414979)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573558"
FT                   /orf_name="CD36_62070"
FT                   /product="Uncharacterized protein YNL193W orthologue,
FT                   putative"
FT                   /protein_id="CAX41127.1"
FT                   /db_xref="HOGENOM:HBG397605"
FT                   /db_xref="UniParc:UPI000192D669"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIQ9"
FT                   /transl_table=12
FT                   /translation="MAVDFSFAFSHFFLFWFSIIKWLLRKHHKQPSNMRIRRLPKKSEA
FT                   KKVSLPSTATEYLEQGSIDEESGERWLGSDVSKCLRFFNKAYLNYLQAIKLDPKLLDAH
FT                   YNSVRLLLHACQIFKRIPTSHEIAIENASLEVVQNISDIRIAYENSLNSAQRLDQVSND
FT                   LLYNYAIVYLEWLESQQEEEEETGSSVSFEQVVEVYDRVQGIFQNLLNSQLEELERFVN
FT                   DLKSIDSNNIGGGDIYDGNSSSSGDETKQEELTSEEVVQPTDLFETVLSSYKLIQSVYE
FT                   SVSSNDLISSVSQLVSPLLEINDRVANELIIKYSEASHVNSMVSNITLKDVNELKLVKL
FT                   NLLALAETDIFRSLDIWKIDNEIPETLPEKFMVVSDSLQALLDRNDINLSTINSQGTES
FT                   DKDTFWKILTFQNNMLKKAQELLNDQMQSQKKSNLQSEDLGSLIAQISEVVIARADIEL
FT                   QRSSIKNYSQSVNNHSILMTNCKNLLKNAINIASLNGGLRERMMVKVNREQCKLEAVFR
FT                   LCILENKTSVEELDRAMTRNKWVNELPNLKKSGLYDDFGLNKIIIP"
FT   CDS_pept        415157..416827
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382603"
FT                   /orf_name="CD36_62090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41128.1"
FT                   /db_xref="HOGENOM:HBG397604"
FT                   /db_xref="UniParc:UPI000192D66A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR0"
FT                   /transl_table=12
FT                   /translation="MTGNNKSLMHIRSTNALSSLPPVLSILDKNDSTKLDAKYTYDIPV
FT                   VILDFSHLESDQGIIVFTDFSEIGTHTCMKSGKVPYEIFKKDYFIGNTLISKNKLFNSS
FT                   IRRDQYVTLTKMVIERCMSEDQEDDGFIIARFNFDLKIKNNKYLEGYFNHIEIATKDNL
FT                   SDIFEQGLQYEFSEMLRRMKMVCQPDVYNQLRAKFDFSSFEISRKNKYQSEIELESQLP
FT                   DQKRHHLSDRVATNLMSKTIVKDSQRVNFDTQMNQNQERGSVKGPIIEEQASNQPLNLD
FT                   SQLPPMTNGVSPDSMDFSATSTTNIHDLGANMLFNYPGIRKSTTANQNKKKEEKSKGIS
FT                   QMVIPCTPTQSSNETISEVPSFASINTAVASQDLGYQPEMIEPKLEPNSALNLTNISVQ
FT                   PDWSNVTKKYLNRNEHTRIRIKNIHETLDQSESFPENAPYTLKKIRVKGMFPFNPVFIK
FT                   PYGRTWKIAPFKIIAEDIEDKNLTLTIEINNDDEICKFFNIYEIEDVITEMERINSRMQ
FT                   SLLNCKNEVSFNIKRKTRTLPNNYKYSYWTIGSSIGQII"
FT   CDS_pept        join(complement(417838..417844),complement(416973..417394))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573559"
FT                   /orf_name="CD36_62095"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41129.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI000192D66B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR1"
FT                   /transl_table=12
FT                   /translation="MAPTTKASAAKKAALKGVNGKKALKVRTSTTFRLPKTLKLTRSPK
FT                   YQRKSVPHYNRLDAHKIIVAPIATETAMKKVEDGNTLVFQVDIKSNKHQIKSAVKELYD
FT                   VDALYVNTLIRPNGTKKAYIRLTSDYDALDIANRIGYI"
FT   CDS_pept        complement(418195..418842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382604"
FT                   /orf_name="CD36_62100"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41130.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG397603"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="UniParc:UPI000192D66C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR2"
FT                   /transl_table=12
FT                   /translation="MFSGISKLILGKSAISSAYSIPKPFNYQTISRTLSTSTTLASVQR
FT                   VNKNSSMSQLAQKLNKNKTNEKVVYWKLYATFNRHNTRCTLVAVVEDLDFMEKNKDLPY
FT                   NDKVLYYLQLPHKVKYSVTAGQLGFRKSQRQEYEAGFQVSSKMFKTIEERNYIGPHDKI
FT                   ELILKNFGKGREAFQAALLGKEGSKIKNNIVRVSDATVLKFGGDRPKKLRRL"
FT   CDS_pept        420145..421962
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573560"
FT                   /gene_name="PLB1"
FT                   /orf_name="CD36_62110"
FT                   /product="Lysophospholipase, putative "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAX41131.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG397277"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000192D66D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR3"
FT                   /transl_table=12
FT                   /translation="MNLYHLFILLIINYCVATSPTKGYAPGPVSCPSNQLTRSGSQGIN
FT                   PNEQSYINARYPIAKQALSQFLHNAKLQDFDVDSFLAHSNPTIGIAFSGGGYRSMLTGA
FT                   GEISSLDSRTKSNTPVLAGILQASSYIAGLSGGSWLVGSLASNNLISVDDMLSQGLWEL
FT                   THSFLSYYGIEHPIKQVEAWVDVATQVNSKRNANFNVSLTDIYGRLLSYPLLTNTENEG
FT                   DAYLWSDVTSTSSFQSHQIPFPILISDGRAPDTTIINLNSTVIELTPYEFGSWDPSLNE
FT                   FVDTRYLGTKLDNGLPTGQCYNGFDNAGFFIGTSSALFNQAVLSINNANIPSFLKNIID
FT                   DILVDPVLKSNIDVSAYNPNPFFKSSGGNTPISQSKDLYLVDGGEDGQNIPLSPLLHRK
FT                   VSAIFAFDNSNDISNWPDGSSLVKTYERQFSPQGNGVAFPYVPDQYTFRNLNLTSRPTF
FT                   FGCDAKNLTSLTKDIYDVPLVIYLANRPFTYWSNTSTFKLTYDDNERQGMISNGFEIAT
FT                   RSSGSLDNEWAACVGCAIIRREQERQGIEQTEQCKRCFENYCWDGTIYKGAPLGENFSD
FT                   EGLTNSAAEYNSNNVAGINDGGTSILKKA"
FT   CDS_pept        423561..425390
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382605"
FT                   /gene_name="PLB2"
FT                   /orf_name="CD36_62120"
FT                   /product="Lysophospholipase, putative "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAX41132.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG397277"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000192D66E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR4"
FT                   /transl_table=12
FT                   /translation="MLVWQSILLFLVGCVLSKSPTNLYTPGFVQCPQGKLTRSSSDGIN
FT                   SNEKSYIDKRYAIAKKELNKFLHNANMVDFDIDGFLETANPTIGLAFSGGGYRAMLAGA
FT                   GALLALDSRATNASVLGGILQSSNYIAGLSGGSWLVGSLASNDLIPVDQLLRENKLWDI
FT                   SNSLVAYYGLNVVENTAMWARIDVQVQAKQLAGFTVSITDIYGRALSHQLLANFDKQGA
FT                   SFLWSDVTQTTSFQNNEMPYPILAALGREPNTVLMNFNSTVFELTPYEVGSWDPSLRSF
FT                   VDTKYIGTKLDDGVPTSKKCINGFDNAGFFMGTSSSLFNVVLSNLNNMPIPSFLKELIS
FT                   KFTLDPVEKLNIDIAQYNPNPFHKSNNPDTKIARSQTLYLADGGEDGQNVPLLPLVHRK
FT                   VSAIFAFDQSADKDNWPDGSALIKTFERQFSSQGVGTAFPYVPDQNTFLNLNLTSKPTF
FT                   FGCDAKNLTSLTDNIYDVPMVIYLANRPFTYFSNTSTFKLKYSHAERQGMISNGYDVAS
FT                   RLNGELDNEWAACVGCAIVRREQERLGIEQTEQCKRCFENYCWDGTIYKGEPLGENFSD
FT                   EGLTTSAEYYNSNNVAGINDGGTVLVKRDDVSK"
FT   CDS_pept        complement(425672..426787)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246855" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078302"
FT                   /orf_name="CD36_62130"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase,
FT                   putative"
FT                   /function="NAD or NADH binding"
FT                   /function="glycerol-3-phosphate dehydrogenase [NAD+]
FT                   activity"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="glycerol-3-phosphate catabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="CAX41133.1"
FT                   /db_xref="GO:0004367"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0046168"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG586392"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="UniParc:UPI000192D66F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR5"
FT                   /transl_table=12
FT                   /translation="MTTSPYPIETPFRVCIVGSGNWGTAVAKLVAENCAEKPTIFQNDV
FT                   KMWVFEEEIEGRKLTEIINTDHENVKYLPEVKLPANLVANPDIVDTVKDADLIVFNIPH
FT                   QFLSRIVKQIEGKVKPTARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIAN
FT                   EVARGNWSETSIAYTVPDDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALK
FT                   NVIACSVGFVEGAGWGDNAKAAIMRIGIKETIRFASYWELFKIKASSPPNPRTFTEESA
FT                   GVADLITTCSGGRNVKVARYMIKNNVNAFEAEKIVLNGQSSQGILTAKEVHELLTHFNI
FT                   QDEFPLLEATYKVIYENGSVDDFPQLLEGDQ"
FT   CDS_pept        complement(428773..430119)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573561"
FT                   /orf_name="CD36_62150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41134.1"
FT                   /db_xref="HOGENOM:HBG397602"
FT                   /db_xref="UniParc:UPI000192D670"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR6"
FT                   /transl_table=12
FT                   /translation="MDPASCGPSTALQNLSKHAQRDNSLQHQRHQHPQQQGPSIHQFRQ
FT                   GQQIDSRLNADFKQFNSGNDFANSFMNQMNIKPSMQQQQQQQQQHQHQHQHQQPGWVND
FT                   FSNLSIQQQQQQQQHRHQQNQGTKSDWHQQFMQQQSQSNNLQHQSNFQQMTPNYAMGSY
FT                   QMRNGTTTMTPMFQNQTEHQQQHKFEEEQRAFEKQFDLIEKQLQNEPVTTEENINQDEA
FT                   KEEFARIARKAETSMKTIDSHDSEMNEKFQNSQFLKLMSSIGNRKVELEGDKLVTSDSK
FT                   EDIREKGIPETTTTTPIITSSMNSQEAQFRSQGPSNPDSARQMYDQIPRPKPANIAMPH
FT                   PLSGDNIQDQQQESNDPHQNSLPDPLAHIQDGQLSDINDPLTAARIISGGQVQTNDWVE
FT                   DYDTISDAPSGLESNSNHNQNARPFRKGQIVDHHWDEMYRDYRHDDDYF"
FT   CDS_pept        complement(430403..431485)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229743"
FT                   /orf_name="CD36_62160"
FT                   /product="Carbohydrate kinase, putative "
FT                   /function="kinase activity"
FT                   /protein_id="CAX41135.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG622920"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="UniParc:UPI000192D671"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR7"
FT                   /transl_table=12
FT                   /translation="MLRHKSQKELLHLSRQLIQPLLPNFHKGQAGKIVVIGGNEDYTGA
FT                   PFFASHSAALVGADLSHVICEKAAGPVIKSYSPDLMIHPYLMDLNNPHLNLNNSELEKL
FT                   KSLPIEEIIKTNDNAVLNKLIDELILPKVTSLLNRIDIVVVGPGFGRDPLMLKSLIRII
FT                   EEVKVLNLPIILDADSLYLVSLSPKIIANYPKAIITPNVVEFQRIAKALSIDVDLSESN
FT                   KDKLIDQTIEVSRKLGDIIVFRKGEHDLIVKSSKFLINEFTGSNKRVGGQGDTLTGAIA
FT                   TLVNWSNNYILKLWDNQVDLDQEDANLLACFAASSIVRNASSKAFNKYGRSMQTSNIHE
FT                   FLHDSFTELFGDSIYRTSNI"
FT   CDS_pept        432020..432925
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573562"
FT                   /orf_name="CD36_62170"
FT                   /product="NADH-cytochrome b5 reductase, putative "
FT                   /EC_number="1.6.2.2"
FT                   /function="cytochrome-b5 reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41136.1"
FT                   /db_xref="GO:0004128"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000192D672"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR8"
FT                   /transl_table=12
FT                   /translation="MLTHHLSKFATPKFLVPFAGATALSIGLALQYSTSNNYIANETGK
FT                   TFTDSNEWVDLKLSKSIDLTHNTKHLVFKLKDDADVSGLITASCLLTKFVTPKGNNVIR
FT                   PYTPVSDVNQSGEIDFVIKKYEGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFKSIA
FT                   LIGGGTGITPLYQLLHEITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKDQVKV
FT                   HYFVDKADEKKWEGQIGFITKEFLQKELEKPNPDFKVFVCGPPGLYKAISGAKVSPTDQ
FT                   GELTGALKDLGFEKEHVFKF"
FT   CDS_pept        433057..434496
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382606"
FT                   /orf_name="CD36_62180"
FT                   /product="RNA lariat debranching enzyme, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="mRNA processing"
FT                   /protein_id="CAX41137.1"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG605012"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="UniParc:UPI000192D673"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIR9"
FT                   /transl_table=12
FT                   /translation="MKNIIYKYSFVVTTMLNTLKIAIEGCCHGELNTIYNSIPDIKSLD
FT                   LLLICGDFQSLRNKCDLQSLNVPFKYQRMADFHEYYSGKRKAPVLTIFIGGNHECSSYL
FT                   QELKYGGWVAPNIYYLGEFGSIWYKGLQITGWSGIFNYHTFIANHIDMEKLPFDSTTIR
FT                   SVYHQKLSNFLKMYMMNHDMDIVLSHDWPVGIEKYGNLKRLLKLKPFFKDDIQRGQLGS
FT                   PLNKFLIHYLRPRYWFSGHLHVKFEARIVDSVGGNDEKISDPTANSITESNKEEISLDM
FT                   DDEEEEEKDDDNGVGFEEKFYFKQHLNSTKRPRNDLTPQRDVCEHATEFLALDKCGKRR
FT                   QFLEIKTVEVNNTSHPSFINPGKLYYSKRSIAINKVVEKYLNDNRQDFTDLNTKQILNN
FT                   PQLFPLVNELMPIIENEFKSMQKNITDEDFFMVPENFQIVAPTNDECIESKLKYYPNNQ
FT                   TLEYCEKFGIPKPVLCEKSDQ"
FT   CDS_pept        436113..438572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573563"
FT                   /orf_name="CD36_62200"
FT                   /product="Phosphatidylinositol 4,5-bisphosphate effector
FT                   protein, putative"
FT                   /protein_id="CAX41138.1"
FT                   /db_xref="HOGENOM:HBG397601"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192D71D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS0"
FT                   /transl_table=12
FT                   /translation="MPSHNPLVITLPYTFSNQDVPTEIMANRFSAWRSIIKDLVNYFKE
FT                   YSSVQEEIIRQQSRLQQAVGQITNTTTNNNNYNNSTPNSEIEAINNFFLPIGNGSVQDI
FT                   PNALFKFHQKNVVDGSKTLKDINGLIIPKLEELRKDLLVKIKEIKNLQNDFKNNLSKEL
FT                   NDTKSLISQYNQAIELANKLGSTGNFSHITTLHEADSGKSDPYLVKIRLERQLKRQLVE
FT                   ENYLYDAYANLQNAGRQLESIVVLEIQNYVSMFLNLVNEENLNFSQHLLPNISNGFLSK
FT                   ESNFEWDAFIERNLPNVNNHGTVSSGTFIDLNIPKRHLSDFVIKNFDSNLNVAIREGYL
FT                   ERRSKFLKNYTSAWYVLTCSYIHEFKSSDRKKDPQPVMSLPLDSCTVSDHSKNDGKLEG
FT                   VYKFILTSKSHNTLMNKTHKWVFRTNTYQNMIEWFDSIKKMTSLPTPAARARTIEGGNS
FT                   NGNNGTSGKTIASDTTSGNSISRVSSGNTARSPARSLKTVSTNTTSASQAYKHRSLNQA
FT                   SSSHKRLSSTFSQRNNNQSPRLTNMINSDGTIITPVDTDEDSMKRSSRIYQQQKSQQQQ
FT                   QQPQQPQQQGPSTPNQQPGPYHLIPIANQQHQQQQQQFVNPPAGYQYYIPSNAQQGAQQ
FT                   FYDPVQQQYYTITPTVPVNSNSNNNNQQQQQQQQQQPAPQPQYFSTSPLPTPQIIPGSP
FT                   VAPAFGQYFQQPQFVQQKQQQKDGGLPYPTMSRTTSIYNNDDTITDEQIPKPTAQQQRQ
FT                   DQGKDQLGSSLYTGHPNGDRPGQGISQLSNEEVSTLNSNNESNPRTTVQNKEHVGDISI
FT                   EVTPGKD"
FT   CDS_pept        join(complement(439791..439796),complement(438921..439292))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382607"
FT                   /orf_name="CD36_62220"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41139.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI000192D71E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS1"
FT                   /transl_table=12
FT                   /translation="MSLALPVGAVMNCADNSGARNLYVLAVKGTGARLNRLPAAAAGDM
FT                   VMATVKKGKPELRKKVMPAIVIRQSKPWRRRDGVYLYFEDNAGVIVNPKGEMKGSAITG
FT                   PVAKECADLWPRIASNSGVVV"
FT   CDS_pept        complement(440507..443629)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573564"
FT                   /orf_name="CD36_62230"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41140.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397599"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniParc:UPI000192D71F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS2"
FT                   /transl_table=12
FT                   /translation="MMTPRMMSFPNFIREAEQTTRPLDHAFPPLKVEHKYKSVYERAGF
FT                   EVNKGDNSYRNQSDNKSIGSGLKKRNFSNPRIQHGSANNSSSSLPQATTRKAPVPPPQL
FT                   KSDSSDRIVSPTSSSSSKSSKSSSMNSNFTSTHKSNSSHTTLRNTAEFNGGFDQPLTTG
FT                   SSTTTFFGENDLQQKPSNANPISSCDAEPTAANTSVPTKPDNRPVYEQSQIDSNVLSDN
FT                   NNAPISTINEDSSPNRPAFDANNDQFDFSPSPSQSGKNLKHLKLDLNHDNLSDTSSLPD
FT                   VNQHQKFDSSNNTYQSKNPSNNGHSKDSYTQQGYQMQSQPHSQPGSAKSGVKFDPRRQR
FT                   HQPTSATSTKFPAQNSPQYPMTHPQQKSPAPYPATPMRMPGHGSPYPPPPSQQQRNMSP
FT                   TSGHSQQRIVSPVSMHSQQRHMSPTGMHHQQMHNQRSNQPPIPRMGGMHPNPKQPQLPL
FT                   MTLGGQKQPYYPQSPGAPPLRSQHRPYPQPQGNIQGYPPVHHQGIQQQQQQQGYPRPQG
FT                   PPQQTRQRQQTYSQIRDDKLSSALNEFKSDYENHKGSNDSPTTSNTETDLPSSSSSDLD
FT                   LYKSTHAKDSLNNTPEINDYRFSYEATKQQQQQQQQQQQQQQQQEQVKQPAKATTNDPS
FT                   VQFQNFTTQQLAKEGDLNNEYQQFLNQKEIGSSNNYDNRHLSMVSSIISKESNTSNEDE
FT                   IEKELERQLESLKMSGSSINLTKVDSQGNGSNTGTDYGASNTTMVIPKFNIQDVDDDTK
FT                   PQLENLQNELEEETTKPLTISRTNSTFEVEQPVTKSVKFTELQPEAKVTSNVPQPGYPI
FT                   NDSFGIDEDDNDKGDDEYVKPLSPKNHLIEQELQSMNFQIPQTTESPTTLINQTFETTK
FT                   KPLPSGTGPCRACHGSISPDAKGQLRAIYSKTGELSGQWHRKCFQCCYHENQYDGQEGM
FT                   IKCNIQFNKHVQCYVLDDQPYCFQHYHILNNSICQHCQDGIEGECIENELMEKWHLQCL
FT                   KCSNCHTGIRQDYYIVNEHDIICHECKTNNNMGLNVQDRIEKRRTRIYNNV"
FT   CDS_pept        448063..448566
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094286" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535376"
FT                   /orf_name="CD36_62260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41141.1"
FT                   /db_xref="HOGENOM:HBG397598"
FT                   /db_xref="UniParc:UPI000192D720"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS3"
FT                   /transl_table=12
FT                   /translation="MKFATITSIAIVALAQSATALRTVTLKTFGYPPPQYPEVTGKTVS
FT                   AWHEGAGINYLLIAEPATKFTYDEESKHLYFEGGQGPDGPLKWYFTIGDGEPGILQANP
FT                   TDKPTEITIDNLGFITFEGSYNVKGVKNIDDPYNYSKDYYVLAKYDKEAPSDAVPVFFQ
FT                   AIDA"
FT   CDS_pept        450157..451242
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078303"
FT                   /orf_name="CD36_62270"
FT                   /product="Uncharacterized protein YKL098W orthologue,
FT                   putative"
FT                   /protein_id="CAX41142.1"
FT                   /db_xref="HOGENOM:HBG397597"
FT                   /db_xref="UniParc:UPI000192D721"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS4"
FT                   /transl_table=12
FT                   /translation="MENLYTALSISLITDDKRFVIVSDDSNKAIPKFTSMLINTCSFDP
FT                   SQYCVIDLLNVHTTIDLIHQMTNFRDNQYFLKNIIIWQNVQYLTTNQHKSLYKLILQID
FT                   QFGLRGVRGRPIDIAIGNDEIISINRPQLFTIIMALDYKAFHKKLYIYLKEKFWFAVNY
FT                   NNVEEEDEPGKLPPNSQYQENISRLRNSLCDVFISPDIKGYIYSLIVFTRCHRLASLSP
FT                   KSTRLPTMAIDYMHDFCKCLALWKNQQNLNQELFITPAYVKLAFRKIGYWLVDWEYNEK
FT                   FAKDTQSSVLVDDDSNTLNNEIDYQKRLEISMLTGDWYGSDYFFVNEYLKSSKSKLDIK
FT                   SPTGYTNKIIEDVISSVRPPL"
FT   CDS_pept        451740..456755
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382608"
FT                   /orf_name="CD36_62280"
FT                   /product="Clathrin heavy chain, putative "
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin coat of coated pit "
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /protein_id="CAX41143.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030130"
FT                   /db_xref="GO:0030132"
FT                   /db_xref="HOGENOM:HBG317411"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001473"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="UniParc:UPI000192D722"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS5"
FT                   /transl_table=12
FT                   /translation="MSNDIPIDFTELTQLTQLGIPQTSLDFKSTTLESDHYICVRESGA
FT                   QGNTVAIVNLKNNNEVTRKNMTADNAIMHPKEFVISLRANGTTLQIFNLGSKQRLKAFT
FT                   MDQPVIFWKWLDDTHLGLVTQSSIYYWNVFDGTNNGPTKLTDRHHTLNNCQIINFVAEP
FT                   DLNWFAVTGIAQEEGRIAGHIQLYSKSRNVSQAIEGHVCKFASISLSGGVQPTKVFCVG
FT                   NKNAQGQGNMHIIEIDHVDGNPQFQKKVVDIFFPPDASNDFPISLQASNKYGIVYVLTK
FT                   YGFIHLYDMETGANLFVNRITADPVFTASSYNDGTGLITINKAGQVLSVEVSRDKIIPY
FT                   VLDKLSNVPLALALSSRGGFPGAENLFQQQFQTYLNQGDYSNAAKVAASSEQLRTQDTI
FT                   NKLKNITPQPGQISPILQYFSTLLDRGTLNKFESIELAKPVLQQDRKPLFEKWLKEDKL
FT                   TSSEELGDIVKSYNDTTLALAVYIRANVNIKVVSCLAELGQFDKILPYCQKVGYNPDYT
FT                   NLIQNLVRVNPDKASEFATSLLSSPDANLNVEQISDLFFSQNYIQQGTAFLLDALKNDT
FT                   PAEGHLQTKVLEINLLHAPQVADAILGNHMFSHYDKPTIGKLCEKSGLFQRALEHYDDL
FT                   KDIKRVIVHTNVLPSDWLVSYFGQLNVDQSVACIKELLSNNMQQNLQVVIQVATKYSDL
FT                   IGAAKLIKIFEEYKCTEGLYYYLSSIVNLTQDPDVVFKYIQAAARMNQTKEIERVVRDN
FT                   NVYNGEKVKNFLKEFKLDDQLPLIIVCDRFNFVHDLILYLYKNQYFKFIEVYVQSVNPA
FT                   NTPQVVAGLLDVDCDENIIKGLLMSVLGRVPIKELVEEVEKRNRLKILLPFLEKTLEGG
FT                   SNDQEVYNTLAKIYIDSNNSPEKFLQENNNYDTLVVGKYCEKRDPYLAYISYSKGGNDD
FT                   QLISITNENKMYKYQARYLLSKSDIELWNKVLSSDNIHRRQLVDQVISTGIPELDDPEP
FT                   ISITVKAFMENDLPEELMELLEKIILEPSPFSENASLQGLMILTAIKADSSKVSSYIEK
FT                   LDKFDPNEIAPLCIDNGLNEEAFEVYDKFELRSEAMKVLVEDIVSLDRAEQYAEKYDTP
FT                   ELWYQLGTAQLDGLRIPEAIDSYVKSKNPENFAQVIEIAEHAGKEEELITFLDMARETL
FT                   REPVVDGALINAYATLDRLSDMEKFVGGSNVADLEAIGDKLFEAKNYKAAKVLYSNVSK
FT                   YAKLATTLVYLGDYQGAVDCARKASNTQVWKQVNSACIENKEFRLAQICGLNLIIDAEE
FT                   LPELVKTYEYNGYFNELIALFENGLSLERAHMGMFTELAILYAKYSPEKVMEHLKLFWS
FT                   RINIPKVLTACEDAHLYPELIFLYCHYEEWDNAALTMIEKSEVAFDHSSFKEIIVKAPN
FT                   LEIHYKAIQFYMNENPSLLVDLLKVLTPKLDLPRVVRMFVQSDNLPMIKPFLISVLDKN
FT                   NSVVNSAYHDLLIEEEDYKSLRSSIENESNNRFNKLDLAERLEKHDLIFFRQIAATLYT
FT                   KEKKFNRAISILKTDKLWPDLLRTVAASKSKKIAHELLDYFVETGNHECFVALLYTSYE
FT                   FIANDYVVELSWLHNLSNFIKPYEISIAYENQKKLNEVYQDLQKRKESERQQEEEPGVG
FT                   QPLMLTNGPMSYQGTGATGIGYQPTGAGFGNAF"
FT   CDS_pept        complement(456906..457997)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382609"
FT                   /orf_name="CD36_62300"
FT                   /product="Central kinetochore subunit, putative "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41144.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG397596"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniParc:UPI000192D723"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS6"
FT                   /transl_table=12
FT                   /translation="MDSVEVDQINNIEREIDEIKADIALIEKDLTSSQLQKQQLQEEIE
FT                   VLVLEQQKQMQDKTKESPIPDAADEMDIEIPEIIKHNYFDPSIQKYFQHPTPPQSNQLP
FT                   SHENALPTIVSSQLKPINDLELKENVLYENIFRMFGVTAFPINQYLFKNNNDPNEQILG
FT                   LRFDLYSNFTKCFQQPHYCILRKLSFEKNETIFYNWIVYKHTLPSYIPIDEYSKILNES
FT                   NNDNNSNNLFKFAESIQLTLTKTQYKLDKFNQLLRFNKNQFGLDKDEAIFINLDCDLSG
FT                   QRILLNLSHNSKTQIKKTQMMGLELICSNDLIEVIHFTNFPNTINSNQLLICQAILQNS
FT                   KINDLIKNFRKVIQILVKYKVIE"
FT   CDS_pept        458349..461279
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074522" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573565"
FT                   /orf_name="CD36_62310"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41145.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG397595"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="UniParc:UPI000192D724"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS7"
FT                   /transl_table=12
FT                   /translation="MATGSTSNRFPNSYWSIDYITGLNNLKSQSFKSLKQLHELRKLVF
FT                   NYMTYYHANSEFLNKSSIDLFPVESTFLPFEYNPRSVSNTPTTSPYRKRIVSNETTVLK
FT                   HETTMTTAYSEYIDYMSQESTILLNLTSIIDRDVFQDITMYLKYHEPKINQQFSRLDEI
FT                   YNNYLKSYKVIEKLKSRHTEQLRLKEFSQSQVEQTKASQDESVGEEEEEEEEQQQQHSS
FT                   SFEESYADEDLEEEEIDNTFDLNFPLHIGTVVVSSAEELQLIMNQLITKVPITMRKIPL
FT                   PGYKNEIFSSESISKVLLSIPIKGFKPSRLNIEKFGQGLLDLKLMTSSNFFNKKFKSEG
FT                   MWFEWSDLAVYFAEFKSSSAASSVQETSSIGSNTTSTTNKSSAISSPKNGRAKFITDMA
FT                   ETTTRFNAMFNNVRSSILKTNHAEILAEIEDNYNEEILNLQEYKYLLENGLFDLSQYLE
FT                   KFEKMKIEIIYKSLSRLSEILLRFQKEQTTKLEAFSNNFIHNINKSENYLHDFNKAMEH
FT                   FSTGIYFPSVITSDTNVRPTSIRTNYQNLKYQFDLYKDIPLQLQNNFNSDNESLLSIAS
FT                   IPYILYQTIKIIEERSNDNVEDVRKLWMAPIEYQSQWRIKQDIIQLIADYTPDLKNDIS
FT                   NKYLIEQEFCNQVLKHLKAQNTNDVIIFVKNWLLEISDSIIPFVIFDSLMNLYNQENIA
FT                   STDLIKLLSTIPRSNLASLIYFIEYFGNLFALGSIPNYEISDELPEESLLESIEESKIV
FT                   QVSDELNSMDTIGSIPIMHLILRPSTSKNSTGFKPPLDKYKRIMVDILKLDVRTELLKH
FT                   LIEHEIKYKSKKEAEKLQVKKIPVSAPVSVSVSVSESESPQTPPPTKVNSVDKNMPAIA
FT                   QPQPTQPTTQKRPESAEFTLRPFRTRPTPVPSPQSSPKRASFPTFTGALSSSISGGGAT
FT                   GKSLTPPQSQYTTTNQLLPSTSHHTNRGRSLSNSFITPKIEIEFEN"
FT   CDS_pept        complement(461410..462789)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229744"
FT                   /orf_name="CD36_62330"
FT                   /product="Inner membrane magnesium transporter,
FT                   mitochondrial, putative"
FT                   /protein_id="CAX41146.1"
FT                   /db_xref="HOGENOM:HBG397594"
FT                   /db_xref="UniParc:UPI000192D725"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS8"
FT                   /transl_table=12
FT                   /translation="MFPLRSSIARVLPNGSLTKLCLRQLNKSSKLNLNKNKNFDSFNEV
FT                   FIHKTLLSSIKQHNDTDYVRCSIFNSNGDMIQHGKEILKSQFIKRYNLTPRDFRKFNWQ
FT                   RSATGTTTASSSSASSSAGESSSAGTKKSSGSSSSSSSLHPSTSALSLSNSSLGSSSNV
FT                   DIVPNITIRRNSILVQLLNIRALINHDKLIIFDNSSSFQNSQVSSYTHSQFLKDLSQRL
FT                   KSTNLDGLPFEFKALEGILIYIVSNLNMEMKVHNTVLQNIITGLEDSIDRNKLRYLLIE
FT                   SKKIHQFHRKITLIKNCLEDLLENDDELNDLYITEKFQNNSNGTNDGQPRQGTNHEEIE
FT                   MLLENYYQTIDEIVQIVENLKNQIKTTEDLINVVLDSNRNQLMLLGLKFSTGLLSMGVA
FT                   LYVSALYGMNLENFIEEIDGGFEVVTVVSTIALIALLLFSVKQLKKVEKVTMTSLNDQR
FT                   K"
FT   CDS_pept        463265..464950
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573566"
FT                   /orf_name="CD36_62350"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41147.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397593"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D7E3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIS9"
FT                   /transl_table=12
FT                   /translation="MEYTRVNSSEELEVYEEVGRGGFGVVYRGIIKSTNQEVAIKQIDL
FT                   EKDSTDLIEINKEIQIISECHCQQITSYMGSFVKNYKLWVIMEFIDGGSIFELLKPGPI
FT                   IEEKIISFILYEILLALNYLHNQGKIHRDLKSQNILISKTGDIKLTDFGVSTQLSSNFS
FT                   KRNTTVGTPYWMAPEVIVNNNGGHSFKADIWSLGCCCYEMFTGKPPLQSKYPPMRALRL
FT                   ISKCQKNQDFIRLIELNELDISWEFKDFLHQCFIEDPKLRASANKLLKHKFITKHIHDK
FT                   DRIKLLKKLITKKQLWNQQNHIVKTQNYYVPTDIYNNQLKWNMDEQYENENQQMELTKE
FT                   SRDQHSGNTIKFDISSLMLNNKLEDDIEDDVEDDGHEEGKSSPSSEPNDDVIGFFKNDF
FT                   NNILMKIFNKIDNRNQLSRLQYDQLVEMNNLMTQLITNDNIHENGSGTNNNRKILLFQY
FT                   LKYLLKELLKEKNSHINRLILPSSILRNTGTNNNTTNISGNTLVNNNHTTNLMTNFTTN
FT                   GILSSTTTTSTRANHNRTINHTWTKFDEIESSLLDSWINRMEQG"
FT   CDS_pept        complement(464998..466137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382610"
FT                   /orf_name="CD36_62360"
FT                   /product="Subunit of the COMPASS complex, putative "
FT                   /protein_id="CAX41148.1"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D7E4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT0"
FT                   /transl_table=12
FT                   /translation="MGIPILTSDIQQSDLFKVRYTINEPSITFTAIKFSPNGENFACSS
FT                   SNGKIYIYNTTTGKLVTTLSGHTKGISDIVYSPINSNILASCSDDLTIRLWNITQQRCI
FT                   KILRKHTYHITTLKFTQKGNILISGSSDETITIWDIASNGGKILTTLAAHSDPVSSIAL
FT                   TPDDSIIVSASYDGLMRLFDLQTSQCLKTLTNSTFGGHGTATASTNDVLNFPIAKVELS
FT                   PNGQFILNSSLDGKIRLWNYMENKVYKTYQGLNGEKICEKFNCDIKFITRNVNNNNNNG
FT                   ISGDGDEYNNVLIVSGSDSTGLLIWDIQSKQIVYQVDPQMCGKDAILGVDTYNQGEILG
FT                   CCSRDGRITILDMNQKYIDRNENQEPQQKEVESRGETPI"
FT   CDS_pept        466866..467402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573567"
FT                   /orf_name="CD36_62370"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /protein_id="CAX41149.1"
FT                   /db_xref="HOGENOM:HBG328134"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniParc:UPI000192D7E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT1"
FT                   /transl_table=12
FT                   /translation="MDHNHSSNLFRFASIQLPKSAKLRSFGIYLSGALFAIGFWSLVDA
FT                   SIYSKTINASDVHVNFIDWIPFLASSMGMLIVNSIEKSNLMINPNNQTDFTGSGGGHAW
FT                   AARIILFMGFSLLAGGLAGSFMVFILKYLMNHYTFPTLGMGVANIVCNGCVMLSCIFLW
FT                   LSQNIEDEYSYSLAL"
FT   CDS_pept        complement(467942..469165)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078304"
FT                   /orf_name="CD36_62380"
FT                   /product="Protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41150.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D7E6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT2"
FT                   /transl_table=12
FT                   /translation="MPQSSSTFINEYTLPDVVENSSSRASKMTIKEYKRIGEGAFGTVV
FT                   EAMLKYENNSSKGNDGTGSHLLGHFRHHSHNEKDSNSTTSNNSNNNNKDGEWLGPFAIK
FT                   RVPAQTEYKSRELEILRFVNHPNIVSLRFFFDKKSSSDNKVYQNLVMECLPSNLQSEIK
FT                   YYRQSKYTIPYPHMKAYTFQLARAMLYLHGYGISHRDIKPSNILVDPNTVRLKICDFGS
FT                   AKKLEPNQPSVSYICSRYYRAPELIVGCSLYTTKIDIWGLGCVIAEMFLGKPIFQGQSP
FT                   ESQLKEIAKLLGPPPNTFFFKSNPQYRGNMYTTRLFNCSIEERFKQIFSNSPSDAIDLL
FT                   MKILVYDPDVRASPRRVLVHPFFDELKSSQFKVYPRGSSTPIELHLFNFSEYELELLGS
FT                   LKNEFVKS"
FT   CDS_pept        complement(471957..472352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573568"
FT                   /orf_name="CD36_62390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41151.1"
FT                   /db_xref="HOGENOM:HBG397592"
FT                   /db_xref="UniParc:UPI000192D7E7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT3"
FT                   /transl_table=12
FT                   /translation="MSTNSFPILKTPSTSNIQTITRPPSQTKPNLVATRSQTTITQLPL
FT                   SQNHYSTRTRSTTINEINELIKQDYKANKNKSNSTGGKIKLLDDVDLEKQLIETAGGRN
FT                   HVWTFILKLVILTILVLGSGILIFYAL"
FT   CDS_pept        join(474865..474883,475035..475588)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573569"
FT                   /gene_name="SAR1"
FT                   /orf_name="CD36_62400"
FT                   /product="Small COPII coat GTPase, putative "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41152.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000004DF65"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT4"
FT                   /transl_table=12
FT                   /translation="MWIFDWFQDILSSLGLWNKHAKLLFLGLDNAGKTTLLHMLKNDRL
FT                   ATLQPTLHPTSEELAIGSVRFTTFDLGGHQQARRLWKDYFPEVNGIVFLVDAADTERFA
FT                   ESKAELESLFRIEELSQVPFVILGNKIDVPTAVGEMELKNALGLYNTTGKDTGKLPEGT
FT                   RPIEVFMVSVVMRSGYGEAFKWLSQYI"
FT   CDS_pept        476356..478392
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078305"
FT                   /orf_name="CD36_62410"
FT                   /product="Uncharacterized GTPase, putative "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41153.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG610636"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI000192D7E8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT5"
FT                   /transl_table=12
FT                   /translation="MENSNKISLHPEQKKWKAPKGPKPIHHKNKNLIGLGRSIANQRTK
FT                   ENAIQYLPDGEMRFTTDKKEANWVKLRSVTQENALDEFLSTAELADTDFTADKNQQVKI
FT                   IKVGNTSIVNSNGLLTTDEMLAMRQKHMMFENKLTIPKRPKWNKNQSKLEIDRQENLAF
FT                   LNWRRELAQLTENNDLLLTPFERNLEVWKQLWRVVERCDLIVQIVDARNPLFFRSIDLD
FT                   KYVTSLSDSENNKAKNNLLLVNKADMLTRDQRIAWAEYFKLKKINYVFFSAAKANELLE
FT                   KEREELENLQNNTGTSSNAAAVVVEQEETETNESIRILKIEELEKLFMDSAPKFEVDPE
FT                   FPDRKLQIGLVGYPNVGKSSTINALVGSKKVSVSSTPGKTKHFQTIHLSPDVLLCDCPG
FT                   LVFPNFAYTNAELVCNGVLPIDQLREHIPPVSLVCQRIPKFFLEAVYGIHIPIQKVEDG
FT                   GNGEYPTARELLNAYARARGYMTQGFGSADEPRAARYILKDYVNGKLLYVNPPPKEAAD
FT                   DDKNEWILPNLQESRVFNRELYTLNHLPESRQHQIVSAMQHKHIPIDEFNLEKDLIKLN
FT                   FSQHIAAANATGSTGESKDEHNKLTGSNQSQTEAKTLFYGGKQAALESAGDELDREFFA
FT                   MNNISGKFATPFHKKNNSTEKNSNKKHNKKNKKQDKKVRVVGY"
FT   CDS_pept        complement(478479..479132)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207014" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382611"
FT                   /orf_name="CD36_62430"
FT                   /product="Ribosomal protein, large subunit, putative "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41154.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316566"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000192D7E9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT6"
FT                   /transl_table=12
FT                   /translation="MSKITSSGVRENVHKLLEYSTETKKRNFLETVELQVGLKNYDPQR
FT                   DKRFSGTLKLPQVPRPNMTICIFGDAFDVDRAKSLGVDAMSVDDLKKLNKNKKLIKKLA
FT                   KKYNAFIASEVLIKQIPRLLGPTLSKAGKFPTPVSHNDDLYSKVTDVKSTIKFQLKKVL
FT                   CLAVAIGNVEMEEDVLVNQIMMAANFLVSLLKKNWQNVGSLVIKSTMGPSFRIY"
FT   CDS_pept        479513..480625
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078306"
FT                   /orf_name="CD36_62440"
FT                   /product="Ribosomal RNA methyltransferase, mitochondrial,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41155.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG447778"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="UniParc:UPI000192D7EA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT7"
FT                   /transl_table=12
FT                   /translation="MIWNVYKYMPLRKEGGRYLTTTFTTSHLQQLRFKSFRTIDLSFGS
FT                   HDHTNIPDKRKDKIFFYNYDNTSKIKNLDRRFKILNKSQTKILELGFIPSNWLIYIRDT
FT                   VARLHNLSDPEKIHQKCHILGFDILFGSPPIGVSSIQGNIFSKLAHKNIVNHFKEISWT
FT                   QLRDQRQLELDIDPKSYFSREQDESMIIDKQIERIEAGLKNITMSQLKRQQLLSKRDSL
FT                   LPDYRIDLILSDLSKPGYQQSGFYDLTESNPYYRYNNNKGLNHSILQPNKANFEFLDAA
FT                   LLLSCNLLKPGGKFVARLNEIDPYDPETHLLHEKLEKVFNDILEIRNFGHINNNNNETS
FT                   LSIQPPIEKYYICDGKKNDDEYDLNDIFKQ"
FT   CDS_pept        complement(480782..483544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17573570"
FT                   /orf_name="CD36_62450"
FT                   /product="Beta'-coat protein of the COPI coatomer, putative"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAX41156.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG330931"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000192D7EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT8"
FT                   /transl_table=12
FT                   /translation="MKLDVVKQFSTRSDRVKGIDFHPTEPWILTTLYNGKIEIWSYATN
FT                   SLVKSIQVTELPVRAGKFIARKNWIVVGSDDFQIRVYNYNTGEKVTQFEAHPDYIRSIA
FT                   VHPSKPYILTSSDDLTIKLWNWDHNWKLEQTFEGHQHYVMSVNFNPKDPNTFASACLDR
FT                   TVKIWSLGSSQPNFTLIAHESKGVNYVDYYPQADKPYLITSSDDKTIKVWDYQTKSCVA
FT                   TLEGHLSNVSFAIFHPELPIIVSGSEDGTIRFWNSNTFKLEKSINYSLERAWCIGILPK
FT                   SNVIAAGFDSGFVIIKLGSEEPLFSMDSNNKLIYAKNSEVYQSVIKPSSSEGLKDGESL
FT                   NLQQRDLGSIEIFPQTLSHSPNGRYAAVCGDGEYIVYTALAWRSKSYGSALDFVWNSHD
FT                   SSAACPFAIRESGVSVKIYKNFQEYLTLDLIYQADKIFTGSLLGVKSEGCISFYDWEHG
FT                   KLVRRVDLDDDIADVIWSDNGELLAIITTSNLGEISSTVGVKKNNETYFLSYNHELFEE
FT                   ALTNGELDAEEGAESAFEVLYTLPTSESILSGKFIGDVFVYTTGTTNRLNYFVGGEVIN
FT                   LGHFDRKFYIIGYKASDGKLYLIDKSFDVVSWYVNAEVLELQTLVMRGDLEQFATHNVV
FT                   DEESGEEVPDLSTITLDNVSEEYSQLISRFTKTELNQLSRFFEKLGYLALSFSLSQDFD
FT                   SKFQLSLSTGNLKQAYDLLSAQEKENPSLSLANSTKWKKLGDLALTKWNIKLAQESFWL
FT                   AKDYSSLLLLLSSSQNKSQLIKLAEVCEAKGKYNIAWQSWWLVGDVGKCFDLLITSERY
FT                   TEAVIFGKNYGVDSEKLTKAIELWKQTLHKKNKSKVANRLIDNFSNLQTNGSTGAPLID
FT                   LENKQDDEEEKEEEEKIEDEAGASEVQHEEVDKVEAEIQQDDEVTAEDV"
FT   CDS_pept        complement(484013..485842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382612"
FT                   /orf_name="CD36_62460"
FT                   /product="Alpha-1,2-mannosyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX41157.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG525304"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000192D7EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIT9"
FT                   /transl_table=12
FT                   /translation="MYLILFVILVVYVPYKLITTVWPHHLLIPSQNWREKISHVVKYPK
FT                   PIYLKVGTKRSSYRRRLILASENPAFYTNFVNNKLKIDPNDCKNGDEFLNEMSRRDIDD
FT                   PQRRIIYGFFHPYANNGGGGERVLWQAVKATLLADDRNICAIYTTNIEAEPLAILNKAE
FT                   TKFQIDGLDRSRVVFIYLRRFNNLIDGNYWKHFTLIGQLFGGIVLSLEAMYELSPDIWI
FT                   DTMGLPSSYLLVSLSLKIPILAYTHFPILQEDMFGKLKFQKLKDLTKFNFIKFSDYFSL
FT                   GKFFYWSVLYYFYVYLGSKIDIALANGSWTFNHLSKIWVFNTAFGNVLDVLYPPCGTEF
FT                   LIKEANLNKPRSNKLLYLAQFRPEKRHDLLLKEYSSFLSNNFPNVTEVPSAIPTLVFAG
FT                   SCRTADDTATLKSLQEQVAKLDLLRFVEFRIDISYDEVVELLSTCKFGLNAMWNEHFGI
FT                   GVVEYMARGCIPIVHASAGPLLDMIGRNDQEEESLTNWKTEAGFFFKSYDDPDLDPKFQ
FT                   ENTETGYITFELFDTLIQYPTFETLLKELYVNDPALIEDSKLIKMRQIDQTRVAEKFSN
FT                   KAFNKKWIEYINDLNSLEKQYREEKRTKVEKVY"
FT   CDS_pept        486975..488150
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382839"
FT                   /orf_name="CD36_62470"
FT                   /product="Transcription factor, putative "
FT                   /protein_id="CAX41158.1"
FT                   /db_xref="HOGENOM:HBG397590"
FT                   /db_xref="UniParc:UPI000192D7ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU0"
FT                   /transl_table=12
FT                   /translation="MSATVINNGQAKAKTPLKKEELEQIARQLKKKLSKASITAKQSLS
FT                   PTNIKTSTIILPKSSPLKSYIMKNNSNEQSPTNNINNLSSSPINLYSPNGKSPTHIRTP
FT                   AAAFLSCSPLKNVAHADTSAADDMMLDSPTKRRKTSPRKMVLREITPEKPKTESTLKPS
FT                   LELTSTPTKKPESQSQSQSQSPPKDQATTPTMAKRELSSQSSSSQNALLKTPKQNSNGN
FT                   GYNDAEGADLLMYLATSPSPARPYLSNTPRGINKPLPSISQSSQPSQTSTSTANASSSA
FT                   GSGSGAGAGSGANSGASASTSSSASAFLAPPPPVTPKRVINSHSTRTPQNRLTPFFNTL
FT                   NANGLPSQGLALTPTSFNMNDYVTFFTPSPGGAFNKNLLKTPDFHNSLSKK"
FT   CDS_pept        complement(488506..490752)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078567"
FT                   /orf_name="CD36_62480"
FT                   /product="tRNA wybutosine-synthesizing protein, putative "
FT                   /function="FMN binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAX41159.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG628142"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="UniParc:UPI000192D7EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU1"
FT                   /transl_table=12
FT                   /translation="MGFGRILLCACSILYLSTGGRWTVVTLVFVLSILYNKDKHQDEKQ
FT                   LGSSSSAPQPKPKKPSPIYAVDFTSTTSFTSPTTINIPRRVIGSRAKRSPKVFKASKNA
FT                   IQQQQPVLTKTTVDLAKSQIYIFYTTLTGSSQRIAKSLYEKLSGIEKFESPPKLLSLDD
FT                   DVDDLEEYFLKTPQDNCIYLMVLPSYETDSPIDYFLEHLIDTYQDFRIDKYPLRKIIGF
FT                   SVLGLGDSESWNGDKFCYQGKLADKWLGKLGGRRLYPMGQICMKYEGEPKAQEWIQNFA
FT                   SMIVNDSDNDQPFYIDVGSDDIDDSDAEDESVGSDDADTLVDVEDMGDIIRKSGKTSSS
FT                   SFSSGIETKEMVAKGSPTFKSLTKQGYTIVGSHSGVKICRWTKSALRGRGSCYKFAFYG
FT                   IKSHLCMETTPSLACSNKCVFCWRHGTNPVAKSNWRWEVDPPEKVMAGALEGHYQKIKQ
FT                   LRGVPGIQMDRFEEAFRVRHCALSLVGEPIFYPHINEFVGMLHQQHISSFLVCNAQHPD
FT                   ALARLAKVTQLYVSIDAPTKQDLKKVDRPLNSDFWERLMSCSDILRTIQSHQRTVFRLT
FT                   LVKGFNMEDIESYADMVERARPSQIEIKGATFCGSSNGNGNPLTMQNIPFYEECKTFVE
FT                   NLNQELQSRGLDYDIAAEHAHSCCILVADKKFMINGKWHTHIDYPKFFELLESGKEFVD
FT                   LDYVKETPEWAVWGSEGAGFNPEDTKYDRKAEKLKKKAIRDEQAKKLLDQQKSM"
FT   CDS_pept        complement(491281..491583)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574591"
FT                   /orf_name="CD36_62490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41160.1"
FT                   /db_xref="HOGENOM:HBG397589"
FT                   /db_xref="UniParc:UPI000192D7EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU2"
FT                   /transl_table=12
FT                   /translation="MLRREATTIRLSPEDILEYDDSVAQQKQKQEQQSIPSQQNPSDFS
FT                   PHNILQEQINNSSHSIIPDFKEETGSIHQRSRASQQQQQQQLQQSRDERIGIHRN"
FT   CDS_pept        492093..493805
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078568"
FT                   /orf_name="CD36_62500"
FT                   /product="Subunit of SAGA histone acetyltransferase
FT                   complex, putative"
FT                   /function="transferase activity"
FT                   /protein_id="CAX41161.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397588"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="UniParc:UPI000192D8AD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU3"
FT                   /transl_table=12
FT                   /translation="MSTKADQVITLAQVSSLLENPESKKSIVWKEFGNYLDKSVEIEDP
FT                   NPNPNRNPNPNSDSIIIRSEDPCLNSQSTKYIPDCYPEKSYLSQNIAYKICNSCQRPIG
FT                   TKSLPLHYTKCVAMKQKRQQEQQENAASLSNNNNNNPQKKKRGRGGGGGNALVDIDASS
FT                   VDSSRNATPAPNGNGESGSKPGTTRPKKKYKKSQAQKEKEAAAAAAAAAAASAGEKPPK
FT                   KKKATATSAASAASAAASTVASTAATSTVNSQAPSAPKPKPVAKPKGPVDVEKQCGVAL
FT                   PSGGLCARSLTCKTHSMGAKRAVPGRSAPYDVLLQQYHKRNQANIAKSHAMMLQRRENA
FT                   AFNDQSESGNNVTKVLNPDEETEYVLAGVSKNNTIPLERKVIMPVRYRHRFLRAREFYA
FT                   NALIISAHHNQSQNQSSNQSQIQQNNEQTLANQAISGSIGGLQGRCALINIDAKPIDVN
FT                   SPTQTFSAIPGEMYQVRAPSKTIVMTAQHNNMQQQAFQQQLFKFQQQQQQQQQQHQQHQ
FT                   QHQQQQQQQMLWRQRQQQQQQQQQQQQQQQQQQQQQSTTGQLVTNSTEIKKET"
FT   CDS_pept        complement(493940..495676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574592"
FT                   /orf_name="CD36_62510"
FT                   /product="Spindle assembly checkpoint kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41162.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020663"
FT                   /db_xref="UniParc:UPI000192D8AE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU4"
FT                   /transl_table=12
FT                   /translation="MMLPRNSPHHSESSVAYNNNNNNNNNSSNNNGRSLFERKPLAPIN
FT                   REFKISKPQHIKPNTHSHTFTTPTPKTRNHNNINSNRNHQYRNPNLNTSLVFTPTKKSS
FT                   SSSSSSSSSSSSSSSSHSSNLLSSSPFIEEPENQQQSNYTRTTSHYRTTSQYKSKSSIN
FT                   KDVLQHPSIFTTKKTPSNKEMSEPTTNPKRRTTTTTTTATVQNSNNNNNNNNKILNPSV
FT                   PHFSTTTTTTTTTSSSSTSTTTTTSSLYTSPKPQQQQKHQPQQQQQLSLDDFEFGKILG
FT                   KGKLGRVYCVKHKQSGLIFALKVMSKLEIINLKLEKSLRREIEIQSNLYHINITRLYSW
FT                   FHDSINIYLLLEYSLEGELYTHLKKFKRFNNIMASYYIYQITQALIFLHQRGIIHRDLK
FT                   PENIMVSLDNRLKLSDFGWSVQIHPPSNNNNNNNNNNNNNNNNNHNQKKRLTICGTLDY
FT                   LPPEMIESKSHDFSVDIWALGILCYELLVGKPPFESINRNITYEKIIKLDYKYPNHNHN
FT                   NHNNNNHNKFNFDLDPDAIDLISKLLVKDPNKRLNLNQVLNHNWIIKNKPNWSKLKQKN
FT                   YL"
FT   CDS_pept        499848..500420
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574593"
FT                   /orf_name="CD36_62530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41163.1"
FT                   /db_xref="UniParc:UPI000192D8AF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU5"
FT                   /transl_table=12
FT                   /translation="MAIKDRVKRVSKIFTSDSKESLKQQIKDKEEIEPATTTTEAGEAT
FT                   KDATATQAEAEVEAAPAATETETETKAEAKAEPVVEEAPKEVETEIKDVKEGETEEQPS
FT                   PSADITEEVTEPTTEKKEVEAEAEAEAKAETETDAAKEGETETEAAKNAKDEIKDAAEK
FT                   TEKAVKKNEFFKKFISKFKKNSHAAKN"
FT   CDS_pept        503173..504456
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229974"
FT                   /orf_name="CD36_62550"
FT                   /product="Casein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAX41164.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000192D8B0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU6"
FT                   /transl_table=12
FT                   /translation="MDLRVGKKYRIGRKIGSGSFGDIYLGTNIISGEEVAIKLENTKAK
FT                   HPQLEYEAKVYKALSGGVGIPFVRWYGTECDYNAMVIDLLGPSLEDLFNYCNRKFTYKT
FT                   VLLLADQLICRIEYIHARCFIHRDIKPDNFLMGIGRRGSQVNVIDFGLAKKYRDPRTHL
FT                   HIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCRGSLPWQGLKAATKR
FT                   QKYDRIMEKKMTTPNNILCKGLPSEFLEYMNYVKTLRFDDKPDYPYLRKLFRDLFKKEN
FT                   YRYDYVFDWTLYKFQQEKQRAQQGKIVDGDNQDQQQNNQIQNQNQNQNQQAQITAPQAS
FT                   VPVSQQQQQQQIPQHIPTPQQQLPPPQQQQQQQKASVTPQLQQYTDQRLQTQRAVYQSN
FT                   QNYSGSKVTQPQSQPQPQPPQQGNPAWL"
FT   CDS_pept        join(complement(506371..506417),complement(504865..506284))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229975"
FT                   /orf_name="CD36_62560"
FT                   /product="tRNA pseudouridine synthase, putative "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAX41165.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG736083"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000192D8B1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU7"
FT                   /transl_table=12
FT                   /translation="MTRNVLKRNSIQDKSRIEYTPLVDENGQPIPKTPRKPKRKVAVML
FT                   GYCGSGYNGMQVQNDPNVKTIEKDIYDAMTKAGAISLENSVDLKKSGFQRAARTDKGVH
FT                   AAGNVISLKMIIEDPNIINKINDLLPKQIRIWGIQRTTKGFDCRKCCSSRIYEYLLPTF
FT                   SLLPPKPKSILSELIKEKKLKNPELFEDDQEGIDWWENVKMKILQSGITQEQIDSITSS
FT                   YNDNDEQQVTGDEKDGERELSFTKLIKQIKTIENQSRRSYRISSIRLNQFREVMKQYEG
FT                   THNFHNFTIGKPFKDTSANRFIIKTLISDPFVIEGTEWISIKIHGQSFMLHQIRKMIAM
FT                   ATLIIRLNLPSNIINNFFQSKKINIPKAPALGLLLENPVFDGYNIKLTKSDYQPIDFTK
FT                   FSKEMNDFKMKYIYNKIYAEESKENIFYGFFGYIDAYRSNKNEDGELIQNGSSIFDFLF
FT                   NYTEKVENTEEKEKEKKNVHQSEVAKTETI"
FT   CDS_pept        506921..507466
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574594"
FT                   /orf_name="CD36_62570"
FT                   /product="Ribosome subunit biogenesis protein, putative "
FT                   /function="RNA binding"
FT                   /biological_process="ribosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41166.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042255"
FT                   /db_xref="HOGENOM:HBG377944"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="UniParc:UPI000192D8B2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU8"
FT                   /transl_table=12
FT                   /translation="MRPLTEEETKVVFEKLANYIGRNISFLIDNPENPHVFRLQKDRVY
FT                   YVQESIAKFATSVSRQQLMSLGICFGKFTKTGKFRLHITSLPYLSQYAKFKIWIKQNGE
FT                   MPFLYGNHILKAHIGRMSDDIPEHAGVIIYSMNDIPLGFGASAKSTAEARNLPPTGIVA
FT                   FRQGDIGEYLREEDTLFT"
FT   CDS_pept        complement(507668..509104)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574595"
FT                   /orf_name="CD36_62580"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAX41167.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG397585"
FT                   /db_xref="InterPro:IPR019368"
FT                   /db_xref="UniParc:UPI000192D8B3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIU9"
FT                   /transl_table=12
FT                   /translation="MLRATNILRGRIPITSSLLGKTTNIARTFTTSSISFAVVRQKEGK
FT                   KKQVLRKRIDPNKQKQKKSTGLTHLPFRDAVRNLNLEQTAPTLIVETLSNKEELKVGTV
FT                   TSYEKSIEKKLIALDAFKKYQHHEMFQNPISLITSNTIRINKEFVEKLDGESKSNRIYI
FT                   DGIKGSGKSTLINQAISLGQEKFNNEAIVLYLNSGEIIGNGTSDYIKNSKLGVYQQPML
FT                   TKRWIHKILSANANIFKKLKLTKDIKFTKDKSEILLKANIATLYDFLSQNRDMGKVHPT
FT                   YAFQFFIEQLIDHSQNVPIIVSIDDFNALADYPWTKYKHPDFTPIHVNEFEIGQFLLKC
FT                   ASGEINFVKGGVLLGKSNDFALNRQTVKVGIYPNEEYNPFLKMPIFDFNLANSLTSNGG
FT                   IKPFKIDPFTKEEVRSLMQFWKDQGVLIVREDFHKKDYEKVSNSNEINIDEQFEKLVQA
FT                   SYVNNQGNPYGMIKQAVLSY"
FT   CDS_pept        509420..511105
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535612"
FT                   /orf_name="CD36_62600"
FT                   /product="ATP-dependent RNA helicase, mitochondrial,
FT                   putative"
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41168.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG397584"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000192D8B4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV0"
FT                   /transl_table=12
FT                   /translation="MFKLLIPNKYNYVIRPLTRFKSTKSTKFTKSTKSRPTKLSPNVFS
FT                   SGKFSQLHNETNTTNIESKITSFDQLKIFPSVREAMIKEIKSQYNLKGPRHSNIEEIDI
FT                   KPTPVQIAAIRKINQTRKLKTLPTIKKNLEDIEDDAERIQYELQYSNEIQKTKVFTVAA
FT                   ETGSGKTWSYLAPLLSKLKQDDMEFWKSDEENYQNMKKKGQFVKSIILLPTNELVEQVY
FT                   EILQRVNSFELEHKNVPDNFTSFLKLPENKNLNISIMKLGQGEAPIGLFRQLETKGPID
FT                   ILITTPGKIVAFSKLININRPFRVFTNVKYCVLDEADTLFDDSFEKNTTDVITHFPKLL
FT                   DLILVSATIPKVFEKKLSKLFPDQRSLVRVTTPSLHKVPRNIKVMTIDADVAPYNGSKP
FT                   RCLAQALYAISKDGTEPGYIKRIIVFVNEKSEVDGIVESMITKYKVRPEDIVGVSGSVN
FT                   IKDRKDMLQPFLQPAQLIEDDVFGSKVKILVTTDLLARGLNFQGVKNVILLGLPRNSVD
FT                   LVHRLGRTGRMNQNGRVFVIVDKKSKKSWVKGLGNAIIRGLRIG"
FT   CDS_pept        512651..514063
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535613"
FT                   /orf_name="CD36_62620"
FT                   /product="NADH diphosphatase (Pyrophosphatase), putative "
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAX41169.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG397583"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000192D8B5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV1"
FT                   /transl_table=12
FT                   /translation="MIRSITRVMSHSIHTAIKDIQKDMYFGTEVLNRVSFLREDSEFIQ
FT                   SSLFHPSTRFIFYYKQQPLIHKNFHNKLCVLTNGSNQTIVDTMDNGKLEYSGEKAIIQS
FT                   GLIDNLPQWKEILINWYNDNKNHDKNLRAKGKPIFLFMGLLDESVGLNLQSLKFADTNE
FT                   ETYLDHQGRYQGIAYYAVDLSSAKELTEILINFVNDSINKLHHHNNTSNDGTPESNGLF
FT                   FTHSRKHYLGFEQKEASLYSQGAMLFSWLNTNKFCPGCGEPTIPINAGGKLLCTNEKKR
FT                   SDVNDDDDDDRYACPVKSARVSNASFPRTDMAVISVITNEDRSKILLSLNKRYAIARMY
FT                   TCTAGFMEPSETIEVATRREIWEETGVTCDEINIIMTQPWPFPQNLMIGCMGIVQFNNK
FT                   NEIIHLGHDNELEDARWFDISFVRKLVYPDEVTEDEKDSFNPEGIIIPMSESIAFSLIK
FT                   LVVDEAKNRHKL"
FT   CDS_pept        514991..516208
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535614"
FT                   /orf_name="CD36_62630"
FT                   /product="Glycerophosphodiester phosphodiesterase, putative"
FT                   /EC_number="3.1.4.46"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAX41170.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG397582"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000192D8B6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV2"
FT                   /transl_table=12
FT                   /translation="MSTSSIIPKITYQSLNRMTSTISPVIVGHRGFKSKYPENTFLGFD
FT                   KCFEAGGTVIETDLWLSKDNVIIISHDQYTKRVFVDSDGNPTNYNVTETPYDPILKNLK
FT                   TIEGGYPLITFKELLYWFKKYIDTTQSNDHKLQLDIKRFNPTKITKFILSDLLDVHNDI
FT                   SWWYHRIQFGIWDLNFLKYLNQNDYFQDKFGKINKFGYDQFDIFNISVNWRDSIHYINY
FT                   NFYLEESSPVDRVKIKLTGVSLIYISTWSIGFLTKFVPLLRIQNLKLYSWTVNNKLQYS
FT                   YLNKVGKLANLVEYGVISDYPDVMAKYKQEDESLEAEFGGEMSPLIKSESKDYYSEDGD
FT                   LSIDLTLQQRFYHWIFVQFNSLVGKRVTNDEQHFATKVDENQVRSVNINPFFQWMFQKL
FT                   QKYGVF"
FT   CDS_pept        516800..520555
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574596"
FT                   /orf_name="CD36_62640"
FT                   /product="Chromatin remodelling complex subunit, putative "
FT                   /protein_id="CAX41171.1"
FT                   /db_xref="HOGENOM:HBG397581"
FT                   /db_xref="InterPro:IPR004022"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="UniParc:UPI000192D8B7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV3"
FT                   /transl_table=12
FT                   /translation="MVLYKRKQVKIIPPDDLPEDLTTQVWFIPETKEWFLSYSDYIKRM
FT                   DYLKTRNFVCEITGNSCLTYFEALQSEEQEITEVEKNFPEALKEHILRFLQFNRISRLD
FT                   MLVDNVYQVFKNDYFPGETIFLRGIDNNKEHSVKQRGTIREKVQYGQDQPTKYLVARLN
FT                   DNHQAIVTEQNISRDRNHFTKWLIKTFIKLTMSRSYKVGAPWVVKTKYAKQYGIPTTYP
FT                   DDLKQFADTTPTGDIVFIQPKKKRGPQPKITETPPKPPKPPKPPKPAKPAKEPKKPKKI
FT                   AIKTERKQATPASQKPIVPIAPTPPVVVVPFKKKFPTHYIPDAIMKEYEEEEAKGTPSF
FT                   GLSQFQPTKKNIVEDLELKFDLQNSKPLPKILSLPENAKYWNQQIIEEEEQQEESMDEI
FT                   ERKRLSCYGLPSISEALQSWIFLNVYHNILNIDTFTFDDFVFAMGWNGDQFSEDGRCEL
FT                   LDEIWCAVLSTIVSNELPTNKEAKDYKERDEIYGLTISLPEKDEINEDSDDEDEDEDED
FT                   EDEHDNNDNQDKKGDKIEEDKQLNQDGKQDNDTNSEQISSKPKGDDSEDHGSESESEEK
FT                   QLDIDTEQSESEENDKDSNIEKPVVTHNAYECMNHRGTSWDERLRKRNFKDGNWQCILL
FT                   GVLSLVEHVPEYEATIYKIYHKLAPKDKPATALSVRNQFYDELDIELKFKALNILVDLV
FT                   ISSPLVRNHIDDCLENSTSLRRNRLDNLKEYKTVLEQAQKAHQYITTKIATTNVSQLDQ
FT                   SPPSPPPPQQQQQIEQPSEVKKGLDLNNLELSEAERLLGEQDSEFQEQCNIRKDAIIKL
FT                   NQLKEAKREIEQKLTELDCQRVKLLGKDRLYNRYWWFENNGLPNLHSGRNNEDDEDDEE
FT                   NNDNKKEVEEEDVDSDNETDDVHDETYLMGRLWVQGPSNNDISIHFKTDLKNAQEFSEK
FT                   IDKIRLENDGQEFDNGKLDPDNNNNNNNNSSSNNSSSSNNSNANSNNNNNNNRVKKLNF
FT                   SKLPSQLITTVRDSFALDVKEKEIFTQSGEKLIDEEGSFILPLAKLSNLQRKCIEEFPD
FT                   PLMTGSDWRYYDKPEDITKLISWLNPWGKRESLLRKELSLVKEAIISSMEARRKALWLD
FT                   QTPPEELEISDNIKKLETKLSGGGNDNDKDNLFSKDTTIAAGGGEEGDDDVVLTSGSKR
FT                   TRRSTGSRKRQKVVTVQDALEFGEPEDINKMIQNLEEELVEKKDNREINRVLEWVNSRA
FT                   LDLFEKSLYEGGDKQKSNTKSKQKKK"
FT   CDS_pept        complement(520617..521414)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574597"
FT                   /orf_name="CD36_62670"
FT                   /product="Pre-mRNA-processing protein, putative "
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAX41172.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG397579"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniParc:UPI000192D8B8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV4"
FT                   /transl_table=12
FT                   /translation="MFSSLLSRPINSSYDPSYHFFPVARDSKNDSTVKEVVSTTKKEIT
FT                   TPSLKYDTTIPLKKRYPNLVHNFPKPELDENLILETKKMIDSIIHSSSDEPTNDINYIK
FT                   YETLNSNSNSKSNSNQNQSKIIQIKQFQEDPMLPPRFKLRKNRHERIIEDITFVKDPKT
FT                   KKLTKEDREFWNIPAAISNWKNSQGFTIGLDKRMIGREYVSPEMNITKFNDLSTALSDA
FT                   DLQAREDLKKRNEIRQQKQLQEKRLRDERIKEIASRSKRRKRY"
FT   CDS_pept        522112..522915
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248114" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574598"
FT                   /orf_name="CD36_62680"
FT                   /product="N-acetyltransferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="CAX41173.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG397578"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000192D8B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV5"
FT                   /transl_table=12
FT                   /translation="MSTTTTRSGTNPKPIKRNPYLSTLRHLTNKDVTKAAYTLLEAFAE
FT                   DNLAKMLVCHIEDKAERQLCELTLYEAYIRQHIAKGIVIGQGETESGFETVSIWSHPKS
FT                   EEEGLDSYTNLMEAGYGKVWNVYGEEGRKKVFYGMLPLLHDSCERIINNDSRFKNKNVY
FT                   TLVYVGSSKQARGKGNLRKLFDYMFETYIDNDENSITYLESSSPANIPIYNRFGFHVAE
FT                   DIVLGEKCDDAVIGRDYAVMNVMIRGNKGHDWTKDENAFNSKGKL"
FT   CDS_pept        complement(523055..524035)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382840"
FT                   /orf_name="CD36_62690"
FT                   /product="Ubiquinol cytochrome-c reductase complex assembly
FT                   protein, putative"
FT                   /protein_id="CAX41174.1"
FT                   /db_xref="HOGENOM:HBG397577"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniParc:UPI000192D96C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV6"
FT                   /transl_table=12
FT                   /translation="MLRTTSKLTYPSVRLLSQTSKITFQQRPSFLDKYRADQESIEAPT
FT                   KLASESTLPVIEQDLKIKPRQPKTKAPFLSEDEDKKIELPSWKEKIGQFVVSTFGVDMD
FT                   KSRSGPVAGGIYFSECKRQALVYPNEPMSDTAKFYYETLRLPKSFSQQVQITILHYWIL
FT                   SVRMRALPFKYSKEYQQKLVDRIFNDLDYRMSTELGIKSNRTIEGYLKDYHTQLLGCVL
FT                   SYDEGLMTDDITLASALWRNVFNANENVDMRHVEALLVYVRSQLYVLNKMTDRAFGFGK
FT                   FKFVPPDQVVEPISLEQEELIKQKTKEEFAKMTLPSQQSVLSMDE"
FT   CDS_pept        524091..526241
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574599"
FT                   /orf_name="CD36_62700"
FT                   /product="Signal recognition particle subunit, putative "
FT                   /function="7S RNA binding"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="CAX41175.1"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG397576"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000192D96D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV7"
FT                   /transl_table=12
FT                   /translation="MKSLLKTISWKFTSFSFFFFFLLFLQFLARHTLFFFFFRSSYTPT
FT                   VVSDFFKDRKKKKKNFVFSKNQFSNECISTLYLLVDIMSNSIADAFKKLNVSPEISPSE
FT                   HEKIFNVSYEYLSKVKKFNDLKASKNCLVALINLDKYYKADQIIKKLPKSLISSLLLEV
FT                   AYIYYKIGKVEDLVKLYEANENTLPNGADIGLKHVLAQSYYKIGKYEKALELYNELIKN
FT                   NKYDDELDLVINEKAIVSQLNFQKGGKIESTTTGNDNNYDLLFNEALIKLSILNTTQAL
FT                   ALLDKASQVCHTELSGPDLESELLPIKLTTAYVYQLTGESKKSLEILESIDIEKINDLL
FT                   IKLIVKNNFYSHSTITNINLVDRDLNYQQNLHKLNQKLTVLQYERVLKNSLVLKFASGT
FT                   LSKSQLNNQFINNFQQTFPGDLLPLSYKVLSELNIDYKDLQDSTKSKSVGRKLVKYIST
FT                   QHTNNDDLKIVAILILVSVNAQIGLFDQSLPILEQLTHESLTTSKVLPGLIGTLIAIYE
FT                   RTHNNKKLTDLLLKVLEKLLYTPQELFKDINYYNFAKIVAFKALNQGHDKTATQLFEYL
FT                   FEVNPSDHLINSILSNTNNDLLPLDELTSKKPIDEILSVDIDTLIPTTKSKSIKPIVKK
FT                   SSKITKKKQKPKFGPNKVLKPIEDLQLDEERWLPLKLRSYYKPTKKEKKKASGGQQGVA
FT                   ESSARTTTSSSNNKKKKKKGKK"
FT   CDS_pept        527259..528368
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574600"
FT                   /orf_name="CD36_62710"
FT                   /product="NADP-dependent alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.2"
FT                   /function="alcohol dehydrogenase (NADP+) activity "
FT                   /function="cofactor binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41176.1"
FT                   /db_xref="GO:0008106"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D96E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV8"
FT                   /transl_table=12
FT                   /translation="MTTDSVPDKFQGFASDKKENWNKPKLVSYDRKQINPHDVVLENEV
FT                   CGLCYSDIHTLQSNWGGYNRDDLVVGHEIVGKVIAIGEKVTEFKIGQRVGIGAASSACR
FT                   ECNRCKSNNEQYCPKAASTYNGIDVRSNNYVTQGGYSSHSIADEQFVFPIPDDLPSAYA
FT                   APLMCAGITVFSPLLRNLGSDAKGKTVGIIGIGGLGHLALQLAKALGAKVVAFSRTSSK
FT                   KDQALKLGADEFIATNEEKDWSSKYHDTFDFILNCASGVDGLNLQDYLSVLKVDKKFIS
FT                   VGLPPATEQFGVSPFTFLKHGASFGSSLLGSKVEVLEMLKLAAKHNVKPWIEEIPISEE
FT                   NCSKALNRCHDGDVRYRFVFTEFDKAFAK"
FT   CDS_pept        complement(528671..529411)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078569"
FT                   /orf_name="CD36_62720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41177.1"
FT                   /db_xref="HOGENOM:HBG397575"
FT                   /db_xref="UniParc:UPI000192D96F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIV9"
FT                   /transl_table=12
FT                   /translation="MSSNHTSPVKRSILSPKPSNITNNNSPLGKRFNTSSRLTPSPSKS
FT                   GYNRSSTTPSPKKQTLGFIIWEDKVDKSNSTTDIVGTPTSNKLNHNDQENILQPKKVEN
FT                   KRFHNHRQPLSNLSINEFKGFISTNGATPIQLTELYQPINFDNEFKSLHKQSNIPSYLT
FT                   PSRRSRDKYLVKSGIDEIDEEMEDEMELLLSKKQKQRSTSLATKTNNINKTHLIRKHTR
FT                   SLSVGKNDSKLNLIRKNKFSILSN"
FT   CDS_pept        complement(530790..531974)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574601"
FT                   /orf_name="CD36_62730"
FT                   /product="Aminomethyltransferase, mitochondrial, putative "
FT                   /EC_number="2.1.2.10"
FT                   /function="aminomethyltransferase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41178.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="HOGENOM:HBG299834"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="UniParc:UPI000192D970"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW0"
FT                   /transl_table=12
FT                   /translation="MLRITSKRLYSSTSNLLKTPLYEAHIELGGKMVPYAGFEMPVLYK
FT                   GQSHIESHNWVRSKVGLFDVSHMLQHNINGKDAQKLLQKITPIDLNKLPVNTSSLSVLL
FT                   NNNGGVIDDCIITKHGEEDYYMVTNAGCRDKDIKFIKEEASQFNSVNHNTFEGTLLAIQ
FT                   GPKSQEILQQFTNEDLSKIYFGQTKFLKLSPIGATVHLARSGYTGEDGFELSIPSTTPE
FT                   ESKQALDFFYTLINEYPDVVKPIGLAARDSLRLEAGMCLYGHELTEEITPIEASLTWLI
FT                   PKTRRDENNDFNGASKILSQIKDKSSFTHRRIGLTSKGPSPRDGNKIFNEDGTVEIGYV
FT                   TSGSPSPTLSGNVAQAYIDKKHKIGNKVKIEIRNKLRDAVITKLPFVPSNLYKP"
FT   CDS_pept        complement(532305..532766)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094292" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535615"
FT                   /orf_name="CD36_62740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41179.1"
FT                   /db_xref="HOGENOM:HBG397574"
FT                   /db_xref="UniParc:UPI000192D971"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW1"
FT                   /transl_table=12
FT                   /translation="MRILKVDNRVKQLETPNEYNYDSLKACKCDSCDYWSSLSPNQSSG
FT                   LFLGILIPIIWLINLFRIIKCLYFINNEPLATTEYLQIFKSKIRMKSNVPLTSHYINYH
FT                   NNNRVEMYSCLGHILTAIIIYGLVIFGIVMAFVKSTRVMIWPQTDIMYL"
FT   CDS_pept        533808..534605
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229976"
FT                   /orf_name="CD36_62750"
FT                   /product="Iron sulfur assembly protein, putative "
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAX41180.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG397573"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="UniParc:UPI000192D972"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW2"
FT                   /transl_table=12
FT                   /translation="MMIATRRQSLQLTKRYISNHATKNKRFIQTIPISTNTGSNSFLSK
FT                   LHQSEDNDVPTSKWARHTLSFPKTETSNTTPQPPVRKSRTSRFANKSTSTNDIKQFNST
FT                   TPTSQSNIIEITSDPEIQKASNKITSTSASVPTEIKSAATPSVTPKKKRVLRPRKALIT
FT                   LTSSAVQHLQGLLDQPDPKLIRIGVRNRGCSGLTYNLEYVDKPGKFDELVEQDGVKVLI
FT                   DSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV"
FT   CDS_pept        complement(534896..535339)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078570"
FT                   /orf_name="CD36_62760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41181.1"
FT                   /db_xref="HOGENOM:HBG397572"
FT                   /db_xref="UniParc:UPI000192D973"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW3"
FT                   /transl_table=12
FT                   /translation="MGWFSFSSNKESSVSAVPSQQVEQRSHQSLNLPHNSDIATTLNQL
FT                   SSQTGNDQDVKVKEIDNIQDKNEIEKTVENFVESYPISNMFVIDGEKDSKQSIICTTTD
FT                   SGKTCLKLKMNSIQLFKIMQKQEYFCSLPDDINATYFECRKIK"
FT   CDS_pept        535781..536407
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229977"
FT                   /orf_name="CD36_62770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41182.1"
FT                   /db_xref="InterPro:IPR004330"
FT                   /db_xref="UniParc:UPI000192D974"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW4"
FT                   /transl_table=12
FT                   /translation="MNNTVDDNKTLQAAFKEASSAPEKFMFNGLPNESEDNVDLIIGYF
FT                   KDDDFERWFKSISLNYNWSRKSSFESPEENNNDNKTGKSLYSKEEYFGCFSRGKFKSKS
FT                   KKSNDAIVNQTVSSIKSDCPARLYVKQQKGIPGYKLIGFVPTHNHAPQENGPLNAVARD
FT                   WLVDVVEKGYTRSQIAKILFNLHGQRNRSQISMSYRPFLRIQTSY"
FT   CDS_pept        complement(537416..538096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574602"
FT                   /orf_name="CD36_62780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41183.1"
FT                   /db_xref="HOGENOM:HBG397571"
FT                   /db_xref="UniParc:UPI000192D975"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW5"
FT                   /transl_table=12
FT                   /translation="MYKPKFNFRPNAKGIILNKPVINISTTFDEISKLPSFRSKLLAFY
FT                   KRFYKLRKFECNEQLYIIKDIPYYTPDINDQDYAAFVKRQFRSISYNTKREAILNLPAL
FT                   SEQELEQRMMNTLVFVFNHTVTAETPYSNNSSMTEDDVAKTGIDNEETKIVSTILKLDN
FT                   EMPNDIKYDFKFKWFKEFTNQLDSIDPKVGPTKKQLEYLTEHYGYRMYYITLMRLNEST
FT                   KLCL"
FT   CDS_pept        538116..538961
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382841"
FT                   /orf_name="CD36_62790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41184.1"
FT                   /db_xref="HOGENOM:HBG397570"
FT                   /db_xref="UniParc:UPI000192D976"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW6"
FT                   /transl_table=12
FT                   /translation="MIGSRCKFFLQESMRNVSHFFFFFSKLGQPFYNQRFVAIIYELIN
FT                   IMSLSIRLFEDYYKLQYSYLCTKPQLLKTATPSVNFVIHVNILINNNALTTRTFDSQLI
FT                   TGLATRFTKFWSLLEYEVSLNICDDSSHTFDMVLKCKIFELYAPTNCLLSLDLELSILT
FT                   QENTIHLEDMSTNFNYLLASWYLFMETQAPFVFSLIGRQYAKSNIFWYRRVRRDVLGYD
FT                   SMDLDRVLMLLEGKISYSFTVQQLLLQNVKLQSLLEATSPTSRKKASSAIKSYPVTLIQ
FT                   "
FT   CDS_pept        539302..540348
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248145" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574603"
FT                   /orf_name="CD36_62800"
FT                   /product="Uncharacterized oxidoreductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41185.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397569"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D977"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW7"
FT                   /transl_table=12
FT                   /translation="MSQPINLAIVGTGIFATDNHLPTIQKIPGLKPYAAYNRTKSKAET
FT                   FAQKANIASDKVYDSLEEVFEDKDVEFVDALLPVQFNLDAVKLAVKNNKPICFEKPIAA
FT                   NLDQAKEIVKLSESTDLPILVLENWTYLKAIDILKNEVLPKIGDVVAFTYNATGPFNDA
FT                   NKYLATGWRLKPEHIGGFLSDGGVHQLALLTEVLGDVESVSGLTQQLKEQSGTDDVLFS
FT                   TLKTTKGAIGTFTYGSAFGATDKSTFFKIFGTNGSATYDWSPCLSKPQITYATGATSGQ
FT                   ASGKTTIEIDEVDTIEEEFKNFKDAVAKKDKKLVKVPPRKAFHHLAIVAAALESSKNNG
FT                   SNVTVETP"
FT   CDS_pept        complement(540414..541412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535616"
FT                   /gene_name="SEC20"
FT                   /orf_name="CD36_62820"
FT                   /product="Secretory vesicle transport protein, putative "
FT                   /protein_id="CAX41186.1"
FT                   /db_xref="HOGENOM:HBG447524"
FT                   /db_xref="InterPro:IPR005606"
FT                   /db_xref="UniParc:UPI000192D978"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW8"
FT                   /transl_table=12
FT                   /translation="MSAVYYKKLDTVQFQIYDLFNSLIQLSNSEDESVYKASFDDTVQE
FT                   IDSLLIAFKDLLRLLRPKDKSNKLNTYELKFHSLKQKLRELQVFINDQQQDKLHEYRVK
FT                   HFRLQDSPVDTLNNESARDQLFASRSIKKTQKETEASINQQIVNQNKSITKSLQASRQL
FT                   LSAGILQSELNIENIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYL
FT                   SMGFFILCCSWVVYRRILRRPLKIFLWSFFKIFNIFNWLLGGGRSKGLSATGVLVSSVI
FT                   AATTEIDEYETTKTFLETFSGMEDSNTAIDTLTMVVESLTTSSMERIVDEL"
FT   CDS_pept        541611..543104
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574604"
FT                   /orf_name="CD36_62830"
FT                   /product="RNA exonuclease, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="exonuclease activity"
FT                   /protein_id="CAX41187.1"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG397568"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000192D979"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIW9"
FT                   /transl_table=12
FT                   /translation="MSPISNESKDRNNLSNGTGDTANVSKPVTKKPMDPKLLTQEYILE
FT                   QRRLRELRKEKIRQQKEALGLIPPPEKEKFLKRPMLGICKPKPGLPSIKIMSYNILAQT
FT                   LIRREIYPTNGKILKWSVRSQILLDELKHYNADIMCLQEVDKVQYEGFWVSQLEKLGYS
FT                   TRFYRNNTKNHGCVIVFREKLFVCKHQSFIRLDQDLNQEASEKQLPPARIATTNIAFMA
FT                   YLEFTPAFVKEYPCLKETNGFIIGTTHLFWHPFGTYERTRQTYMLLYKFKEFQRVLRII
FT                   VGNSKRFYSFFTGDFNSEPFDAPYRAITAKPIKFSGRSKNVLGCSLAYTYSKDRSLDED
FT                   DVDIEELEQERDNNPSDPEPETFETTPEQEQLIKDLEEAHNDLDVRAISLYSVGYKQAH
FT                   PENAGTAGHRNEPAFSNWVDKWNGMLDYIFLLVPWNKSDDHSKKRDLPEDLAEQYKIKL
FT                   TKLLRLPTPEEMGPPPSGQPRMNQYPSDHLSIMAEIQLE"
FT   CDS_pept        complement(543111..543932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229978"
FT                   /orf_name="CD36_62840"
FT                   /product="Kinase activator protein, putative "
FT                   /function="kinase activity"
FT                   /protein_id="CAX41188.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG737456"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="UniParc:UPI000192D97A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX0"
FT                   /transl_table=12
FT                   /translation="MALFQNFNTHSLRSTRGFKLKQSSPISSPQPISNSVLPQTPLENS
FT                   QRPHLEQTEQNPYQTINFNNGNGQPVSSHKDIRNYAEQTLGSDNALIQAVKLPRDEDVN
FT                   EWLAIHVVDFYNQINMLYGAITEFCSPATCPRMIATEEYEYLWQESAPTNQDGTVQSPK
FT                   RPVSLPACEYIENLMNWVQNFFDNDNIFPTKIGAPFPHQFPTLVKTIFKRLFRIYAHIY
FT                   CHHFHEVSELGLQSHLNTSLKHYVLFANEFQLISRKDYGPLEDLVDTMLQR"
FT   CDS_pept        544376..546904
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078571"
FT                   /orf_name="CD36_62850"
FT                   /product="Nuclear polyadenylated RNA-binding protein,
FT                   putative"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41189.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397567"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192D97B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX1"
FT                   /transl_table=12
FT                   /translation="MEVNPVNLHKEETEEKKDVSQQDSGAAETLTTASDEKHAVEAGDE
FT                   VSREQDVDDDENDKDSQPDDEQNQEETTIDHALPADSATTTEQDGENRTEPEEVKEPVE
FT                   SNETEQVTATDEPDVQKSTNEIVRELFADATPTTENKSSSPGDNLESEDYDPESAFADN
FT                   NVEKDSISNDYSENQENKDNSDYEPEFKEEEEEAEEAERKSPVATGFSSKKPHGLAGLP
FT                   PKPPVNATVKPSTAAITEESSSQQRLKDAYDAIINSPIGRDPEFLRLPAEEQVDAIKDQ
FT                   LQKLGIDLSSGSHPINFDQVYSYNKPFKNLKDPIPLVPIGEFCRRPNITAAMTPEEEQE
FT                   YAEFIERENYYLNLQNWDEFPDKSRLFIGNLPANTISKQDLFRIFSKYGEVIQIAIKAG
FT                   YGFAQFRTGEACLECIKGETDIPLHNKILRLDASRPQKSRRPGHPEINNPNMSGRGRER
FT                   VRDESEDQDQQPSHKKRKGSIDCQVYVTGKSSVFFIRKVKKAFAMSQVTIDVEDVTQRN
FT                   ISEVLSEAAYSGVLAACVIKEQKVDIQTFENTPDGGIKFDEYADVEPEEGAEIVLKAKV
FT                   KKYGDRLPAYVPQDTSYHDNSRSHTAGPAHSSGPRRGGERNRGSRRGDRHGGRRGGYGA
FT                   HNNDYGHGRGRGSNYDSWNQQPYGSVPPPPQQQPYGSVPPPPSSSSSRQPHSYGQPYYG
FT                   NQQPSYGSPVQQPAINQWNSPVQPPQNPANNLLQGLNAAQIQSMIQLLQSQQQGAPPPQ
FT                   GNYGQPSRPGPAPNTYGGMGYNNNYGSNAPSLAPQPQGPNDNTANQVQALLAQLQQSNQ
FT                   QGNAYGQNSSQNQQGQGSSFYDTLSRLAKQ"
FT   CDS_pept        complement(547066..548580)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574605"
FT                   /gene_name="CDC37"
FT                   /orf_name="CD36_62880"
FT                   /product="Hsp90 co-chaperone, putative "
FT                   /biological_process="cell division"
FT                   /protein_id="CAX41190.1"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG397566"
FT                   /db_xref="InterPro:IPR004918"
FT                   /db_xref="InterPro:IPR013855"
FT                   /db_xref="InterPro:IPR013873"
FT                   /db_xref="InterPro:IPR013874"
FT                   /db_xref="UniParc:UPI000192DA32"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX2"
FT                   /transl_table=12
FT                   /translation="MPIDYSKWDKIEISDDSDVEVHPNVDKQSFIRWKQRDIHEKRMQR
FT                   NIEIKSILIQLTMYAKLNERVDYLLEKLTSTELLDNTKVMSVLNSEFDPQEKFDYDKLI
FT                   KDKGSTLRKGLKDLKFDREEIENTPCYNEMIEDLFVQIKDDHPETKTDGDKLIEHLREH
FT                   RKKIDDVLSKQTIKLDDLLYQKAQLIVSDDLHTGFDRSFLNKDKPEEEVKQDTPKASQT
FT                   KKTTVTTTETINSPKPIEDKSDKEILDELELLPATKEFAKIPSDNLSEAAEFLIKHPSI
FT                   CTEQQKDALIMTAFDLQLENKSDEAKHIIHQSLLLQYVGQLSGNGKAAPANVINTIKLF
FT                   FSKIAAESSPAKHAFLEDVNQTFTHIKGRCEIIKEEQRQNASNNEETGEEEALIQLKAL
FT                   DDNTELSVNIPKEGTKEYEIFTTKLPIEFQNAIKTESIDEVNKEFAKLKIEDAEKILEI
FT                   FNECGVIGISGYIEDEKEFEELKKEYAHEAVNQEEQQSAPVEDTVD"
FT   CDS_pept        complement(548923..549288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382842"
FT                   /orf_name="CD36_62900"
FT                   /product="Ethanolamine utilization protein, putative "
FT                   /protein_id="CAX41191.1"
FT                   /db_xref="HOGENOM:HBG568350"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000192DA33"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX3"
FT                   /transl_table=12
FT                   /translation="MPLLYKPAAEGKDVKPAQIPSPGNNSFLEDTFTSDAPKDKQISCG
FT                   FYRQEKGEPLVYTYDYDEMKIIVEVSGEFTLTDETGKKVNAKPGDVFYFSKGTTITFES
FT                   TDYALAFFTGLRPNGAA"
FT   CDS_pept        complement(549868..552159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248148" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574606"
FT                   /orf_name="CD36_62910"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /protein_id="CAX41192.1"
FT                   /db_xref="HOGENOM:HBG626553"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI000192DA34"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX4"
FT                   /transl_table=12
FT                   /translation="MSFKNQLNFNISKSTPTTSTNNTNTTSNSNLTSNDNPQPVTVKPP
FT                   PFISNILLKSNFDSSVSTNNSSKTPPKSSSPRLSATGVVPAVVTIDNGESVGNNVSTTS
FT                   TNSSKTDLIGLFDKFDINKDDKEQAKTEHEEHQPFTEKHEDDEVSQEDKLEKMVSDDDG
FT                   DDGESPKEKEAVSEKEGTSTKDITLSPSIKQTEQKNNGTTSFAALMTIQPYILPEEKEV
FT                   AEKQEEAVNDNLIDLDDTETLSSKNHNLHDDLAKSESTNTNQVESSTPKGNLLDIAGSE
FT                   KEQSAVEELSIKVGGSESKSTNDVLTQDVSITDPNKAHKHRFQVNDSSEQNKQSHKPFD
FT                   FQTFLVQLRKKSADPIVRYIRSFLGSFIRQGHTFTSDQRIKIISDFKIFMNEKFTLYEP
FT                   FASMDQIDLENSREGLEKLIMNRLHDLCFPAEVIKQHLSYIPESYTLDLQKDESFAVQL
FT                   EKFSWINGNHLDIDINELANKIVKNDQSFLEYAITELNKINNYRAPRDKIICILNACKI
FT                   IFSYLKLSKQETNADSFIPILILVIFKAKTDHLISNIHYIENFRGQEWLLHGETSYYLS
FT                   SIQGAIEFIQNITAEDLTISQAEFDAHMEAWEAQGKQKLQQLKLVQPIPTIPTTPTDGS
FT                   GEAHLKPDTPNTPNGLSPSKVLFSSAEMFTKSITNFLSPSPHLSESEPEEFQPPANPPP
FT                   PQEQNDPSAQYQPLPPREEEINAEQMRKAYDTLIEIFPSLDTNILKDVIFINRGNIDVC
FT                   IDACLQLVDG"
FT   CDS_pept        complement(552651..553697)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382843"
FT                   /orf_name="CD36_62920"
FT                   /product="Transport vesicle protein, putative "
FT                   /protein_id="CAX41193.1"
FT                   /db_xref="HOGENOM:HBG397564"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI000192DA35"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX5"
FT                   /transl_table=12
FT                   /translation="MPQLPTSDDHEYRYNYNQDSSFSTLRNVLASKLAAVTDIIQQART
FT                   WYLEQSIIKQILLGGALVVIGVISILMVIFHIYIIRFLIYLSDEWHNLKYGSLIIFVLI
FT                   FMVGFPPLVGFSALSFLTGMIYGCPQGWPLIASASVLGSTCSFIVYRYVLHNQAVKLMN
FT                   HNETFRAFAEILGEGNSLFLLILIRLCPLPYSLSNGALAAIPELPLLTYFLATLITSPK
FT                   ILIHLFVGSKLKQIGDDKSSGGTKIVDIISIVLTGTAATLAAYLIYAKMQQKLASYHSR
FT                   GIAADDVMVFGNFEDDLELGSNEIELNSADFDADNFIIDDNEDDPRQQGNGNNTNKDNG
FT                   VRTSEEML"
FT   CDS_pept        complement(554006..555460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574607"
FT                   /orf_name="CD36_62940"
FT                   /product="Pantothenate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41194.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG324666"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000192DA36"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX6"
FT                   /transl_table=12
FT                   /translation="MDKVLQPLRTLRRIVWGQPPENPVERSYLFKLDAFVLSYVCLLYW
FT                   ANYLDRANLANAYVSGMQEDLQMKGNELNIINTCFYVGYIVAMIPHNLILLKIRPRYWI
FT                   SICGFCWAVLTLSMYKVHSFKQLCVIRFFEAMFESVTFAGTHLILGTYYDEELLPMRTA
FT                   VFTSSGLLGSLFSGVLQAAIYRNMEDYNGIRGWRWLFVIDFIITVPIVIFGFFCFPDEP
FT                   QLSKPFYMTNEEHQLALEKKLRSKEKANNDWNLMSICNRVFTNWHWYLFSFLWVLGGEN
FT                   ESFVTNSLMALWLKYYNYSVEQRNHYPMGQYAVGVVATIISALYIHAFGKGRHHWHMGI
FT                   IIGIFTTVAAAVFAAKPDNTGAVFVSQYLSAVSFAGQTVFFSWANVVCINDLQERAIVL
FT                   ASMNMFSNAVNAWWSILFYGADTAPEFKKGCWALLATAIASIGVVVVIQVLQAKDKHQS
FT                   RNGGGLVAVVMEGESDEVESGSPIKV"
FT   CDS_pept        complement(556451..558163)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574608"
FT                   /orf_name="CD36_62950"
FT                   /product="Amidase, putative"
FT                   /EC_number="3.5.1.4"
FT                   /function="amidase activity"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="CAX41195.1"
FT                   /db_xref="GO:0004040"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="UniParc:UPI000192DA37"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX7"
FT                   /transl_table=12
FT                   /translation="MTITHPVYKEIAAKKRSIRDKKFNPEWLIPQHELPADEVTDVLNW
FT                   IKKTNHLTPKEILITESKAVDIVNNIKSQTWTSLEVALAFCHRASIAHQLTNCLTEIFF
FT                   DEAIKRAKELDHYQLVSPGGGKLVGPLHGLPVSLKDNFNVKGHGTTLGMVNFCFNPQQV
FT                   EYDSTLVEMLRQLGAILYVKTNVPVAMMMPETTNHVWGSTVNPMNRLLSCGGSSGGEAA
FT                   LIKLKGSPIGIGSDIGGSIRIPASFQNLYAIKPSFGRFPTFGTRSGLPGLESVNSVNGP
FT                   ICDNLDDLEFYCKTIIDAKPWLSDAKCVEIPWRQIEFGNISTDRVTINGNTALPQESPK
FT                   LNIAILMDDGFVRPTPPIRRGMEMVTEALKKEGHHIIEWDPQDHVRLSEIIGQFFVSDG
FT                   GHHVLEETTVVSEPFFPYMENYGTSKDIPVSQLWKLQRERTILIDKYLKRWNATADSTS
FT                   NGNPIDAIIMPATPFAGNPLGKFPTYVGYTSPFNALDYTVGVFPVTRVDKTVDVVDEAP
FT                   GNYNDIDVQVWKDYDPEESHGGAVALQLVARRFEEEKVIAMMKIISKLINYTD"
FT   CDS_pept        complement(562188..563591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078572"
FT                   /orf_name="CD36_62960"
FT                   /product="Cell wall integrity and stress response protein,
FT                   putative"
FT                   /protein_id="CAX41196.1"
FT                   /db_xref="HOGENOM:HBG447785"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI000192DA38"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX8"
FT                   /transl_table=12
FT                   /translation="MLLIFLSLLLPVYADSWSKSGCYSSINVAESKGSYTFQSSGYCQQ
FT                   QCAGYRVAALKNGNECYCGDVDPTSQSNGCNMKCSGWPSDTCGGSSAYMVYINADADSQ
FT                   AESSSTSTTSTSSTSSSSSSTTTSSTSTSSSTSTSSSSSSTSSTSTEEPSTTTIQATTT
FT                   EESTAQPETTEQPETTTSSSSSRTTTQPRTTTVISTSVQNGTPSVVYKTIVATPSSNPS
FT                   TSSSSSSSSTTTPPSTSTSSSPSETGNNDKGKNQSKSSVSGGTIAGAVVGSVAGTALIA
FT                   GLVFLFCWHRRKKQDEYDEDVDDQFTLSGPKQEMEHHPYSTIGGGAGGGGGGAPMMDPN
FT                   PFLIAGGYNNFDTSQQQTPRQQITSNGTVGGSGGYGHNYKISSSGTSGDGNHSFGSQTD
FT                   TEFAFYDYNNSNNNNAITNPNNNNNNNANNGLLNTDSPNPEFGRRKLSNGSLPDMIARN
FT                   PGSLKVVNN"
FT   CDS_pept        567021..567878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574609"
FT                   /orf_name="CD36_62980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41197.1"
FT                   /db_xref="HOGENOM:HBG397563"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniParc:UPI000192DA39"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIX9"
FT                   /transl_table=12
FT                   /translation="MSLTSIHTIESILSQLNKDVQELDIPTLYQLSTTTTTSTNTTIPK
FT                   ASPYITKFKLIQIKNSLTNLNNQFHANFTSSNKYYHNVKQTLDKLYINEIDEKLYIVDK
FT                   LIIQYDQANSPTASNSGDDDNDQQKQKQEGEQNLQHGDSGVITNDEELSSLRQRLLSSS
FT                   KLHQINQDNNNDGDTTKLNEYHESIQDDIVNELSELTSTLKSKAIEFSSKLLNQDSDIL
FT                   QQTHDNLSINRTMFDTLNKNLNDYLLNKTGWSISIWTLIKFAVALIVIFVVMLLFIIIV
FT                   PRIR"
FT   CDS_pept        complement(568414..570327)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574610"
FT                   /orf_name="CD36_62990"
FT                   /product="RNA-binding protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41198.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG626535"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DA3A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY0"
FT                   /transl_table=12
FT                   /translation="MSFYPSQQPDPNEDMMLDPNQYPMYQQQNSQAMPQPMAGQIPQYG
FT                   QFAPEHLFQQQQQQQQQHQQGSEGFDGMNLMPPSQYNDFSNGGVGGYPQYEQQHFQQQQ
FT                   AFHQPEFQQPELGVGMIPQHDQQHQQQNHQQQQQHQPGLPGMAVAPGQEAGNSRTVYLG
FT                   NLPNDLEPHELLDYVRSGIIENVRIIPGKNCCFISFLDTNAALLMHSEFILKKINIKGY
FT                   NIRVGWGKNTAIQPGVLQAVTNDGATRNVYLGNLSPSNISEEEIINDLSIYGPIECIKT
FT                   IPEKGIAFVHFLSIASAIRCVNNLQSEKYPKVYYGKDRCAFITKTQQHNAAQYLGLAPG
FT                   MEHIVTAADREFISSALVQQSAAAAQIATQAGGANNLGNRTVYLGNLHQDSSIEEICNV
FT                   VRGGLLQSVRFLKERHVCFITFIDPIAAAQFFAMCQLHGLTIHNRRIKVGWGKHSGPLS
FT                   NALSLAVSNGASRNIYIGNIVDFEYFNPTKLREDFTKFGDIEQINYLEEKNCAFINFIN
FT                   IANAIKAIDGIKSFDDYKNLKINFGKDRCGNLPRQFQNQLPLSSSSPSPAQNQSSGVTP
FT                   AFANDHDDNTQSLSTPQTEVPPASPSSAAVSSDIQSEALPVGGGALGIIEDGEFYKEST
FT                   PF"
FT   CDS_pept        complement(571388..580009)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574611"
FT                   /orf_name="CD36_63010"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAX41199.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG397562"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR015519"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021668"
FT                   /db_xref="UniParc:UPI000192DAF2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY1"
FT                   /transl_table=12
FT                   /translation="MSTSDINKTIALLQSSKIKERNDALNNLENIAASKFRLNPKQFRQ
FT                   LTQAILGLIKHESQIYFNNKSTTVDSRLSQASYSLRLLTEKSIEDTRIDFKFRTYLDLC
FT                   MSIKDQFFVHSELLEPCSIDFIKTVTSILNLSYVKEHLNRKEWATLYNFLVSLINNILD
FT                   DCQGSLSNNGNNEKLLIDLYTALQNLLQCENNVSVNYLQLYDNDNYFKLLRVLDKTSEL
FT                   LKKENVIIIIIFRIINKLITVITTEKFKFVNKLIKIGIRLMVFFHHSHWEKLQEQFLIF
FT                   INLPGTHDLINLHNLPKLIGDQYILSETNTQEDGNSIHSQADDQDEVFLYNLGVLIHHL
FT                   MKKLMSGSFELKTDDIGICAINSSLTWFNLKTIYSTSQNYKPWLLTLGVSRLLKSYYDL
FT                   KQFINKQSNDPQTSLLLYSNGSPNKNKRQKLGSIADTISDSNSAIELCNKLIHSKESSD
FT                   NQVLGLKLLVFYLDLYTFEKPKEKPTESDSMDTTIGENTTFDFVISTTDNTFIDKNVVM
FT                   KNILITFDDNSMNFWSSLCARSVLLDEILESNHSGFKFKKTFSIQLLKLSLLLLKEPVV
FT                   ANIACNIVFKLVFEQKTNLSELIDDSVIIQLETLIDLSEINGPYKITEESFQFWYAINK
FT                   LAIEVNLSKKNFLGRRIQDWMLAKWDITFSPGEDFVSVGSSVANFMYWLSGNSITYSPA
FT                   TTQKSIYEGEICEFYCFAQSYENLEKFLCLKSVTDIKEIPKFEIISIASSDRIDTILNK
FT                   VNLTFMAFDRSSVASGSLFHWIIVLSNIVAKVRFIKFVTHELTGLQYQLSAGLNSFKDI
FT                   TLSCEEIIGVMEMVNKYLPTDPDTIQIFIQNFPSEKLVNTIKFDYPGLTDKDNRKSFPE
FT                   DGFGREFSRVRDATTPPFTASTSAMSFMKLNYKKIQSLEVSKFIIITADIEGKLQSDIL
FT                   TSFLNYIETLGTDDFLPSLLFAVENIFTDHSAHFLDEIQLARLLRIINEKLLTTQNYEK
FT                   NEFALVVISQFLSATAPIWINSSDSSLSSDFYSLVSRLYQSGRDDLILTEASIIEYCKF
FT                   LAQFITHNDERVFSNTDIKNELLEKFSNSPNNIKDRLAQSFGELVSISTIQQQGQIYSD
FT                   LFDRFVNPEQSVESAGTYTKFFTNLSQSSLHILRLALFNLLECSRFPFFIPYLETCLKE
FT                   FCKIMKLDDANRLFKIFKFEILRNWWKYDSIDTFPFVLFSYTDLNSFYRDNYRELIAVA
FT                   LSTKSKSREISNEFVEQLADLKQSHIETLVAESLSIIVPLSYCKDGVRNDMFQVLLDYL
FT                   KDTLKQEFIDKLPLIVLEIIKFTEISNEKSFESLGTDKSLAIFLADANSSSIIQTAGEM
FT                   VISFDSSVQLLKKLVEKYHQPEHETFWSSRQIYFLLRRLSISLKSATTLEHKIIFLRKF
FT                   KFVLILGGKKSVDYAVSRLLVDTLCPLLLDEPSISTDVFLILQLITDVYSHRYTYEKSM
FT                   VLIIQIINSLLASKAVDRSSSLLDCIDDFVNTGDQDRAICQLLKSSIAILKGQSVEIES
FT                   SLVELCLEESGPDYIKQMILISRIFGNVVFATSHSGSKLTVVEKLLTISKNQIQEFSDG
FT                   FKLWISGYLSDFYIEGGCKEDVKALTFDEYEGIPVNDFENEVRSFDFTLKSIEKFIYKD
FT                   DFQAAACAESIIGVLIRKYETNKREVSKFLNFETMVEKYSDSILPIDFHTCVILNDKAD
FT                   VEYLGDDLVDIIGNFELFLLNGTELWCTKLYLALLQELAVETSIAPLLSTFVIMVPEFA
FT                   KTSLPVLVCNYLAIKRSHSQDRIISLLNEFLHTSKKSESSIKIFLQILILIRVGAKIFK
FT                   KPIFANVFAKIDKLKFYQLACEVKQFKTALMLFEDVASDNNSDLHLQDHYQTLQHVYES
FT                   LDDDDLVFGLPERTTLEYSISMINRVGSSEDKLRFSSAGFDTDMMLHQEPSYSNIVGSL
FT                   STAGLLGVSRALSKNASFESNDDSQYEWSWKLSKWDLPISKNATKENEVIYKTLKQIHD
FT                   FPLNSEEICSTSLLNAVDNKVSATDMSVKEFKQEGINWLKTISTVASIAEIANSTGENI
FT                   IPMTNQFVEKTQWFGEVEFSMFENLLLARQSTFGLINGRPLLSSPSDAAWIGSLYDLVR
FT                   YNNLARANGEYQKMVTSTMLVDKVSKKLQSSSLDMVAINANNLASFQTAQTLWSQGNTN
FT                   VPVMIMKDLYAAGGIEMSENFLKIDPCLIRAIMVDWMSQSRQEVASSIMEKYVLPTEES
FT                   SNYMTDLQQQSKIFAILARFCEAQYKSKSLSEKISKLEKRVLNKENEIKDLKRQYEKVT
FT                   VTHAEQKQVQQYYNRLKRQFISESKDLESLRKSKQLFSTKAVQYYMKSIIVDDFEEENL
FT                   DKFFSLWLEQSGNNELNQTLQSDLLALPSHKLVSWCTQLISRLSNETNGFQILLKKLII
FT                   NLCLDHPHHSLYLLLSLKKHKPGANEVLNPSLLSRCAAAQAIWDQLLQQDHRYVSEVLL
FT                   PIDGFTDHCTTLAAYKVSKGKNIDLTKFPSGEYWLNELPAIPPPTKTIKVDPNGQYKNV
FT                   PVLHSIDKKIQIATSGLSLPKIANFTLSDGTEHRVLLKHGTDGIRQDSIMEQVFNKVNN
FT                   IFAKDRECNKRGLTIRTYNAVPLGPLSGIIEFVPNSMAFIDVISGYHQIHDKISYDKAR
FT                   EIMKSCQSGDKQKRIHSFEQIETKIKPVMRYFFQETFLTSDSWFESRVKYTHGIATSSI
FT                   VGHILGLGDRHCNNILIDRSTGEPIHIDLGVAFDQGKRLAIPETVPFRLTRDIVDGFGV
FT                   TGVEGMFKKSCEHTLRVLRSNKEHIISILDVLRWDPLYSWTLSRFKKRKLQEDETGPGV
FT                   QPEEEGSEAGTAIMTVIEKLNANGLSTEAAVRELIQEATSTQNLALIYFGWSPFY"
FT   CDS_pept        580227..581027
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574612"
FT                   /orf_name="CD36_63030"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41200.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG397561"
FT                   /db_xref="InterPro:IPR014751"
FT                   /db_xref="UniParc:UPI000192DAF3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY2"
FT                   /transl_table=12
FT                   /translation="MNKETHEGEKILSGIILRIPLIIEDKETSETIKNSSLWLHVSRGD
FT                   YEPSNSPLFINKSLTAICSEGYFHKTLTTDNSNRVFRRYIPNIDLSNDKHFALLNNLFP
FT                   LDLESLIEAKQTTKDPTQQQQLKLTAKLISDKSKYDANNEYLEDIEPNKNNIVLSIKTD
FT                   AKYAVTIGTIELPSIEIEKHPYLNDEENLLNWMELYNYQNESLLELLIESNNSLDQLKS
FT                   ENQELESNLELTKNDYNKIIEDLESKFYLALNSKKDKIFELTHK"
FT   CDS_pept        complement(581506..583176)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382844"
FT                   /orf_name="CD36_63050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41201.1"
FT                   /db_xref="HOGENOM:HBG397559"
FT                   /db_xref="UniParc:UPI000192DAF4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY3"
FT                   /transl_table=12
FT                   /translation="MEVANNQPAPVLNTSILADVINEIQGNWQHCNNNNLFPPDSQLSP
FT                   EIQQWIKNTVPTLISLAKTDENFNFPVNEGFSDLIKRFLQLPTIRTELISAYPYFIALL
FT                   RFPAIDASFYRRMFDPDYLRINWDPTEFVVKRNFIIPAGGRFRNRVKWMSRVNSSRIGP
FT                   PASTGQPQNDMFIQIMHSTNVNGIRNDRNMPNAPPGPGPGPIPPVATANGAQNIQNVSN
FT                   LSNDTSHGSLVRLPVSIQLFSEGVPAHSRLTKFFYPDALPDDLTIDSFDQEMSVDEFKL
FT                   CFASSCKYYRWGVRRTPTYVYLHCKMGRINFASEFNNQDSGCPAQIKLKVENNRIKMTY
FT                   SFHHNHSFFKYEKDYTPIIKKDPVRAWLIEQALQGKDWAWVNANKEGVNIAGDVVNIDL
FT                   SKKINRRLYFQIRRILGVETSDQPDESEEDVEEPVSPSTNRNNQHEGNYLFNDETHGSH
FT                   QNNSYDFPSNDYHGVSESPPDFDIPNFDQSEDNNHEAETEANNRVVLKAECEEILKYVQ
FT                   TTMENAFEVLHIERLHDLKGFIKRTAQEMQQEFSPNHST"
FT   CDS_pept        585020..586663
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574613"
FT                   /orf_name="CD36_63060"
FT                   /product="Pantothenate kinase, putative "
FT                   /EC_number="2.7.1.33"
FT                   /function="ATP binding"
FT                   /function="pantothenate kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /protein_id="CAX41202.1"
FT                   /db_xref="GO:0004594"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG736409"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR011602"
FT                   /db_xref="UniParc:UPI000192DAF5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY4"
FT                   /transl_table=12
FT                   /translation="MPVFEKKDTVHTNVPSPRPSTNSHTSSTYIPRYRLSITTNEDINL
FT                   QSIDPGTVKIDCSGAFIANDDLLRDTVPDINDENNNSSSSTSGTPPSSNTSSDLEEEEE
FT                   DEFDTEENGGGVSDSSSTTVEDDENQLQQLQQQPLYGGVITKNNITLPQHNDEIIHISV
FT                   DIGGTLTKLVYFTKSSSNRKNSTRKTAGGGGKLHFQDFQTENFKNEAMKFMIKLIQKSI
FT                   NKSNINPPITYIMATGGGAHKFYNLMKKTFKKHKLPMKIIAKDEMECLIKGLDWLITKI
FT                   PQEIFTYDLTELTTKFEPIQSKKEIYPYLLVNIGSGVSMVKVTKPGPEGFERIGGSSLG
FT                   GGTLWGLLSLLTDAKDYNEMLEMAQNGDNENIDLLVGDIYGTNYNKIGLKANHIASSFA
FT                   KVFKKLRKFNTNTNNTTNSDNDSNKFKKLTAAEKLAQFKQEDIARSLLFSISNNIGQIA
FT                   YLHALRFNLKRIYFGGSYISGHMQTIHTLSYAVNFWSKGEMQSYFLRHEGYLGSVGAFM
FT                   MGPAPILEENGNLSNENTNTSIKIANGVQH"
FT   CDS_pept        587735..589297
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078573"
FT                   /orf_name="CD36_63070"
FT                   /product="Peroxisomal membrane protein, putative "
FT                   /protein_id="CAX41203.1"
FT                   /db_xref="HOGENOM:HBG397558"
FT                   /db_xref="UniParc:UPI000192DAF6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY5"
FT                   /transl_table=12
FT                   /translation="MSDIELINPDQYQQVRSNRYQQTPILHTLQQQQQQQQSPSNSTSP
FT                   QQQQYSINTSNFPYRRSPLHPTSKLYSQPQQSFNSEWVEDQSYNNSPSKLSTLLELERE
FT                   REHNNNTNNMAGTSIDPSKFETPSKSSTNQLNFNYINTPVSHHKLDNNNNNPTKDNYTD
FT                   NNDEYIEKASTTSSSTTIATRLPKVSNWDIFWSMLNDLVGKDKMAKVGQYTLRLLVYHA
FT                   GKSQTYLSDNNINIKIINDRYNDITKKLNLFKNFLNHPADFIKIIVILFLSIFKQKAAG
FT                   MINGLSMYRQFLRFGKTPFRIRDLIVKFHNNVLSNSSNEKVQINKSKIFDRKTLGQFLS
FT                   LYYGINDESILLYKLNVLSNGDYKKFVIKHESIAWHCETWLALYNAYENLQNLLQQEMD
FT                   LKIQIQVKNKAKQLSKQILLGGNGSNNLIGFNISTTTPTLNNEDAKNLSQIQFKKNNAW
FT                   IDIYKNLSDLAFNTYTVFNIALPFDTWQIWMGISASVLSTIKLYRETKQKMIEKELGKL
FT                   KSD"
FT   CDS_pept        complement(589418..590638)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574614"
FT                   /orf_name="CD36_63080"
FT                   /product="Cysteine synthase, putative (O-acetylserine
FT                   sulfhydrylase, putative) (O-acetylserine "
FT                   /EC_number="2.5.1.47"
FT                   /function="cysteine synthase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="CAX41204.1"
FT                   /db_xref="GO:0004124"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000192DAF7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY6"
FT                   /transl_table=12
FT                   /translation="MPINWKSTLQTSASVISLFIIAKELYNLYITTISPSKNKLHSKLT
FT                   LLPPRTRGIESLIGNTPLIEIKSLSRQLGCKIYAKLELCNPGGSAKDRVALAIIRAAES
FT                   SGQLIPNANNIIFEGTSGSTGISLAILCNALGYICHICLPDDTSSEKLQLLKSLGAELE
FT                   PVKPASIVDPNQYTNAARRGALAVNQNNNNNNNNSNDSQRRAIFADQFENDFNWRIHYE
FT                   TTGPELLQQMGQDKIDVFINGSGTGGTIAGVGRCLKEYNPKTKIVLADPQGSGLANRIN
FT                   YGVMYDSVEKEGTRRRHQVDTLVEGIGLNRLTWNFKQAEPYIDEAIRVTDDQALKMAKY
FT                   LSINDGLFLGSSSAINCVAAVKMALKNGPGQKIVVIACDSGARHLSKFWKEAAKLSNDL
FT                   TLDDVLQ"
FT   CDS_pept        591263..592345
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574615"
FT                   /orf_name="CD36_63090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41205.1"
FT                   /db_xref="HOGENOM:HBG397557"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniParc:UPI000192DAF8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY7"
FT                   /transl_table=12
FT                   /translation="MLLSFAIVVAIIVVGYFTVLHFWSIPNHSSVINNIPPVASNFKWE
FT                   TQQPLPIRPFVNKKNFNPSMAIKNISDSPQDWLLIENTYYNNVKQRQKHIELEPDILTF
FT                   IHNNDQTKQAVSEFYDMVTQFILSRYPMYFKYDFWSGIITNTITDDKFPKYSKSLIPNY
FT                   QSMVEILGRNIEEDFLILIKNNPQNKEEEYIMRASMNGFPAGFDPRVNFNQPISFIHQP
FT                   VPQYKSKLQFSMSKFFNNLHPNKLWVRHNWGVQTHNSYFNMDTNHGRPGERIHQLSMNE
FT                   IDFDNDGCCLRCERQLFTRMPQSGAIIMTIRTYLTPMKQIKQEGLGQELSRAIDGLPDD
FT                   LAFYKKRSAWGEAVKEYLSI"
FT   CDS_pept        593060..594373
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535617"
FT                   /orf_name="CD36_63110"
FT                   /product="Alpha 1-6 mannosyltransferase, putative "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX41206.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG397556"
FT                   /db_xref="InterPro:IPR005109"
FT                   /db_xref="UniParc:UPI000192DAF9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY8"
FT                   /transl_table=12
FT                   /translation="MLSAELKRRKKLLLPLALISGIIGLIFFTNYNYSFTTTSHPVLSS
FT                   SSITPHKSNSAFPKLDQSSSAKAKPNPGNLIVNHQNDKSKTDTYFTKFTHKDPQFDYTK
FT                   ITYTSTNKNFITNNIKVDEETGETTEVVNKPTVLIMSVIGNNEPYGSDRYFDQFMLTVL
FT                   SLVENQPDYEFSLGLLNNNNEEFIRIQDYFEKNLQKDLPETLSSIFKSISLISAPFLDQ
FT                   NTGFSREQRHDDRVQRLRRRLIAKSRNFLLLNSLNLEQYVLSLDADMVRFEHPEKFIKT
FT                   FIDSKKDIVVPRIERPGLKDYDKNSWRGQRTKPTKEQLDKMDNNQWDQWNYVPHDVKDH
FT                   IYHFQTYLDNKDNEYDLHKDEYDYIVPLDSVGGAVLFAKSIVFKQGVVFPTSLIVGTTW
FT                   DRQEGYDGIETEGVCYLAKPLGFSCWGMPNVVAHHSGG"
FT   CDS_pept        join(complement(597485..597503),complement(595138..597413),
FT                   complement(594535..595044))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094301" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382845"
FT                   /orf_name="CD36_63130"
FT                   /product="Inner nuclear membrane (INM) protein, putative "
FT                   /protein_id="CAX41207.1"
FT                   /db_xref="HOGENOM:HBG397555"
FT                   /db_xref="InterPro:IPR018996"
FT                   /db_xref="UniParc:UPI000192DB98"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIY9"
FT                   /transl_table=12
FT                   /translation="MDHLKEDFDPTTFTVAQLRKVLNLHAIQYDSSAPKSTLIEIFNKE
FT                   IAPNSKKLLSEYNAKVENMNDDGFVNASDVEKPSEKSTTSEKASTLFVSDTESDDSNEK
FT                   INVSKSRNKTKKISKPKSRASSGTRNSTSRSTSRTKSPESESDTESKDDEAKPASRSSS
FT                   RLSSRSNRSKPLNSLFDLDDSVLNIRKSSKNTKAKSRNTSKSKTKKTIESTPEVTESSD
FT                   IEKEKVEQQAKKETEKVEQPAKKEIHKESTPENTNFSKENVFQSPPGSSTKKRKHQDAE
FT                   EGDDSTLVKKIKPSQRTAEENRSLFEDDNDSDVEFIEEFIRTETKKKAPVARSGSTQTR
FT                   APSSSSKKEHKKKETSLISPGSASKIKKPKSSSKRVTPKKSGDRSVSSPTTNEKSFKSI
FT                   EDETKDFDAELKKIQSKKNQSQASPDLAKSLGITIQGFEPPVVTPSKAKDLTPAKDEST
FT                   PVTNIEKQSIGNNRTSRKETPKNLNRSNEKTKKTYTKIQTARKRSSNTSTPSAKIKSTK
FT                   KLSPLVTKSALTPKPRLISLGSQKYETDDESDEEDISELTKPVSPTKNDSANASTKHFA
FT                   LPFSIRRLLLSMFLWVLICSGGLFGLWYYEQKYAVGYCGQEIDSPTFANSDNEYLNKLG
FT                   QVLDTNFKPECINCPLHARCYTNLEIGCFEDFMEYKPWYDFIVPGHKKCIPDTKKAEKL
FT                   EIMIDVALDLLRSKNAAIQCGQNPNDEESGIKLNDLHDLLLSMKAPYITIDEFEELWDR
FT                   SVIELEKEPDIIKRHSNVATNEFTFDFDNAETESKDEYKILRSTSLSNISLKCQIRNSI
FT                   MGSVTEHKYKLLGVALIIIITKIIQYKYKQYQLYSVKIDILYEEVLKKLKMQSNMSKEN
FT                   SEINSYIGASQLRDLILSNEDNLHQRITMWKDVSVKVEHNSNISSQIVENNGEIMKVWE
FT                   YIGI"
FT   CDS_pept        597795..598742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574616"
FT                   /orf_name="CD36_63150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41208.1"
FT                   /db_xref="HOGENOM:HBG397554"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI000192DB99"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ0"
FT                   /transl_table=12
FT                   /translation="MSEAPILSYKKPSSNKNSFSVSGSTPSTPVLSHSGSPVPPAIQSP
FT                   ASIDSPRSSTSTTNAGSSTRKVSARRKALQDFYHLNSNQDKVPSNGNDTTNEDASNKSN
FT                   LNDIENLIKTAPIEEILKIRNDLTAKLNSSNQTKKSIIYDNYYELIKLSNTLSDLSTSK
FT                   PKRKSVSTGLKIFTDDEDKREGDGDKKSTELTKEEYVDQVLKELSEFATTEAPTFNGTF
FT                   NEVLGKLKEQDEADNSSMVVLNDDKLTEKIESPEDIAKQISHINYILNLSLRMNVDETE
FT                   REQAIEYIDKVISDNPENEILSLQLGKIKHDITT"
FT   CDS_pept        complement(598765..599682)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229979"
FT                   /orf_name="CD36_63170"
FT                   /product="Subunit of RNase MRP and of nuclear RNase P,
FT                   putative"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /biological_process="mRNA cleavage"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleolar ribonuclease P complex "
FT                   /cellular_component="ribonuclease MRP complex"
FT                   /protein_id="CAX41209.1"
FT                   /db_xref="GO:0000172"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0005655"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006379"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG397553"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR016848"
FT                   /db_xref="UniParc:UPI000192DB9A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ1"
FT                   /transl_table=12
FT                   /translation="MFGIEKLYQDGITIFFLSSTLQIEPPLMSLQADTELEKHLLSRCY
FT                   DSQSKIVELLKDRYSVTGSQKPTILFKNIVTDTKKPKSLLHQENTQPTKITPERKKTTR
FT                   QELREYISSTLNNQRKLIKKIQSHNRKKTTKQPFPINRYLQQYKIPNFDDFFQMNELWQ
FT                   KYAQDLVFQNGNSMQSISNILPRLTAADFNGCLLSVLQSRNTNVIGTRGIVVWDAQHSF
FT                   ILVVPRNEDSKEWNEEKSQFSPSEMVGGLKVIPKKHTMFGFDIIDPRNEDDCYGFTIVG
FT                   SRFEIRSVDRSGKKFKNHSVDDIL"
FT   CDS_pept        599750..601111
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574617"
FT                   /orf_name="CD36_63180"
FT                   /product="Lipoyltransferase 1, mitochondrial, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="ligase activity"
FT                   /biological_process="protein lipoylation"
FT                   /protein_id="CAX41210.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0009249"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397552"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniParc:UPI000192DB9B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ2"
FT                   /transl_table=12
FT                   /translation="MFLRRILPRHLLSIQRRRISHVNVPFEDDLIGFEDDSLADFQHYQ
FT                   GPQSPPPIDQNSAPTTGTDKTIAQVPFQETFAVPQLPEISKSKNPVIFVSKLTNPYMNL
FT                   AIEDYIYNAMPKPEGAKDNSFDRLMFYINTPCVVIGKNQNPWQEVNLPVLNSLGIPMLR
FT                   RRSGGGTVVHDLGNVNYSYMTTKANFDRHKFASYIVEAVNRASPRFKIETNERGDIVSE
FT                   KLLGLNYKISGSAYKLSKGKSYHHGTMLLKSKLDILGKLLHRDEKQLGVVDSKMSIPSV
FT                   KSKVINLEMSSDQFIDVVSQKFKSLYSVASEEDKEMGEFNEMFGLTDFAKAQEVTLYVI
FT                   DDATTIPEEIQKTADELKQWSWRFGHTPKFTHMFTNEKYGLEVLFNIEKGCLKSFKLTF
FT                   NDSNSDSREIKKSFQYLETYIKNNDLEYTGSNVAGFVLHDEISDWIGESIDGTI"
FT   CDS_pept        602303..603367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535618"
FT                   /orf_name="CD36_63190"
FT                   /product="3-hydroxyisobutyrate dehydrogenase,
FT                   mitochondrial, putative"
FT                   /EC_number="1.1.1.31"
FT                   /function="3-hydroxyisobutyrate dehydrogenase activity "
FT                   /function="coenzyme binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /biological_process="valine metabolic process"
FT                   /protein_id="CAX41211.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0006573"
FT                   /db_xref="GO:0008442"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG729179"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192DB9C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ3"
FT                   /transl_table=12
FT                   /translation="MLRTSIRAFSTQPRLSTNYGFIGLGLMGQHMARHIYNKLEPSDKL
FT                   YVYDVDPQHTTQFLTEVTTQTPQNAPLLTPLSSLKDFTTEVDSQLDFIVTMVPEGKHVK
FT                   SVVSELIGHYKSTGNYDPSIKTTFLDSSTIDIPTSRDVHQLVKSSIPEFDFIDTPVSGG
FT                   VAGARKGTLSFMLSRETHDDIDPSLTTLLSKMGINIFPCGATHGTGLAAKLANNYLLAI
FT                   TNIAAADSFQLAKSFGLNLQNYAKLVAVSTGKSWASVDNCPIPGVYPDNNLPCDVNYEG
FT                   GFITKLTRKDVVLATESAKFNNRFLMLGDIGRHWYDKACEREDIANRDLSVLFEWLGDL
FT                   KQNEKGDVIDVKRK"
FT   CDS_pept        complement(603532..604230)
FT                   /pseudo
FT                   /gene_family="HOG000040465" [ FAMILY / ALN / TREE ]
FT   CDS_pept        604946..606838
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574618"
FT                   /orf_name="CD36_63200"
FT                   /product="LPF family protein, putative "
FT                   /protein_id="CAX41213.1"
FT                   /db_xref="HOGENOM:HBG395681"
FT                   /db_xref="UniParc:UPI000192DB9D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ4"
FT                   /transl_table=12
FT                   /translation="MCILSTMFKDTKKKILWHASTPDCDCNSFQVSFSNWKKGITQYGI
FT                   YPKVIHMQDMEQYKIFLGAFPELLTGSLSINGNFKKNKDLDSNALLEFLSDSKVRFDSL
FT                   QLSDFGDLGTFPSTATTISLIGTSLNRYEIPGVKKMTIKSQSEETETFTFSSDLEDLEI
FT                   VVSTRLSLILPQNLRKLNINTYILSVDFMSEEMANLEYLRLKLSCIESFEDTKIIAPNL
FT                   KILELDRCLELSNYDGLQQFQKLRCLVVIEGNYPVSLLNECPFPELETFKYHGDRFPIL
FT                   GGPDNIKLTFPSNLKSLSIECFDFVNAEFNTLVLPTTLKHLHLASISIKDEYLHLGENL
FT                   QTVHIYTWRLTLESSFRIPHMIEKFTLYTHYLTVESLDFMYHLPNRLVKLHLFAYKQIK
FT                   RDPFTQKIKWPLVLGELDLRGFRIDHRALELLNLKESRLQHINISGGDVRKLNVDLFPV
FT                   SVEILILSYLKIHELPESFERLENLRRLSLMRNQLRKIKPVKLPVASLNHLDLFQCNIR
FT                   LLSPFLVSMYEEKNRNAVLKVFAPGNRNVNVIDARRVMKEFKGLSLALADFDETLKEIS
FT                   KHSSRLECLSHSDPYFDKSEFSGTEEVVSHYDPEDLYNGSEFSSDEEDNGSGNK"
FT   CDS_pept        complement(607564..608265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000040465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535619"
FT                   /orf_name="CD36_63220"
FT                   /product="Ribonuclease H, putative "
FT                   /EC_number="3.1.26.4"
FT                   /function="nucleic acid binding"
FT                   /function="ribonuclease H activity"
FT                   /protein_id="CAX41214.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="HOGENOM:HBG742437"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000192DB9E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ5"
FT                   /transl_table=12
FT                   /translation="MPYYAVVNGREEGVFSSWQECRPHVYGYSGAHYRKFENRYEAEEY
FT                   YQNDGDYFIYPIYVDGACRHNGSPHAEAGYGVYYGDGDSRNVSVPLDDVDPDGLIPTNQ
FT                   RAELWAMNHALRNIWNELEEETEDGKAIIYSDSIYAIKCLTDWPQKWTRNGWLNVHGQT
FT                   ISNYDLVTKNYELYEWINDEYDDRGWGQLNLIHVRGHSGNDGNEEADNLANLAADRYGY
FT                   QSSSSSYGSYY"
FT   CDS_pept        complement(608960..612193)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078574"
FT                   /orf_name="CD36_63250"
FT                   /product="A-factor-processing enzyme, putative "
FT                   /EC_number="3.4.24.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41215.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328356"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000192DB9F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ6"
FT                   /transl_table=12
FT                   /translation="MKIPSLKLTTARSPFVSVSKYYSGMSNQFTTLSDDKTIEKPLLDD
FT                   RSYRFIKLNNNGLRVLLINDPSTDKAAASLDVNVGSFTDKEYNISGLAHFCEHLLFMGT
FT                   EKYPKENEYSNYLSKHSGSSNAYTAAEHTNYYFQVGADYLEGALDRFSQFFIAPLFSKS
FT                   CQDREINAVDSENKKNLQSDTWRLYQLDKFTSNLAHPYSGFSTGNYQTLHTDPVAKGVD
FT                   VRDILIDFHKQHYSSNLMSLVILGKEDLNTLTDWAIEKFAAVPNKDLSRPNYKGELVYN
FT                   PQQLGKLIKAKPIMDNHKMELNFLIPDDLEDKWDTKPNGYFSHLVGHESKGSIIYYLKQ
FT                   KGWATDLSAGAMTVCQGTSNFYIEFQLTPKGFENWQEIVVITFQYLNFVTDDAPRKWIW
FT                   DEIEEMSQVNFKFKQKMEASKTVSTLSNKLYKFDEYIPASYLLSSAIVRKFDPEAIKRF
FT                   GSYFTPENLRITLASQLLAGLNKQEKWYGTEYEYEDIPQALIQQIKSQPYNGNPNLHYP
FT                   RPNNFIPTNFEVTKAKSKHPQVAPYLIEHNNKINLWYKQDDTFEVPKGSIEVAFHLPSS
FT                   NTDINTSVMSNVAIELLDDELNELTYFAELVGLKVKLHAWRDGFLINVSGYSHKLSNLL
FT                   QEVLTKFFQFEPQQDRFESIKFKLLKNLKNFGFQVPFQQVGVYHLQLLNEKLYQQDDRI
FT                   EVLQKVTYKDVYQHFKQNIWQSGIFAEVLIHGNFDVAQSKQIRDIINESMENVKPWMDK
FT                   YNEEQFHLQSYVLQPNETIRYEVPLKDTANINSCIEYYIQINTNADSLKLRVLTDLFAT
FT                   IIREPCFDQLRTKEQLGYVVFSGTVLGRTTLGFRILIQSERKCDYLQYRIEEFLAQFGN
FT                   YVNNELSTEDFIKFKHALKNIKLTKLKHLNEETARLWSNIIDGYYDFDSRSRQVEILEN
FT                   ITKDELVEFFNTFIAKSDNTGKLITYLKSQNPTEFTESKKLHSGIINYLYRNQIEIDHE
FT                   LIDNLVKQYGEHKDLVLVAKELSDNINVNKDKLLKVLNKAISYPVPEIYPTGKLVVNDE
FT                   EFRKNRELSGKPKPVNALTKFLYNEQSHL"
FT   CDS_pept        complement(612776..613843)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574619"
FT                   /orf_name="CD36_63260"
FT                   /product="Regulator of (H+)-ATPase in vacuolar membrane,
FT                   putative"
FT                   /protein_id="CAX41216.1"
FT                   /db_xref="HOGENOM:HBG397550"
FT                   /db_xref="UniParc:UPI000192DBA0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ7"
FT                   /transl_table=12
FT                   /translation="MTTNILDNKAFIDSVLSIQSIQNDKELHWYIINMILPDLPQIIET
FT                   LQICSNLLMYNSPQEPDSKQCIEKGPSIKLPLSLTNQQDSVNGTITRDGPYITNLKLTV
FT                   KNHYFNKYFYKLHLIKPMVLEQLVNVLNLIRDSIEILQNLQSIDKELSVLSEKEDNQHT
FT                   VKHDQLINDFKRLLVNIHDSKTNLQLPLDPNLIFPLRVTDGESFEPQLSDRVAVDFYLS
FT                   QNQVCIDLKSLHRITEKPWCEIDDNGKSFVDKLREEMKNKRSSVGDKSTSDAINQNNNT
FT                   NIFSNMMSHLSLRHKYDTMDYITRCITYNNMVVVVNKKFEVSTEDPILISCFTKLDSLE
FT                   SIIKGYIYSLNSFSM"
FT   CDS_pept        614561..616165
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574620"
FT                   /gene_name="RBF1"
FT                   /orf_name="CD36_63270"
FT                   /product="RPG-box-Binding transcription factor, putative "
FT                   /protein_id="CAX41217.1"
FT                   /db_xref="HOGENOM:HBG397549"
FT                   /db_xref="UniParc:UPI000192DBA1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ8"
FT                   /transl_table=12
FT                   /translation="MSSNKNERDLNIPTASASIKQKQRQQLGIKSEHGASTADVYDPQV
FT                   ASYLSAGDSPNQFSNTALHHSNSVGYSASAAAAAAELQHRAELQRRQQQLQQQELQHQQ
FT                   EQLQQYRQAQAQAQAQAQAQAQAQAQREHQQLQHAYQQQQQLHQLGQLSQQLAQPHLSQ
FT                   HEHVRDALTSDEFDTNEDLRSRYIENEIVKTFNSKAELVHFVKNELGPDERCKIVINSS
FT                   KPKAVYFQCERSGSFRTTVKDAAKRQRIAYTKRNKCAYRLVANLYPSEKDSKRKNKTDE
FT                   PDYNEDNSRISEMWVLRMINPQHNHPPDPVNKKKRQKTSRTLVEKPINKPHHHHLLQQE
FT                   QQQQQQQQQQQQQQQQQQQQQQQQQQHNVNSLAQQQAAQLQQQMQQQLQASGLPATPNY
FT                   SELLGQLGQLSQQQSQQQQLHHIPQQHQRIQNQPQQQQPQAHTQGLEQPDAAVIAAIEA
FT                   SAAAAVASQGTPNVTAAAVAALQHTQGNDPDTQQEDPAAIDSNVDPSLDPNVDPNVQAQ
FT                   DHSHGLQNSYGKRGGFL"
FT   CDS_pept        complement(616455..619058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574621"
FT                   /orf_name="CD36_63280"
FT                   /product="Positive regulator of mannosyltransferase,
FT                   putative"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAX41218.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG398338"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniParc:UPI000192DBA2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WIZ9"
FT                   /transl_table=12
FT                   /translation="MSLVKSITSTKQSNKLIKGILFTLVLMNLIYFTLVIHNNNKESIS
FT                   LIASKLSSPANNKDQSISNTADDELLSSSKQQQQDTHESVLEEHEKEQQKQQQQQQQQS
FT                   LSDEDIQFKKLVDVKLNSIKKNQDKYYMTDTDLHETKINVPIKQFLRKYESSESWINKN
FT                   ELYYDPRFTLSIYLNELYMQYLEMSDEQLIDANDNQHLIGGKINSNELPEISLPFNWVD
FT                   WIDLTMLNKELSKPMDQRLKCHDIQENSHSRPDTSYFCTDNEDISEETFQQFFKMGYKY
FT                   KTQFPGFIINDHERHEHYCDNDYRVMQAKAYTMTHLVNPLKVIILGDDKKDSNGGTFEF
FT                   NVDNSNTRLTSSKLIDRYMETHGYYTHKQDSNVDIVRNGKRFFFDSSEDQNEVPDTIEM
FT                   DYLSIWNKLNEKVVPKYLSPNETGYNNFLNMRDKNVMVLQESKFMEPPSIASQIQQYTG
FT                   KPEAELSPQEKLYLQGLQECSKYTDKNEIRYFRMAVINPGDPKNRENEWGWHYDWRFFN
FT                   GALNYEKPNWNQQELTHRTNIILDRLLRNWSKFAMEKGIITWIMHGPLLSWYWNGLLFP
FT                   YDNDIDIQMPIDELVNLAKNYNQTLVVENPSEGYGKYLIEVNTYFHNRGISVEQNHIDA
FT                   RFHDVDSGIYIDITALSSSNAEVPGEYKQEKTIKLIDDLAKPHSNEDKGEQINSENQLI
FT                   FNDRRKHFYKIDQISPLKFTMMQGIPVMVPNQITNRLQFEYSKGLNSLEFDDWFYIKQL
FT                   NLWIHKDNIIPILNDQTKTSKEDILKQIQPPSSLSNDQILKLLNNEEILQEYYLTKSLT
FT                   RFHDFEKQILFDDNGNDKPIDLIKYKTYKKGLKMVKPLRKALYEYENIERIKHHH"
FT   CDS_pept        622108..625497
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078575"
FT                   /orf_name="CD36_63300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41219.1"
FT                   /db_xref="HOGENOM:HBG397547"
FT                   /db_xref="UniParc:UPI000192DC42"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ00"
FT                   /transl_table=12
FT                   /translation="MFKECIGCSQKRLGDEPEDDRSNVLCPICRMTRYYNAYKKYITSK
FT                   LRSKSKAKRTSIERKLRKFMTNKFHITTKLYALKQLTSSHKSKEYSQVKLFLLSDRQIK
FT                   FIFNNNKNISSRLCLREIERLEYSDKAQEELLQLEETSSSCRSSDNENNDEIAEVPNRA
FT                   GNLAEEQPLPNNQNSKQIFDTNNNGISHNVIGNGNNEDTLMNDIDNNEKSSSHVSDDSE
FT                   VSQTRTGNTVLSTDIAAENSKNGATDSVILDMHEPLDLGSRNGSWEPSRDVSPPNEYAF
FT                   ILEESPSTVKSPSSLLAPDPATAEKPISQDTTFTGHVYKLKPSKIAKPSHNERTNDAQL
FT                   HLMVQNLRRNLSSIVFRQNQSPNTDMNDAAVDTTASPPITNNLPEQNKTTTQVEHSRQT
FT                   ASPELAGSIPQSHSSETSTLIDNTSPVTDPAIQTTLSPTKRFGCCKRPKPSDMPPECLS
FT                   FSTCPRCLIRHRLHRDTLQALSKVIKLYGFYQMHRYYNKDKEYIKLAMERDPYLEELGS
FT                   RTFDYSIELEKLRAEENSKIEQSQSQQNASINLKSATNSNSQSLTDLEVVETNNQIFRT
FT                   HDVPQQTGNLSQQESSFNRENSAQAESLPIQENIASQANVSNRESSLEQNEIRSDQHTA
FT                   SNENALPVEDDLDTLDKHAEVSIKPEDNVFENDTGHSNDDNPATSDKEEESGHDIEDSN
FT                   NNENADTNTSTHRNSSQDNVADPNENTHNNENDVNANVEDNAGIVDVQRNSNDKREHTE
FT                   SQNKSDSISKVEYGDEAKHIIQDSSTNGGDKQKVTNTGSASTSPNEPIIQFNVDDLSRT
FT                   SSSNSSIQEIPQIGNPPVTRAYSAPIQPTSSFDPSSSQPTNVLNSTSQNIDVDKLITTI
FT                   NNTTMPERIPTPNNPVSHGLLPNQVQRLNDPVTTGSVASKTICSICKQIREPDEPFPAS
FT                   KSPSCPKCTLKVALLKGQSNTVFGVTKLYALKQVYEWQNYSSFQLRTMFLDQDMYLSQF
FT                   NTRPFNFVCEMIRLSGPPSPYRPFQPPEFPSFLQRMNRVCQKCNASILDAFNEMKNYSC
FT                   CAKCTLVDGIANEYSHALSNSVKILALKQVLEGNTLEDNQLVLKFLFDKFLQQYKGKKF
FT                   DYEIELLKYKTGDENYDEFPLH"
FT   CDS_pept        complement(625747..626271)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022909" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535620"
FT                   /orf_name="CD36_63330"
FT                   /product="Uncharacterized protein YKL069W orthologue,
FT                   putative"
FT                   /protein_id="CAX41220.1"
FT                   /db_xref="HOGENOM:HBG704019"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="UniParc:UPI000192DC43"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ01"
FT                   /transl_table=12
FT                   /translation="MVHADYSNLKSGEFSKEETLQHVLDSYKALETDNWVANLSNCSSL
FT                   IWHAYKSLSINVNWTGFYLTIENSNDQTLPKELILGPFQGKVACQLIKFGHGVCGTAAS
FT                   EQVTQLVPDVEKFPGHIACDGETKSEIVVPIVKNGQTKGVIDLDCLDLEGFDKVDQEYL
FT                   QKLAELIAQSL"
FT   CDS_pept        627056..629278
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574622"
FT                   /orf_name="CD36_63350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41221.1"
FT                   /db_xref="HOGENOM:HBG397544"
FT                   /db_xref="InterPro:IPR014839"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000192DC44"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ02"
FT                   /transl_table=12
FT                   /translation="MEAFQQFLQSRGIQRIRKQHRRSTDTIRSRATSDGNVRISTIMSN
FT                   IRNENEVHFSDSDDEVIIEDEPLGIIQINNDIDDDFDSFYNTRRESFGGGGGGSRNQNF
FT                   IITDQCNNEIDKSYEYVAAQSTAPPSIETAIPDESYKDRFEFKIPSQDFKNVNYTAIDT
FT                   SDYSKILYKSPSNKFVNSLKLKHFGIKKLFGEDFRKFKNNLSTIISDGTMEYLVLGLNS
FT                   ELIVFGFDGLTNLPSKQLLRIDTRPMYTSSTDRLISTWPYFPHTINYIKTGNFNNRQVL
FT                   GVCSDDGTLFIWYTETIIKLVKKFGNSTKQQSNDNDQDTDNPVATVTLSSTASTSVTTP
FT                   TIVKPDFRIKTEASLWGLDFKTYNGHNIIVASDNSQSVVLLYYHPADERFYHIKSHQIL
FT                   HNIPDISIVLYTQTEEKHTVQVSCVSISGEIIVFEFNFAIALGPLNKEEFEYFRKEPYY
FT                   YVDATMEQLENRNGIDSHDLALLKSKKFKRVKFAEALCISRVVLSEDCWTVKPMNSKWF
FT                   LPVGSLKDVFGDDNIDESRELNRIGQETRILNVSGGKFQFFPSKTVNFESQLEDNCRTN
FT                   PSTTTNYKPTTLDDEYRRIHKELVNGSSDEFLLVSTAKKLSMFRFPSLFCNCSTSKVFD
FT                   LAIPFNEESKFTNRISISMVIPELSCLVAATQQGLITIMRLCTYQGVYGMRQEHIFPNA
FT                   LSLSLGYHGYRTIIGLSVRKRTVEKPIYNLYVSYNDGLIIGYQISI"
FT   CDS_pept        629694..631244
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535621"
FT                   /orf_name="CD36_63360"
FT                   /product="Kinetochore protein, putative "
FT                   /protein_id="CAX41222.1"
FT                   /db_xref="HOGENOM:HBG397543"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000192DC45"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ03"
FT                   /transl_table=12
FT                   /translation="MYLSNLGGQSRKTGIRPKTNLKTDKYGMEDVDEFFEDDEDDRMNK
FT                   SKGQKSTISLPRAEEVSKYKSTISQPFNNIARKINFNQEDDETFNLPSTSTSSATATTS
FT                   SVSNKKSPVTTQQSPLRSPLPEQDYDYNQFDVEEDYGDITEEDRQPSPPPPPSVPKSNT
FT                   ETKSNTKSSKAASSFTKKMALGKTKKLPSSFDSANTTSVTEYFDEEEDDDDDRDYGESQ
FT                   QDSIEDSMMDSTFNDYSQPSSNIKSKTRRKIIKESPLPSPPPDNPNGLRRSKRTRIKPL
FT                   AFWRNERIIYSKDLDYDDEQDTTLARDIHNIPLQSIKEVVHIPDNETVDNSRSPNSTTG
FT                   AAASGSTKRRSNRKRTYKQSSVVAPTDYDYESDPEISGSEWFKEDNLSLEVNDNGESRV
FT                   RKIAYNHKGGNYVKPTDDNYLVASLFDEDKSFFAGGMLQLPVDGFKPPVTVTGSTYMFN
FT                   VMKGLIQVTLNENMFVVTKGCKVQIPEGNEYSLRNIGQGDAYLFFVQIRKPEEIDTNW"
FT   CDS_pept        complement(631712..632419)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078576"
FT                   /orf_name="CD36_63370"
FT                   /product="mRNA turnover protein, putative "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41223.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG628300"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI000192DC46"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ04"
FT                   /transl_table=12
FT                   /translation="MPRSKRSKLVTLAQTEKKGKENKTRLFDEVRTALDTYKYIWVLQF
FT                   DDIRTPVLQDVRNDWVGSKLILGKRKVLQKALGETVEEEYKDNLHQLSKLCEGLPGLLF
FT                   TDELPETVDAYFKAYSKQDYSRAKSRAPIDFTIPAGIVYSRGGQISIEEDVPMSHSLEE
FT                   TLRNKLKVPTKIKAGKIVLEEPYVVCNKGDVLDTRQAMLLKQFGVAASEFKIPILGYYY
FT                   DGEVHKYDNQQTV"
FT   CDS_pept        complement(632702..633382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382846"
FT                   /orf_name="CD36_63380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41224.1"
FT                   /db_xref="HOGENOM:HBG397542"
FT                   /db_xref="UniParc:UPI000192DC47"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ05"
FT                   /transl_table=12
FT                   /translation="MSFSISYILEMIQLSILFVFEQLRKITIPNPERYTPQIESNKMAT
FT                   PLSLPTTNTSIDEGVYDQNNFVSTVILYACIVVVFSVGLISVLKREPHRLPEIELQVQL
FT                   PPSTASSIMMSSPSSSLVAPIPEPLTRNPKFETILPETFEFPPLERTPSITSSNYSLNS
FT                   TIDTTRDFKYTYRGDSPALHLLNFSANSPSRSTIVSQVVSEETVNASFTTSDSSSDSLR
FT                   RLKT"
FT   CDS_pept        633744..635519
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574623"
FT                   /orf_name="CD36_63390"
FT                   /product="Transcription factor with zinc cluster DNA-
FT                   binding motif, putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41225.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397541"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000192DC48"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ06"
FT                   /transl_table=12
FT                   /translation="MSQSPSSLSSATSSSSRVNSPSDQPPPPRVRKSYSRNGCRECKRR
FT                   KIRCPEEKPYCSTCVRLGKQCSYPLAGEKVLRISRRLIKEEIENMGKSTQFLPVQYDIP
FT                   RRIKPQTQSSIKPSPLNIENLINSNDFLSDSDLNILTADLNNLVSDIIEVANIPILEED
FT                   FQFNFLNEPLIVEQITKNVPIDYIKLPRKHEQLYWEEFYNNFAQIIEPFQAYDAKTKKT
FT                   SNPARDIILQTAATEPFLLAAILAEGANTCYLKYKRPEDERAYGAYLSKCLKLLEPARQ
FT                   TDINANIEAVLLTLLLLTAATATSQTQKWRPHLMGAKSLLLKAINQNVSKKFVFCKFWF
FT                   VSIEILAGLSTNLGGTLQTDAEIDQLVTPGNEFEVEVLRDLGIISDQGFNILMGYDNTC
FT                   LVCFRDLLKILNKKRLNVYIDTMSYVKLLSDFYNQANIVYIDSRGVIAENELTRYVSGL
FT                   PVEELRINNVSYWISWQDISHQSYVLSSLIMILTRFFVIDVSGLVDKIISFIHYLSQFS
FT                   DVQQHASPYLLLMIQWPLLVTGLSTTKLEQRHLLLKYFSMVGQIGAAAANVSTQILLKH
FT                   WKGTIDIENDDTLIY"
FT   CDS_pept        complement(635659..635982)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574624"
FT                   /orf_name="CD36_63395"
FT                   /product="LYR family protein, putative "
FT                   /protein_id="CAX41226.1"
FT                   /db_xref="HOGENOM:HBG562185"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI000192DC49"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ07"
FT                   /transl_table=12
FT                   /translation="MSSPILPFTEANSKRVTSLFRQALRTAYDHSMRWDVYRDATINIR
FT                   RQFEANKHISNQQELEAAINKTKAKLAEWKHPDPYIPPCRPGGTKYQRNIPVAREPLVP
FT                   GDW"
FT   CDS_pept        complement(636355..638298)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078577"
FT                   /orf_name="CD36_63400"
FT                   /product="Fimbrin (Actin bundling protein), putative "
FT                   /function="actin binding"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAX41227.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG316743"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000192DC4A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ08"
FT                   /transl_table=12
FT                   /translation="MNVLKLQKKYPILDQSDLFSIIEDFRAIDLDDKGWVEKKDVINAV
FT                   SKKGEYSYDQARETLKQVDVDASGHVELDDYVQLMAILKEDSSSATPPPPSSTISGNSA
FT                   SSPSVVSPKFKKPPPPIPTANSKNKTFLGGKTSGTTHTINDEERTEFTRHINSVLAGDP
FT                   EIGDRLPFDTETFQIFDECRDGLVLSKLINDSVPDTIDTRVLNLPKAKKTLNNFQMSEN
FT                   ANIVINSAKAIGCVVVNVHSEDIIDGKEHLILGLIWQIIRRGLLSKVDIKYHPELYRLL
FT                   EEDETLEQFLRLPPEQILLRWFNYHLKNAGSQRRVTNFSKDVSDGENYTVLLHQLQPEH
FT                   CDLSPLKTSDLLTRAEQVLTNADKIGCRKYLTPNSLVSGNPKLNLAFVAHLFNTHPGLQ
FT                   PIEEHENIEIEEFDAEGEREARVFTLWLNSLDVDPPVVSLFEDLKDGLVLLQAYDKVLA
FT                   GSVSWKHVNKKVNGEVSRFKALENTNYGVEIGKANGFSLVGIEGSDIVDGNKLLTLGLV
FT                   WQLMRRNIVNTLAELGKGGHNLSDADILKWANQQVSKGGKSSNVRSFSDSSLSNGVFLL
FT                   DVLNGLKPGYVDYDLVYTGNSDEEKYANAKLAISIARKLGALIWLVPEDINEVRSRLIL
FT                   SFVGSLMAVSEK"
FT   CDS_pept        638970..641402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248603" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535622"
FT                   /orf_name="CD36_63410"
FT                   /product="Vacuolar membrane protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41228.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397540"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI000192DC4B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ09"
FT                   /transl_table=12
FT                   /translation="MTSNGHKTKSIKSETNSSYTVHSLDQQQASICDNLQQAKFELEPV
FT                   HLQFSLSNKLNKLLVSSNIMYILLTNVVYKIDLDNPSQVENYVLPGKVTNAWLNPNGKS
FT                   LLVQIEKQTYYTLEKKVFKSLKFKNIEVTSIAFSNHNMVVGTRDGIIYVYEKSLKQVYK
FT                   VDSPIQGVMFSNDYSQINVLANSLYTWDCFDTTYVELQKVFKQTTPVIKSINPPGIFTS
FT                   TPQNYVYISSDKEIITNDEEMQLDRVDEEFSQIALTPHHLLGIEGNSLKIYNKLNKQLQ
FT                   ELSLPENKIRGIAVDNLFNTYWVYTKNSIYEFVIENESISVWYDYYKMGKYSEALKYLD
FT                   EDDEGNFPKRDLVLIKQGYDYLQRGGFGIVSDDLSLQIQGIQILAKSTEPFEKVCLMLL
FT                   NHKQSDALLIEYLLAKLNKKNKVRMIVLSAWIIELMARNNDSRVYDFIKNNYKLLDRPT
FT                   MYQILNSEKLVFYAELIEDYNFILKYYIDKKNWTLAVKTLIKLYTKGDIEPVYENASIL
FT                   LMNYPKVTETWLKLDLEYEKLLPGLLKHQQQAIHFLQQVIMDKHYKKNKQLNNAYLCLL
FT                   ITTPGTDKQIIKFINFTSNFDTNFILRLCISHEKFHPAVLIYIEIGLFDQALELALKHD
FT                   LTSLAEFILNRYDEDKQVDAIKLEDANYNVKRKLWLKFAKYLIDKSDDLNETLHHIINV
FT                   SMLDLKDLLPLFPETVSINNFKDEIVESLNEYNKRIVHLSLDMNNSSEHLREMKKKVIY
FT                   NKKKTNVAIIEPGEPCRKCGKLLVQKNFVYFPNCHHAFHKECMKKNQCLLCNDFLNL"
FT   CDS_pept        643284..644537
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382847"
FT                   /gene_name="SAP6"
FT                   /orf_name="CD36_63420"
FT                   /product="Secreted aspartyl proteinase, putative "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41229.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192DC4C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ10"
FT                   /transl_table=12
FT                   /translation="MFLQNILSVLAVALLIDAAPVKRSPGFIALDFNVMKTPVDQNDPT
FT                   VRAKRSPLFLDIDHTGFPVDDTGRNDVVKRGPVAVDLDNEIITYAADITLGSNNQKLSV
FT                   IVDTGSSDLWIPDSKAICIPKWSGQKGDFCKTNGSYTPSASNTSKNLNTRFNIQYADGS
FT                   YARGNLYQDTVGLGGAFIKDQIFADVWSTSAHKGILGIGFQKNEATESMYDNLPISMKK
FT                   QGIISKNAYSLFLNSPEASTGQIIFGGIDKAKFSGSLVDLPITSDMRLSVALKSVNVLG
FT                   QNVNANVEVLLDSGTTISYFQPSIARNIIYALGAQVHFDSAGNKVYVADCKTSGTVDFQ
FT                   FDKNLKISVPASEFIAPLYYTNGEPYPKCEVRVRASESNILGDNFMRSAYIVYDLDDNK
FT                   ISMAPVKYTSQSDVVPIN"
FT   mobile_element  complement(645097..645366)
FT                   /mobile_element_type="retrotransposon:solo LTR, pi A"
FT   CDS_pept        646690..647865
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574625"
FT                   /gene_name="SAP1"
FT                   /orf_name="CD36_63430"
FT                   /product="Secreted aspartyl protease, putative "
FT                   /EC_number="3.4.23.24"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41230.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000192DC4D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ11"
FT                   /transl_table=12
FT                   /translation="MFLKNIFIALAFALLVDATPAKRSAGFVTLDFEVIKTPVNATGQD
FT                   GKVKRQAIPVTLNNEVVSYAADITVGSNRQKFNVVVDTGSSDLWIPDASVTCENPPPGQ
FT                   SADFCKGKGLYTPKSSTTSQRLGNPFYIGYGDGSSSHGTLYKDTVGFGGASITKQVFAD
FT                   VTKTSVNQGILGIGYKTNEAAGDYDNVPVTLKKQGVIAKNAYSLYLNSPNAATGQIIFG
FT                   GVDKAKYSGSLIAVPVTSDRELRITLNSIKAAGKNINGNIDVLLDSGTTITYFQQDVAQ
FT                   GIIDAFHAELKQDGNGNSLYVADCQTSGTVDFNFANNAKISVPASEFTASLFYTNGQPY
FT                   PQCQLLLGINDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASNIAALT"
FT   CDS_pept        complement(648026..649615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382848"
FT                   /orf_name="CD36_63450"
FT                   /product="Mitochondrial external NADH dehydrogenase,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41231.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319217"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000192DD0A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ12"
FT                   /transl_table=12
FT                   /translation="MSRTVPRFPIIRKFFKYTLSGVALTVVGGTSFIAYKVYQESQPID
FT                   QIKQSPYFPNGQPKKSIVILGSGWGAVSLLKNIDTSLYNVSLVSPRNYFLFTPLLPSVP
FT                   TGTVDMRSIIEPIRSMIRRCRGEVNYYEAEAIDIDPVNNKLTIQQSTTVHSGHSGDDSS
FT                   SNHPKIHQEHKMEHITTQLNYDYLVVGVGAQPSTFGIPGVAEHSTFVKEVRDSIKIKKK
FT                   IIDLIEAANLLPIGDSDRKRLLHIVVCGGGPTGVEAAGEIQDYIDQDLKKWMPQIANDM
FT                   KVSLVESQPVVLHTFSSELVEYTNTIFKDTNINLVTNSRIVNVDDTHVDVMRKSDKSID
FT                   KVPYGMLIWATGNSVRGFTKIIMDKFSEQQTSSRGLLVDDQLKLKGSNNIFALGDCTFT
FT                   NYAPTAQVAFQQGIYLAQYFEKLQEVEKLRYKIKQDPSISEVYVHRLQRLENSLPTFVY
FT                   NYRGSLAYIGSEKAVADLAVGSWSNLSSGGNLTFLFWRSAYIMMCLSIKNQVLVCFDWI
FT                   KVYLFGRDCSRE"
FT   CDS_pept        complement(650661..652529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535623"
FT                   /orf_name="CD36_63460"
FT                   /product="Phosphatidylinositol transfer protein, putative "
FT                   /protein_id="CAX41232.1"
FT                   /db_xref="HOGENOM:HBG397520"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000192DD0B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ13"
FT                   /transl_table=12
FT                   /translation="MASDNVRYRLQRIQTLNGDQEIVLKQVWAYFLKYYGYPVDIADSD
FT                   LAYKQCFVASTSTANFDESQAIPTAGLSKTNTRGSINSTQSNASKKKRGLFGSKKSTAS
FT                   ALNNGGTGTAQGSPPANSKRMIQIQTQSSSERYVPVDVSSDEYYAIYAHHHKSSYEYSD
FT                   DYDPSFDNIVGAGGFSNGGGVNYNNGNVNGGAYYDNDTASVNSLETFVTAETTITDYDF
FT                   TPATIFKNGNNNKINGNYGGRIGHPNKFQQQQQQQQQQQQYYQQPRGGNGISRHQATIN
FT                   FPIHVNAGQTPLNSLSQYNAKEQHRAILKVPRTDLVDNLVLRFVRARKWDTEKAIEMLS
FT                   KSLHWRSNDFPADDWAMEADGPSYLNGTNKGFVKNFTTEKSWIKGRDKNNNPIFMFQAK
FT                   KHLTADSPLEQNQRYAVVTIEWTRLFLREVSESVDTCTIVFDLTGFSLKNADYATIKFL
FT                   ADVFEAHYPETLGFILIHNAPWIFSTVWNIIKNWLDPVVASKIHFTKDAKELSKFIDPT
FT                   LIPDYLGGEDTTRGYYPIPEPQHEFPPKQKDAEYARLKRERDELCVRFLETTRKWIEST
FT                   NPQVSDRYLKDKIDLNIALSSNYIQLDPYVRNRGIYDRDHTLTIGH"
FT   CDS_pept        complement(655364..658861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247934" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535624"
FT                   /orf_name="CD36_63480"
FT                   /product="Component of the nuclear pore complex, putative "
FT                   /protein_id="CAX41233.1"
FT                   /db_xref="HOGENOM:HBG397521"
FT                   /db_xref="UniParc:UPI000192DD0C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ14"
FT                   /transl_table=12
FT                   /translation="MPDRRRSLSPNTETSFNQNPTESSNKLSNGSLKLKPSTTATANAS
FT                   SIFNQSSTYSPRGRKPERIDNDIDLDGPLLTNFESSDKRKRLSIQGHPPASGIPRSSVF
FT                   NSSSLPQNKLRSYSIICNDLKTSEEELNNDLEVRVTTKDNYSRSIGTSDVEDFSMSRDV
FT                   SPFVNLPTAPNSDIITGATRFNENEDDDYDDKVSDGSSVVYNEGALVVQKEFGSLYQDE
FT                   DGNLVRPPFINLDPRERYQLLQLKRSIELSESLQKRIKYMINPNETTSKRIPGTNKVEI
FT                   STQTHDFNYLSTKLNFKKRSPPSSFDRSEISRPKKKPKRKGFAMKEFLYDVNEEKPVSS
FT                   TSSFNGALGSITKPKFNSHPKTQDKSMTQIIPREDEEPSFKTFGNKTGRDRETFGLNNN
FT                   AKLTLDPEYLEKTSSSSIADIIKLKEPDVVENSKLNKPTTGPSSGFKFDIKKNDFESII
FT                   NDRKQNQELLAKSKLAKETVPESVKSTEPNQSAKTGLFGSKHVSSEEAPKKKRNFSDSE
FT                   KEDKPSVPSSVPSFSFGSTNTSKPATPSLFGNKENGSTTPSLFSITNSKSNDAKDATST
FT                   TKPLFGKSSTEPESNSEKPKFTFGAPPSSNKPSFTFGKSLDSAEKQTTADSKPSLFGNT
FT                   FKATDKAESSTTSKPLFSFGSNNTTTTPISSNGSEKKDATPSSTPFAFDKPDTTKDEAK
FT                   PQETTSLFGGKSKSGTTTPFTFGQKDDKATSDSKEEDKLTSTTKPASTGFIFGAPPKAT
FT                   ESSVESKGETNSDAASATTATTTSTTTTPFKFGITNKASTESDEKKAEESATKKFNFVT
FT                   PSTDKPSTPFSFPSANGSSTSKPAFSLGGIGTTDDKEKKETSSSPAVTQSTSAAPLTTS
FT                   AFSFSAKKPDSPATSSTGADAAKSSTGSGFKFAAGVTPPSQTVSNKPPSIFNFGAASQP
FT                   PTTSVFGGFGQPSQPPSSSGGIFGGKSPFGQSTNNAFNQNSNTSGIFGNKTGTTPSTNA
FT                   FGGMNNPSSTSTPATSNVFGGASTGAGVPTTNVFGSRPTTPAFNFGGSAPTVAPGGFGA
FT                   AGTKPPSFNFAGSKESTPDPASLFGQQNRSGTSTPFSSGGVGAPNNVFGQPGQPGQQPG
FT                   LFGGASNNNSFTFGGAPSMPGATGTPAPPVAAPGGMNMPVVTPVPNPRRILQPRSRRR"
FT   CDS_pept        659174..661945
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078578"
FT                   /gene_name="NAM2"
FT                   /orf_name="CD36_63510"
FT                   /product="Mitochondrial leucyl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.4"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41234.1"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG693845"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192DD0D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ15"
FT                   /transl_table=12
FT                   /translation="MIKHVETIHRVRYSTATVAKKIQFSKLDEKWRAKWKSQSPTGSLH
FT                   PTKHLIPETNEKFYSLAMFPYPSGVLHIGHLRVYTISDVVARYKRSKGFNVIHPMGWDA
FT                   FGLPAENAAVERNINPSEWTETNIAKMKNQMETFLADFDWQREVNTSSPEYYKWTQKIF
FT                   LMLFERGLAYRKAAEINWDPVDNTVLANEQVDAEGRSWRSGAIVEKRNLEQWFIGITKY
FT                   AKELNYDLKNLPDWPEKVKIMQKNWIGESNGVEINIPVNFPGLEHVTVFTSRPDTLFSM
FT                   QFVALALTHPIVEAASREDQELAAFVESAKLIDDPTSKAGYMLKNIKASIPIDVNNKIK
FT                   KTYDIPVYAAPYVLGNYGHGAVMGCPGHDERDFEFWKLNGLKGVPAVQIIAPKKQNAKD
FT                   DYPYTLKKGTLEDSSVLPHGLSDIGEYKGKTIEKATQMITDCLKSHSLGNYTTQFKIRD
FT                   WLISRQRYWGAPIPIVHCQDCGPVAVPDKDLPVVLPDVKGKHFGKGNPLGNIEEFVNCK
FT                   CPSCGKDAKRETDTMDTFMDSSWYFFRYLDSKNENLPIGTETSKQMPVDLYVGGVEHAI
FT                   LHLLYSRFIAKFLSDCGLWDGEPHHKEPFKKLVTQGMVHGKTFSDTVTGKFLIPEELDF
FT                   TDPTNPVIKATGKAPVVTFEKMSKSKHNGADPGEFIEKYGADVIRAHLLFSAPVSDTLN
FT                   WQEEQISGTDRWLRRVIQLGDSITEIPKNQFKTESSGSSQTFQNVNLNKVRYDTIEFNS
FT                   QELELYNSVQGYVQSIASSIEVKFSLNTIVSDLMKMTNTISEAIKDTKTYNQDLIFDSY
FT                   QKLLICTSSVTPATAEECWERFALNQGKPAPNSIFLEQYPTDTPIESNLTMYNIFINGK
FT                   HRGTMEAPKSFAKESESEIVKQISGIEKFNDLIVGPVKKVIAKPSIISIVFK"
FT   CDS_pept        complement(662061..664358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382849"
FT                   /gene_name="CCM1"
FT                   /orf_name="CD36_63520"
FT                   /product="Mitochondrial group I intron splicing factor CCM1"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX41235.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG447509"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000192DD0E"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WJ16"
FT                   /transl_table=12
FT                   /translation="MIRLIRGNNVPSLVFKRSLFVPSNSLTNKRKRRIPPLKPRSSNKE
FT                   GGDIKQSRITDRNQTSRTVGVSEKLPTQIKKELKDLRSFTKVIAQHLKPEQENDSLTSA
FT                   EKPDTSQLPPIDIEEATDDIFGQISGTKKSSVEVAPPPPPPGLDIPDEIKERLGLLSEL
FT                   LVPEKSSNSKLPEKQVENNWKLLLSQLDQAGGLSGLSKRTISKFFSKIPPKNLKGLIPI
FT                   IENMYNKAEMSIPHPIYYMFVRSLTLGDKISDTQMQLIDKYFQEISKQTDLKIDHYETM
FT                   ILAQVKNNHMEKIDGILALMKTKNIEISKMIYTSIVRGYIFYQKDHQKALETFDSMKFL
FT                   SQKTQPDEKVYTDVIVSCIMHREIEKALDLYYELKDKGMNVNQNLLSTLAKGCSRSKQF
FT                   KTQAWNFLFQIYDHGWVPNLQTYEHMLYIAARDGDVELTRALFYKMLQTNSVTVRAFRY
FT                   LILSYSKYVPPHKRKERYLILLNHKGQLFRENILQDVDFSKPIHGFPFLPSSHIPDSKF
FT                   VLAESSAIWAHTVMNNPSFLRQQTLVASYVSIALELDDFTEFKNRFNSASYLNKDGIPK
FT                   VREIEIIEPQQDEPTETVTATEQQNTSSNTSVIRSPILNQLQQNINDNQFKAPRDSYLY
FT                   NLAIKAAGKFKNYGFAQEILHERGQFRKSNSFKSLSPKQQHQDDFQFAGYLVECWTNMN
FT                   LLEDAYAVVLSSIDRFPWSWRELGVLNNAAMKLGSLELAEAVRKVAQVTQVKHHGKIKR
FT                   QDFKTYVMKRGY"
FT   mat_peptide     complement(662064..664169)
FT                   /gene_name="CCM1"
FT                   /product="Mitochondrial group I intron splicing factor CCM1"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WJ16 "
FT   transit_peptide complement(664170..664358)
FT                   /gene_name="CCM1"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WJ16 "
FT   CDS_pept        664785..669575
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574626"
FT                   /orf_name="CD36_63540"
FT                   /product="Uncharacterized protein YOR093C orthologue,
FT                   putative"
FT                   /function="catalytic activity"
FT                   /protein_id="CAX41236.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG329637"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI000192DD0F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ17"
FT                   /transl_table=12
FT                   /translation="MSHSNNNINLKVPGNSLSGSNINHGSSSSDRHNNRHRSVSAASLN
FT                   PTTGTLITGEMNQTDPSTNITPDIGGTSGVGGDIPPDMAILLQKLDEDFLVNKVIDQWT
FT                   FINRREEIMQSINRLHQMQNEDLLNLDPSKLQMPLNPRMSTGDFSKISPDNLIDILAYR
FT                   ANIYKTELAFIVLDARGKEVSSISWEKLYLKAVKVAYEIQHKLTMKNSDSVVLLYKDGE
FT                   VTEFVVALFGCFMAGVTAIPIHQDISLTEVLNIINLTSTKLLLYSETVAKELDRLSAQN
FT                   SRINWPSKLLRWRTTDLGSARKSEVSHWNAKQQKLKKDNKTSSEQNTNLAYVEFSRSPV
FT                   GELRGIALSHRTIFHQMHCLDSALSSLPNSGGGLQRSYKQYRADKKVVLATLDIRFSIG
FT                   IILGVLFTVYSGNVHIWAPQKVMEIQGLYANLISKWRASLLLADYFGLKRVTYDYQQSP
FT                   SATRYFSKTQRVDLSSVKWALVNALTIDGEFMEILAERYLRPLGCQHPENAIIPMLTLS
FT                   EYGGMVISLRDWIGGKEKLGISITDDDSNDLSSVLIDKEALSRNIVKIVEINPSANDDI
FT                   GHDLLRVDAFGYPLPDATLAVVNPESSVLANKDELGEIWIDSPCLSGGFYGLRKESKSI
FT                   FHAKCRGPNGQLDMDFLRTGLLGFTFNGKVYVLGLYEDRIRQRVSWIDQALYQKLHREL
FT                   VIGSGSRYHYSSHLLATLASEVKQIYDCTIFDIFIGNEYLPVAIVEAEVIRKQVADETA
FT                   GAEGGNAKANESVHVSGVPLNEPVLNAIAQKCFDTLYKRHFLRLYCVVVVDCDTLPKLL
FT                   RSGGREIANMLCKKKFLEGSLRADFVKFFIRKSISMIPHGEDVIAGIWSPYVSELRSKA
FT                   LANFPDQYSTIDYREKSIDDKTGAPLTDFKTIIDILKFRVAKSGDSIAFQNVDNNSKSK
FT                   PLTWKKLESRAYAVCQYLIEKANIKAGQYVILMYSLSEEFVIAVYACLMCGIIAVPMLP
FT                   FDSNRIGEDFPAFVGVIRDFDISEILVNDEVEKFLKNGPIADSLKKITHKRVKSLKIKN
FT                   TVKLTKVSNMASLNSKIASYQAAVNFRDENTTALVWLNFTSDHYRVGATLSNKNIIGVC
FT                   KVFKETCNLSSQSAIIGCVRHTSGIGFLQACLLGVFLGTTTYLSSPVNYAENPLSFFLL
FT                   LARHKVKDVFVTEQMLKYAAIKFTPKGFNLSNLKNMMISTENRVEIDLLRKIAKVFSST
FT                   KLSAASMSTVHNHYFNPMISTRSYMTVAPVDLYLDPIALRQGYVSVVNQAEVPNALHIQ
FT                   DSGMVPVCTEIAIVNPETRKICKEGEFGEIWVCSEANLTAFTNGPKGPVDHFAQTQFRG
FT                   IIADGNPDVTYLRTGDLGFLHNVSITKNKTGGVTGPGASGEVDPEITTFQPLFVLGKIA
FT                   DTFEVMGLHHFPIDIENTIESCHSDIYRNGSCIFKCGDYTIVVCESKRTKYFASLVPLI
FT                   INTILSKHHLVIDIVAFIKKGEFPISRLGTKQRARIVDAWVQGVIPISASYGVNYGENS
FT                   MIKLIEEIDIVTRDDPITGLKNPALSYYDDNDDQNGDVFSENRETLKLNDDEHYASIGQ
FT                   KAEFSLGNYSNSIVSED"
FT   CDS_pept        complement(669660..671765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229980"
FT                   /orf_name="CD36_63560"
FT                   /product="Central kinetochore subunit, putative "
FT                   /protein_id="CAX41237.1"
FT                   /db_xref="HOGENOM:HBG397522"
FT                   /db_xref="UniParc:UPI000192DD10"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ18"
FT                   /transl_table=12
FT                   /translation="MSSNEEIINLLGRLNKDKTNDNNDSLENETTLNLLENLTKNGISE
FT                   PLIMIILDKIIKPTLKVTDKTKLLDQCLIPNDDLSIDIFFKIISIIGVSRVYFKGDRKL
FT                   KSKQLNIPLQLKLIQWIINYFQFFENNLCKSGSIVLTLLIKSLDYEFSRGPISQLIIIL
FT                   LNSMLSNHNQLITFYNQEIYHTINILKSNHIQSVVNLYNKFPLDIYLQELLAYFRNFNP
FT                   DLDYIIYSPENFPLLNKLKCNLYQVYRWKDNDELAHITTTNNKRQKTSIISKPDTIIHN
FT                   IEILDQINKINPYKLVRNAFDNDNEAKLLTILFQTGNNRFINKVDKYIGAILTTFINSE
FT                   KELQFFLQQISHLYEISDGTIILPSIENFILDINISVMKFCQQFKYRYKLIKYLYNVDL
FT                   ERLLQMIHHHTLILKQIYDTNNGLYQDNSNFNYQSCDEYVGNILYLLNLGIFEKLNDII
FT                   SRINQLLPKLYEFIKYCKYNQEQLVNQIIEFLINLSPSLFQQLNSKTIIIPRSLTYSCL
FT                   LSCDPIVVSNITQHIFNCKTHNYQDSINYRNLQNSYIMDTINFLWKQRFLNIDDGNNTS
FT                   NKGFFFHPNFITKLTSLHTFDCSYLSSPSSIGELFYNPAFSYIVTKIIWDIEDNTKDSI
FT                   NTRHEGPISKESLLRLRNDNEKIWLPLSFDELKISILENLEIKHFNGITDLLFNSLKSL
FT                   ADKRKHQ"
FT   CDS_pept        672001..673044
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574627"
FT                   /orf_name="CD36_63570"
FT                   /product="5',5'''-P-1,P-4-tetraphosphate phosphorylase,
FT                   putative"
FT                   /EC_number="2.7.7.53"
FT                   /function="ATP adenylyltransferase activity"
FT                   /function="ATP binding"
FT                   /protein_id="CAX41238.1"
FT                   /db_xref="GO:0003877"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG397523"
FT                   /db_xref="InterPro:IPR009163"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019200"
FT                   /db_xref="UniParc:UPI000192DDB6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ19"
FT                   /transl_table=12
FT                   /translation="MTSKYQLSNDFYEKLSIKYDSAVKGGHILFNGDSAINEIEKIVIT
FT                   DENDKENTTIDVQLTLLKSLIHRPEIGTTTKNENDLNPFLKPEPELTIIDDYNNTNEFK
FT                   IVFNKFPVVPRHFMLVTKEFKSQNTPLSPNELMATYQILQALKNQPPNQDQDWFAFYNC
FT                   GPESGASQPHKHIQFMTLPSREQFKPYAETLFQEEKEEEDDDGDDQEQQQQQQVKKSEP
FT                   KQNKHLPFAHFFVPITNEVVTDESEEELAHLFSSILQKTLTELRETNQTHISYNFIMTL
FT                   NYMLMIPRSKGKYENKLGINSCGFQGLILCKNQELFEFVKSIGPLEILKQVGLPNSSNK
FT                   STTEYDY"
FT   CDS_pept        673351..673737
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078579"
FT                   /orf_name="CD36_63580"
FT                   /product="Cytochrome b-c1 complex subunit, putative "
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="CAX41239.1"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG324319"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="UniParc:UPI000192DDB7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ20"
FT                   /transl_table=12
FT                   /translation="MVQSITSVVKAANFILSRPTLSKIITPLAKQFTAYAGYREMGLKF
FT                   NDLLLEETPIMQTAIKRLPSELSYSRNFRILTAHQLALSHQILPPEKAVKPEEDDNYLI
FT                   PYILQAEKEAFEKAELDNIEVVKA"
FT   CDS_pept        join(complement(675077..675108),complement(674060..674960))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574628"
FT                   /orf_name="CD36_63600"
FT                   /product="Mitochondrial dicarboxylate transporter, putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41240.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000192DDB8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ21"
FT                   /transl_table=12
FT                   /translation="MSKPQTKIQYPFWYGGAASMAACLVTHPLDLAKVRLQTATKPGQS
FT                   LLSMIYQIITKEGFFKIYSGLTASLLRQATYSTTRFGVYEFLKEQYMEMKSKTFHNDNN
FT                   NNGIMEKPSTAILLPMSMISGALGGLIGNPSDVVNIRMQNDSTLPINQRRNYRNAFDGI
FT                   YKICQQEGINSLFRGLTPNLIRGILMTASQVVTYDIAKSILVDQIHLDPSKKSTHFSAS
FT                   LIAGLVATTVCSPADVVKTRIMNSKTTSTSNGGGNAISILKNAVKHEGIGFMFRGWLPS
FT                   FIRLGPHTIVTFLVLEQLRKFKLGMNQSS"
FT   CDS_pept        complement(676731..677864)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535625"
FT                   /orf_name="CD36_63610"
FT                   /product="RNA-binding protein, putative "
FT                   /function="RNA binding"
FT                   /protein_id="CAX41241.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG397524"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000192DDB9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ22"
FT                   /transl_table=12
FT                   /translation="MTESLFDTNFTSENEPKPEQQQQQQQQQHEHEQQQSSSSSVGATA
FT                   TAAETAAGTTSTSTSTIDQSSTLPSLQDKSNIDALINYRVLVSAKEAGCLIGTNGQVID
FT                   SIRNETSTKAGISRLIPGSHERILTVSGKLDDCAKALSYFAQALINGNIENYNYFPLKQ
FT                   LSSTPNTNDTTILRLLIPNSQMGTLIGFKGIRIQQLQNNYNISMIASKSFLPGSNERLV
FT                   ELQGTVDDLYDSLRIISRCLIEDFSSIVGTTYYVPRGNTYSHSHNHNHNHNNNSTGVGA
FT                   GSGVGGGSGAGKTIDTISFPNDIVGALIGKRGSRIDGVRKVSGAMIAISEIIEGENERI
FT                   FTITGSSHSVEKAKQMIYQNFKREEERRRNEELSKKE"
FT   CDS_pept        complement(678716..680083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229981"
FT                   /orf_name="CD36_63630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41242.1"
FT                   /db_xref="HOGENOM:HBG397525"
FT                   /db_xref="UniParc:UPI000192DDBA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ23"
FT                   /transl_table=12
FT                   /translation="MSQPSSSAQFNFYSNSSSSLEDPISTTTYSSSSPVQSQPLPLPSS
FT                   SSSSSSSHNHNHNHNHGHNHNHNHQRHHHNNTSNNNNHRNDKLHKSIKKSLSKLTFTPP
FT                   PPPPNGVVVGGGGGSGGTNLTYSNPPSTCSSTGHSFSEADIFERTCSKHNYHYPLINNL
FT                   ETPSHYNLENYTSPILDTATEILSNNIPLDQVKLNCYCDENDKEIEIENEYEYENENID
FT                   QINHQKNDQQKEAKVDEILQQQQQQQSPQPPQPPSTTTTFIRPRARSIISQTLISTLDH
FT                   HNRKMHSSMSTNGFNNSTTTNTTNTTFTPSPPPLLAKRSMSYAGQTRYSQSKNNNNHNN
FT                   IHNHNQIIEDNDSNTNIIDFFSFADIINHEEVEEEQEKNISNNNNNNNNNNNSPTRSSV
FT                   STNSSNGIGIGGQYNHIISSSSSPPPQQPAAVNEYHPIRRGSCVATISAQDYIGRF"
FT   CDS_pept        685310..685888
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229982"
FT                   /orf_name="CD36_63640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41243.1"
FT                   /db_xref="HOGENOM:HBG397526"
FT                   /db_xref="UniParc:UPI000192DDBB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ24"
FT                   /transl_table=12
FT                   /translation="MKRSLNDSIYSNSSSSSSSSSSSSSPPPPPLIKSFKRLKLEYEIF
FT                   STSIQDIEKLFNEEITTTTTNTTISPELSLFTKNNPIKGISNTFNNPDSSQYLDKIIPS
FT                   TSFNYDCINMSFLEPPTTSRYPTDNIPVKPTNQYITTTTGTTTTGTTTLTTNMYLDIDY
FT                   DEYDYDYDYQPLINQDLSMIDQLILKSSI"
FT   CDS_pept        686224..687717
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078580"
FT                   /orf_name="CD36_63650"
FT                   /product="Actin-like protein, putative "
FT                   /function="ATP binding"
FT                   /protein_id="CAX41244.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="UniParc:UPI000192DDBC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ25"
FT                   /transl_table=12
FT                   /translation="MTTTVYGGDEINAIVLDPGSYTTRIGYAGDDFPKIITSSYYGQQQ
FT                   QQEVENETNHQRKRVFGESINVPRSNFDIKPILKESIIIDWDAAIEQYQYYFNQQLKII
FT                   ESEQPILITEPIWSKTNYRQKLIETFLENFEFNGIYLAKSPTCISFQQGRSNCLVVDLG
FT                   HDSVSITPVIDGICLLKNSMKTNYGGKFLSNEIQDYLNSFDNNNNNNNNNNNNNNKIII
FT                   EPSFKIKSKLPTIYPDSPKYQIKNNLPNNITKSFLEYQNEKIYHNFKEILEVPEKGYST
FT                   TNNNKDSTRLFELPTGQSIIIDRFKISESIFDPTIYKFTNSKLSLLYPPNNGELSISQV
FT                   NEYRPLKRIRKNDEDGGQEEEEITENPSSYSSNKSTPNPQQITTTNNNNIRGISQLISH
FT                   TLSNIDIDLRASLANNIIITGGVSLISQLTERLYYELSNNNPGLKIRLHAVGNSTERIN
FT                   QAWIGGSVLASLGTFHQMWVTKEEYNEVGVDRILNQRFR"
FT   CDS_pept        688729..690762
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078581"
FT                   /orf_name="CD36_63660"
FT                   /product="1,4-alpha-glucan-branching enzyme, putative "
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAX41245.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000192DDBD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ26"
FT                   /transl_table=12
FT                   /translation="MSKSLIQGVLDLDPWLEPFSQSLINRQIEFQNWHKKLIESEGSLI
FT                   EFANSYQKYGLHTLSNGKIQIIQYIPNVEQVSIVGDFNNWNKDNHKLNKLNEFGTWELT
FT                   LESNTIPINSKYKIAMQTKTGEWIYRLDPWVHRATFNKQQALYEGHFWEDNYKFKNPRP
FT                   SSSSSTTTKEGGIKIYEAHIGISTPEPTIGSYKNFTENILPIIHDLGYNTIQLMAIMEH
FT                   AYYASFGYQVTSFFAISSRYGTPDELKELIDTAHGMGIQVLLDIVHSHSSKNVDDGLNM
FT                   FNGTDHYLFHGGNKGNHDLWDSRLFNYTNYETLRFLLSNLKYYIDVFQFDGFRFDGVTS
FT                   MLYKHHGLSVGFSGGYHEYFGDGVDNEALIYLMLAHQLMKEISTKEGFSLTSIAEDVSG
FT                   MPTLCRPISDGGIGFDYRLSMAIPDMWIKILKHLTDEQWDIGNIVHTLTNRRYGEKVIA
FT                   YCESHDQALVGDKTLAFWLMDKEMYTNMSVLSPLTPIIDRGLALHKLIRLVTYALGGDG
FT                   YLNFEGNEFGHPEWLDFPRQGNGESYHYARRQFNLINDDLLRYKYLYQFDKKMLQLKIT
FT                   NKKEYISLKHEIDKILIFEKDQSIYIFNFNPTQSFVDYKIGVELPGTYKIILDSDAKEL
FT                   GGHGRLDHNTKYFTFNEPWNNRSNSLLVYIPTRTAIVLERIE"
FT   CDS_pept        691190..694030
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247944" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382850"
FT                   /orf_name="CD36_63670"
FT                   /product="Uncharacterized protein YPR097W orthologue,
FT                   putative"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAX41246.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG397527"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000192DDBE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ27"
FT                   /transl_table=12
FT                   /translation="METNIQSNDDIDTFLKQLTPTQEHFLKKYLLEEQLSKELHKFNQP
FT                   NCCQLLGYPFRSFTTTTTTTKDNDELSHELPLLSFFFKQFLSTFPFITNNSNENQQDFW
FT                   QNTLQPFIESFNTKPISQSEERQENITKRRQVNKKILSGLLLFYNSMIITDQELDYLKE
FT                   NHYKPSDTGKLDKFHNRKETIINDQNGQNGKNGKNGQNGIGLINIVAVRVIYENPTNIS
FT                   SWIPFYNRVKIYHLYIIEIQNDNKNDKNDKYYIAKSYQNFKTLHHQLKKKFPGLITEIH
FT                   LPSHKHKHDNGWDVNDKESIYEDETTFSNDKILIREKMRLSLRGYLKSLMKIPEIVHCT
FT                   ILSEFLTTNKTILTNEDIIDYNQRKDHEEIMKQTQIEFQQQTTKIMLSLTKDFEIFKNK
FT                   LIMNPNTITQIFYELGSTPNIKQMSPLLQTFNEWCKVEIAATIYQTFISQDNSNEWFNK
FT                   VKKFHRIFPYNIIYGILKYTNPMKIISRIVDLLLVNIPSFPQWNLSGPVSELSEHSKKN
FT                   GARNLLSMIFIMLLNEDLNGFDKELTILESNLIGYEVYLQRIKNYIQLDYQQINLIREE
FT                   EQQQQEQEQNEDLLLTILSTSKLTPQIDNKFNEIKSSYFHYKNITTTNNIGKLEQSELY
FT                   LNLKQYWQIQIRKRDKDLFKQLWQEPELSELIKKFLIIFYQPLIIIFSKSDIHLAFKNL
FT                   QKFIDDLINTIDKIINQEIYYLNSFEIYNKLINLLNRHENFIWEFIHKIYIKDDEKLFL
FT                   NLIKWIEKYLIMMRIKFINPEIVKININTSNSGPGPGPGDISLNKQLFMNQLNSRVEKI
FT                   ITKRKLFKEYLELKAKAKAKSKGNLQTNSNNDIDDNWEDINNKIFGNTTSDEFGIKIDD
FT                   LEEFNYLNVEDDLLNDLSNQTDLEWNLLNKLQKLDEITLKTNELDKLNIIDELYQVLNR
FT                   INTLETSNGITTNMNR"
FT   CDS_pept        complement(693971..694966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535626"
FT                   /orf_name="CD36_63680"
FT                   /product="Uncharacterized isomerase, putative "
FT                   /EC_number="5.1.-.-"
FT                   /function="isomerase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX41247.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG563743"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniParc:UPI000192DDBF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ28"
FT                   /transl_table=12
FT                   /translation="MPRFKQVDVFTKTKYLGNPVAVIYDCDNLTTKEMQKIARWTNLSE
FT                   TTFILTPKSFKSSSSSSLPIADYRVRIFTSNGNELSFAGHPTIGTAFALLEDGKIKPNN
FT                   QGQIIQECGAGLVKISVDKKAPRSNGSGGGGGDNDDLSVLLSFELPYFKFQEIKHEVIK
FT                   ELQNSWNNVNIIGKPIVIEDGPKWAIFQFESIQQVLDLNVDLKQIERLSLENDWTGIGV
FT                   FGKYYDNDNDNDNDNDDGEIAIELRNIAPAVGVKEDPACGSGSGAIGVYLANYIMNDND
FT                   KDKFTINISQGKSIKRDGKIKVNVERNNKNDLSIHVGGYAITCFQGIYSI"
FT   CDS_pept        join(complement(697154..697543),complement(696493..697110),
FT                   complement(695420..696490))
FT                   /pseudo
FT                   /gene_family="HOG000093309" [ FAMILY / ALN / TREE ]
FT   CDS_pept        698370..700286
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535627"
FT                   /orf_name="CD36_63720"
FT                   /product="Vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="CAX41249.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG559243"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI000192DDC0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ29"
FT                   /transl_table=12
FT                   /translation="MALNLSNIKKAYFDKLFLSQNDTTTVSTNNSTPSSNIKPRVLLLD
FT                   KYTTPIISMCYTQSELLANNIILIELIQNYHEFSSMKHLDCIVYIKPCQESVNDLRQEL
FT                   HNPHYGQYKLFLNNCIHKNQLESIAEADEYEVITKVIEIFQDYQIVNDNLYLIDSNSSK
FT                   QDVNPVLSESEKLISLLLALKKNPIIKYESNSIDLKRLSSELLYQINSNSNNNLFDDLN
FT                   RYSDSPPLLLLLDRKNDPITPLITPWTYQSMIHEFLTIEKNIVHMKSDESSSNNKNSQI
FT                   IVSDENDPFYKESMYLNYGDLTEKFQKYVEKYKSETKQSSIDNLKTTNLSELKKILTKF
FT                   PEFKKFSTNVLTHLNLISEIDKQITIQDLWEVGELQQAIACGLDNQQNLKERVLLVLNN
FT                   TNNNNKRVSTINKIKLILLYSYRYNTSNDVSLFLQKLNDPVFTQPLPSSGQVQLIKRFK
FT                   TLFGSNSLIDQQKLQNQNQNQGLTNIFANKKIDLNNLFNRNNPSHSVSDNIYLQYTPRL
FT                   NEILAGLINPQQPHQEGSLGLATLVPDKVKQQYGVNASDESVQDIIIYIKGGVTYEESR
FT                   LIYELSESNKRINLIIGGDSILNSEMWLQRLYSMVMKFSDESGRQDSEDSHANRQTQLR
FT                   DIL"
FT   CDS_pept        complement(700357..701781)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247936" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574629"
FT                   /orf_name="CD36_63730"
FT                   /product="Histone deacetylase complex subunit, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41250.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG447511"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000192DDC1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ30"
FT                   /transl_table=12
FT                   /translation="MSRKSGRRGYNSDTTTSSHRGGGGGGRERQEEDIVDLEEEEEEEE
FT                   EEELIEDGEEDEITRCICGQDELTNDSINPELSTFLKKTYKIEIDQGLFIQCEKCSVWQ
FT                   HGYCVGLFESQDVPDEYWCESCKPEFHILVNNDGYSKRTLYKPVNDKRKKLEQMTFKNN
FT                   ETSHNSTRRRGVKNERNVPQQEIMSNTKDKRKERRHHHHHHNIDEDDDEYNEQLKRALR
FT                   ESARESGVKLSESESNEKGNGNSVKREDNKSDGNNSSGRESSRGNGSGSRKRETSRRDD
FT                   DSNDSKRLKVERLDHPSGSELNENSEQELMSGSEESRSRRRGGATSKTARQKKKKSTPP
FT                   RSSANNNNKKQDDSSNETNSLGPTKEELIQQPSKPRYVNDKSSIFELRKRTIAILEWLG
FT                   RSQVELQEEKQQKLELFSFISDDDEKEGSTNSKENVNSNADTLALKETFDENLLLMEQL
FT                   TERILAWQDTFGKYAV"
FT   CDS_pept        complement(702095..702901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229983"
FT                   /orf_name="CD36_63740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41251.1"
FT                   /db_xref="HOGENOM:HBG397528"
FT                   /db_xref="UniParc:UPI000192DDC2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ31"
FT                   /transl_table=12
FT                   /translation="MLSTIFISLVIAIYIDLNEPNTTDISYYTAPHSILVTHIVLTTLF
FT                   NYNPKTIISITDTNSTIVPSDEILLTPSNQVSTITNFRYLELQHFNPIWQTSLIPLTPC
FT                   ITRQFRSPYHKHITSAPVGVILTHRTAIYSRLSLGTGFSLGEGILVNTTTLGVSLGSKI
FT                   TLKLTKQRMIDTTVGCYSYKDGLSARVFGYIPTVQVTPRARKILYNRKKRVVIDHVWEE
FT                   LKPKKIMVESTVQTLCDVGTSEELQCNKKTGTHIDQYGNSLIWNNM"
FT   CDS_pept        703537..704430
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI17574630"
FT                   /orf_name="CD36_63750"
FT                   /product="NADPH-dependent 1-acyldihydroxyacetone phosphate
FT                   reductase, putative"
FT                   /EC_number="1.1.1.101"
FT                   /function="acylglycerone-phosphate reductase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41252.1"
FT                   /db_xref="GO:0000140"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192DDC3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ32"
FT                   /transl_table=12
FT                   /translation="MPPKYALITGASSGIGYNLAIELSKKGYKVIGCSPQSVLFGQKPL
FT                   EQEYGVISLPLDVTNIDNIKNVLKKVEEITGGRLDVLYNNAGISISGPAIEIDEEELNK
FT                   VFQVNVIGQINMTKYFAPLVINAQGTILFTSSVAARVPLSWVSAYNATKAAIDAYALTL
FT                   HGEMAPFGVRVHSVITGGVDTAICDANIKTTLGDSFYDVDGVYESIRSSAMMSRDLNIS
FT                   PQQYAKEVVKDIVSWCDPGFNLYHGARSYFLHWVSRFLPLWLVEFGVQVHFKQRRVLQT
FT                   IAKLIRLKKSEEKKNV"
FT   CDS_pept        complement(704597..705397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000040465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535628"
FT                   /orf_name="CD36_63760"
FT                   /product="Ribonuclease H, putative "
FT                   /EC_number="3.1.26.4"
FT                   /function="magnesium ion binding"
FT                   /function="nucleic acid binding"
FT                   /function="ribonuclease H activity"
FT                   /protein_id="CAX41253.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="HOGENOM:HBG742437"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017067"
FT                   /db_xref="UniParc:UPI000192D2ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ33"
FT                   /transl_table=12
FT                   /translation="MPYYAVAKGSKTGVYSNWGDCKEQVHGYSGASYKKFSTAAEANAF
FT                   VSSGGKSGSSSSHSSGGRSSGGGSGSSYSSGGYSGGYSGGSSNRSSSSTTNRVYVDGAA
FT                   RGNGQTSKAPSGYGVYYGPNDSRNAAVPLDRVDKNTSYKPTNQRAELHGVKHALKNIHN
FT                   DLQSGKATGRTEIHSDSKYAIQSINEWSSNWAKNGWKNSKGEPVANKDLIQETVALKNN
FT                   INKTYQDKNWGNLKFVHVKGHAGDPGNEAADRLANQGADQYGKN"
FT   CDS_pept        complement(706058..708367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574631"
FT                   /orf_name="CD36_63780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41254.1"
FT                   /db_xref="HOGENOM:HBG396201"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000192D2EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ34"
FT                   /transl_table=12
FT                   /translation="MTKSYMPLLRPPRQFKRVYFILIPLIFAVIVLHVFFNGFSKISDY
FT                   SPTFITNRILKQKQQHKQTGEKSSNVISSYYPSLAIYPKNFDNRVEYVNEPENSKWIQY
FT                   FGDSKTVLSNYITNQTYTNHTFGLYSSSTTKVAGSCKDILYERSFEITKYRTLHDDLYI
FT                   LTTTLLNQLENDPAFQDLSPFFKDRLPHIIMRGELHKHIYKFAGTSVWLEQHGVHLMLS
FT                   RVIYSQKGRKNDPQLSLLYAQVYDENWNELNDIELIVPVINHKGERVYDAVRYPQFVAI
FT                   PFYHNSEYTKSRWYGPEDIRLILTKNKFGDDEPVIIFNSYHRQIKDMSTEDDTNVHTKF
FT                   EFYRSMFVGWLFQYQLGKLNTDGIQDSKFNNVTFNKVKELRIEGKERTLVEKNWTPFID
FT                   TDERNQVSYYGTQNLGDNYVYIVYQWNHLKILKCELDNFIDSSHSTCTMIFKDVETTQE
FT                   VGPVRGGTELWPIKIDNNNNDKIDELPSNKHEPKQRQLWIGFLRAHVKDCGCGGSMYRP
FT                   NFLILEKMNSKFKLTYLSGSINFNVTVYGWLDYDVVCAGHEANALIPNGISMFDQDEDY
FT                   LTLTMSVADQDNTLVHIHGVKNVINSLDHDWDGILKENKQIECVVKNATDYCKAYGEEH
FT                   YKLGDSEAAIKEVKKKAKEEAARKKAEKEKARKEKEEKEKEEKEKAEQEKANKEKEEKE
FT                   KADKEMADKELAEQEEEEEGNKDEGDKEKNDESEEINDDEDLENPDEAEAEDAEDAEEA
FT                   EEEEEEEEEEEEGIDV"
FT   CDS_pept        complement(710568..711599)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229984"
FT                   /orf_name="CD36_63800"
FT                   /product="NADPH-dependent methylglyoxal reductase, putative"
FT                   /EC_number="1.1.1.283"
FT                   /function="coenzyme binding"
FT                   /function="methylglyoxal reductase (NADPH-dependent)
FT                   activity"
FT                   /biological_process="cellular metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41255.1"
FT                   /db_xref="GO:0043892"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192D2EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ35"
FT                   /transl_table=12
FT                   /translation="MSTPTTVIVSGATGFIAQHVVKQLLAKNYQVIGTVRSTTKGDHLL
FT                   KLFNNPQNLSYEIVEDVGTKGAFDKVLQKHGEAKVFLHLASPFHFNVTDVEKELLLPAV
FT                   DGTKNVLQAIYNFGKNIEKVVITSSYAAISTASKEADKNAVITEKDWNEISWQDSLLNP
FT                   VNGYRGSKKFAEKAAWDFVKSNDNVKFSLSTINPSFVFGPQSFSSEIKQSLNTSSEIIN
FT                   SILKLKPNDPIPGSKGGWVDVRDVAKAHIIAFENEDAKNQRILLNSGRFTSQSLVDIIN
FT                   DKFPDLKGKIPVGEPGSDKEIIAESLATIDDTKSRELLGFKYYNLEQSVYDTVEQIVNA
FT                   HKL"
FT   CDS_pept        complement(711914..712951)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574632"
FT                   /orf_name="CD36_63830"
FT                   /product="Ornithine carbamoyltransferase, putative "
FT                   /EC_number="2.1.3.3"
FT                   /function="amino acid binding"
FT                   /function="ornithine carbamoyltransferase activity "
FT                   /cellular_component="ornithine carbamoyltransferase complex"
FT                   /protein_id="CAX41256.1"
FT                   /db_xref="GO:0004585"
FT                   /db_xref="GO:0009348"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG579429"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniParc:UPI000192D2F0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ36"
FT                   /transl_table=12
FT                   /translation="MMSSVRTITTTRLLSTTPIKAAATSQTPRHLINIAQLTNDEFSSL
FT                   INKAYQFKQLVKSDKPSIENHQKLLGKLVALLFTKRSTRTRISTEGAASFFGAQPMFLG
FT                   KDDIQLGVNESMYDTTKVISSMTSCIFARVNKHQDILDLCQHSSVPIVNSLCDKYHPLQ
FT                   AIADLLTIKEQFGDNLKGLKLTWIGDANNVINDLSIACLKLGINVSISIPKNITFDQDV
FT                   VEIAEKLAKEQNLSFEIVNDPIVALNNANIVVTDTWISMGEEEQKLAKLKQFEGYQITQ
FT                   EMCKLGKVNSNWKFMHCLPRHSEEVADDVFYSDNSVVFEEAENRLYAAMAVIDGFVINK
FT                   GDLLK"
FT   CDS_pept        complement(713316..714383)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078582"
FT                   /orf_name="CD36_63840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41257.1"
FT                   /db_xref="HOGENOM:HBG397530"
FT                   /db_xref="UniParc:UPI000192D2F1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ37"
FT                   /transl_table=12
FT                   /translation="MNIEDDDDDDLLSELNHELKNTQASKVSFKRKSFNKPQKIQRNKL
FT                   SFNIDEEEEHDGDEDIKELKGVTTQIKSKGSSLLRFNPRAKFTKEKSSEPEQSIKKPIN
FT                   LSRYQIDSTTTTSTPVINDNDTILFELDEDDPENNPVITNIDDLKDEDSEEFVKLKSKL
FT                   TTSSQQLRQSQVLSSVSEDTSKRYVPIETNRDPESSKLTARQYANALVNEYKDDKNYDD
FT                   GTERQNQEDQEQLLNDINDGDIELNDEDMGTLNMGKRSNFDDNKFNFEIHSDDADQEES
FT                   DGQQHSENESYDDGNIEFSIPTIEEQIIRINGLIKQFEVTKSEKQKLIQNLKIEQNELS
FT                   ETKSEVLEKLNNLVI"
FT   CDS_pept        714580..715572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574633"
FT                   /orf_name="CD36_63850"
FT                   /product="DNA-directed RNA polymerase III subunit, putative"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41258.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG397531"
FT                   /db_xref="InterPro:IPR007832"
FT                   /db_xref="InterPro:IPR016049"
FT                   /db_xref="UniParc:UPI000192D2F2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ38"
FT                   /transl_table=12
FT                   /translation="MSGVLVSDKARHLYTKMREYPNSKLFDQDELQTLFDIKKGSELME
FT                   YLQELVNGKYVKISKMGDQLKFQTVAEEEAKKVSSMSDDEAMIYSYIEASGREGIWTKT
FT                   IKAKTNLHQHIVQKCLKNLENNRYIKSIKSVKHPTRKIYMLYNLQPSIDVTGGPWFTDS
FT                   ELDTEFIETLLEVCWRFIVGKTMYIKDENADTEDSNPLQTTYHNHHPGVNLDQLVEFIN
FT                   NSNITSVELGINDIRSLCDVLIYDDRIEEVGGNQENSGIFKATWQSIIDKGNTILQNNY
FT                   QDLKNAVSDDCLNYLQQNQSDFSVFQYKSTIQDLQDESDLVYLDSWMNE"
FT   CDS_pept        complement(715725..716642)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229985"
FT                   /orf_name="CD36_63860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41259.1"
FT                   /db_xref="HOGENOM:HBG397532"
FT                   /db_xref="UniParc:UPI000192D2F3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ39"
FT                   /transl_table=12
FT                   /translation="MRFLLVPARCRISIIPKLAFPRISFYKNYSFTPETTLNRRGDIET
FT                   PNPRLKILDNFDPENKPNETSAVYTRFGWFYIPTEFYLDGKIGVEIQNSLDDNGVTSQT
FT                   PKSEIQRLILEWCRDQPYETKKKYTRKRASKKEAPEVILDRLFNDAKNGSVGEHKHEPT
FT                   VEGLPYEIEKAMLKVTSRSVFAKFDESTGKYEIKGAITQGAAYQYYLSKEWNHFRDSYI
FT                   TIKKTREALGKAWKNKTPEEREAMRLEFLEMLKNGKDLVAGKIVPLELRLTKTVFNDGY
FT                   RLRVRSDYTKYLSRLKNIPISRES"
FT   CDS_pept        join(717683..717769,717771..717803,717806..717931,
FT                   717939..717989)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        718515..721496
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094314" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574634"
FT                   /orf_name="CD36_63870"
FT                   /product="Arrestin-like protein, putative "
FT                   /protein_id="CAX41261.1"
FT                   /db_xref="HOGENOM:HBG397534"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000192D2F4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ40"
FT                   /transl_table=12
FT                   /translation="MNIPNSPLFAPQQLTNHHSTPTNSNNDKGTTTSTPTSKNHLNKSS
FT                   SLSSAVLTPTLPEKPTVSTSSLAVYIVPSEQNLFVQGFEEHIYLSRPPTILRGSLVVKV
FT                   LKPTKIKSISLTFKGIQRTDWPEGIPPKKNQYNEINEIITHTWPFVQGNINDKLPHNGA
FT                   DYFIEKDGTTHQGGINASFEDDFSSVRSSTPPPPALGHSATSPSSTLSPTRKSHREEQS
FT                   SNNAANFFTRNLSPSFIRRGKSSSISSMAEVGKTSSFIDLIPTTSSPSPGDSHSNIIHF
FT                   SPGDYIYNFEHPLPASIPESCNATFGSTSYYLEVSINRPGAFKTNLAGRLPINIIRTLA
FT                   ESSLEENESIVITRDWEDQLRYDIVIGAKSVVLDSYLPLAFRFVPLWGKVALHRIRVYL
FT                   TENLEYYCSNKKVHRMEPSKKYLLLEHKAKKGRSLLSSKNPEDESSTDSLNDFDDDILP
FT                   KELEFQLFVPTELNARTNSRLHPDTSYENIQAHHWIKICLRISKQDPENPEKRKHYEIS
FT                   IDSPLHVLSHLCSHNNTLLPAYDDLIPSMSLVHSHNELPPLSPGVTPVEHTERPRNGSV
FT                   SNQILGMFNSNNNGNSQSRSSSLSRENENGRSSTPIEFHHISSGLESAGAVEREADMHL
FT                   EANLYQPKENAISAINSPQALPHPDTFSSPVISSPVQRPIHLIRKPSVNPPPFDADVPP
FT                   PSSIPPPAYEECDPEGRRGSNGYGRDLSVTSDNSRSLSLSPLRIDEPSESGTTSSTRPS
FT                   VTTNSFPSTAIASNTPVRDLLIQQLNGSGSSSLVTPTELVEPTTKIDDNIPVDSPVPQI
FT                   EIHNENNDEIHGNNVSTESISSLRRSSFNSERGSNSNGHDQDRASNREGEPETETEEEE
FT                   DITDYPSPILPPTAVHGMAKISRTSSAASTTSINSAEIPVEQTIPLLSLVPSHTSQANI
FT                   DSYNKGRNESVGSLLYEVAKPTEFYNGLESSAGVDNDFFKVMSSSLSKLRNPRLAKHYQ
FT                   DQES"
FT   CDS_pept        722724..724397
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574635"
FT                   /gene_name="MDR1"
FT                   /orf_name="CD36_63890"
FT                   /product="Multidrug transporter"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41262.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000006C7D1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ41"
FT                   /transl_table=12
FT                   /translation="MHYRFLRDSFVGRVVYHLSKHKYFAHPEEAKDYIVPEKYLADYKP
FT                   TLGDDTSINFEKEEIDNEGEPNSTQSSSNNTVVSNTNEDDKIIVTWDGDDDPENPQNWP
FT                   ALQKAFFIFQISFLTTSVYMGSAVYTPGIEELMHDFGIGRVVATLPLTLFVIGYGVGPL
FT                   VFSPMSENAIFGRTSIYIVTLFLFVILQIPTALVNNIAGLCILRFLGGFFASPCLATGG
FT                   ASVADVVKFWNLPVGLAAWSLGAVCGPSFGPFFGSILTVKASWRWTFWFMCIISGFSFV
FT                   MLCFTLPETFSKTLLYRKAKRLRAITGNNRITSEGEIENSKMTSHELIIDTLWRPLEIT
FT                   VMEPVVLLINIYIAMVYSILYLFFEVFPIYFIGVKHFTLVELGTTYMSIVIGIVIAAFI
FT                   YIPVIRQKFTKPILREEQVFPEVFIPIAIVGGILLTSGLFIFGWSANRTTHWVGPLFGA
FT                   AITASGAFLIFQTLFNFMGASFKPHYIASVFASNDLFRSVIASVFPLFGAPLFDNLATP
FT                   EYPVAWGSSVLGFITLLMIAIPVLFYLNGPKLRARSKYAN"
FT   CDS_pept        725564..727510
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574636"
FT                   /orf_name="CD36_63900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41263.1"
FT                   /db_xref="HOGENOM:HBG396201"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000192D2F5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ42"
FT                   /transl_table=12
FT                   /translation="MGNYKPSIKQYVVTAKAIKSSQFARLGICAIVLLFILGYPFYFIS
FT                   NNPFDTSIRFQYVDPYNDTTRKYTTIEKQHTDIGGNSTTIIYPKNLDLDLDQAALQQVL
FT                   NTTNTTNPFVQYIGNSSSIAFSQLNQTLATHNIQVFDSSSNSKNCSDILTETRLTISQN
FT                   IIIKESFEIMIKRLIHQLNTEPAFKELAPFFQNRLSLHLRWKTYHKHFYKFAGTSVWLK
FT                   DYGVHLMISRVIYSQKAKKGDPQISLLYAQLYDTNWQELTNTDLLVSMQDTTGAYKLET
FT                   LSFPRFLPMPFYFNPSLTKGRWYGPEDARIMLVKNQLDIEEPMIIFNSYHRQITNHTTT
FT                   ETKDGSVELNFEFYRSMFVGWPFRYQLGKANTDGFVDDRFDNVKFTRVAELKIHNQTRA
FT                   AVEKNWTPFVDPSERNPEDKSLYIVYQWDKLRILKCDISNLVTDDGFTHYSACKFKQDS
FT                   KLKKVEKVGPIRGGTELIPTTIDNKRLWIGFLRAHIDKCGCGKAMYRPNMVVLQKTDKG
FT                   TFKVAYLSSYISFNIPVPGWKTPDIQCAKKDPSVLIPNGISNWEVATIDGIERDVLTMT
FT                   LSAADEDNILMDIHGLKTVIQDLITNQKQDNELDTDSVQMKCVVAYSTEFCRAYGEEQA
FT                   RLGLTGGWLPQHI"
FT   CDS_pept        727732..728991
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535629"
FT                   /orf_name="CD36_63910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41264.1"
FT                   /db_xref="HOGENOM:HBG397535"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniParc:UPI000192D2F6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ43"
FT                   /transl_table=12
FT                   /translation="MLKPLIRKKFSRHLWRTVHTRHYSNKKLQNVESTPEQESTSAIVD
FT                   RMKQILEEKISSQSATTIETMKRSDESLNQILSKYDTMSTSLPNTKQAASYIKSEPILA
FT                   HNKHAKDIYNSIPWSGTESVYDSNLRMIVDSKPKPINDPASLAYKKRNPTNNEKLAMAR
FT                   DISLDYKVNKPQKGKDKDGDNKDDDDDDGFREMYRERLLGPSMLINHSSTSVDFVEMLA
FT                   SNKINAKIDQTTGKFETDDMQNVRGKPLEKQHLVNCTDSNYFMNQVLNKQEVLPPWIES
FT                   QQNLNRNIAQFRRNLIEMWSKSKKLHESDLKYIETKINLLNQEIRNYNLQCPSVSGHKF
FT                   KLNKEKEIENAIKQALENPIKPKPIEVKNNTGFLDIFGGGSGGSTHTSAGSRQNIHIDR
FT                   NIDPKLNVWQAIKDVFSLGK"
FT   CDS_pept        729376..731763
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI17574637"
FT                   /orf_name="CD36_63920"
FT                   /product="ATP-dependent permease, mitochondrial, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41265.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000192D2F7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ44"
FT                   /transl_table=12
FT                   /translation="MIILPSIRNFLFLSSSRSIKVLPARQYFKNLTFITTKLNTIHSGP
FT                   TTTTTTTSSSSYLLKTVCLSQFRTYSTTPSSNLPPSQVSVKAHLDATNLKKKEIKQERL
FT                   EQFQKQENKKTFKQNLLTIGRIIKLGKPDWKLFVLAIGFILCAVLYPTTAVKLVGSVLD
FT                   SFNNNIKDEDGDLLVWGYKVSTVFAVMIPFMAVSAVCFWARIWVLKLLGERLVARLRAR
FT                   VMKNLLRHDQEFFDNDKHKVGDLISRLSSDAYIVSRSITSNLPDGLKNLLFGLLSSYMM
FT                   YSINPMLFGMMLLISPPITIGSVFYGEKIRKLSTNLQNATAGLTKVSEETLNSIKLINA
FT                   FTGEQKELRKYSTRLRRVVEVAKQEAFAQSNYSVSIYSLYHTGYLACVALGVYLMTKGT
FT                   MSAGDVVAFTMYSEFFNSALYSLTTTYLELMKGAGAGVKLFALIDYKNKVPAIQGEKVT
FT                   TWRHTSVQDDIQFHDVTFSYPTRPNHTIFNHCNFEIVGGTSTCIVAPSGAGKSTVAALL
FT                   LRAYDIQSGEILIGGKNIKDIQVRDLRRYIVGIVQQEPVLLSGTILENIVYGLTSSEIN
FT                   KLTMQDIIDVSKQANCHDFIVNFPDGYDTVIGNRGASLSGGQKQRIAIARALIKRPKVL
FT                   ILDEATSALDSKSESLINETLKNLTNEGSMTIISIAHRLSTISKSEFVVVLGKHGQVVE
FT                   TGKFVELFSNPDSELSKLLDESATSQAAAATQEEDEVDGSEQENRHHKTQEDELEHINR
FT                   EAEEIENKQIKYSKVKNLIESLPLDMKQQLLAEINNEEKNTT"
FT   CDS_pept        complement(732086..732277)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574638"
FT                   /orf_name="CD36_63930"
FT                   /product="ATP synthase catalytic sector F1 epsilon subunit "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, catalytic core F(1)"
FT                   /protein_id="CAX41266.1"
FT                   /db_xref="GO:0000275"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG398609"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="UniParc:UPI000192D2F8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ45"
FT                   /transl_table=12
FT                   /translation="MSAYKQAGVSLNKALAIAAQTLRNSLKPEFRAAAEKRGFVDAKVI
FT                   TFKDGKQSEPIPLKPTDK"
FT   CDS_pept        complement(732635..736036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078583"
FT                   /orf_name="CD36_63950"
FT                   /product="DNA polymerase V, putative "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /protein_id="CAX41267.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="HOGENOM:HBG397536"
FT                   /db_xref="InterPro:IPR007015"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000192DE4F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ46"
FT                   /transl_table=12
FT                   /translation="MAVSRDHYFKLGSELPKERLNAATSLISELIATDNEEEWSYALNR
FT                   LLKGILTTRQAAKFGFSMALTEVVNELINRNILTVGKYLNLLVETTKITSSMKGKEQRA
FT                   ILFGRLFGLQVLINSKIIILKSELNDMLQFVEILMELSNYKNWIRETGIFTLIQFIKLL
FT                   DNIEYREKIYIKILNLINNFGLNLSTEGLAIYLSIPQSGQLSQNISNIKPNWKNGDPFY
FT                   KGNLPILAKVLKDVEVINDEETETETETETQTKKTKKNKNKNQQKSSWNSRLPFVWDLI
FT                   VAKFNQFVVDTNIEDELQDSISISKKRKKTPPQKHVSNNKRAKIEPEYISLKEFWKVVI
FT                   DETLFSEKSSNERKYWGFEIFIKFITSLESSSSSSSSSSSLVEYLFTPNFMRCLINQHA
FT                   SSTRMLYKIAQQTLKTLVKTIQQEPNSELGPIVLSCLLDESKGGCWNFDLISKSHTIDE
FT                   ILQIKSNVNQYINILLENFIIKLQTQIVSEDSNNTNNKNSNDNILKWYLDKIVSLIKHH
FT                   NNNNNNNQFKLSDTILESILTKLLQYSFFDTKEIKISKFLQSICKEKFNSILSEIITLK
FT                   LENKIYKTWSTFCYQIIEKLSQLPKNKCLVEFDDEISIVKQETEQLLSTIIELNTNLTS
FT                   SSSSSSSDKLYIFELMFSMCLIQLYMEDEETIQVINELKLVFENQFSPKDDDTNNNNNN
FT                   NNNNNNNNNNNNNDDNDNDDENKIDDNLVLTEIVLSFISRKSTLFKKLSVLVWENFLCQ
FT                   VDDMGKLRVNEGCFKLLFDVLEAKENKQGQEKLFEGDEEFQEEEQEEEEEEENEEAQDD
FT                   KSNENSEIDSESDSDSDSDNDSDDDDDDDDDSELDNNEDTIAEIDKQTNLKLAQALGIP
FT                   TKESGEVKFDELDDLSSDDDDYESDSMDDEQMMAMDDQLSKIFKQRQDTIINLSTGNKR
FT                   KLEVLEAKENMIFFKNRVLDLLETFNKVAINSHYNLTFIKPLINLMNLTLDKNLGIKAH
FT                   KLLKNKISKTKIENEELKKYYNDDDDDDNNLSEYYHHLINLIEELQTKANTIKSSNQSV
FT                   VQSYNQSCIIIAKNLLNLDESNMQAIVDIYCKSLKQWCLQSESKLQPSLFFDFINWINS
FT                   KKNNACHNSKTKTKTKTKTNTKNSKP"
FT   CDS_pept        736327..737664
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574639"
FT                   /gene_name="ASA1"
FT                   /orf_name="CD36_63960"
FT                   /product="ASTRA-associated protein 1 "
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41268.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG448189"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DE50"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WJ47"
FT                   /transl_table=12
FT                   /translation="MLSKKFTLRSHKSSITYIYPHPTIPSNVFTADSSGLIINWDLTIR
FT                   RPKSSWQAHTDTILTISTIENNNSNNNGDGDGDGDGDYYLLTHSRDNTIKIWDLLKFSC
FT                   LLEIPCNSLNFTNIEIFNDLLFTPSSINSNNLDVYKINPKNWQIKRLIFDFDIYKLVNK
FT                   NENENGNIIQEIGSDTITNNRNDFGIIMQMKIIKTITTTTTNTTTTTTKENQEENGGDF
FT                   IIYLGFESGDIVGLQLILPPARILSTTNKSTNTNTNTNDKTIIYNQSAKFILKYHNSFH
FT                   VPNPIICLSNLNSILISSSITNKLIIHYNPIIEIKNLKYSGIQSIVYFKKFHQLIFGYW
FT                   NGYIQYDDILIKQNLPKLGTTNNNNINNNIDTDINQEQSKLTKKLTFMTILNESKQEIS
FT                   QTSTTTTTTSGGDKSKYSSLIKSKRNFKLPLLLVGYEDGSIVAYNI"
FT   CDS_pept        complement(737742..739397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229986"
FT                   /orf_name="CD36_63970"
FT                   /product="Uncharacterized protein YBR130C orthologue,
FT                   putative"
FT                   /protein_id="CAX41269.1"
FT                   /db_xref="HOGENOM:HBG448188"
FT                   /db_xref="UniParc:UPI000192DE51"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ48"
FT                   /transl_table=12
FT                   /translation="MTDTPNSPSKNTTKSASSSTKVIDSLHSKIDQLTDELTALKQSHQ
FT                   ELTKKHSITAKKNDSFVDQLANAKHENDMLSALLKRKERRILDLEDQFNELTSQNESLV
FT                   LSNKNMKIRCDNLQSNSNANIAEFERLKISYDALIASQMEYKNHYQQELNNLQIAFDNY
FT                   KLENTKRFEELQTSIVNNDKDIDTLLDSLTNKRKAMDNIYVNKNNKVLQLLGNLAHLAK
FT                   LHGQDTKSQVEQNLNIIEQLLVKYPDLQEKILEKEKIEIDLTEIIAHSNDVLTNSSFDE
FT                   DTTLINSPDLENNHNFNNHNTSGSATPNNNNHNNNSNSHSLQSKKRKNYKRNSLILKES
FT                   PPIISENVPSSLPKKPQVNNNLINIPKSRSKFNTPPTTPRQTTPRQFTNHNNDFEITHQ
FT                   WSSNNNNNNNNNNNNHRRNNSVDSRSDNGHHPHRRNNSYDSRPDHGQQHRRQPSQQNNN
FT                   YNNNNYNNNNNNNNNINNNSNGFVKRSGSVRNGNNYNNNNGNGNGNGNGNANNNANNHG
FT                   NKSKRRSTYNNNNNNNNNSKRNSQLFDNNFALNV"
FT   CDS_pept        complement(741686..744028)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574640"
FT                   /orf_name="CD36_63980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41270.1"
FT                   /db_xref="HOGENOM:HBG397940"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000192DE52"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ49"
FT                   /transl_table=12
FT                   /translation="MTERSNKFIEILSNPLDFSSYRYITIPSPSPSPSPDNILPIDITK
FT                   TIKPPQFIPTIHEAIIHLKLLKAFQVMKNKVLINYELNDEYREKYWQSFITLAVRRFIV
FT                   FISAIREKNYKNYINSEGRNINFRKTELQIFNDAIITTTNDNDNQKWFINMMNDLMPPL
FT                   DVIMVWHSFLLNPKTFYDTCLRNNVLNFANYPLPLYKINQFIDNYTFEFNVDYSINQKN
FT                   YLNLIKSFTNDTTTTTNDDNDDDDNERDINQYDIATNFSLNKQLVRFYCPGCKKILTDW
FT                   IKINDKNQMGLADRNLSVRTLRSQSFIIEDDLSPPPLSSQPSKKCAYTCPCINISMITH
FT                   ESLRILHLIVDAKRRKNKNEIYPLLPGIYKYFSSVICNPKYSSKSPITLNKNICQAIEK
FT                   NYSVEKNLITIINDILIKKPTKKPTKKPTKKPTKNNINININEIKKIRIILRNYLQFNY
FT                   ISSTVKNGIEIGEDLVGCILRQEIFWEKINQIDWLHSPLIYESLKESLIRYKRFYSMLT
FT                   TTNNNNNNKYTKEILLVPTLDIDLIWHTHQLSMYGYFHDCLTSSCHYVIDHNDKIDNNK
FT                   LNDGFSFTSKKYKYLFKDNYSICYCQYCTNYRIKYTTNKKFLSLFQTKKQQLQQQQQQQ
FT                   QLLKNNPLFDGENQGGVTHISNHNSIQMPTKKAINRREKTPMPWDDNNNKNNNKNNNVN
FT                   NNNNNRRDGYYVVVPYAPIEIDHCQFYGTGLCNSVNAQCVSDSGKCCSFGGSACVTDNG
FT                   SACGGDNGGCSSCGGGGCGGGCGGGCD"
FT   CDS_pept        745179..746222
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172419" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382851"
FT                   /orf_name="CD36_63990"
FT                   /product="Adenosine kinase, putative "
FT                   /EC_number="2.7.1.20"
FT                   /function="adenosine kinase activity"
FT                   /biological_process="purine ribonucleoside salvage "
FT                   /protein_id="CAX41271.1"
FT                   /db_xref="GO:0004001"
FT                   /db_xref="GO:0006166"
FT                   /db_xref="HOGENOM:HBG314716"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000192DE53"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ50"
FT                   /transl_table=12
FT                   /translation="MSSYKLVCLGNPLLDLQAKVEKDYLQKYDLKDNDAILADTKHMPI
FT                   FQELIKRDDLVLVAGGAAQNTARGAQYILPPKSVVYFGSVGKDIYAERLNQANEEYGLI
FT                   TKYQIQPNISTGKCAALIHNHDRSLVTDLAAANHFTPDHLQKLENWEIIENAGFYYIGG
FT                   FHLTVSPPAIKLLGEHASKNNKPLILNFSAPFIPQFFKQQLDEILPYVDYVIANESEAA
FT                   AYSESHDLKTTNIVEIAKKIVKLPKKNNQISRTVIFTQGLDPTITVTYDINKDSFDIQQ
FT                   YPVKELDKEKVVDTNGAGDAFAAGFVASLVQGKNLPQSIDVGQWAAALSIQEVGPTFPF
FT                   PKQTYSN"
FT   CDS_pept        complement(747395..749626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094316" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382852"
FT                   /orf_name="CD36_64000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41272.1"
FT                   /db_xref="HOGENOM:HBG397537"
FT                   /db_xref="UniParc:UPI000192DE54"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ51"
FT                   /transl_table=12
FT                   /translation="MISISILTYLIFIKLIQANDLFRVKTIIDYQDLFFQIDPINFQVQ
FT                   LSDSSIDIFEFNKNSNKLFCAGTNDIITYNENNCSYLKKFSNNNNDDDDDDESLSSSIG
FT                   WSLDRQTLKFDHDLYFCGNKLPYSILANPLGLSNCRKLAIFKIVIEPKVEIQQQEEEEE
FT                   EVEEEYDEDIESSTDFPSSTTEESSEEIESSITNEIDLPTTETDLPTTKTDLPTIKTST
FT                   DNDISTTVESTTIETDKPSTTSTSTSTNTSTTTSNDSVTTTSKSNESSTTIESKESESE
FT                   SESVTSTDESTTKSSTTTMTTDEQEEESTTSSQLSEETESPSEEEEEDVEGGGDGEGEG
FT                   EGEEEGGNIDSTMSMIISAMFQGDRVYFYSNEKFITLLNGDLAIFKIIDGYLQINNNNN
FT                   NNNKWININDEKLLELVDNQKDAIQGWIINDEGIFLIQESIDGFYSDNVKFSACNNHDD
FT                   DDNNNDDNNNVGYRVYFGEENGCEPLNQFKIVNIEEDNIDEIDPTDPTEVPESTDNDDN
FT                   DDDNDDNAVESNPPIEDSPSDTPSDTITTNNDEQSITPTSNPINESIETDESNESTKSS
FT                   FDTITTKDITDQELTTIITETTDTATVTDCEEEDDDGSCTPRTTIRNTIIITHCPIVTK
FT                   TEIETIITDLTITLTTCIDETICEVKTSMISTIVTTTTTTLTTHSVITEYISNDSSSAT
FT                   TTTATTTAAIANNDAIVTPQEEQPDNNNNNDNEVTDGPINPENPENPED"
FT   CDS_pept        751787..753211
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535630"
FT                   /orf_name="CD36_64010"
FT                   /product="F-box protein, putative "
FT                   /function="ligase activity"
FT                   /protein_id="CAX41273.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397538"
FT                   /db_xref="UniParc:UPI000192DE55"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ52"
FT                   /transl_table=12
FT                   /translation="MLVKLPLEIQIKLLLMVPNSNLKFVNSHFYLLYNDLYYHKIVNTF
FT                   GEATVKVIIKILPWLKPYIKSLDVFRKQARLVITKRLQLEELPIIIHNSDFTTTTTINP
FT                   LNCQYIKDSWKYIYSILKNKRLYAEYCDYQIDEPSNYVFNHYVEINRTYLLSYKKVCWL
FT                   TPGDYNLNIALAIKNGQGLGTTKFEVRYQELNELGETLIKSQTFYPPSNINEILPKNQF
FT                   VYLNVGHFIIPKPSKIESKFYSKQFQFQPQPNNDHNKLRRIEIVMEEIGLYLKSGFRVY
FT                   FIDISQPSMLFNEYDLLYYSINETDYRYFINILLKNLYKALNYVQNAGCSDDLSFQYNR
FT                   DIYGDGDPFIIIKKYDKQFLLEYDKTNGMLSSSSSSSSSSSLALSSLQDYVLYDNKKLL
FT                   NYGRFFFLNKFTIRNFKFTTIYQQRQFINRFGDYLIDWKEQDSKKNTNKDEMPIERNCT
FT                   YDKYGLKWKLPILGQL"
FT   mobile_element  complement(753402..759521)
FT                   /mobile_element_type="retrotransposon:sampi D, Tcd24"
FT   CDS_pept        complement(754839..755273)
FT                   /pseudo
FT                   /gene_family="HOG000093730" [ FAMILY / ALN / TREE ]
FT                   /protein_id="CAX41274.1"
FT   CDS_pept        complement(755900..756592)
FT                   /pseudo
FT                   /gene_family="HOG000078648" [ FAMILY / ALN / TREE ]
FT                   /protein_id="CAX41275.1"
FT   CDS_pept        join(complement(757346..758362),complement(756582..757361))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229987"
FT                   /orf_name="CD36_64050"
FT                   /product="Hypothetical transposon protein, putative "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41276.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="UniParc:UPI000192DE58"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ55"
FT                   /transl_table=12
FT                   /translation="MAYNNNNKNRNNNHKAGKNPNFRNKSHSKNFKPKFNPRFKQFKKE
FT                   TAVEIQVKLNRQNPDTAIQRAKVMDGSDKSITVAVKRQMMNRLIQTKNDMAASKFKTSM
FT                   IFAIARPHLAGMAAEWLQEFENDQIEKENTINGERRSNATTLTIQEFIHQFDTRFLPKN
FT                   NNMEIQEFIHQFDTRFLQKKNDMDIQVNLNKLTHTGTYDQFRNAFFKLYDSMIEKNDAA
FT                   VNSYTLDLFKSKVRPMFYPELSAIHSISELRYFRPSEGSLAGDEALQKAINSTNSSGHQ
FT                   SQPTKFNNSNNQQWDDKKVCLRHGPCNHTTNECSVIANLIDADKKKSSKQFTKSESKNV
FT                   GVKKLVVSREDIKRDLSQTNSHAQSQIIQINLNASESKVLFIYVQLENINFHKALLDTG
FT                   SDSNLIYSNLVSNLQTQQIAPMKLSSPDGTFLATVTEKISIFWPAINENVTFIVADFDN
FT                   FPIILGAEVAKKFLKFPDTIQEWNDETMKLQDPIPAQAETDTSPMDIDSVVDTYLDEVD
FT                   GLEENLEERFVSSLMLSQSSLFPTKYTKSFSIDFNKQLSNENLVVSNITTEPDTQFHHN
FT                   EKAQTLLQQLLIEYSDTVNNEQ"
FT   mobile_element  758567..758860
FT                   /mobile_element_type="retrotransposon:solo LTR, nu L"
FT   mobile_element  759033..759503
FT                   /mobile_element_type="retrotransposon:solo LTR, eta H"
FT   CDS_pept        759621..762641
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229988"
FT                   /orf_name="CD36_64060"
FT                   /product="Polyphosphoinositide phosphatase, putative "
FT                   /EC_number="3.1.3.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAX41277.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG676929"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniParc:UPI000192DEA2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ56"
FT                   /transl_table=12
FT                   /translation="MNLNVSMVGSSGQDKSMPKSTAVTASNSSLDQNTPSQHPKDKQHE
FT                   QEMEKEILQQGSKDASFVNDNNKPPQQDQPLNGQQYENQDEQTQPNQPDHNQQQDNEND
FT                   EQQDDYGDASESNKRIILQRFTIYNATTTMYIAGSNSKESLFRIMEISKDEENDNVVSI
FT                   IEDSNYFYTRKDMIELLNGLDESIEGGIHKVAQGYGMLGLIRFTQSYYLCLITKCSQVA
FT                   ILGGHFIYHIDETKLIPLGTNYKRPEKYSDEEKLLSIFKYMDLGKTFYFSYSYDITNTL
FT                   QTNFVRNKKKATDVQFGVNTNKVNDLFNNFEHNERFVWNNLLLKPILDNPEVATYEWFQ
FT                   PIIHGFIDQANISVYGRKFYITIIARRSHHFAGARFLKRGVNDKGNVANEIETEQIVSD
FT                   MLISSFHDPKYGFYNNPRYTSFVQHRGSIPLYWTQDMNKLPKPPIQINLNDPFYQSSAL
FT                   HFNDLFHRYGSPIIVLNLIKQKEKQPRESKLNHYFMACIKYLDQFLPESKKIQYYSFDM
FT                   SRHSKKNLDVIGPIQSIAANAINQIGFFHNGINLSNTNLQKGIIRTNCIDCLDRTNAAQ
FT                   FIICKEALTHQLRSLKIISQTQNLDYDSDLINVVTEIFHDHGDTIAIQYGGSNLVNTMD
FT                   SYRRINQWSSHTRDMLNSIKRMYSNSFMDSIRQEAINLFLGNYIYEPNKPKLWELQNDY
FT                   ALHNDYSGNGLHKPHKSYINWYNETYLLDSRYFFGGNECNEILRLEAFPDCNEKWFNEC
FT                   YIPRKYQSFTELFQFNMNSNSRYFPPTENTENGNNKFDYSPFESRRKKYKTFEQESKKI
FT                   KHDIKIKSSPRSKRIQKFLPFNNVHHSNNNNNNNKRNLELIEDDDDEDEDEDKDDNGNV
FT                   EEEEESISFPDSNQENSIVTVNEKDIELYNSQWDYDKIINHQTINTQDYSFNPRVKTNI
FT                   EDKEIYWYYSNEIFSKLRNNGGGGDSNYNGLEDLISPQDLKTYLSFDNRNNVYDDDEMI
FT                   TNFNNQLDLNTDNNYFF"
FT   CDS_pept        complement(762738..763127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094318" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535631"
FT                   /orf_name="CD36_64070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41278.1"
FT                   /db_xref="HOGENOM:HBG397644"
FT                   /db_xref="UniParc:UPI000192DEA3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ57"
FT                   /transl_table=12
FT                   /translation="MKFTISLDQFLQYYNDHGKHPELLKSSQFDSNKIIQSLTTTTTTA
FT                   TKNNSSSQPHDININDIELDVENLPQCMPPINQEEYENYLMMKKIHHDNFLREVNEKGL
FT                   QLKDQITQLPFDSSQSIEYLKMMGK"
FT   CDS_pept        763623..765041
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535632"
FT                   /orf_name="CD36_64080"
FT                   /product="Membrane transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41279.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG396145"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192DEA4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ58"
FT                   /transl_table=12
FT                   /translation="MTNTLSSFESVELTAVSLRHQIQFRPEDDQLSNDSLTPIVTITEE
FT                   EYEDNDSSEEYPEGGLKAYSVILGSFLGLIVNLGLINSIGAIQAYVSTHQLSNLKATSI
FT                   SWIFSIYLSLAYAGGIITGPIFDKRGPLEILIVATIFIFLGLMGAAQSVEIWQFILSFI
FT                   SLGIGSGLGTTPLIVVISHWFCKKSGSFTGFATSGGSIGGLIFPLMLRHTYNVYGYVWA
FT                   IRILAFMSLGCMLCSIFLVKERFHKVQTEVISQQSKTTTKFSFQILMEKLKSVNASDFK
FT                   YIYVILGAFFAELSLILLVTYFPSYAIAQGVSESTSLLLLTVWNATGILGRWIPGLVSD
FT                   IYGRYNVYVFMLILYCLSIFVLLYPFGSSEKILYAFAGVGGYCSGSILGLLPACLSQIT
FT                   PVNEIGTKYGILNAVLSLANLFGIPIAASIIKDGTSKEYNNFVVLVGCLAVAGSLFWYF
FT                   SRVAISGFKLNIKV"
FT   CDS_pept        complement(765140..766876)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574641"
FT                   /orf_name="CD36_64090"
FT                   /product="Uncharacterized protein YDR026C homologue,
FT                   putative"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41280.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG448190"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000192DEA5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ59"
FT                   /transl_table=12
FT                   /translation="MQEDQHENGAHTLLKLGVKQENDNESAQNNHINDTVEAAVMKYVG
FT                   GTLGTDDAKRKRKLNTDDYEFAQWTGFLDDNFINEASSDAIAPSSTPPKKKKKKDKKKH
FT                   KEKDKKKDKKDKKDKKKDKKDKKDKKDKKKKKHRHRRGHDEQTQNVDGPQEGEESVMST
FT                   KVEGNTNNGTADNWNAGEGNVTEKNTIEEKDQFHDIDEAQSKLIEAAIQNAHELTHELN
FT                   EAQERKILEAANEVVASESFLNNDISLPNIGSQSNYSFTWNTFPTPITAETTAAAAAAV
FT                   AVAAASAAEATAPAPAPPAAAPAAPVPFPLPPPPPIARPRPRATRTTTTTTTTTTTPKT
FT                   LKKTKIRKRDIPKEPHKLPEYDFTTLSDVPTLARDVSRKTLEWYNQNVKPEDRKKPRSF
FT                   SPEEESYMDYYFAGYCYLHKMNRDDLCQRVWAKDTIKDGFWRRVYQIFSYRTISSVYKH
FT                   VRRKFHIFDVRAKWSKSDDEQLKELTLTHPGKWTHIGEVMGRMPEDCRDRYRNYLVIGE
FT                   NRKMNKWTKEEVDKLMSIVEEQLAVVSTINWTLVAEKMGTRSRIQCRYKWNHQKKILNQ
FT                   DK"
FT   CDS_pept        768214..770202
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574642"
FT                   /orf_name="CD36_64100"
FT                   /product="Acyl-coenzyme A oxidase, putative "
FT                   /EC_number="1.3.3.6"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAX41281.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000192DEA6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ60"
FT                   /transl_table=12
FT                   /translation="MTTELQKEREQIKFNPKEVNYFLEGSKERSEIVSNIVEQMEKDPV
FT                   LKVDASYYNLTKEEQREVTAKKIDRISRYFENEFPDQQAQRLSIIGVFDPQVFTRIGVN
FT                   LGLFVSCIRGNGTNSQFFYWTINKGVDKLRGIYGCFGMTELAHGSNVQGIETTATFDKE
FT                   TDEFVINTPHIGATKWWIGGAAHSATHCTVYARLKVNGKDYGVKTFVVPLRDSNHDLMP
FT                   GVTVGDIGAKMGRDGIDNGWIQFSNVRIPRFNMLQKYAKVSREGEVTMPPSEQLSYSAL
FT                   IGGRVTMMMDSYRMTSRFITIALRYAITRRQFKSKISGDKETQLIDYPLHQKRLFPFLA
FT                   AAYLFSQGALYLEQTMNETNERLDDAVAEGDKNEIDKAIVASKKLFVASGCLKSTCTWL
FT                   TADAIDQARQACGGHGYSSYNGFGKAYSDWVVQCSWEGDNNILAINVAKPMVKEILQEP
FT                   EQKGLVIANVSDLNDPAKLDKAFEHALSGLARDIGAVAKDKGYDVTGPSLVLVSKLNAH
FT                   KFLIDGFFKRITPEFGPVLKPLGFLYADWIIETFSSVFLSYGVIAPEVIKKISSEHFPA
FT                   LAKQIRPNVVGLTDAFNLSDMLTNAAIGRADGNVYDHYFETVKSLNPPENTKAPYSQAL
FT                   QDMLNRPSVEERQRGEKSEEAAEILSS"
FT   CDS_pept        770653..771207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19382853"
FT                   /orf_name="CD36_64110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41282.1"
FT                   /db_xref="HOGENOM:HBG397643"
FT                   /db_xref="UniParc:UPI000192DEA7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ61"
FT                   /transl_table=12
FT                   /translation="MIYPIVLILSIFASFIQCQFRPPSEPFILAAYDPGYSLSDNNNIM
FT                   HQNIQRFGYNKTKVILSKNIDPTKNYLEGRILNNSSYQIDATVKGLFIRVDKFTHRLKL
FT                   CPNGKTSRYFSIKKDMLFYKNDTTWSVCYDDFEDVSYIYHGGIDDNKKYCCPDNGKEIV
FT                   LRALGKYDASGALPDYDNIVN"
FT   CDS_pept        771424..773517
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20229989"
FT                   /orf_name="CD36_64120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41283.1"
FT                   /db_xref="HOGENOM:HBG397642"
FT                   /db_xref="UniParc:UPI000192DEA8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ62"
FT                   /transl_table=12
FT                   /translation="MNNYFTKYIPNIRLVDTGDSDDHTIKPPTNSSPHINYILIFNPTF
FT                   VSPKTESDEELIKQIIIFLQGKELSESQFSQIGQVKLIGLLRGIESLGESFSNLSTTTT
FT                   TTTIDNKPTILKSLDSSTVMIELESNYFLACNIATGFQTDDQTVNGINQQLIKSIIQSQ
FT                   RYFELFNKSIDCIYKQYGINYLQDSLTSFWNNFLTTYNSQSIKIPISPTSSINWFNGLN
FT                   YQGFLGLLPYAQYKKSTIVINQQVREDIELFINANKSVSGVLINYFNRKLPKRHGVVYM
FT                   NSFGDQYFGNNDGLIDIYNWLEFNEYHDSLGNLNNGGILSSNVSVAITATQQDGESQDG
FT                   MVSVDTTDTQLGFDVSSSLRILNPVNLTNNLVISPINYTVSTVMEGTQVSNWLAMPQFI
FT                   KKLTVGDDNETAEVLPNQSTDHNEDGSEEEEELSGEFIIGLQSDGNILRQVIYLKTRNM
FT                   TYQEHQLVTYHKDEIYITLVCESSDAKFDSPEFYKSLETSMLNPVIEQIEIVAMGGSML
FT                   QTSVNSIRSLYVPNDIDQDFFYITCNPKQKYFQSSLPYLPHLSNMNSDNLTKYQLTALY
FT                   YLHNQLSNIFQPKFFENQLHEFFHKFTSNKLNDWMFYYIKYHDKFIIIMKNKSKNTSST
FT                   MTNNQLSASVPPTIERSIVNRISEGVLDYAKLGFLENLGDDVKYWLGTQQGELESVERL
FT                   SLS"
FT   CDS_pept        complement(773553..774233)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094321" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574643"
FT                   /orf_name="CD36_64130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41284.1"
FT                   /db_xref="HOGENOM:HBG397641"
FT                   /db_xref="UniParc:UPI000192DEA9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ63"
FT                   /transl_table=12
FT                   /translation="MSNSDRDTILAESKAILKSVTNWKPGKQYKSKIIPETITTSTYST
FT                   TNIKDDQFWCARESLVPSAYKQKVIDCLIGTANIGSTHSDHEVHYVEEFDSLQISNITK
FT                   YPDGGWSYELHAEYKFGTIGISNRMFYELVHIYKFDKNQEGGEDFNCAYIISVPIDGPT
FT                   GNFVIGKYHSIEKISWSDNQDSDLKWVMATTSDAGGYLPRWLTNMILPGAISNDVPSVL
FT                   KYIQ"
FT   CDS_pept        complement(774699..776282)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574644"
FT                   /gene_name="CYP52A5"
FT                   /orf_name="CD36_64140"
FT                   /product="Cytochrome P450 52A5, putative "
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41285.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000192DEAA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ64"
FT                   /transl_table=12
FT                   /translation="MSSATTSSNIIDSVLPYLTKWYTILIGAGLIFILSTNLKNAYYSY
FT                   KLGCKNPVYLKRAGWTGIPALIDAIKAKNSGKLAEFGDDTFEELNTKTFYLNVAGVLKI
FT                   IFTIDPENIKAVLATQFNDFSLGTRHAHFYPLLGDGIFTLDGEGWKHSRAMLRPQFARE
FT                   QIAHVKSLEPHIQILAKQIKLNKGETFDLQELFFRFTVDTATEFLFGESVHSLYDDKLG
FT                   IPPPNDIPGRDNFATAFNISQHYLATRSYSQTFYWLTNNKEFRDCNAKVHYLAKYFVDK
FT                   ALNSTEEEIEEKSQGGYVFLYELVKQTKNPKVLQDQLLNIMVAGRDTTAGLLSFAMFEL
FT                   ARNPKVWNKLREEIETNFGVGEESRVEDITFENLKKCEYLKAILNETLRLYPSVPINFR
FT                   TSTKDTTLPTGGGRDGTSPIFVPKGSTVAYTVYKTHRLEEYYGKDSYEFRPERWFEPST
FT                   KKLGWAYLPFNGGPRICLGQQFALTEASYVITRLAQLFPVLETREKQYPPNKCIHLTMN
FT                   HDEGVFVSMN"
FT   CDS_pept        779062..781035
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17574645"
FT                   /gene_name="FGR17"
FT                   /orf_name="CD36_64150"
FT                   /product="Zinc cluster DNA-binding protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41286.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000192DEAB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ65"
FT                   /transl_table=12
FT                   /translation="MSSKSRSYVSIACDNCRKRRRKCNGEIPCHYCSGKNKPCVYDKTK
FT                   DKRRRRVDLVYVDYLEHKYNNLLNFVKRIRSATKDERLRAQCNEMLANNDPKFIDNKDL
FT                   GLSNDELTPASESDKQQKEIIQLTKPMDDLVSMKWELKFDESGNTKFLGPPVRQVDRCL
FT                   IKDRTIIIDECKQMCYFNETVLTDTEFIKELTNTFFQNMLPFNFALEEINIDEIMSEIT
FT                   LINNKSNCQEVRSCLHLLVLAILAYGFNILPKEHPYVSKLNRWNPFLTMVERSLFKLLR
FT                   QTSHTITGNLTDHSHIVYTILIITLLHLGNYDESQAWVYSSILCSQIQHVGWNVSTDYP
FT                   SELETNSKNLGKFRSRLFWNCLVVEKMSASMFGRSSPINFRQLLTEFYTSETKDINELV
FT                   FQFNSKLWFIYDKFMGQIYSFHFNTQNKMLYKKVLMTATQSFQDFQGFMNQYLPLNETN
FT                   LDNQNIVLIHLTFHVFLLLIIRPYMKMPEISWSIFQKSISITEQCYVFINHYNSRFENG
FT                   VAGWYNCHYGFLLYQVSVFLLCTITVSDPVIPPQQYSILIQRLNLFLQCLKKGSQYLTV
FT                   YNVYYQTLLNLFNNMNLNEEISILVRQAFEKESLGMATAIIEKEDLVVDFDQDWQSYVN
FT                   SLNLELDQDVYGFLEEGILDML"
FT   CDS_pept        complement(781103..782644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575642"
FT                   /orf_name="CD36_64160"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase,
FT                   putative"
FT                   /function="lyase activity"
FT                   /protein_id="CAX41287.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG566971"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="UniParc:UPI000192DEAC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ66"
FT                   /transl_table=12
FT                   /translation="MSLNPALKFRDFIQVLKNEGDLIEIDTEVDPNLEVGAITRKAYEN
FT                   KLAAPLFNNLKQDPENIDPKNLFRILGCPGGLRGFGNDHARIALHLGLDSQTPMKEIID
FT                   FLVANRNPKKYIPPVLVPNDQSPHKKHHLTKEQIDLTKLPVPLLHHGDGGKFIQTYGMW
FT                   VLQTPDKSWTNWSIARGMVHDSKSITGLVINPQHVKQVSDAWVAAGKGDKIPFALCFGV
FT                   PPAAILVSSMPIPDGATEAEYIGGLCNQAVPVVKCETNDLEVPADCEMVFEGYLDRDTL
FT                   VREGPFGEMHGYCFPKDHHTQPLYRVNHISYRDQAIMPISNPGLCTDETHTLIGGLVSA
FT                   ETKYLISQHPVLSKIVEDVFTPYEAQALWLAVKINTHELVKLKTNAKELSNLVGDFLFR
FT                   SKECYKVCSILHEIILVGDDIDIFDFKQLIWAYTTRHTPVQDQLYFDDVKPFALAPFAS
FT                   QGPLIKTRQGGKCVTTCIFPKQFTDPDFEFVTCNFNGYPEEVKNKISQNWDKYYK"
FT   CDS_pept        783218..783907
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225437" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575643"
FT                   /orf_name="CD36_64170"
FT                   /product="Phenylacrylic acid decarboxylase, putaytive "
FT                   /EC_number="4.1.1.-"
FT                   /function="carboxy-lyase activity"
FT                   /protein_id="CAX41288.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="HOGENOM:HBG297290"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="UniParc:UPI000192DEAD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ67"
FT                   /transl_table=12
FT                   /translation="MIARVCLKRPNALPIFSISSRKYSIDYEKVNNSVYNNVIIPKRIV
FT                   LAITGATGTQIGVRLLEILKELGVETHLVMSKWGIATLKYETDYQVDYVTSLATKTYSA
FT                   RDVTAPISSGSFVHDGMIVAPCSMKSLSAIRTGFTEDLIVRAADVSLKERRKLLLVARE
FT                   TPLSDIHLDNMLYLSRMGVIIFPPVPAFYTKPKTVDDIIEQTCGRILDNFGINIDTFER
FT                   WDGINHK"
FT   CDS_pept        join(784174..784983,785580..786386)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575644"
FT                   /orf_name="CD36_64180"
FT                   /product="Nucleolar GTP-binding protein, putative "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41289.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG716564"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI000192DF08"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ68"
FT                   /transl_table=12
FT                   /translation="MGTQKKEKQRRVRENDTRDGNLRVKGENFYRDAKKVKHLNMYKQG
FT                   RAIRNKKGEIIKAADLQSTDIPNARVDPNRKWFGNTRVIAQDALTHFREAMGEKSKDSY
FT                   QVLLKRNKLPMSLLDEKDTTESPTAKIIETESYSSTFGPKQQRKKPRVAASSLEDLINA
FT                   AEADSTQFQEKQELNSTLGLMGGSILDKDDFTQEAKEAIFHKGQSKRIWNELYKVIDSS
FT                   DVVIHVLDARDPIGTRCESVEKYIRDECPHKHLIYVLNKCDLVPTWVAAAWVKHLSKSF
FT                   PTLAFHASITNSFGKGSLIQLLRQFSTLHSDRKQISVGFIGYPNTGKSSIINTLRKKKV
FT                   CQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSSKDTEADILFRGVVRVEHVSNPEQY
FT                   IPDMLQKCERKHLERTYEIKGWSKFEEDESLLERASTEFIELIARKQGRLLKGGEPDES
FT                   GVSKQILNDFNRGKIPWFVPPPKDEEKDEDKTGEDKKIGYKRKRQEREAAEKEQHDQDD
FT                   REEEQDEDENNKELKKAKLEE"
FT   CDS_pept        complement(786495..787928)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575645"
FT                   /orf_name="CD36_64190"
FT                   /product="Subunit of the CCR4-NOT complex, putative "
FT                   /EC_number="3.1.13.4"
FT                   /function="nucleic acid binding"
FT                   /function="poly(A)-specific ribonuclease activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41290.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004535"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG748413"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000192DF09"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ69"
FT                   /transl_table=12
FT                   /translation="MNINPHLQYLQQQQQQQQKSQPSQSNQSQSNQSPQFSQLQLQQLQ
FT                   RQQLLNQHLQQQSQSQVPPQLTQQSMGTPTSTNPLLAVLNGGANSNTTSTGNGSLSSNP
FT                   VLQQLQLQQLQQQAQLQQLQAQQQQQQQQQAIPIIKEVWSSNLEHEFQSLRTFINDKTS
FT                   KVFIAIHQEIPGIVARPVGTFKSSSDYHFQTLRANSDLLNLIQLSLCVVKISKNETIST
FT                   PVIWQFNFLYDLSKEMYNEEHLAMLAQTSQINFQLLSTQGIPHFQFAELMIESGLILDD
FT                   NINWVSFHAGYDLGFFVSLLSNDDLPVDEPDFYWWCAKYFPNFYDLKYIGNQILNKPTT
FT                   NGAGTNSNTLDEKTNKPSIEYLAEELHLLPISPAIRQHFTNSTFHSQQLTSTLHAYLSM
FT                   ECFKELLRRSNMTLLSRFKGTIWGLGTFSGGGTSINNTNNNGATEDEIVASRINGISTP
FT                   STPVGIINKSGMVHFGGRV"
FT   CDS_pept        complement(788230..789420)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575646"
FT                   /orf_name="CD36_64200"
FT                   /product="Cell division control protein, putative "
FT                   /biological_process="cell division"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41291.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG525157"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniParc:UPI000192DF0A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ70"
FT                   /transl_table=12
FT                   /translation="MNFLRKRRSSEDEDDDDILNNDPASSIHKSRKPPNTAFRQQRLKA
FT                   WQPILTPKSVIPLLILIAIIFTPLGIAIIYTTYNVQDLIVDYSMCNEASNSFENIPKKY
FT                   TGYHFRGPSSNPNFQWRLDNNNTCVIQFNLAKDLNGPVYLYYKLTNFYQNHRKYVESYD
FT                   LEQLRGEALSSDDVTDNCKPLKHRVYNGKEKLIYPCGLIANSYFNDTISSPVLLNARNG
FT                   DNNETYVFSDQGISWPSDRSHKFKKTQYSPDEVVPPPNWDEMYPDGYTKDNMPDLQTWE
FT                   HLQNWMRTAALPSFYKLYGQNTTQSMSSGTYQISIKMNYPVEVFGGTKSIVITTNTIFG
FT                   GRNMSLGVIYIIVAVVALVLGIAFLLQYLIKPRKMGDHDYLQDSNGGDITTYRDQL"
FT   CDS_pept        793060..796947
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078844"
FT                   /gene_name="ALSD2"
FT                   /orf_name="CD36_64210"
FT                   /product="Agglutinin-like protein, putative "
FT                   /protein_id="CAX41292.1"
FT                   /db_xref="HOGENOM:HBG397640"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniParc:UPI000192DF0B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ71"
FT                   /transl_table=12
FT                   /translation="MLQQFILLFVYLSVATAKTITGVFNSFDSLTWSNAANYAFKGPGY
FT                   PTWNAVLGWSLDGTTADPGDTFTLIMPCVFKFITTQTSVDLTANGVKYATCSFYSGEEF
FT                   TTFSSLTCTVNSALTSSVKAFGTVTLPISFNVGGTGSSVDLEDSKCFTAGTNTVTFTDG
FT                   DNKVSTTVDFEKSTVDSTGYLTSSRLMPSLNKVTSLFVAPQCARGYTSGTIGFSSSNGG
FT                   VSFDCSNVHVGITNGVNDWNFPVSSESFSYTKTCSSTGITITYRNVPAGYRPFIDAYIT
FT                   ASDVNSYTLSYTNDYTCVGGSVQHKPFTLRWSGYKNGEAGSNGIVIVATTRTVTDSTTA
FT                   VTTLPFNSDVDKTKTIEILQPIPTTTITTSYVGVTTSYSTKTAPIGETATVIVDVPYHT
FT                   TTTVTSEWTGTITTTTTQTNPTDSIDTVVVQVPSPNPTVSTTEYWSQSFATTTTVTAPP
FT                   GGTDTVIIREPPNHTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNHTVTTTEYWS
FT                   QSYATTTTVTAPPGGTDTVIIREPPNPTVTTTEYWSQSFATTTTVTAPPGGTDTVIIRE
FT                   PPNHTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNHTVTTTEYWSQSYATTATVT
FT                   APPGGTDTVIIREPPNHTVTTTEYWSQSYATTATVTAPPGGTDTVIIREPPNHTVTTTE
FT                   YWSQSYATTATVTAPPGGTDTVIIREPPNHTVTTTEYWSQSYATTATVTAPPGGTDTVI
FT                   IREPPNHTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNHTVTTTEYWSQSFATTT
FT                   TVTAPPGGTDTVIIYESMSSSKISISSDEISSIIPSFSRPHYVNSTTIESSSVNIPTST
FT                   DNDNVLLSSTTLFIESRTTTEMICSDDKGCSESSSSSGIVTNPDDSESSMVINTVHSTT
FT                   TVSDLHSSTGGISATSSENSSESGVSISTDSSITTTHTSPNPLSTSMTSLTQMSTNPSV
FT                   LVSESKVTFTSDGDNQSGSHGSQSTYLKSSMGVNSGSTTSTEIEIVTTSSTSILPPVAP
FT                   SSTVLTTESTNTIEQPTRSPTISNTINESISTSQPIGGNGNNTSLTSSVPTVTTDASAT
FT                   ANGEDNRTGSHGSSSTHLKSSMGENSESTTYTEIEVTTSSPTESSSPIAPSSTDATTES
FT                   TNTIEQPSISLIVSSTIDESNTTSQPTPENGGNTSSTNSGPALTTGTSASMTINSEVVT
FT                   SASNDQSHSNFATNDNIIVSNTPQTTLSQQAISSSPSTNTLIVSTYDGSGSIIQHSAWL
FT                   YGLITVLSLFI"
FT   CDS_pept        799529..805270
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535860"
FT                   /gene_name="ALS9"
FT                   /orf_name="CD36_64220"
FT                   /product="Agglutinin-like protein, putative "
FT                   /protein_id="CAX41293.1"
FT                   /db_xref="HOGENOM:HBG397639"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniParc:UPI000192DF0C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ72"
FT                   /transl_table=12
FT                   /translation="MLQQFVLLFIYSTIATAKTITGVFNSFDSLTWTNSGNYGFKGPET
FT                   PTWNAVLGWSLNSTIADPGDTFTLIMPCVFKFITTQTSVDLTVDGVNYATCSFYSGEEF
FT                   TTFSSLTCTVNNVLTPYAMASGTVTLPISFNVGGSGSSVDLEDSKCFTAGTNTVTFNDG
FT                   DTKISTTVDFDASPVASSGYITSSRIIPSLNKVSSLYVVPECESGYAFGVMGFVASNGA
FT                   TIDCSNVHIGISKGLNDWNFPVSSESFSYTKTCTSASITVEFQNVPAGYRPFVDTYISA
FT                   ENVGRYTLTYANDYTCNNGYSVVDPFTLTWWGYKNSEADSDGAIIVVTTKTVTDSTTVV
FT                   TTLPFNPSVDKTETIEVLQPIPTTTITTSYIGVSTSYQTETVAIGGTATVIVDIPYHIT
FT                   TTVTSFWTGSVTTTTTHTNPTDSIDTVIVQVPSPTTITKTEFWSESYATTTTITNPPDG
FT                   TNTVIIKEPPNPTVTTTEFWSESYATTTTITNPPDGTNSVIIREPPNPTVTTTEFWSES
FT                   YATTTTITNPPDGTNSVIIREPLNPTVTTTEFWSESYATTTTITNPPDGTNSVIVKEPP
FT                   NPTVTTTEFWSESYATTTTITNPPDGTNSVIIREPLNPTVTTTEFWSESYATTTTITNP
FT                   PDGTNSVIIREPLNPTVTTTEFWSESYATTTTITNPPDGTNSVIIREPLNPTVTTTEFW
FT                   SESYATTTTITNPPDGTNSVIVKEPPNPTVTTTEFWSESYATTTTITNPPDGTNSVIVK
FT                   EPPNPTVTTTEFWSESYATTTTITNPPDGTNSVIIREPPNPTVTTTEFWSESYATTTTI
FT                   TNPPDGTNSVIIREPPNPTVTTTEFWSESYATTTTITNPPDGTNSVIIREPLNPTVTTT
FT                   EFWSESYATTTTITNPPDGTNSVIIREPPNPTVTTTEFWSESYATTTTITNPPDGTNSV
FT                   IVKEPPNPTVTTTEFWSESYATTTTITNPPHGTDTIIFRKKVFSSDSSTDKVNSVTILS
FT                   STPDEKSVSNISTFSSDPDSTFFVSTSIPVSVSNESNTQYSFSTVDKTSLDSDVPSFTG
FT                   MGFLSSYTTASITPSISSFESKVFSSSEAQPNLDSYSSDTFVTSISVITEASYDKSSTS
FT                   VSSTFSTLHFSSYSWSSSSISPFTRPHYVNFTTSILPRFESSSAYSSTASAVTSIDTNI
FT                   DTSSSTTLVAQSSSDSEAQCNDIGGCTSVTQSSDIMVTPSKSGRMVISNSAHLTITHLY
FT                   SESESELTSGAIQTESTDWSLISGKSNKPEFTSTISEESSYSLSDPTTSSTGYPISFKS
FT                   EKESHTSSYASRISSYETSVEVSISSSVSSEKEIGSTDKSVISSVTVFPSSGTTFKSTT
FT                   GTTSISESTTTGTPSFVSLTTRLNITKTTSAETSAFDESSFKSSVVKVSSSELISKEAT
FT                   TEASSFVSATTDLDTTGITIETSVSGESSSESLSESITKAAVPRIRSSGFATSSSTTIE
FT                   STISESSIIAVSSSFLSTTTTLNTAGTTTIETPVIKKSGSGLSTLKVTSSESVSKRETT
FT                   ETILTRSTATELTFTGSPSFILTTTDLDITKTTITEASATRELTSRSLVVSTSSLSKGE
FT                   PTGTITSGLSASQSLTTTKASNGTTTEISSTESLTTDIQSFTSITAEQENSETQRFESK
FT                   TNGEPYSETQSTESSTANSQASRTGYSKFSISESVISKDERTLMSTIEHSITTQTSTQY
FT                   QDCSSTPEVPISEESGSKLSITDSKTDQSATRLSTQFDGIETSTFSNTSVALKYSKTHS
FT                   DLVNSNEVIGSSTKAGFNVMTKTSISHTTYSALNPSVSFDTTVLSSTTLDDSTTTFSSI
FT                   AVNTQGTLNSSIIDKHLHGFATISIGSNGGHSHSSTTSTSAITDNNSFTFNTQQTTLSQ
FT                   SVASSLPNTVIATTYDGSGSTIQHSAWFYRLITILFLFI"
FT   CDS_pept        806003..808912
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535861"
FT                   /gene_name="ALA1"
FT                   /orf_name="CD36_64230"
FT                   /product="Alanyl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.7"
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41294.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="HOGENOM:HBG354397"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniParc:UPI000192DF0D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ73"
FT                   /transl_table=12
FT                   /translation="MIKTLFRRMSSNTTIPTPNGSNHWTASKVRSTFLDYFKQQQHTYV
FT                   PSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFASLKRAANSQKCIRAGGKHNDL
FT                   EDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTKVYGLKEDRLYVTYFGGDEKQ
FT                   GLEPDLEAKNFWLKVGVPEDHILPGSVKDNFWEMGDQGPCGPCSEIHYDRIGGRNASDL
FT                   VNMDDPNVIEVWNVVFIQYNREADGNLRTLPNKHIDTGMGFERLVSILQNKFSNYDTDV
FT                   FLPIFDKIREITGVRPYTGKFGNEDKDGIDTAYRVIADHVRTLTFAICDGGVPNNEGRG
FT                   YVLRRILRRGSRYVRKYMNYPIGGFFQQLVDVVIEQNKEIFPEISSGAQDLKEILNEEE
FT                   LSFAKTLDRGEKLFEQYAIIASKTPEQTLSGKDVWRLYDTYGFPVDLTRLMAEEAGLKI
FT                   DEDGFERAKEESREASKGSGTKDGKTLVKLDVHALSELDQNDTIPKTNDEFKYGLENVK
FT                   AKVVGIYDGSKFVESIEDPSIQYGILLDKTPFYAEQGGQEYDTGKLVIDGKSEFNVANV
FT                   QVYAGYVLHTGNIVDGKLNVGDEIIATYDELRRWPIRNNHTGTHILNFALREVLGDGVD
FT                   QKGSLVAPEKLRFDFSYKQAVTPKELEKIEAISNKYIKNNDKVYYKDVSLTKAKEINGL
FT                   RAVFGETYPDPVRVVSIGVSVDDLLADPTNAKWHEISIEFCGGTHVAKTGDIKDLVIVE
FT                   ESGIAKGIRRIVAVTGHDAHHVQKVANEFEQEIDAAASLPFGVVKESKSKELGVALKKL
FT                   SISVLDKQRLTEKFNKLDKSIKDNLKARQKEETKKTLDVVNNWLNDKENVSSFLVSHVP
FT                   ITANAKAITEAINLIKKQDKSKSIYLLTGETDKVAHGCYVSDEAIAKGINANELAKSVS
FT                   ENIGGKAGGKGNIVQGMGDKPEGINTAIEEVTKLFKEKL"
FT   CDS_pept        complement(809085..810473)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575647"
FT                   /orf_name="CD36_64240"
FT                   /product="Mitochondrial ribosomal protein, small subunit,
FT                   putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAX41295.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG397638"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI000192DF0E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ74"
FT                   /transl_table=12
FT                   /translation="MIRSATTRSTPSRYCVQVLRNISRNYSTENSQTNPNEPPLEHTLS
FT                   HKELREQAIAEALAREEEAILKTKKLRELTQESQTLISALNKTPTTLINERLNKLNEDL
FT                   SKLSQDKIKQLDEELRDYLNQNMILPDHLKANRPWLKSNDSISNDNDVSKKLKATTNTS
FT                   SDSNHTSTTTTTTSSRYTEQFPNLKPTPDYKPYSSQELYIRQLNHTRINGRIGSRLTQV
FT                   YKPQRDINNPPQFDNTTIAKLMAAGCHLGHSTSSFRPSMQPFIYGIYDKVHIIDLNKTL
FT                   EKLTLACKVIEGVVEKGGVVLYVGTHKNNSSIQEALVKASERSHGYYVNKRWIPGTITN
FT                   YTEVTKQYGQIKTKMEVDMKDQKITTKNSNRIIKPDLVVLLNPVENRNCIKECISAGIP
FT                   TIGLCDTDMEPSLLTYPIPCNDDSVRSVNLMLGIMSKSAESGLQKRISAIKKLEENDGK
FT                   VVKA"
FT   CDS_pept        810655..811260
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078845"
FT                   /orf_name="CD36_64250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41296.1"
FT                   /db_xref="HOGENOM:HBG397637"
FT                   /db_xref="UniParc:UPI000192DF0F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ75"
FT                   /transl_table=12
FT                   /translation="MLKYYNRSSTFDELVLKLSALKDTTCYILISDPALYYSHHSSDTI
FT                   KLSLKGIHNLSNCQLILIESWSEIKDFVSSIVDRCLIVFYGIFKTFIELGLNDDVGKKN
FT                   VFLQHHQFCGWELNKLFHLLLLKQSKYGVDVLVNDCIGQDNDNDDSEPLIWSLQIPNVR
FT                   EKLRNDITTTNQEEKMISLRVIFIKWFETTNRIDYSIV"
FT   CDS_pept        complement(811287..811913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575648"
FT                   /orf_name="CD36_64260"
FT                   /product="Co-chaperone protein, putative "
FT                   /protein_id="CAX41297.1"
FT                   /db_xref="HOGENOM:HBG749677"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000192DF10"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ76"
FT                   /transl_table=12
FT                   /translation="MSTTQTPTVLWAQRSSEDDAAKNIIYLTIAISDPVDLKIDLKNDH
FT                   LTIDSKSNDSVYSSIDYHLHIDFFKEIDPDQSKINTENGSHIFMILRKKDKQEEYWPRL
FT                   TKEKLKYHYIKTDFDKWVDEDEQNEVKDDPNDFGGPGGAMDFSQMLSGMGGMGGSGGPG
FT                   AADLSALASQLGQAGGAANPAGEEGGEEEETEEEAESNTNATKKE"
FT   CDS_pept        complement(812376..813788)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230223"
FT                   /gene_name="SHM2"
FT                   /orf_name="CD36_64270"
FT                   /product="Cytoplasmic serine hydroxymethyltransferase,
FT                   putative"
FT                   /EC_number="2.1.2.1"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="methyltransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /protein_id="CAX41298.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG301263"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI000192DF70"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ77"
FT                   /transl_table=12
FT                   /translation="MSPYALSESHRQLTEGHLKETDPEVDQIIKDEIDRQQHSIVLIAS
FT                   ENFTTTAVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQERALKAFGLTPDKWG
FT                   VNVQTLSGSPANLQVYQAIMKPHERLMGLDLPHGGHLSHGYQTDSRKISAVSTYFETMP
FT                   YRVDLETGLIDYDMLEKTAVLFRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMA
FT                   HISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGIRSINPKTGQEILYDLE
FT                   NPINFSVFPGHQGGPHNHTIAALATALKQANTPEFKEYQEQVLKNAKALESEFKNKGYK
FT                   LVSDGTDSHMVLVSLKDKQIDGARVETVCEKINIALNKNSIPGDKSALVPGGVRIGAPA
FT                   MTTRGLGEEDFKKIVSYIDFAVNYAKEVQSQLPKDANKLKDFKNAVSGDSEKLKAVRDE
FT                   IYQWAGSFPLAV"
FT   CDS_pept        complement(815013..815804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383100"
FT                   /orf_name="CD36_64280"
FT                   /product="Uncharacterized endoplasmic reticulum membrane
FT                   protein, putative"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41299.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG593106"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniParc:UPI000192DF71"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ78"
FT                   /transl_table=12
FT                   /translation="MTDVSPNSKIEHLTPDNITVTAPPQPPFSSSTSASASTSTSIAED
FT                   HLTTPIPTPSPSHRRGSSIGSSNSPSRNRSNSNSANALTPTPSHHQPAHSITRQRRSSS
FT                   LIQHLEPDTLDTKIDQALNPNVNANWVHQKGAWVIHVVIIILVKMIFNFISVLNNDWKW
FT                   TLTNLTYNIGSYIMFHQVKGTPFEFNSGAYDNLTMWEQIDNGDQYTPSKKFLMLVPIGL
FT                   FLISTHYSSYNLNLFILNGLSCLCVVVPKLAFAHRLRVTLF"
FT   CDS_pept        complement(816691..818598)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078846"
FT                   /orf_name="CD36_64290"
FT                   /product="F-box protein, putative "
FT                   /protein_id="CAX41300.1"
FT                   /db_xref="HOGENOM:HBG397636"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000192DF72"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ79"
FT                   /transl_table=12
FT                   /translation="MTLSIYDLGEDILTSQISNYLSPEDIFKFFSLSKTLYSIYQNSSI
FT                   IYQYLYNKKFTNNENNYTLSLKENLNWKQLFDLRCNRHQKIYTWGQSSMGRLGYSLSQV
FT                   PIENRSENFGWMMVHTPTNITNFNDHIIIDIVANGFSFIILTNDGELFFTGNDWKQSHN
FT                   RTTPGPIQTQDYRPTPGTMALYTLTNNQTLQPIGSRRNIARGVPPMPMMNRRYANNDDE
FT                   EEDEEDDNNGITPDVTTTTEATSSIVPPFLPAPKTSSSLPQGRRKITTQQQQEQNQPAL
FT                   SHRPSKIKESNFISRLFLPPLPPNRKQSLEKRRIISISAGREHIIALDNYNNIYTWDTG
FT                   CQSNVGVMLEFPNIPINSNRIIKISAGWNLSTALIDNYGLIVWYTRIGITESQFNSREF
FT                   ISKVKYFIIPFTKNDIIDFAVGSNFIIFIKKSDGKLYQTRFDVHEFATRDTLITFDEIN
FT                   QITNPMNNFNNWKQQQQQSEIGKENIIFTKVSSCFNDFAVFTNYDQVLLGNLHHLQYYE
FT                   NNNDEQGIEPIIINELQGKNIKRIEIGDYHYLALTTDGSLLSWGTESRFCGCLGLGSKQ
FT                   DIIDQYNNHNTSGGGDEVSLRGNNLVVLKPLPVKPPPYKGKWVCIAASGWHSGGIYVPT
FT                   "
FT   CDS_pept        complement(819185..820825)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575649"
FT                   /gene_name="HGT10 (STL1)"
FT                   /orf_name="CD36_64300"
FT                   /product="Glucose transporter of the major facilitator
FT                   superfamily, putative"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41301.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192DF73"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ80"
FT                   /transl_table=12
FT                   /translation="MSGFIDKVFKRTTTAGLTGRKLRAAVTITATLGFSLFGYDQGLMA
FT                   GLISAEQFNWEFPATKDNSVIQGAVTASYELGCFFGAIFALLRGDTLGRKPIIFIGATI
FT                   IVLGTIISVTPFRPHWPLGQFVVGRVITGIGNGMNTATIPVWQSEMSKPENRGKLVNLE
FT                   GAVVAFGTLIAYWLDFGLSYVNTSVSWRFPVAFQIFFALWVIFGILQLPESPRWLISKD
FT                   RKPEAYEVLAALNDTTPDDDAIVAEASVIVDAVRRNAKVQAGFKDLFTGGKTAHFQRML
FT                   IGSSTQFFQQFTGCNAAIYYSTLLFYETVFNHSQYRLSMILGGVFATIYALATLPSFFL
FT                   IDTLGRRNLFLIGAIGQGISFIISFACLIKPTEQNAKGAAVGIYLFIVFFAFTILPLPW
FT                   IYPPEINPLRTRTTASAVSTCTNWLTNFAVVMFTPPFIAASGWGCYLYFAIMNFLFVPI
FT                   IFFFYPETAGRSLEEIDIIFAKAYVEKRQPWRVAATLPKLSLQEVEDEAKNLGLYEDDF
FT                   EKDNFETKEDISDGTVSNTNGVFEKPENV"
FT   CDS_pept        complement(825183..827114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575650"
FT                   /orf_name="CD36_64310"
FT                   /product="ADIPOR-like receptor IZH3 orthologue, putative "
FT                   /function="receptor activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41302.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397635"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI000192DF74"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ81"
FT                   /transl_table=12
FT                   /translation="MSTATELASTGEIRNRSNNDKNKTDEDSSTSSVVQTAEDLLVEKL
FT                   DLFISSIESRLDNFERFFKLDKNAKKEQQQQQQQGTINGGGGGGGRPLGRSRRSSSTSS
FT                   LQSFRDFSINNLNMVYERLGIIKKSVLSNSFNNLEYLSKVLADQYNYLFSSSAIDSDSD
FT                   SEEENNQNDNNGTNNNNNNNNNSINIGQFKEEFTNLGMKSLNKREILSQKIITTIQYFD
FT                   EKLIKIDDFIKENKPSATDDYTHDIIFSKLRYFNFNRALQNSNNRYLHYYELPLIWREN
FT                   KYIINGYRFSLSHISMLKSIFHFNHNESMNIWSHLIGLIIIIYICINHFPNSNIFQQIT
FT                   WGDNLIMYMFLFAAIKCLINSSLWHTFSCFAHYPTRQTFACVDYTGITVLITCSIISVE
FT                   YCSLYNYPKLLMGYMIFSTLCGLAGFIFNWSSYFDKPECRSIRIGFFLGLSFSGATAMI
FT                   CKSYYEGIMITLSFFSPLLYKSFIWYLIGVGFYGGLIPERWRYDIIIEENHLNNRHTYK
FT                   PTDVILEKMGHDGEDEMEEIEEEFEEIVDQHISDNTTTTTTTSTSTSTTTTTNHDIFDH
FT                   DEKFEELIAKHFKPNPINTPYANNFLSLWWVDYFLASHNIWHICVVLGILGHYVCLLDM
FT                   FRGLEKLV"
FT   CDS_pept        829531..830865
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230224"
FT                   /orf_name="CD36_64320"
FT                   /product="Cyclin, putative"
FT                   /protein_id="CAX41303.1"
FT                   /db_xref="HOGENOM:HBG397634"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI000192DF75"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ82"
FT                   /transl_table=12
FT                   /translation="MLVDNYIKASSIKFNISIAPCVEIARYLKSNQQQQQQLRLHEDPT
FT                   QLLHQPYPSSQPQPQPSSQETQYYYQQQRRQQQQQQQQQQQREHKRPHATPRIRRPSSS
FT                   LTPIYSPKTKKSTPNKTTKTPLHKSLESPSPPIKKKSKNRIIVPNEFIRCDLDIIITLI
FT                   NRMLISLIKLNDNNNTTNINTSTPLPPPPTRFHSKTPPAISIFSYINRLTKFNNLKSNG
FT                   LITMIYYIDILSYMYPHFQLNSWTIHRFLLVATMISQKAMEDYFYTNDHYAKVGGVSLE
FT                   ELNCLELDFLKRIDWRTIPINNPNVQQLYYNKLVEMTGRISNMIDEGNDNDNRYKHTKF
FT                   IMENEDPTDYDEEEGSEEDLEEDDDEEEEEEEEEEEGFYDSDDDINSEDNIDIEIEVDD
FT                   YDYEMEENNSNVPDLPNIPMYKYDSNGFSIDGSSSPHLKRRYSKD"
FT   CDS_pept        complement(831015..831953)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575651"
FT                   /orf_name="CD36_64330"
FT                   /product="Molybdopterin binding protein, putative "
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="CAX41304.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG460925"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniParc:UPI000192DF76"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ83"
FT                   /transl_table=12
FT                   /translation="MGVSHCLYHTLSRMTQFTTTRGGGKPIRNAGCLIIGDEILNGKIL
FT                   DTNSYNFARFCFNNLSIPLKRTIVCGDDEQDIINSLNILLKQDKLDLIITSGGLGSTHD
FT                   DITYKVISDYFQLDYQLDQEVVDRMKSIRGEYLDKLNPEQLNAFYRMATLPAPPQISNP
FT                   KSNSTTTTIVEKYFIDDKLWFPIVGLNEQVYILPGVPQLFTQLIKDMEPMLKPRVISSD
FT                   LIRRYVVTKSGETQLAPFLTNLQEKCDKKYGKGILKLGSYPHMNLHINTISIIGQKLNN
FT                   EDLDWIVQALIENIGGDAKEITQAQEDEYSK"
FT   CDS_pept        833048..834772
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535862"
FT                   /orf_name="CD36_64340"
FT                   /product="Serine/threonine-protein phosphatase, putative "
FT                   /EC_number="3.1.3.16"
FT                   /function="cofactor binding"
FT                   /function="magnesium-dependent protein serine/threonine
FT                   phosphatase activity"
FT                   /protein_id="CAX41305.1"
FT                   /db_xref="GO:0004724"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="UniParc:UPI000192DF77"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ84"
FT                   /transl_table=12
FT                   /translation="MGNSPSKDDPLPKSSSSNKSSNGGSSSSSSTVSGTDLDPDEMAPA
FT                   LSQLMINDKLNKKSNFPQRSSSLNVGNSTKHNKTSNNNNNSNSKTIRTLEVEGMSTSTL
FT                   VSTTATTTPPQRIPSIRSRQSSEVYDFDLEIGMSMAKLLKNQQDFPSSLESSNASVSSP
FT                   VFTTLGVDTKDEDSLSSINSSPCDTKNNVIANKQLSYPENMSTSKKLDVIDEINSLESS
FT                   PSNSSKLSQANLRKHNKTLVHQLTKRISDSSTSSASGSPPLVGTSQKLEVDIDNIIARL
FT                   LATKKRSTSRKTKSRLPVETSELKYVLAKSRQIFLDQPTLLRLSPPVKIVGDIHGQFHD
FT                   LIRIFNCCGYPPHSNYLFLGDYVDRGEKSLETILLLLCYKIKYPENFFMLRGNHESANI
FT                   TKIYGFYDECKRRLSNHKLWKNFIDVFNALPIAAVINDKIFCVHGGLSPDLNNFEQIEN
FT                   IKRPTDVPDKGLLADLLWSDPDPSVKNFSLTNWPKNDRGVSYVFGKKHVDYFCSKFKLD
FT                   LIVRGHMVVEDGYEFFNKRKLVTVFSAPNYCGEFNNFGAIMSVDKHLYCSFELIKPI"
FT   CDS_pept        complement(835212..839696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575652"
FT                   /gene_name="SNQ2"
FT                   /orf_name="CD36_64350"
FT                   /product="Multudrug resistance protein, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41306.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000192DF78"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ85"
FT                   /transl_table=12
FT                   /translation="MSSEDIESSSSSLQEYVGQQHHKTQPSTDEDYNDYDENNDESRRL
FT                   HLVRTVSSINRHNFDEKFDSISREISRQVTNKEGEFQLRLDEFNLAKILANFVYFAKKQ
FT                   GIVLRKSGITFQDLCVYGVDESFAIAPTVTDLLKGPIGGIQAILSQMKTPPRKILKNLN
FT                   GFAKPGESVLVLGRPGAGCTTFLKALSGTDFDLYKGVTGDIRYDGLPQSEMLKLFKNDL
FT                   VYNPELDVHFPHLTVDQTLTFAIACKTPEMRINGVTRDEFINAKKEILATVFGLRHTYN
FT                   TKVGNDFVRGVSGGERKRVSIAEALACNGSIYCWDNATRGLDASTALEFAQAIRTSTKL
FT                   LKTTAFVTIYQAGEGIYETFDRVTVLYDGHQIYYGPANKAKKYFEDMGWECPPRQSTAE
FT                   FLTAITDPIGRFPRAGWENKVPRTAQDFEHYWLNSPQYQELMQEIKDYNDEIDEDETRG
FT                   KYYESIQQEKMKGARTKSPFTISYLEQLKLCFIRSYQRILGDSAYTLTLMFASVAQAFV
FT                   AGSLYYNTPDDVSGAFSRGGVIFFAVLFMSLMGLAEISASFSSRPILMKQKNYTMYHPS
FT                   ADSLSNFVMSIPISIFINTFFVIILYFLSNLARDAGKFFICYLFVIMLHLTMKSMFQAI
FT                   AAINKSIAGANAMGGISVLASLMYSSYMIQRPSMHPWFKWISYINPVLYAFEAVIASEF
FT                   HGRKMQCTSQYLTPSGPGYENLGAGEQVCTFIGSVPGQSWVLGDDYLRIAYTYRFSHVW
FT                   RNLGILFGFLAFFLTIATLGTEYVKPITGGGDKLLFLKGKVPEHITLPSERKEEDIESG
FT                   GDTTATSNGTLSQGKSDDEKGAIVDEGLKAKGVFVWKDVDYVIPYEGKKRQLLQNVSGY
FT                   CVPGTLTALMGESGAGKTTLLNVLAQRIDFGVITGDMLVNGRPLDTSFSRRTGYVQQQD
FT                   IHFSEVTVRESLQFAARLRRSNDVSDAEKLEYVEKIIDVLDMRGYADAVVGRLGNGLNV
FT                   EQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWAIVKLLRDLANAGQSILCTIHQPS
FT                   ATLFEEFDRLLLLKKGGIVTYFGDIGPRSRTILDYFERNGARHCDDKENPAEYILEAIG
FT                   AGATASTEFDWGDIWAQSPEKVQTDAKRDELIKESAQNAADTTTSSSEKNSTSKYATPY
FT                   WYQFRHVTHRTSLIFYRDPDYIAAKIFLMTIAGLFIGFTFFGLKHTKTGAQNGMFCAFL
FT                   SCVIAAPLINQMLEKAASRDIYEVREKLSNTYHWSLLILPQVIFEVIYMIIGGTIMFVC
FT                   LYFPTQVNTVASHSGIFYFSQAIFLQTFAVSFGLMVSYVSPDVESASVIVSFLYTFIVS
FT                   FSGVVQPVDLMPGFWTFMNKVSPYTYFIQNLVSSFLHDRTIRCNAKELSYFNPPSGETC
FT                   KEFASAFISRHGGYLIDDGATSNCGYCSFSNADEYLLTIGVKFAYRWRNIGFFCAYIIF
FT                   NISICLILYYFIRYRKISLNVTGLISKFKKSKI"
FT   CDS_pept        complement(841183..842628)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535863"
FT                   /orf_name="CD36_64370"
FT                   /product="Hypothetical GPI-anchored protein, putative "
FT                   /protein_id="CAX41307.1"
FT                   /db_xref="UniParc:UPI000192DF79"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ86"
FT                   /transl_table=12
FT                   /translation="MRSTPLFFALFQIALAAKRADQTCNDHCTNAYQKQQSCGGAGTVG
FT                   SQSDTLRCLCGDEGYWSELAQCDCSNYDSNVSAQDLRAYYCNFGVSNGSQGQSAGGDTA
FT                   TATANTDGAATDANAATANTDGAATDANAAAANTDGTATDANAAAANTDGAATDANAAA
FT                   ANTDGAATDANADTANTDGAATDAAAATNGNDGASGTADANNANTAGTAVAVNVGSTDG
FT                   TGATDATNAGSTAAVDATNAASDPANATGSDAANAATASGAATGSDAANAATASGAATG
FT                   SDTANAATASGAASGSDASGSAEANAASTAADAASGSDASGSAAAAARTATNTGSESGT
FT                   ASRTGATTGSGSNAASMTTITSGSGSANGTSSRSGSMTTITSGSGSANGTSSRSGSGSG
FT                   SSSATRSGSGSDSSSSGSGSGSGSGSSSTRSGSGSGSDSGSGSSTSSGSGSGSGSSTRS
FT                   GGIAATLPTVTFGSLVALALNLL"
FT   mobile_element  845112..849648
FT                   /mobile_element_type="retrotransposon:lambda G, Tcd14, LTR"
FT   mobile_element  complement(847491..847732)
FT                   /mobile_element_type="retrotransposon:solo LTR, upsilon C"
FT   CDS_pept        complement(850339..850995)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535864"
FT                   /orf_name="CD36_64390"
FT                   /product="Hypothetical GPI-anchored protein, conserved "
FT                   /protein_id="CAX41308.1"
FT                   /db_xref="HOGENOM:HBG397631"
FT                   /db_xref="UniParc:UPI000192DF7A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ87"
FT                   /transl_table=12
FT                   /translation="MKSGLLFAVILPVAFAVKKDQQSCNSSCIKVLQKQQESCPSGSDT
FT                   NCLCDLSDSDYWEPLADCDCINPDKKFSASELKIQICGGTSSSSSATTTTTSSSTEAET
FT                   TEQPSSTSSSSSVQSSETTILETPSIQELDAESTSSLIAPLTESAVAAVANTDTNTLIE
FT                   PQNTETTPQEAPLIQPQLNNGSDWSQVSVQAFENNAGRTVVIGSGSLLALLLNFI"
FT   tRNA            complement(851605..851677)
FT                   /gene_name="tRNA-Ala (TGC)"
FT   mobile_element  851692..852001
FT                   /mobile_element_type="retrotransposon:solo LTR, beta A"
FT   CDS_pept        852740..853522
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18535865"
FT                   /orf_name="CD36_64400"
FT                   /product="Peroxisomal 2,4-dienoyl-CoA reductase, putative "
FT                   /EC_number="1.3.1.34"
FT                   /function="2,4-dienoyl-CoA reductase (NADPH) activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41309.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008670"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000192DFCF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ88"
FT                   /transl_table=12
FT                   /translation="MSQLFSLKGQVAILTGGTNGIGLGYAKGLASADLNQLILTYRSES
FT                   TLENAKKIIHEVNPNIQIDGIKIDFLKDEEDEIITKIVKESYKLSKTSNIDILVNNAGI
FT                   TERYPFEDFPQDKFDDVIKVDLNIPVKLTKAVGKKMIETNTKGKIVFTASLLSFQGGML
FT                   STPYAISKGALKQFTQAVSNEWSSKGIRVNSIAPGYIKTNLTDSMSEENKKIVDLRIPM
FT                   KRWGNPDDFMGPIVYLTSDASKYVTGDTLLVDGGWMGR"
FT   CDS_pept        complement(853576..854730)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383101"
FT                   /orf_name="CD36_64410"
FT                   /product="Antiviral protein Ski8 orthologue, putative "
FT                   /protein_id="CAX41310.1"
FT                   /db_xref="HOGENOM:HBG397630"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192DFD0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ89"
FT                   /transl_table=12
FT                   /translation="MSKQYISTVSVSQAHKSDILGVAITNKFTVSVSSDGYAKFWDNKQ
FT                   DEVHSPKEFVQSVFIDKSGIHAVAVYENVLPSSTLKVTLSAFACFNGSIVFKYYVNDDF
FT                   STIQSLTDDVKSFRSNCWTPGFYRDPESKKDYFITTKTNGTTEVYLLNIVDQDGKPLIT
FT                   FEKYGQLKGNASSFPNSLAICPTENKKCAVGYINGDVLLYDFVSLKLIYTFRSGDLVTS
FT                   RNSQSTSIPRVLAFSPGGTLLAVARDNQAAGSITLYDVDHGENVGSLATPSHSAKSVVG
FT                   GFAHQGWILGLSFDEEGKHLASCGFDKCIRVWNLETSEREATINISVSDLDDTTHDEQD
FT                   ESVASGVAFIKKGVRGGSGGDSNEGLCVVSFDRGIRWYREAGGI"
FT   CDS_pept        854937..857339
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535866"
FT                   /orf_name="CD36_64420"
FT                   /product="Nuclear pore complex subunit, putative "
FT                   /protein_id="CAX41311.1"
FT                   /db_xref="HOGENOM:HBG397629"
FT                   /db_xref="UniParc:UPI000192DFD1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ90"
FT                   /transl_table=12
FT                   /translation="MSSIGSADQFIHQITQQFVFQRLWTGNSTPPELVPASTPYNRLVC
FT                   RNNTDLFFATGNIVRCCSISPNHKNYKLFKVQHQFHEVVSLLMNKSGTLLAIIGEEQID
FT                   VVSLPTNVMKSGGIYVDGACFKINNLQGKVRKCVWQTVAANDSTLVVLNDNSQIRAYDL
FT                   TKSLDVPVVDIDLKSYPNFANEEAISITFGSSKNLAGGLTLYVSTLSNIYAIYPFTSRF
FT                   GNLATTKEAIDIALEDTKAAMELIQEKYPVNLVETATSSLNKAAIQQFEYYSYFRNQLC
FT                   GELPIVKEVRDTHTNSPYELFVVRQNLSNWTDYSLQGPLISSNSGIKDLISIGDNDLVS
FT                   ILASIDTNATVTYYAQLAPMLMKCNLTSVASNGASNESSQTVHKPRYVKPKRGFGFIDN
FT                   SEEEEKALVKQTQSQESFWKEELTTLDFLQSDKLPVDDNNAITNFPTFFGEIDSTRFSV
FT                   CVNSNKLVLVDCSWVQAFVDDLKNDKIDSVSITTNYGIASAEKEPITAFAYVKDDVTST
FT                   GEYLIVCRSKLVNDMEVVQIVDKAVSDDQDEAAGTLLLPEEPHKESTLTYIPSKPFSVL
FT                   EEELESLEKIDIGTDIKSNEDLNSLTVDNLSNLNSLSVRTIQLASSYTIFGIKLQSRIL
FT                   ANLDSLKEQLHILDKIKNDYDGDHPKDHTDKLDKLTEKQTKLDERMMKLQQKIFDGLNK
FT                   FKQDKTLPISKAEKDWFKEINSINALLNSSTDDEVALTKKIENLSLQVHSIIESREKEK
FT                   TPKLTAVEQLELEKRLSKLKNWLQREDKSIEILKDKLNNSLKLIGDK"
FT   CDS_pept        complement(857351..858211)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575653"
FT                   /orf_name="CD36_64430"
FT                   /product="RNA binding protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41312.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397628"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192DFD2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ91"
FT                   /transl_table=12
FT                   /translation="MSKDFPVKPPHPSTLENIDLSKLDARLVLDKASQRWLFEDGDQEY
FT                   EYDYIKDQWINTSKRSLSEDDLNKEDIKRQRKQDMSKLKEELNSLKQKKKNSSIFISNL
FT                   PIDSRFSEIEETFAKYGKISVGKDEKSRIKMYTNEKGSFKGEALIIYSNPESALLAIEM
FT                   MDNTEYNGNTIRVEEAKFDNNNNSKKENLKKNSSKTVVIRNMVRKEELANDIHIKQDII
FT                   DDIKEECKNIGVFDIEDIAFNEEDATISVRFSKQESLLSCIKKFHNRYYDGLTLDVQES
FT                   KVIMR"
FT   CDS_pept        858541..859551
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575654"
FT                   /orf_name="CD36_64440"
FT                   /product="Regulatory nuclear protein, putative "
FT                   /function="kinase activity"
FT                   /protein_id="CAX41313.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG446629"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000192DFD3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ92"
FT                   /transl_table=12
FT                   /translation="MTDIAPPSAATPNDYILSLSPEQIEHDQKIGIKAIRLFLQSKTSY
FT                   DVLPVSYRLIVLDTSLLVKKSLNILLQNNIVSAPLWNNQTSRFAGLLTSSDFINVIQYY
FT                   LQFPEKFELVDQLTLGGLREIEKAIGVDQIETASIHPFKSLYEACVKMLESKARRIPLI
FT                   DEDEKTKREIVVSVLTQYRILKFVALNCKETKMLLKPLKNLSGLGDVKKLSTCTMDTPV
FT                   IEVIHLLTENSVSSIPIVDEQGKLINVYEAVDILALVKGGMYTDLDLSVGDALLRRQEE
FT                   FEGVHTCTLNDRLSTIMDTIRKSRLHRLFVVDDEGKLVSVITLSDILNYILFGED"
FT   CDS_pept        859976..862129
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535867"
FT                   /gene_name="OPT8"
FT                   /orf_name="CD36_64450"
FT                   /product="Oligopeptide transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41314.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397627"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI000192DFD4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ93"
FT                   /transl_table=12
FT                   /translation="MMSLETISNNEGIRQGSTNESPHTHTYLDQLDIPQITLRSTIVGL
FT                   LIGSLILISNFQFGLQTGWVSMMSLPAALLAFSIFKLLPISIAKNFTDVENVFVQSIAV
FT                   AVGTGPLCYGFIGIIPAMEKFMTNEESGLGRPLNFGLGQLMIWSLGLGLFGVFFAIPLR
FT                   KQVIVKEKLPFPSGSATATLISVLHGSDIYQDKEVSDEKILIDEEEEEGENGSENLTQQ
FT                   SSKSRLITATTTSIQDDYDSNMRSLIITFIISAAYTILSFFIPILKKIPIFGTYLSSHY
FT                   LWNFQPSPAYIGQGIIMGLPTVSYMLFGAILGWGVLAPLAKHMEWAPGRIDDWINGGQG
FT                   WILWISLTVMISDSLVSFIVVSIKSINNALESFKQRRDLDQYLELQQNQQNEYLLSDQE
FT                   ETRSSTSSNENPENSTYDGKKNKEDSKYTMEVPERHLISTKSTVIGIAVSTLLCIISLK
FT                   LVFGNTVPIYASLAAIILAMFFSILGVRALGETDLNPVSGIGKLSQLIFALIISNDHPA
FT                   KILINLVAGGVAEAGAQQAGDLMQDLKTGHLIGASPKSQFIAQILGTLYSVGLSSIMYK
FT                   VYNSVYQIPSEMFRIPTAVVWIDCSRLVTGQGLPPHIREFALVLGVIFGLISLLKNTVS
FT                   PTSSYHKYLVYLPSGVAVGVGIYNTPNFTLARFIGGLICYNWQKIGPNGKIGMIIFSSG
FT                   LVLGEGLFSGFTMLLTSLGVKHW"
FT   CDS_pept        complement(862528..864129)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078847"
FT                   /orf_name="CD36_64460"
FT                   /product="RNA binding protein, putative "
FT                   /function="RNA binding"
FT                   /protein_id="CAX41315.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG397626"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000192DFD5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ94"
FT                   /transl_table=12
FT                   /translation="MSDDANNTNNIHVDTPDESVLTPPIEPVNHNVTSTLKRKNEDADD
FT                   NEGNEQSANSHSGNDTINSSSIKRIALDSEQLDLQDKEEELQQTAPIITNNSTSHLETE
FT                   SEEFDKPNEDANQTQETLEPAYVPPESDHADEQNTASSSSSKPVSNHRDRDDPTFIQLR
FT                   MYCPVKEASTIVGRKGETINHLREKANVRITVSENLKGVPERIVAVKGPAENVARAFGL
FT                   ITRVILEEPEDEPASITSQQYNLKLLIPHPMIGFIIGKQGLKFREIEENSAAKLKAAEN
FT                   PLPYSTDRVLSVMGVGDAIHIAVYYIAQVMLEHKEVLKKNKVVLYNPANYQPTDHQNLG
FT                   GRQRHPPNNSYNNPMGYQAKLPPFSKPPHHSQHQQSPYNFSMMFQPAVQPQHFGTPVTS
FT                   NPNAISPVGMQPSINVPPQNQYTDEFGNTIVGEVITTPPVQAGQDKYNQDVFVANSSIG
FT                   SVIGKGGNNIKHIRETSACTYVKIEPDKGQSMMLGGGKGMTNIRKLTLTGSLNSIQTAI
FT                   YLINQRINADRERNTR"
FT   CDS_pept        complement(864428..865435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383102"
FT                   /orf_name="CD36_64470"
FT                   /product="SWR1 complex subunit, putative "
FT                   /protein_id="CAX41316.1"
FT                   /db_xref="HOGENOM:HBG397625"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniParc:UPI000192DFD6"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ95"
FT                   /transl_table=12
FT                   /translation="MAKQNINKNTEHLPGEDTISGRNHNIESKQNNIDSEDDDEEDEDY
FT                   DPEKKNEADNASGVSSDEEEDNDRYKDEKSSKIPDYSTIESSTSQIKTRSQRLHEKLSN
FT                   QSRFIGNFEVDSKTGLVKDQSTIDVDSIFENLKTGSPSIDNSEELNIDNEKMANNQQQQ
FT                   SNIDENEFEGPKQIKIQINYTFAGKLITETKYVDENSQEAKAYLNSTSNISSSNSDNDI
FT                   PYRRSQVKVIRTDPVTNETKELRIKLKRPSLIDRFLSVSANSKKMKLSTLEKSRLDWAS
FT                   FVDKRNINEELKIHNKAGYLDKQDFINRMNSKRDDLYLQAKEKEKIRNQQLLQK"
FT   CDS_pept        866175..868277
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187784" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535868"
FT                   /orf_name="CD36_64480"
FT                   /product="Dipeptidyl-peptidase, putative "
FT                   /EC_number="3.4.14.4"
FT                   /function="dipeptidyl-peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41317.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008239"
FT                   /db_xref="HOGENOM:HBG324368"
FT                   /db_xref="InterPro:IPR005317"
FT                   /db_xref="InterPro:IPR016526"
FT                   /db_xref="UniParc:UPI000192DFD7"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ96"
FT                   /transl_table=12
FT                   /translation="MSEVSNKNQENKELFYADIDAPIVVLSALKHFEALSSKNAKKYAH
FT                   YLSRASFEGTRAVLRSVSPESEPIYDMILTIHGKLGTPQSVEEYQQKLAPLTKQDVQHY
FT                   LEYTLQFLDNAGNYKSFGDKKFIPRLEPETFDKLIKIVDDTKVSELYNKVKEALFSTEK
FT                   GLLGYAESGHLSNYYPNSETITKKEIDSVNQLLAENGIMPENTRVEKKSDSEFTVHVAS
FT                   SETTNKTTYYPKDKLTSKDGKINVTFKFGDHHEQFQKIVENLTKALPYVANETQEKLLT
FT                   YYIESFSTGSMNAHKQSQIEWVKDLKPEVESNIGFIETYRDPSGVRGEWEGLVAMVNHE
FT                   RTAKFSKLVANAGTFIKELPWDKIYEKDTFTPPDFTSLEVLTFAGSGIPAGINIPNYDD
FT                   VRLNYGFKNVSLGNVLSANPKNPKQKEVITFIGDDLQDEFKKWRDEAFEVQVGLHELLG
FT                   HGTGKLLQETSPGKFNFDNKDDRIKSWYGPNDTWSSLFGTTSGSYEECRAELVALYLIL
FT                   KNPDQVFPIFNIGNKDDQTIVKFISALLMIRAGLIGLEFWDPSSSKWGQPHMQARFAIM
FT                   KQLHKANVFKFEYSNPDYSDLEIVVDASKLDDGTAVDALGEFLSNLHIFKSTGDVKQGL
FT                   EYYLNKSQVDPEYSRFRDAVLKQKKPRKMVIQANTFFNETTDDIDVVEYEESEIGMIQS
FT                   YYDRKV"
FT   CDS_pept        complement(872090..873640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575655"
FT                   /orf_name="CD36_64490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41318.1"
FT                   /db_xref="HOGENOM:HBG395835"
FT                   /db_xref="UniParc:UPI000192DFD8"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ97"
FT                   /transl_table=12
FT                   /translation="MSEVPNQESPSSSIFKQSNASSSTKIHGAPSSSQIANVDFNTLRK
FT                   LNTNTSFSSNLTNSTTKTSNALSRLFTRNKSSSNISIYHSPSDDDSSPKTLRESASPSE
FT                   SSKSGNRLKIAQKLKFSKNQSSRKPELFLDTSSSISEDNSSFRKIVTGNSSNEVNKSRK
FT                   NSMSSPMSTTFHSLFHRSHHNGSSFQQDTNSVATGTTPLSSKFDDLSKVSKTTLCLSSN
FT                   SSNSIISNPELAQIYNFINPNISIEDGETNMDHTNSSFLDIHKKMLVPADSFIQNKLNK
FT                   YHQTEVGLGIYESELDHEKDSKIYSNLYHYLKPLFTPSFSASDSGRKVSMRPILNANVE
FT                   EIASFVKESFCLHQPNERAPLDHDKSFRSKTRSSVSSLGRAKVDDFDYRQLSNLFEKLM
FT                   TVLSHNLQTAEPSEVSLQTLILNAWRYYNNYIRFYVLSVFQPLQIHLNELYMKNQNGSK
FT                   ITRIDDLLLVSFRKVFITEQGIGSGNREPSQFLGNTESDELTGNELFTSTLAILSSIS"
FT   CDS_pept        join(879056..879334,879337..879465,879462..879611)
FT                   /pseudo
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT   CDS_pept        884605..885897
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575656"
FT                   /orf_name="CD36_64500"
FT                   /product="Alpha-1,3-mannosyltransferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX41320.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG320579"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000192DFD9"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ98"
FT                   /transl_table=12
FT                   /translation="MSKRQDNKKIAFIHPDLGIGGAERLVVDAAVGLQDFGHDIIIYTS
FT                   HCDLTHCFEEVSSGQLKVSVHGDSLPTNLFGKLHIFFAILRQFYLVCWLIFTGTIKDYD
FT                   YFIVDQLSFCIPLLKTFCNSNCQVLFYCHFPDQLLVRRTSFLKKLYRVPFDAIEEYTTG
FT                   SSDQIVVNSNFTKQIFHDTFKKLNHIDPQVVYPCVDTETDVDTNASSNTEVSKFFNDSP
FT                   FFLSINRFERSKNIELAIKSFARMNKLMVTNKKPRLVIAGGYDSRVAENVEYLAELSTL
FT                   CDELNLINFTIRGKLIMMPPSVDVLFLPSISTQLKNSLIQQTELLLYTPPREHFGIVPL
FT                   EAMLAKTPVLAINFGGPLETVVNYNGNNLDEATGYTETGDFSKWAKIIMKHYNLDESTK
FT                   VKLGENGRNRVINKFSRKKLAQSLENILNLN"
FT   CDS_pept        complement(886130..887542)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230225"
FT                   /orf_name="CD36_64520"
FT                   /product="Reduced viability upon starvation protein,
FT                   putative"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41321.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG334000"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="UniParc:UPI000192DFDA"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJ99"
FT                   /transl_table=12
FT                   /translation="MPLLPSTPLPFLPYNLPPPPLPLFLYYYILMSFKGFKKGVLRAPQ
FT                   TVRQKLNMGEITHDAVYLDAERRFKEIETETKKLSDESKKYFNAVNGMLDEQIDFAKAV
FT                   AEIYKPISGRLSDPNATVPEDNPQGIEASESYQAVVKDLKDTLKPDLELIEKRIVEPAQ
FT                   ELLKIIQAIRKMSLKRDHKQLDLDRHKRNFSKYEQKKERTVKDEEKMYSAQAEVEVAQQ
FT                   EYDYYNDLLKNELPILFQMQSDFIKPLFVSFYYMQLNIFYTLYNRMEELKIPYFDLSTD
FT                   IVEAYTAKKGNIEEQTDAIGITHFKVGHAKSKLEATRRRHAAMSSPPPTGASSITSTGT
FT                   GSELPAYTPGGYNQPYGDNKYQPPSSPATYQSPVTPAAAQSPTIYQSPVATGQPPAYLP
FT                   QTPASAPPPQAGSGLPTCTALYDYTAQAQGDLTFPAGAVIEIIQRTEDANGWWTGKYNG
FT                   QTGVFPGNYVQL"
FT   CDS_pept        887860..892335
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094326" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575657"
FT                   /orf_name="CD36_64540"
FT                   /product="RING finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41322.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG398615"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000192E03A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA0"
FT                   /transl_table=12
FT                   /translation="MDGKKKKFSFALQYNFDILLLYISKYLDNMAKQYEITGDLGYNGF
FT                   PISLNYITHLPDISTLYNSEVVVIFKSLMKRDPKTKEKALNDLLTITEIDDPTIVAWLQ
FT                   VYPKLALDNSRSVRLLSHQIQGNFLKIVGGKKYSKYLKSSIPIWLMGIFDTDKSVSSIA
FT                   YKTLLQSFQGDVSKLNKTWNIFEEQIINLIGTLVSIESMETLSDRRYTSESEMVSKYDR
FT                   GLVCAINMLSKLSDENIVPILEEESLWDHLSNSLKEDNMDLVLFKNLLLLITNLSDDNL
FT                   QVVYKLVSKKFIKIKFKSNKISGSIIYSNVIIPFWQAIVRLTEFGIRNKLKKNFWDLAG
FT                   SKSSTRFYEYLKLGPCNSDPSYYQLVVKIFQDLQKLDVVDFNSQDEYDYVINLLSKQYS
FT                   TTMGTFKAGALDCALKISNLFTVESTMLVDELILQVLKSLASIRSQPDKTAIVQTLKNN
FT                   LSSGTEKVFNKLNKTVEKFITDANVIDSSPKSFLSVYFDVLKQLGLQSQLDNLVRYVCT
FT                   DLLDESEDLNLEIPFFVIKLYLNNMIDPIPEVTDFLVQLPAFVEEDFITPILDILNIAI
FT                   AKKLLQNEDELDDIVNDFYLKLTMVKPEKIDYFIQNLGITIDEKRFPEIYSHLTDVSKK
FT                   EMSKDQIEMIVKSTKDKDVLLNVIKSLDSEDAYLKFIELVVQYNLLSIIIDLDISQLLH
FT                   VAWIHLNVKFLTTLKEFKDIYLVSMIEFIKLGSGSLSEEFYKFVKTGPLPIEQFKQRTL
FT                   DSISKIDIFSVAISNPLGSAVYLCQKGKTPSELDEFIPSIGKFLNNIDGQVVDTLLLLI
FT                   KEYLADYILLKDNVNQDVVDVLSNLQHKISKHFKNFKFGDLINEKTLVLEELWQLVERN
FT                   DVHAFYAARIIKRAVEDSLEFESLSSFESFDINYTKLVKTPFKFVSLVGGFSKFLNSKK
FT                   LDRIRNYVLSEILAVKKEEQIITDGIKWVVLSLVFFNTEVFATDVYPIHKLTMVLSLIS
FT                   DWLDSSVAYDNEFIDLRVLICCFLGVIISKQTNIPDNYYELAKKVFENNFEIIQLEPNR
FT                   LDLNYYTLKFYIQVMNKDMGKFDEELIDIFLNFNYTCRNQATILVEQTIARVLRESSIE
FT                   MKIIQSKKSSFFKLFTSSKSVSVQRICAWYLRQIILLEQQEFVVEYQLSKNDEKELQAR
FT                   IPDELIKIVNHTLGHQEYEVFQYMWSWVLILSYMEDITLKMKNEYIGQLVQNKELPILF
FT                   DFVFEYLHVEDESLFIIDSGKQQQQQQQQQQQDTENNIIPNYDLIETGKSESSIHELKL
FT                   LAGYIYFKCAQLCGSQVQLWYQEIRDKQFKNIVEKFTVKFIAPILVKDIKENVGKEIGK
FT                   LEQNEVNIKIGTNQIKANISVEEENISMRWSIPSNYPLSNVSVEGPLCVGVKENQWKAW
FT                   LLASQKIISLTNGSITKSIELFCKNVNLHFSGFEDCAICYSILHQDSSLPSKNCTTCSN
FT                   KFHAACLYKWFKSSGSSTCPLCRSTFNFRR"
FT   CDS_pept        complement(892447..893811)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575658"
FT                   /orf_name="CD36_64550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41323.1"
FT                   /db_xref="HOGENOM:HBG397623"
FT                   /db_xref="UniParc:UPI000192E03B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA1"
FT                   /transl_table=12
FT                   /translation="MSPSDLLIELSEFINTDNYQMKLKNILISKFLLKFPIEIIYKILF
FT                   YVPDLYLLVFFSINLKTINCNKISIKDLEDYIFNNINNNKIIYLDLKPLIDINSINYQT
FT                   LEDLLIFKKIDFRFLDKFQFYYHSLNIKNWQFPLFMSPFIIRFINKDKTKVEIDDWNRI
FT                   LLDGMELGLGLGLDLDSTATATTTSTSTSTTSTSTTTTTTTTTTINNNSHMIIRGLHHM
FT                   ITKPITTPATTTTTTTTTNTTNTSNSFSPFIPDVKQFSLIIQNLKNKIPGFNQWQINQQ
FT                   EIFFLNIKNTNFQFTLKGIDENCWFKHYNFTKLYLKTYYLYQDDYKLNKLFNFNNLIKL
FT                   TIDFGQSPLNFIPHWFQFIKNLLNLEIFNLNIGKISLIDIGLIVLKLNQLIEFNLKTFK
FT                   YWTQIFWKWLIIKLINQRKHRKHQKYQKQKSKTNNQNLNPNKTKEFKFTLQFIDD"
FT   CDS_pept        894976..896334
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575659"
FT                   /orf_name="CD36_64570"
FT                   /product="Methionine aminopeptidase, putative "
FT                   /EC_number="3.4.11.18"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41324.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG318153"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="UniParc:UPI000192E03C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA2"
FT                   /transl_table=12
FT                   /translation="MTGVTGTEDTKVIESKINELNIDKSKPEKTNKVNKSDDVDNDDVD
FT                   NDDNDDEDNDDDDDEITESGNSASSSGDKKKKKNKNKNKKKKKKKIISIDSSYPEGIFP
FT                   EGQWMEYPLEDINSYRITSEEKRYLDRQQNNKWQDFRKGAEIHRRVRHKAQSSIKPGMT
FT                   MIEIANLIEDSIRNYSNNDHTLKSGIGFPTGLSLNHVAAHYTPNTGDKLILKKDDIMKV
FT                   DIGIHVNGRICDSAFTMTFNDEGKYDNIMKAVKEATYTGIKESGIDVRLNDIGAAIQEV
FT                   MESYEMEENGKIYPIKCIKNLNGHNIDDFIIHSGKSVPIIANGDMTKMEEGEIFAIETF
FT                   GSTGNGYVLPEGECSHYAMNKNIQHLKPPSERSKQLLESIKQNFGTLPWCRRYLERTGE
FT                   EKYLFALNQLVRHGIIEEYPPIVDKRGSYTAQYEHTILLHPHKKEVVTKGDDY"
FT   CDS_pept        join(898476..898509,898814..899841)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575660"
FT                   /orf_name="CD36_64590"
FT                   /product="Vesicle-associated membrane protein-associated
FT                   protein, putative"
FT                   /function="structural molecule activity"
FT                   /protein_id="CAX41325.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="HOGENOM:HBG397622"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="UniParc:UPI000192E03D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA3"
FT                   /transl_table=12
FT                   /translation="MDVSPSNLEFTGSFTKQITEYLTLSNPTNTPLAFKVKTTAPKLYC
FT                   VRPNASIVQPGESLQISIILQGFSQPLPNDYKCKDKFLLVSVPAPNSIDPTKVGESWGQ
FT                   LEAQFKPQVVSKKLRVNYVVGPDKPDGGAGINQQPQQQQQQQQQPAQQQFNQQQPQPQL
FT                   QQQQQPSQSNIDVGTGAGIAAGAGAGAGAGAGGVIASSGYNQAQNVPNGDNSFNQTANR
FT                   SFDTSSAHNGYNNQSFASTTAAVHQQQPQQQQQHYQQSNYQASSGNGHGNGYGNVGGGA
FT                   SQPSPALQRELEALARQVQTLSTKLDQNEKAAASRSPVSSLVGGSGEDVSGISLPVALV
FT                   LVLIAFLIGWLVF"
FT   CDS_pept        901632..903158
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575661"
FT                   /orf_name="CD36_64604"
FT                   /product="Vacuolar amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41326.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG332582"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000192E03E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA4"
FT                   /transl_table=12
FT                   /translation="MGRATIRSGSINLLNTIIGAGILAMPYGLKNNGLLFGCILIIWSS
FT                   LTSSMGLYLQNKVAKYTDQRGSVSYFSLSQLTYPNLSILFDSAISIKCFGVGVSYLVVI
FT                   GDLMPKIVESIAGKNVPLDSILMARNFWITIFMIIIVTPLSYLKKLDSLKYTSILALFS
FT                   VGYLICLVVAHYFSTTPTFASSSDIVYHYIGPISLKSTLSSFPIFVFAYTCHQNMFAII
FT                   NELKPNDTDGSQTRQSNLIIRNSISIACLSYLIVGVFGYLTFGNSVNANIITMYSPNSI
FT                   SSLIGRLCIVIMVSLSFPLQCHPCRGSINHVIYFCTHGVQQSKFRTATATATATATGGS
FT                   NNNNNNNRDQHGYTSLSSDIESLQSIGNDTTIGDGNDANESFISTTPVEGAQDTDGHDP
FT                   IIVPMTTKKFYIITTVIVILSYLVAISVTSLAHVLAFVGSTGSTSISFILPGLFGYLLI
FT                   KPESESESEPHGSLNNLEKFCKYGGLFLAIWGVLVMIVCLSATIFLGATH"
FT   CDS_pept        complement(903254..906568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383103"
FT                   /orf_name="CD36_64607"
FT                   /product="Spindle pole body component, putative "
FT                   /protein_id="CAX41327.1"
FT                   /db_xref="HOGENOM:HBG397621"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="UniParc:UPI000192E03F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA5"
FT                   /transl_table=12
FT                   /translation="MAKSILKDNQNHTVPILRGDNSNNNNSNKTDESRISINLNQNNNN
FT                   NNNNNRRVSFAREVTLHKIDYVENPNNKRRKTDIGITYQDYGESSGNDLNSENYHHNNN
FT                   DNNNGMNNINEQDEHEEEEEEHEQEQGDDTYGEKMLVDSSDEDEQEEEDHVIDVNNNDR
FT                   RDHEEQTMELTSVGVPEYIPPVIDDGKASTDQQYHRVVVVEEEEEEEEEDMELTEGMPR
FT                   KIEYSSPKETNVDDQNNDDEDITMDVTNVLSHIRQSANQNQNSVQDNAHSENKDPQNVD
FT                   DTQPMELTQTFENITRSSIEKPVLQEVIEEQELEGGIEQHGSENKPEVKEQVIDDVVNT
FT                   EPEEENELDHQIIDNDNREENKPSNISSNDFSEHMDLTIVDYKKIDYNGPIPEIPRGDG
FT                   FDNGELSFAMDLTEIQSFVCPRNDKENQDDNETGIDEVDANAIAIAQEIQPNEEGKIRE
FT                   NEITENDAMELTQTIPMKILDSNEDTNSISQPLEESIPTSNNLPDESLSQPMELTQIDS
FT                   KITTGKESDLGEVSQPMDLTQTTSNISHDDEINTSGIEERVTTTTIPLAEITQDDINEE
FT                   DEREEGKTEPQEEKEESSEEDDEDDSFDEDDPNYIPVSLSKFLSDIRVQFYDDLELDLN
FT                   SIPRLSITNSIELTPSLHDYIKAKPNLELLELYEFCCHELNKKIIQGRELYNEYEKTVI
FT                   INNPILFKKYYSMDDKTKLLINLKIQLIRDFARLKSKKTWYDWRNQLIENLIDKLNEEI
FT                   NSLINDKQLLIEDINRLNELYDKCRIYLNILNNKFNELIRLKNEIKRIPPIELNKLQLD
FT                   VAKRKQDIVEINKEIEIKLLQLSTIKKNLHDSNEKKSLLQIQLNNLQNEFNQIRKYDNL
FT                   EIKLILRKYQFLQNLTNLKYLKTTQKEQQQQEQEQEQEDRGHKISFLFDDSIICQFDFI
FT                   NNKIMYTMEQNNFKNKSSLIGVFDQIIIDGEKQQELNIIDKFQLFCRNWHWLKKLDSDL
FT                   YYVSLKFPIELKFVHNNEKEEEEEKEGKKYLEFTIKYYNFKYDYKLLICGEIDINNFVN
FT                   NQSNVNPKNIEFTGRIIHQRGEINNNNNNKSFREQISNDLKVFDKQILNNLIIVNK"
FT   CDS_pept        complement(907498..913467)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575662"
FT                   /gene_name="ALSD3"
FT                   /orf_name="CD36_64610"
FT                   /product="Agglutinin-like protein, putative "
FT                   /protein_id="CAX41328.1"
FT                   /db_xref="HOGENOM:HBG397640"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniParc:UPI000192E040"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA6"
FT                   /transl_table=12
FT                   /translation="MFLQFLLLCICLSVATAKVVTGIFHSFDSLTWTNAASYPYRGPST
FT                   PTWNAVIGWTLDGAVASPGDTFTLNMPCVFKFITDQTSVDLVADGRTYATCDLYSGEEF
FT                   TTFSSLKCTVSNALNSQTKALGTVTLPLSFNIGGSGSDVDITSSQCFKEGTNTVTFNDG
FT                   DTTFSTTANFQRSDVNANDRILLSRILPSLAKSVTIFIPPRCASGYSSGTMGFSTAGTD
FT                   AIIDCSTVHVGISNGLNDWNYPIESKSFSYTTSCSSKGVSVTYQNVPAGYRPFVDAYIS
FT                   ALTSYTMQYTNQYTCVGARPVDASFSYNWLGYDNAEAGSRGITIVVTTSTVTDSTTAVT
FT                   TLPFNSDVDRTKTIAVLQPIPTTTITTSYVGVTTSYRTQTVPIGQTATVIVDVPYHTTT
FT                   TVTSEWTGTITTTTTQTNPTGSIDTVVVQVPSPNPTVSTTEYWSQSYGTTTTVTGPPGA
FT                   TDTIIIREPPNPTVTTTEYWSQSFVTTTTVTAPPGGTDTVIIREPPNPTVTTTEYWSQS
FT                   FVTTTTVTAPPGGTDTVIIREPPNPTATTTEYWSQSYASTTTVTAPPGGTDTVIIREPP
FT                   NYTVTTTEYWSQSFASTTTITGPPGGTDTVIIREPPNYTVTTTEYWSQSFASTTTITGP
FT                   PGGTDTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNYTVTTTEYW
FT                   SQSYASTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIR
FT                   EPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTTV
FT                   TAPPGGTDTVIIREPPNPTVTTTEYWSQSYATTTTATAPPGGTDTVIIREPPNYTVTTT
FT                   EYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTV
FT                   IIREPPNPTATTTEYWSQSYASTTTVTAPPGGTDIVLIGEPPNPTVTTTEYWSQSYATT
FT                   TTATAPPGGTDTVIIREPPNYTVTTTEYWSQSFASTTTITGPPGGTDTVIIREPPNYTV
FT                   TTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFASTTTITGPPGGT
FT                   DTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSY
FT                   ASTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPN
FT                   YTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPP
FT                   GGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWS
FT                   QSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIRE
FT                   PPNYTVTTTEYWSQSYATTTTVTGPPGGTDTVIIREPPNYTVTTTKYWSQSYATTTTVT
FT                   GPPGGTDTVIIREPPNPTVTTTEYWSESYATTTTITAPPGGTNSVRIREPPNFTVTTTE
FT                   YWSQSYASTTTVTGPPGGTDTVIIKEPPNYTVTTTEYWSQSYASTSTVTAPPGGTETVI
FT                   IKEPPNPTITTTEFWSQSYDTTTTITAPPGGTNSVIIRIRSSPSDESSESTFSILSVPS
FT                   FSASISIVSSFSRPHYVNTTVTNLPSSQSSSVNILSSDEITFTNDDRFTSSIVFESGET
FT                   SVAISTTFCDDEHGCQSSATQGSVVRTTATTTATTTTVIGGNNGTDKPKSGELASTGSV
FT                   TSKIVTPGGPSPTAPSNPGSPNNGVPSPKSPSAETPATKNVPGSPDIPDTKSTDIARTT
FT                   TIVSHTVTESGAIGVSINPNPALTTGTPLVGKPGSVVNPSRETGINTGSRSSTKIVTPH
FT                   ATGTATAAIPDTGNGATTKGHDTTGGNSHGSAATTNTQGGNNEPGNQSPPNTGGAPVGT
FT                   SSQGVDTTASQATTLSQQTTSSLITTPLASTFDGSGSITQHSTWLYVLLTAISLFY"
FT   CDS_pept        917110..919515
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078848"
FT                   /orf_name="CD36_64620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41329.1"
FT                   /db_xref="HOGENOM:HBG397611"
FT                   /db_xref="UniParc:UPI000192E08E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA7"
FT                   /transl_table=12
FT                   /translation="MSFDILSRCYLNTLKQFRLLLPARSLSSTTTTTTTTTTSLPTSKE
FT                   KIIYKLTDQQVKKYYYLIKMIDHQHSYLINDNTGTTTSTTTTSGDLKLFDKINSEWKHK
FT                   SQSDRNRLKEAFENIIYDMNQHKSIEIITDTDTNNNKKDIKCQEFHIMQYKYNQNQATG
FT                   AIFSRKKLSINSILKYFIYSEINNTYGNGSKICFYEQDNNTKLKIINEIKRKRWVKLSS
FT                   IQKNELMKQYNDLIMKGYEIDEKNDYQLIKINHDNFNIMRKVGEDDCFPITTTTTTTTT
FT                   TKEGGGGNKVKYNTKWPTLIIKHNLTTGYCKIDGVSLLDGCDYYLWKNLFNQNIYDYEK
FT                   YQIFKQKWMELTPMEQFQYQQEYTNILKSGKILLFGELQSITPKLIEESNVIKIKYSSI
FT                   WGEQFKSITYKTCKTCKTSKTPIKLDNLRFLINQTVGNIIIIGKNKNNNKNFDYAWNYY
FT                   FAKRLNQLQLNGITRINAINDNHQLIIIKQEWENMTQEEKSKIDIEYENLLLSGKDYLN
FT                   GEIVTIKKKLSSMMMMMMMKKKNNNQGINLIDEIFGQDLVIPSKSRRGPGGYKVKTSIP
FT                   VLIDQKSGKGILLDKIDLVYAYNYYFGLKLNKLKLGNDYDCEGNLNRNHHTVDNISQIE
FT                   NQWILMSEKDKLKYKSDYESLLRDGKDMLHGEIVSLWEKFSANKTISSKKISGQGLKRA
FT                   LFPKSNIDFTVKLISNDDDINKGIDKKFVLFGELSDNKLYQYYKYHRLQEESITNMENH
FT                   LQTLQAIKSEWDEMNEQDKQEIRKAYELLLISGKDIKNNELIDIDIVS"
FT   CDS_pept        920184..920900
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575663"
FT                   /orf_name="CD36_64640"
FT                   /product="Peroxisomal membrane protein, putative "
FT                   /biological_process="peroxisome fission"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAX41330.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0016559"
FT                   /db_xref="HOGENOM:HBG325966"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniParc:UPI000192E08F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA8"
FT                   /transl_table=12
FT                   /translation="MVADTLIYHPTLSKLIKFWDSTPKREKTFRLLSYLSRFLGYYAYK
FT                   KGYSKETIELWSNLKGHFTFIRKAMRFFKPINHLQLASKAYDNKLMDPILQFTTIIRNL
FT                   GYAGYLTIDAIVFFKLLGIIDKKKYPNLGKYASRFWLIGLISGLINSLRIIYSLNSYEN
FT                   NIEKQGEEINEKEKQVDINAINQKLYQAKRKLIWDSLDTFIALNSLDILHFTEGDVGLA
FT                   GVITSLLGLQDLWKAT"
FT   CDS_pept        complement(921071..921394)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575664"
FT                   /orf_name="CD36_64660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41331.1"
FT                   /db_xref="HOGENOM:HBG397610"
FT                   /db_xref="UniParc:UPI000192E090"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJA9"
FT                   /transl_table=12
FT                   /translation="MTIDQLIESKWYESYESYSINHNLPIDNTIKPSFSSTPQQQQQQQ
FT                   TTPEIDLNNDIPNIIQLINNQSNVEELSTELTNVLLKYYWAGFDIGYECSNPNKNSTNS
FT                   SSS"
FT   CDS_pept        921656..923665
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535869"
FT                   /orf_name="CD36_64670"
FT                   /product="Nucleolar ribosome biogenesis protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAX41332.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397609"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000192E091"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB0"
FT                   /transl_table=12
FT                   /translation="MTNDSPIKDLRIYIGNISPKLKENESSLLTRIAKYGTIKSSLEFH
FT                   TKPLQLHYFAYITISTTDSNFNNLKKSLNGILFMGMKLIISLAKPNYLQRWKKSNSKSK
FT                   SKSKSKSKNNNFKQLEQLRRDKIVESRLEKIQEYKTNYPINNFTSNLITSYNAGFNQSE
FT                   ISLSEHTLNNSSGNTKNPPPKQRLIGSKSYGALTKPKKFNENRFLYRSGKGIIIRGVHR
FT                   KTPRSNLKLKQQTLRILINGELKTFKNYKTKLWGFEKNKTIRDLTWRFINGEWRSGDDH
FT                   IIEKVTCGISGEQAKNYGKDNPIIDEDKHNGSDSASASASASASNNREEIDKNKSILAS
FT                   MFDSYDFDKPIELAVTGNDATTNAAAVAAEESESEIEIDSKGRKKAKHYDYEIEGKISE
FT                   DEYEDVEQFNKIDIQSANQIIENYKQSSNIVPIKETYYDEDDEGNEIELDEFNNKYTTE
FT                   AIKNKYDKDHKEEEEEEEEEEEEFIPTFGGAHKTNVNNTETLRALFNPTTIETIQPTSS
FT                   TENSTSFKLGLQDDDEDIDTDKQLDNIKQQELYKTLQQQQRQKQEQEQQQQEEINNQQK
FT                   FGLFWCHFDSPFLSTQSQFSKLGLTGGGGSGGGNNGKIKLPGEEQDEQPKEDNDEEESL
FT                   YEKWFWSMRGEISRECKRRKRDLLRTIRKKNKKN"
FT   CDS_pept        923964..925547
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078849"
FT                   /orf_name="CD36_64690"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41333.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG525447"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniParc:UPI000192E092"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB1"
FT                   /transl_table=12
FT                   /translation="MAIIQESSKEVDNTSEKHPNNKVVDVTNEKVPPELPELTLSNVLD
FT                   DIKQGIIAFLINPKVTIIVYPIIICLSSIITKLVINKIPYTEIDFITYMQQIELINNKG
FT                   IIKYSEIKGDSGPIVYPGGFVQIYQFIQWLISSSTTENGGGGELVLSFDIREAQYIFSY
FT                   LFTISIIFNCLIYINLINIPPWTIYLFLLSKRLISIYVLRLFNDCWTTLSILGVILILQ
FT                   QAAAATTSTTENWLRYLLVLLAGDLYSIAISIKMNALLYFPGFIIIIYFLLDENLMKSI
FT                   SVLIVMIFIQIIMGWQFLLPLEIFNKNDEIKKMASIIRWDYINNAFNFKRKFLYEWTIN
FT                   WKFLSIEIFSSNGFAKLLLLLHGFILLIFIFTRFLNSRIIGGKSITNLIYQILFSSPFS
FT                   SHHHQNSNLIKNPQSGPQLIFIIMSITNLIGVLFSRSLHYQFLSWYAWSLPGLLYLNFP
FT                   IYLALPIWFIHEWCWNVFPSNSISSSILVGILSLIIGATWWNFDYWFPPTINSLSTTSN
FT                   ETNINKNKQE"
FT   CDS_pept        complement(926025..928532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094332" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575665"
FT                   /gene_name="FLO8"
FT                   /orf_name="CD36_64710"
FT                   /product="Transcriptional regulatory protein, putative "
FT                   /protein_id="CAX41334.1"
FT                   /db_xref="HOGENOM:HBG397608"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="UniParc:UPI000192E093"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB2"
FT                   /transl_table=12
FT                   /translation="MNHKQVLPENEPTSTTTTTATPSSSNLMVPNTTKQVLNSLILDFL
FT                   VKHQFQDTAKAFSKESPNLPSIPPLMDCSQGFLLEWWQVFFDLFQVRYGDGNSNNNPNN
FT                   KLYHDYLRIQEAQKHILTQFPLVQQQQQQQHFQQQQGQQGQGQGQPFQQRGIGVAASGM
FT                   QNQQHQFPPQHQGQPQGPGQTPQPPGSATSANFPINMPPNQNPQQQMFPMNQQFAQMPN
FT                   GQNQPSIEQQQRMAMMMKQQAIAAQRQQIPMNGLDPQQQQQMMNAVGGGPNNLNLQQQL
FT                   FLQQQQQQQQQQQQQPKTTFQQQAQNQMNNLRQQAALVAQQQQQQQQQNQLQNNLVSAM
FT                   GDSSSKNNSPVGTRSNQQPTPQQNAAPAPSPHPHPSQQGQTQAQHNFQNQQQQQKHMNK
FT                   SVGSQGMKKNGQMSNGNSSNSSGRNNNALRDYQNQLMLLERQNKERLEFARNSVNSDPN
FT                   PLTNGMMFAGQNQNQNQNQYSNQLPPNQQQPTPATFHPPPPPPTSATIANGSQGQGQFN
FT                   QKPSPATSNNSPALGNKSSPAMSNKKSKKESTNKKSKKGNSNASIAGSNKASGQTTPII
FT                   SQPPSAGTEQKQPQPADQMRQLQDKQQQQRPGSNTPSMGKKDFQPLTPRSEPISGETTK
FT                   KKRKSGKLNDNNENSNGNSPKKQPKINSNSKNLDPIIKEEDNGVLSMKKESSTSLQDQD
FT                   LDLNPPMAPTQATSMSNTFNNDPFDVHLLDTTQQQQQHHHHHHQNNDDNNSDRNHHLSN
FT                   GSNNLSVSGGSGIGVNNSVFGDSTHGFDINFNIDSLDDIWTTTGPGGDITGTGSGSGGG
FT                   TGGTDDDNFMGMNWAADPIENGD"
FT   mobile_element  929972..931163
FT                   /mobile_element_type="LINE:6B, Zorro1-like"
FT                   /note="5' truncated ORF1 + 3' truncated ORF2"
FT   CDS_pept        930171..931146
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(932609..933775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535870"
FT                   /orf_name="CD36_64760"
FT                   /product="Subunit of the nuclear pore complex, putative "
FT                   /protein_id="CAX41336.1"
FT                   /db_xref="HOGENOM:HBG315851"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192E094"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB3"
FT                   /transl_table=12
FT                   /translation="MSFLGNSSTGTSTTGTSSAVTGQELLNDITINNPPEDSIEDLSFS
FT                   PQQDLLAVASWDKKVRIYEIDPNSGNNMGRAMYEHEAPVFSSRWSIDGLKIISGGADNQ
FT                   VKIFDLTTQQSQQIGQHDSAVKSVRYVECGPNNTQIVASGSWDKTLKYWDMRSPQPVST
FT                   INLPERVYSMDNSQKLLVVGCADRHISIIDLNNPQQIFKSSQSPLKWQTRCVSCYPQAN
FT                   GFAIGSIEGRCAIQYITENEQKKFGFSFKCHRKSGGNTTTGTTNTTTGSGTGVSGGLRT
FT                   TSSSNANESHAYSVNAISFHPIYGTFSTAGSDGTFCFWDKDAKQRLKSFPELPGTISAT
FT                   AFNKTGTIFAYAVSYDWSLGYMGNRPDYPNIIKLHATKDLEIKQKNKR"
FT   CDS_pept        934026..936680
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535871"
FT                   /orf_name="CD36_64780"
FT                   /product="Voltage-gated chloride channel, putative "
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAX41337.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397607"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI000192E095"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB4"
FT                   /transl_table=12
FT                   /translation="MNGLDRGTSTTSSSSSPSHSITYSTDEIPILTYTNNNNKNNNLHN
FT                   QEIHKPLDHCQYEENTFIDWCKESILISRNPLIYQNNNKWIILILSAILLGYLTSAIDL
FT                   IQVSLNDFKKGICFSSKDSWTLLNPYMTCPMDDWYNWNQIFFSKNINNPLIKFIINFPI
FT                   YLILAIGFSLIAGYLTLTYNRSSSSYNNNYMIRQSGIPEIKLIISGFNLKIDQYLGFKT
FT                   LILKSIALIFVVSSGLWLGKEGPLVHISCCVFNIIYEIITKHYSNNQNEAIRRELLTAA
FT                   TATGISVAFNSPIGGVLFVLESMPSYFIPTKIMWNSFVSATVATIILTGFKIFTDGRNF
FT                   NEQVLFQVNFGNFSWLFIEIIPFITLGILGGIYGHYFIKFNTKFSKLQFRNLIRHRLCN
FT                   FLQIDYKYGSILEILLIVIITTIINFPFEISKLPLNALLNLLFKSCTKDNDNSTTTTTT
FT                   SKDFICQDSNVRALFKLLYIMIEGFWLTCYTFGLDLPGGILMPSLVMGAMTGRFLGIIT
FT                   QSIQSKFNWESLATCTADSCVVSPSSYAVIGAASFMTGITKLTMSVVVIMFEMTGAVTY
FT                   VLPIMGGVMTSKFVSDWLTPNNIYDTWLENNFNKQKPSDESDITTINNQLINQGKGTGL
FT                   ISFQNLTSTIKSKLPNINIASSMIPLLEVKCLCLIPNQEQENFTLNSLNSFINNDSHEG
FT                   YPMIINYNNPIIVGYIPKSQLLNQLFLSLSNRSIDPNSPISFQITHNQSSIDIPELIQQ
FT                   QLLLLLSQRKQGVQINVQPIQSTLIINEKTPMLLIIEMFEKLHLNNLIIVNSENETLMK
FT                   GFIDRFILNDLIIDKFEKLVDKLNDYQIIQQFDIEENIGRVEMTEFDYNDNDNDDDDDE
FT                   VTRIDRKSIELIT"
FT   CDS_pept        939438..947462
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575666"
FT                   /gene_name="ALS2"
FT                   /orf_name="CD36_64800"
FT                   /product="Agglutinin-like protein, putative "
FT                   /protein_id="CAX41338.1"
FT                   /db_xref="HOGENOM:HBG397640"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniParc:UPI000192E0EB"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB5"
FT                   /transl_table=12
FT                   /translation="MFLRFLLLCICLSVAGAKVITGIFNSFDSLTWTNAARYPFKGPGY
FT                   PTWNAVLGWSLDGTVASPGDTFTLIMPCVFKFITNQTSVDLIADGADYATCQFHAGEEF
FT                   TTFSSLTCTVSSALNPSIKALGTVTLPISFNVGGTGSSVDLENSKCFTAGTNTVTFTDG
FT                   NNKISTTVEFNKTTVDPSGYLTSARRIPSLNQVTSLYMAPQCVNGYTSGIMGISSNSGI
FT                   DIDCSTVHVGISKGVNDWNFPVSYDSFSYKKTCSPTGISITYENIPAGYRPFIDAYISA
FT                   SGVKSYALSYANNYTCVDSSFQNKPFTIRWTGYNSSEAGSDGVVIVVTTRTVTDSTTAV
FT                   TTLPFNSDVDKTKTIEILQPIPTTTITTSYVGVTTSYRTQTVPIGQTATVIVDVPYHTT
FT                   TTVTSKWTGTITTTAIRTNPTGSIDTVVVQVPSPNPTVSTTEYWSQSYGTTTTVTAPPG
FT                   ATDTIIIREPPNPTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNPTATTTEYWSQ
FT                   SFATTTTVTAPPGGTDTVIIREPPNPTATTTEYWSQSFATTTTVTAPPGGTDTVIIREP
FT                   PNYTVTTTEYWSQSFASTTTITGPPGGTDTVIIREPPNYTVTTTEYWSQSYASTTTVTA
FT                   PPGGTDTVIIREPPNPTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNLTVSTTEY
FT                   WSQSFATTTTVTAPPGGTDTVIIREPPNLTVSTTEYWSQSFATTTTVTAPPGGTDTVII
FT                   REPPNPTATTTEYWSQSFATTTTVTAPPGGTDTIIIREPPNYTVTTTEYWSQSFATTTT
FT                   VTAPPGGTDIVLIGEPPKFTLTTTQYWSQSYATTTTATAPPGGTDTVIIREPPNYTVTT
FT                   TEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDT
FT                   VIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYAT
FT                   TTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNYT
FT                   VTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNPTVTTTEYWSQSYATTTTATAPPGG
FT                   TDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQS
FT                   FATTTTVTAPPGGTDTVIIREPPNPTATTTEYWSQSYASTTTVTAPPGGTDTVIIREPP
FT                   NYTVTTTEYWSQSFATTTTVTAPPGGTDIVLIGEPPNPTVTTTEYWSQSYATTTTATAP
FT                   PGGTDTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNPTATTTEYW
FT                   SQSYASTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFASTTTITGPPGGTDIVLIG
FT                   EPPKFTLTTTQYWSQSYATTTTATAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTTV
FT                   TAPPGGTDTVIIREPPNPTVTTTEYWSQSYATTTTATAPPGGTDTVIIREPPNYTVTTT
FT                   EYWSQSFATTTTVTAPPGGTDTVIIREPPNPTATTTEYWSQSYASTTTVTAPPGGTDTV
FT                   IIREPPNYTVTTTEYWSHSFASTTTVTGPPGGTDIVLIREPPNYTVTTTEYWSQSYATT
FT                   TTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFASTTTVTAPPGGTDTVIIREPPNLTV
FT                   TTTEYWSQSYATTTTVTGPPGGTDIVLIREPPNYTVTTTEYWSQSYATTTTVTAPPGGT
FT                   DTVIIREPPNYTVTTTEYWSQSFASTTTITGPPGGTDTVIIREPPNYTVTTTEYWSQSF
FT                   ATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYASTTTVTAPPGGTDTVIIREPPN
FT                   YTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPP
FT                   GGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWS
FT                   QSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIRE
FT                   PPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVT
FT                   GPPGGTDTVIIREPPNYTVTTTKYWSQSYATTTTVTGPPGGTDTVIIREPPNPTVTTTE
FT                   YWSESYATTTTITAPPGGTNSVRIREPPNFTVTTTEYWSQSYASTTTVTGPPGGTDTVI
FT                   IKEPPNYTVTTTEYWSQSYASTSTVTAPPGGTETVIIKEPPNPTITTTEFWSQSYDTTT
FT                   TITAPPGGTNSVIIRIRSSPSDESSESTFSILSVPSFSASISIVSSFSRPHYVNTTVTN
FT                   LPSSQSSSVNILSSDEITFTNDDRFTSSIVFESGETSVAISTTFCDDEHGCQSSATQGS
FT                   VVRTTATTTATTTTVIGGNNGTDKPKSGELASTGSVTSKIVTPGGPSPTAPSNPGSPNN
FT                   GVPSPKSPSAETPATKNVPGSPDIPDTKSTDIARTTTIVSHTVTESGAIGVSINPNPAL
FT                   TTGTPLVGKPGSVVNPSRETGINTGSRSSTKIVTPHATGTATAAIPDTGNGATTKGHDT
FT                   TGGNSHGSAATTNTQGGNNEPGNQSPPNTGGAPVGTSSQGVDTTASQATTLSQQTTSSL
FT                   ITTPLASTFDGSGSITQHSTWLYVLLTAISLFY"
FT   CDS_pept        948392..951706
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575667"
FT                   /orf_name="CD36_64810"
FT                   /product="Spindle pole body component, putative "
FT                   /protein_id="CAX41339.1"
FT                   /db_xref="HOGENOM:HBG397621"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="UniParc:UPI000192E0EC"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB6"
FT                   /transl_table=12
FT                   /translation="MAKSILKDNQNHTVPILRGDNSNNNNSNKTDESRISINLNQNNNN
FT                   NNNNNRRVSFAREVTLHKIDYVENPNNKRRKTDIGITYQDYGESSGNDLNSENYHHNNN
FT                   DNNNGMNNINEQDEHEEEEEEHEQEQGDDTYGEKMLVDSSDEDEQEEEDHVIDVNNNDR
FT                   RDHEEQTMELTSVGVPEYIPPVIDDGKASTDQQYHRVVVVEEEEEEEEEDMELTEGMPR
FT                   KIEYSSPKETNVDDQNNDDEDITMDVTNVLSHIRQSANQNQNSVQDNAHSENKDPQNVD
FT                   DTQPMELTQTFENITRSSIEKPVLQEVIEEQELEGGIEQHGSENKPEVKEQVIDDVVNT
FT                   EPEEENELDHQIIDNDNREENKPSNISSNDFSEHMDLTIVDYKKIDYNGPIPEIPRGDG
FT                   FDNGELSFAMDLTEIQSFVCPRNDKENQDDNETGIDEVDANAIAIAQEIQPNEEGKIRE
FT                   NEITENDAMELTQTIPMKILDSNEDTNSISQPLEESIPTSNNLPDESLSQPMELTQIDS
FT                   KITTGKESDLGEVSQPMDLTQTTSNISHDDEINTSGIEERVTTTTIPLAEITQDDINEE
FT                   DEREEGKTEPQEEKEESSEEDDEDDSFDEDDPNYIPVSLSKFLSDIRVQFYDDLELDLN
FT                   SIPRLSITNSIELTPSLHDYIKAKPNLELLELYEFCCHELNKKIIQGRELYNEYEKTVI
FT                   INNPILFKKYYSMDDKTKLLINLKIQLIRDFARLKSKKTWYDWRNQLIENLIDKLNEEI
FT                   NSLINDKQLLIEDINRLNELYDKCRIYLNILNNKFNELIRLKNEIKRIPPIELNKLQLD
FT                   VAKRKQDIVEINKEIEIKLLQLSTIKKNLHDSNEKKSLLQIQLNNLQNEFNQIRKYDNL
FT                   EIKLILRKYQFLQNLTNLKYLKTTQKEQQQQEQEQEQEDRGHKISFLFDDSIICQFDFI
FT                   NNKIMYTMEQNNFKNKSSLIGVFDQIIIDGEKQQELNIIDKFQLFCRNWHWLKKLDSDL
FT                   YYVSLKFPIELKFVHNNEKEEEKEKEGKKYLEFTIKYYNFKYDYKLLICGEIDINNFVN
FT                   NQSNVNPKNIEFTGRIIHQRGEINNNNNNKSFREQISNDLKVFDKQILNNLIIVNK"
FT   CDS_pept        complement(951798..953324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383104"
FT                   /orf_name="CD36_64820"
FT                   /product="Vacuolar amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41340.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG332582"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000192E0ED"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB7"
FT                   /transl_table=12
FT                   /translation="MGRATIRSGSINLLNTIIGAGILAMPYGLKNNGLLFGCILIIWSS
FT                   LTSSMGLYLQNKVAKYTDQRDSVSYFSLSQLTYPNLSILFDSAISIKCFGVGVSYLVVI
FT                   GDLMPKIVESIGGENVPLDSILMARNFWITIFMIIIVTPLSYLKKLDSLKYTSILALFS
FT                   VGYLICLVVAHYFSTTPTFAPSSDIVYHYIGPISLKSTLSSFPIFVFAYTCHQNMFAII
FT                   NELKPNDTDGSQTRQSNLIIRNSISIACLSYLIVGVFGYLTFGNSVNANIITMYSPNSI
FT                   SSLIGRLCIVIMVSLSFPLQCHPCRGSINHVIYFCTHGVQQSKFRTATATATATATGGS
FT                   NNNNNNNRDQHGYTSLSSDIESLQSIGNDTTIGDGNDANESFISTTPVEGAQDTDGHDP
FT                   IIVPMTTKKFYIITTVIVILSYLVAISVTSLAHVLAFVGSTGSTSISFILPGLFGYLLI
FT                   KPESESESEPHGSLNNLEKFCKYGGLFLAIWGVLVMIVCLSATIFLGATH"
FT   mobile_element  complement(953643..953852)
FT                   /mobile_element_type="retrotransposon:solo LTR, eta I,
FT                   truncated"
FT   CDS_pept        complement(954511..956328)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575668"
FT                   /orf_name="CD36_64830"
FT                   /product="De-ubiquitination complex subunit, putative "
FT                   /function="nucleic acid binding"
FT                   /function="peptidase activity"
FT                   /biological_process="transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41341.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG397612"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI000192E0EE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB8"
FT                   /transl_table=12
FT                   /translation="MTTATTTTTNANANTNQPQPADKSSSTPSATPSATPSATATATPT
FT                   PTVTPKPAPTPVQLSQDRASNIGWFFIKSYYDFFISKLDEIHKIYHPQASINHDAFPGS
FT                   NIDKSEIDASNDSAKDVPIAYKAKGTDAIKETFSKYLSMRKNNRIVITSACFEVSLEKN
FT                   IIIVVFGEWSSNDEPYKQFTQTFVLVPGKTDNTYDVANDILKFVSVNGYKEKHEQKKEQ
FT                   EVKASPQTAVNGGSGSSNNSTATTKKPAVPATESQPTNKATVESTQPASGLKVEPSKKE
FT                   DVKVANGVKEEGKREEPERTQPTKSDVKVEKGEENQEQEPIINKELKKEDSTKDQSNEA
FT                   AVIATQTSKPATTKNEESKEEKTTATKEEAKQSVVKKAQEPTKPAAPPQQPLTWAALAQ
FT                   QAVPIKQTTKSTGSSSTVAKPVSTSSATTKKSVAGSVSTGSVNNSTASSGQHGSNGGKF
FT                   RKEDWYPIYIRGIRSLDEKELKDHLSRKFGELKFFKVNQNIALVDFVHQEAQRKALDTK
FT                   ETTLDGVTFALEPRESKTGNNFHNNSSSNNNNNGAGGSGNSGGYRKFGGSGGQSKEGGS
FT                   GGAKNKDKFDNKKINGSGNKKNLNKALSK"
FT   CDS_pept        complement(957208..957882)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575669"
FT                   /orf_name="CD36_64840"
FT                   /product="Ubiquitin-conjugating enzyme, putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAX41342.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015368"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000192E0EF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJB9"
FT                   /transl_table=12
FT                   /translation="MSRVKRIAKELEECRQDTQSGVSLNLNNENDLTHLTGYFKGPPGT
FT                   PYEGGLFQVAIDIPQEYPFKPPQMKFITKIYHPNISSVTGAICLDILKDAWTPILTLKS
FT                   SLISLQSLLQSPEPSDPQDAEVAKHYLSNKSGFEETAAYWTKIYASDGADGGSNNGGAK
FT                   LSDSALYGIDDEIVSQYESMGFPRDKTIEVLRRMGIKSFKGVGNKSELENKILEELLRE
FT                   CQ"
FT   CDS_pept        complement(958274..964210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383105"
FT                   /orf_name="CD36_64860"
FT                   /product="Subunit of the CCR4-NOT transcriptional complex,
FT                   putative"
FT                   /protein_id="CAX41343.1"
FT                   /db_xref="HOGENOM:HBG397613"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="UniParc:UPI000192E141"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC0"
FT                   /transl_table=12
FT                   /translation="MSFKELLIEIGPENLLPEKLLPSLLQIKPNEIDQGIALILAEILI
FT                   PGSQGLSQGLTFASSLPGSNAKGAQLQACFKSIESSGKFNVNWYEVFNHVHQYLFDSSQ
FT                   RDIQPSVGSITQFLSSLDFKQEPIDIFLNYEWWFNKTLLYILHSSDASQGGYDISLSPN
FT                   LAYCFEEDKNTPQTRRNILKFINVGKLEIQVITKIQQQQQQQHQLSEQDKKLNTFLNQL
FT                   FEHDYRVFPEYILAAALTVVEKSQFINDLIDTLFYLLVDSASPSLPKVVRLLKESGLAA
FT                   VKLADYYKSRKTIAAADKVLTLASSFELTQEILDIFWAFDSKIAIKLLVESSLFGYDYK
FT                   SVIESKLKDPQAKTSIYQALCEALDERAQKDYERGQQVQQAQQLQQQQALPPHQVLKIP
FT                   TVYYLLEKIKSSNGVIDAKTLRNLQLLLLTTYPRLINFGNGHDEAILANEEKSPFFPPT
FT                   VEMEMKAYYSKMYNKELEIKEIVDMLTQMKASDDLHSQDVFACMIHSLLDEYKFFSEYP
FT                   LSALASTSLLFGALLEKDLIQGTTLTVALNFIWESCNQPQDSHLFKFAVQSLYNFKSRL
FT                   HEYPIYCKHLLECRSLSAHAKMYQIVKDAANGIPCATGAAPTQTNTPEVGPKYQSINYV
FT                   DRTIGYATQEGPPESIRDKLLFSVNNMTGENLRLSEIQEVLTESYFAWFSDYLVSDRAK
FT                   AEPNNHELYSTLVKSLGNPIFFEYILNVSLKEVDHIIRNFKDSRSERNQLKNLGAWLGR
FT                   ITLANDKPLRRDYIALKFLLVEAYDFNSLPLILPFVCKILDQAQYSKVFKPPNPWVVGV
FT                   MKVLSELYECADLKLQLKFEIEVLLNSFNMKIKDIEQSTIIRNHNPEPAALARMFGISS
FT                   QSVNLANEMTKLSLEGSQLANNMQAPFPQQIIESKQFPGISQPQMQNVLQQQQNLPPQQ
FT                   QLQGQLPPQQQAEPALDTSFSTLIGNSIFTQHANLRRAFQASLSRAVRECTPHICNKVV
FT                   ETVVTTTKALITKDFATERDVEKLRNSYHKLALSLSHAMVSCNGRKALVETIEATMLQL
FT                   LGNNPNEVPLAELNNAIQANVGLCVDIVDVLVGESILDLIEARMQTEVFLREHHNATVP
FT                   NEPFIEEGASEYSLRLPNPLGLAPTGLSTQQLKIYEHFGETRVDQIVPPPGSAAITQQQ
FT                   PQSLAPLQQQSQAPAGVGVGAVAPPPQQQKERVVAQAQGVPDDIVSFEQLFAAITANCD
FT                   KAVQLVSEVTETKLADLPPNHSIMAALTQALVIAQSNAIKYPELLLKAAQYAVNCLFTQ
FT                   AHENPMSNEIYVVILDKLCEYSPSTAKDVIWWLVHSSDQRKFNMPVMLSLLKVQLIQPI
FT                   KLDLSIGKLIKETNNPVVVKFAASLLTNIFTSEDMRPIALRSEFANTLDALSKYQGNDQ
FT                   SDEHRQAKEATSTLFKLLNEAAPASNQLFAQLGYIFAEWVRLLTHGDEATHELQIEFVK
FT                   GLIQAGILNNPEYVKTFFKAAIEISITSFATEHELRSRTQHETYLAVDTLAMLIVRIVL
FT                   LIEDSKQAIDYLKKVLGIIILNLINDHETSKANWNERAYFRFFSSLLSTWCDASVLDEE
FT                   ATVNLDVEFYNYLGELFNALQPIVIPGFTFAWISLISHRMYLPKLLELPERKGYSTLVK
FT                   LLSSALKFQQVYGNKQSSRQHEHEHEQEQEHEQKDEKEKQENSQQGPDVINVTYKAINR
FT                   IFIGILHDFPEFLVECHYQLVTNIPRGYIQLRNIVLSATPKDIHVPDPFTQGLKVERLP
FT                   EINESPVVFYKPIEDLSKVGLKKPVENFLRIPAPGLMRTIYNGLKLNQPKEVNDLGYEE
FT                   TIHFNIKLINALVLHVGISSVADRLPNNRGFNTKSSQVALLVDLMNYGNTEFKYHLINA
FT                   IANQLRYPNSHTHWFIGIILHFFSNNNIWNSNSNKLVVQEIITRVLLERRISNKPHPWG
FT                   LTILFTELVKNGDYGFFELPFVKDSVEEVKNIFNVLSVNVKGSTP"
FT   CDS_pept        965837..966520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000041378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575670"
FT                   /orf_name="CD36_64880"
FT                   /product="DnaJ-like protein, putative "
FT                   /protein_id="CAX41344.1"
FT                   /db_xref="HOGENOM:HBG591261"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniParc:UPI000192E142"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC1"
FT                   /transl_table=12
FT                   /translation="MVYYFTAKVTAKDDELADFAIDDSQADEATIYMGRDKVENDPLIK
FT                   HSHPKNIWFHVDKLSSAHVYLQLTKDQIKSFKSFASFQIEEDLLNQLGQLTKANSIKGN
FT                   KLNNVSIIYTPVENLHTDGSMDIGTVTFKNNKLVKRFNVVKKENAIINKLNKTKREIPT
FT                   DEFISKQNELIKEIANERKQEEKEAKELSKQYEYQKKQNADPYADLFASESTSKSTNWS
FT                   EDSFW"
FT   CDS_pept        complement(966897..967148)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383106"
FT                   /orf_name="CD36_64885"
FT                   /product="Cytochrome c oxidase polypeptide VIb, putative "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAX41345.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG330644"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="UniParc:UPI000192E143"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC2"
FT                   /transl_table=12
FT                   /translation="MPVDPATFKFDTPQFDPRFPNQNQSKHCAQAYVDYHKCVNVKGEE
FT                   FEPCKIFFKTFTSLCPLDWVEKWDDQRAAGKFPVNMDA"
FT   CDS_pept        complement(967601..968104)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575671"
FT                   /orf_name="CD36_64890"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAX41346.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG397614"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="UniParc:UPI000192E144"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC3"
FT                   /transl_table=12
FT                   /translation="MVQSTLKSDYNKQSNSVFNELSKQLTEKEDITVFKITKNDSIRSK
FT                   VDAILKSIEQDKLIFLSGSSNSIAKLICITEIVKQKQNGQQDPSEKLDQYNKLLHIDST
FT                   VNPNYKPISEKENEQTDRNQLEKEALQEIKGPKIYTLPVLYILIGKHSIMSNIELVSWT
FT                   KQDK"
FT   CDS_pept        complement(968511..970055)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383107"
FT                   /orf_name="CD36_64900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41347.1"
FT                   /db_xref="UniParc:UPI000192E145"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC4"
FT                   /transl_table=12
FT                   /translation="MNNLAIQEYFELALVFIQCVYHYLQQQQQQQQQQPKKKDEDEANP
FT                   ERNIAINSILDSISSRLFAIHFQSTIYQRIPLFVIYTIESNEGSPYDETRLSPTISTNS
FT                   LTSTASTSSTTSLTSRMTSDEPPPAPTLPRLLLPSSHSTSELDLSDPLPLPSPSVSASV
FT                   SPMLSPSLTTSPPPSPPQSPPSIPMQFPLPLPLPLPRPEPEPEPAQLQLPAIAPPPPPL
FT                   LVETESPIPTQLRNEIVPLHNIDQSSSSDTESVVGVKELKELIKGREVLTFGPDGYSQS
FT                   INDEILPQMTSSTPSSTSFTRLTKLLDTEGNEYLLHSNGFVTPIIKNHDLNTMEINSVM
FT                   ANYNNNTNNGYSYNNRSTVLPTNAAGLSTTIPPSTTTATTNTNSSAMANGATNTFLSLI
FT                   NNNNNNTNNDNRKRRRLNQSPYRNLTTRNSRAPNNDRLKEFQTQILELTQFYGDLDLGT
FT                   NNRFGAVDSTTIIIGTISRSNSSKSSFRSSLRTSLCKDDSSQSSNSPASFNVHKNR"
FT   CDS_pept        971467..972756
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230226"
FT                   /orf_name="CD36_64910"
FT                   /product="Alanine-glyoxylate aminotransferase, putative "
FT                   /EC_number="2.6.1.44"
FT                   /function="alanine-glyoxylate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAX41348.1"
FT                   /db_xref="GO:0008453"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG700056"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI000192E146"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC5"
FT                   /transl_table=12
FT                   /translation="MFKTLTTSKVINKFNYKLFKPTTLTNFKSISTTTTNLFNINNNSN
FT                   NSSKMSFQYKQPEHKLTMIPGPIEFSDDVLASMATPSQAHTSPEFISTFQSVLKNLRKL
FT                   FKSTDANTQGYVLSGSGTLGWDVASSNLLNPGEKVLVLSTGFFSDSFAECLKVYGADVD
FT                   VLTAEVGDVVPFDKIEEQLQKEKYSAITITHVDTSTSVVSDVEAISKVVKKVSPDTLII
FT                   VDGVCSIAVEDLEFDKWGIDFALTASQKAIGVPAGLSIFYASERALAKALNKEKESTFF
FT                   ASLKRWTPIMKAYESGNGAYFATPAVQTITALKTSLDEILSQPIDERFAKHAQVSDKFK
FT                   SSVEKLGLKILPVDHKVAAHGLTAVYFPDGVNGPDLLKKLSEKGFVVAGGIHKKLVGKY
FT                   FRVGHMGYSVYAGHVDKLTKALEESLNELK"
FT   CDS_pept        973403..975607
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19383108"
FT                   /orf_name="CD36_64920"
FT                   /product="Mitochondrial ABC iron-sulfur cluster
FT                   transporter, putative"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41349.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000192E147"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC6"
FT                   /transl_table=12
FT                   /translation="MFIRNVKLIKLAPVRLASPLVSGSSLSSSIKIPSIRYFTHQSHSN
FT                   FRSSSSLLSASISPKSSPKAPSYVKPPRHDNDSSSSSNSSESFMLKSLFKTIWPKNNLN
FT                   FKIRVIIALSLLVGAKVLNVQVPFYFKQIIDTMNIDWTNEVGIFSTVIGSLILAYGGAR
FT                   FGAVLFGELRNAIFASVAQSAIRRVAYNTFVKLLNMDLQFHLSRQTGGLTRAIDRGTKG
FT                   ISYVLSAMVFHIIPITLEISIVCGILTYNYGASFAAMTFATMLAYSIFTIQTTAWRTKF
FT                   RRQANNADNQAANVALDSLINYESVKIFNNELYQASKYDKALMKYQQSSVKIATSLAFL
FT                   NSGQNFIFTSALTAMMYLGCQGVYTGELTVGDLVLINQLVFQLSVPLNFLGSVYRELKQ
FT                   SLLDMENLFQLQNQPIRIKEIPNAPPLRLNNNQSLSSPGEIRFENVSFGYHPDRPILNN
FT                   ATFTIPAGQKVAIVGPSGSGKSTILRLIFRFYDIDQGRILIDGQDISKVSLESLRKLIG
FT                   IVPQETPLFNDTILENIRYGRLDASDEEIHRVINQVQLNKLIDDLPDGVQTIVGERGMM
FT                   ISGGEKQRLAMARLLLKRAPITFFDEATSALDTHTEQALLKTIRSIFKQQHQTNVSIAH
FT                   RLRTIADADKIIVLNKGKVVEEGTHWQLLNEQPNSLYAQLWNIQENLDIEKELLQREEE
FT                   EIDEEEAEKLKLIHEKQELVQEAKLFSSQDSEKKKKKERQ"
FT   CDS_pept        978388..979362
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230227"
FT                   /orf_name="CD36_64940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41350.1"
FT                   /db_xref="HOGENOM:HBG397615"
FT                   /db_xref="UniParc:UPI000192E148"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC7"
FT                   /transl_table=12
FT                   /translation="MSFYNTNTNSSPSFHQQQQLSGHSLSTMKRNNTFKSKLKSLKNEL
FT                   HEAIISTATTTKPLSPWSRPPTRSNSTSSFRSPFSSIKLSNGNTTGQSSVFSSCESSPR
FT                   SISLSSTKNGSTIGTTDVFPVSRSTSVSLPISKFKSPTTIISTVTNSATSTTTTCSPCS
FT                   ISYSSLDYDYDYDNLFDFNSPTSSYDPSLKNERLANKNEGSGQEEKFLLPPLPSSTTTL
FT                   TPVLSSSPGKFSHDQMMINGQVDAEEMEKQEFSSSLPTTPSNNSQKYQNSSFSQQLSSH
FT                   ENNQHQQNNNPKSEELVDVDRLACSILSSVGKRTNDQNIEWNI"
FT   CDS_pept        complement(979714..982536)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383109"
FT                   /orf_name="CD36_64950"
FT                   /product="Translation machinery associated protein,
FT                   putative"
FT                   /EC_number="3.4.11.-"
FT                   /function="aminopeptidase activity"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAX41351.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397616"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI000192E149"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC8"
FT                   /transl_table=12
FT                   /translation="MSDTSIPLSISNEYVPIEYHYKLDINHQKPNFNGVAIITIGKNDQ
FT                   QTSHVDKQSEEKPFSITLHANKLVLTSAIIGDKKLSIKYDKLQQRVTFSSPQTYSQLTT
FT                   DNCLVMEVKYMGQIKTINTYKDETQGLFKTNFLDNDSGKSDNYILTTHFQPMGAKQVFP
FT                   IIDELTHKPMIKLDLKTLKKFQVFCNGDENDVVFNDDDEWKTSKFVYSKPIHPAIMGFS
FT                   VGDFTWQSSKTVKTNNIEDSVRVYAPSGEISKTNVALRIIEKYLPKLEAVFGKYPLNHI
FT                   YFVAIPFLKDGVMENWSMINVIAPNLLIDENYSNNQDETQLTELIVHELVHQWIGNWVS
FT                   FDSWSCLWFNEAFATWTARKIIGANTTHSNDEMLSRDCFYDDGDFKIGSIFQYMERNQS
FT                   PGLNATTESIFSTNIYEKGIILLNMIDGIFEAESKDFLREFATKIIEEYQSKSIKIFDI
FT                   WQKLNDDISIDLPSFVYSWTRSKGYPLLRVTHQETGNNPSKKKIAIEQHTYFHNMTTKE
FT                   AAIEDTPYHIPLFIKAKTTDGNENNKKTKLINLMMTDRSIELDIDHQLININTGYKGYY
FT                   RVLYDHFDVDNLSLMDPKDIIMIISDLGTVMGTPNSNSNDLINFISLMGDLLKSKEFNW
FT                   EIWECALSYLEPIIDILRHFSEFDKFNNQWLSKFTGDLFNAIKWDNNSLDKISRNQYNS
FT                   LEWKVRSSILQLNINNTSSTGEAAYKAAHKYYQNFMNSGINKKFTPKEILPAVFNVTMS
FT                   KASMKEYKKVLELVKNANVSLLKQTNASQQDLQTLSLTSLSFVYGSGADVELVNKTLNF
FT                   VNNNIDSKLIELGLIGFTFTNNQRVIDLVFHWFKLNYDNWIMRSLRKGSDWSKQIGITT
FT                   QNIMKMIIMKMMSNNEENKLRLNEFIQLKLKTLPNHGLKELVDDWHLENEESVRIGSFY
FT                   NDLCDHICLK"
FT   CDS_pept        983399..986152
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535872"
FT                   /orf_name="CD36_64960"
FT                   /product="Exocyst complex component, putative "
FT                   /protein_id="CAX41352.1"
FT                   /db_xref="HOGENOM:HBG398618"
FT                   /db_xref="UniParc:UPI000192E14A"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJC9"
FT                   /transl_table=12
FT                   /translation="MFDLNASDEELKSKYGLRSMHPTEVGDVTYFDTAIPEDLSDLTPQ
FT                   QQYELLIKLVDLNQPLSKNKPDSNILLDLILRQDSSKAVRSSNKSLSQFENQAHKYNED
FT                   LKRIIESNSVHFVNTKWKIDNAMIDFMKSKTKAQQDRASARVFNPQRRSLTNKEGLTAE
FT                   LEDNINSLQANTSSMIQPIIESKAKEDKVVKMIEFTKANQNFFDLPNSLVHSLSLNNNE
FT                   KFIDDYNRYIHERDRFLTVLNNRYRDQVLKLTHDNVNGKNHQALRTLEDDRKLQLTLIS
FT                   KVFKEIDTIAHNYRNKIYQEFLSLDHVASKTQSTSKFMSLVDNLSRLNLDDKMKNPIAD
FT                   FLTKQIEAIDKDFEYQVEKFDSKFLLMQNKLIDYIGSLNPERREGSHINYINEKYDTYK
FT                   DEINSATQNGDKLMIIKEAFESNDSLDLSLINEAWLVLFNFINYLDNMVLSNLLKFLNN
FT                   YVHYIKLGIDASGKIRDTAIELINKVVLIMMALFDDENNEKNQVESSPKNYKQFVPYYT
FT                   NSLSTIYHLTKINSIVNKIINSFGNFVGTIGNISQYSETNKVMKSLKNSSTKINQKILE
FT                   AICATWVNDCSQFYELEDWTLDKQNSKYNDRCSAKCTKLMNVIQCYQSYVLLKISSLVI
FT                   HDQSSDYNVVAVYPSKRMLVSIEIQFMRSLNIIVDSMMKKYNLDRQNSQDSNINPDDSR
FT                   NLQVFKILTMNNFDKLSRIIYPELLLQFDKSFDKDLSKQNLKLFADIDKASLTIIDDIL
FT                   NIEKLYIAQTVNRFFHTAGAKGSGNPPQALKVDGFVYEILIHFVKLINKIRPLTNEEVF
FT                   VTIINELQLNLLKNIIDNTRQIPLKSSLSYVNLRLDANFILLVFEKSKLLQLNDSSYKY
FT                   LQILLNEIDNKNNDIPSNEQFKYSKNNFDEILQLNMQDSANEFSCF"
FT   CDS_pept        986520..989012
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383110"
FT                   /orf_name="CD36_64970"
FT                   /product="AdoMet-dependent rRNA methyltransferase, putative"
FT                   /EC_number="2.1.1.-"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41353.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG410779"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012920"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI000192E19C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD0"
FT                   /transl_table=12
FT                   /translation="MGKQQKKHSKGRLDRYYYLAKEKGYRARSSFKIVQINEKYGHFLE
FT                   KSKVVIDLCAAPGSWCQVASQLCPVNSLIIGVDIVPIKPLPNVITFQSDITTEDCRSRL
FT                   RGHMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLTAGGTFVTKIFRS
FT                   RDYNNLMWVFQQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDPKEVFEEL
FT                   GNEKQNNEAKIFNPEKFSSQRQRQGYEEGDYTLFHTMPIMDFIKEDDPINQLGSLNKFE
FT                   LPAKDDHEWKILSKLKLCTPELLECIKDLKVLGRKEFKMILKFRKQARDILGIDKDDED
FT                   NDKAEIEVEPLTEEQKIDQELQDLMERQKQKAKRAKKNANELKQKEIVRNQMNMLTDMN
FT                   IGIEAAQIGADSLFNLKTAEKTGQLDKLAKGKKKMIFNDEELAKDNEIHIDENEEVEDS
FT                   ADELDELENQLDDMYHQYQARKAERDANYRAKQARGDANDEAWNGIEDDDDQDEDVESG
FT                   KDYEMESESDSDSDDDEHIRLIAEKKSNGLSKTARSFFASDSIFNELGDDAILEEVQNR
FT                   TNNTNGKVVEPVTENNSEPVDDDDDSNGDDDDDDSDFEIVPNQESDDDESMDSDDESNN
FT                   VKSATHHKQKVDLATVEAMTLAHQVALGQKNKHDLIDEGINRYSFRDKDNLPDWFVDDE
FT                   KRHSKIVKPITKEAALAIKEKQKQLNARPIKKVLEAQGRKKMRALRRLEKIKKKSDLIN
FT                   EDSGKSERDKADEIQKLMKKLSKKQKQKPKTTVVVARGSNRGLSGRPKGVKGKYKMVDG
FT                   VMKNEQRALKRIAKKHKK"
FT   CDS_pept        991842..993824
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575672"
FT                   /orf_name="CD36_64990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41354.1"
FT                   /db_xref="HOGENOM:HBG397619"
FT                   /db_xref="UniParc:UPI000192E19D"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD1"
FT                   /transl_table=12
FT                   /translation="MSSLPNPNHLTPNFNRRGHRHKRSQAMSGDFDAIGLGLFNSPSHI
FT                   ATNALASSSPPPPPIFSMSDDLDKHYQFNNTEDFSNNPNQGFAFPNTTSSGRLEPYSSS
FT                   APLSSKFNQHGPSNSLNSPIRLHQKRGFQNTSHFNNNPNQPKFFLTNETTVNKDNVPEA
FT                   LIDLDDIFKANLHINDNSNSGPLSKTAHFHKRTESAPANFYYDDFLGSPFIKENAIEEE
FT                   EERLEVSFEDNEEDEEEDDDIRLHVNHGSDEALPPPSFYQSASANSSNSSLKTKTIEKT
FT                   LSNSSSSSLFATPRSGAKASRYKNIYDQSKIISNAMKISSENVSGIERTVTPPLNRNNN
FT                   SKYLNHSSSLPSLKGKRSFSHVPQLRYGDTKRVASPKTNITIDTPPTPAAGVAVSSSTG
FT                   LSSSPSSKSPDTQFILELPSASTPSTSATTLSTSSNLELKKSRNSPTSVNSEALDSNTT
FT                   SSTNSTVDTAASPSLAADITGNTTTPAIVVTNEQTQPDKDPLYINTNISSDNTTIEKSA
FT                   STITPSSGNSTPLVDACVSPTAVVFPAQEDFEKKGTGPQSPTRPQSPAETRILNETRIP
FT                   VFKRKSASKSSLTTPSLPSSSSSSTPEVGPTTSPPKPQYMNKHDFMHRSLFRRRGSNAT
FT                   DTSSVSSVSSRLKRTSRIFNWIRNK"
FT   CDS_pept        997105..1001457
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078850"
FT                   /gene_name="ALS2"
FT                   /orf_name="CD36_65010"
FT                   /product="Agglutinin-like protein, putative "
FT                   /protein_id="CAX41355.1"
FT                   /db_xref="HOGENOM:HBG397640"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniParc:UPI000192E19E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD2"
FT                   /transl_table=12
FT                   /translation="MFLRFLLLCICLSVAGAKVITGIFNSFDSLTWTNAARYPFKGPGY
FT                   PTWNAVLGWSLDGTVASPGDTFTLIMPCVFKFITNQTSVDLIADGADYATCQFHAGEEF
FT                   TTFSSLTCTVSSALNPSIKALGTVTLPISFNVGGTGSSVDLENSKCFTAGTNTVTFTDG
FT                   NNKISTTVEFNKTTVDPSGYLTSARRIPSLNQVTSLYMAPQCVNGYTSGIMGISSNSGI
FT                   DIDCSTVHVGISKGVNDWNFPVSYDSFSYKKTCSPTGISITYENIPAGYRPFIDAYISA
FT                   SGVKSYALSYANNYTCVDSSFQNKPFTIRWTGYNSSEAGSDGVVIVVTTRTVTDSTTAV
FT                   TTLPFNSDVDKTKTIEILQPIPTTTITTSYVGVTTSYRTQTVPIGQTATVIVDVPYHTT
FT                   TTVTSKWTGTITTTATRTNPTGSIDTVVVQVPSPNPTVSSTEYWSQSYGTTTTVTAPPG
FT                   GTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQ
FT                   SFATTTTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREP
FT                   PNYTVTTTEYWSQSFATTTTVTAPPGGTDTVIIREPPNPTVTTTEYWSQSYATTTTVTG
FT                   PPGGTDIVLIREPPNYTVTTTEYWSQSYATTTTVTGPPGNTDTVIIREPPNPTVTTTEY
FT                   WSESYATTTTITAPPGGTNSVRIREPPNFTVTTTEYWSQSYASTTTVTGPPGGTDTVII
FT                   KEPPNYTVTTTEYWSQSYASTSTVTAPPGGTDTVIIREPPNYTVTTTEYWSQSFATTTT
FT                   VTAPPGGTDTVIIREPPNYTVTTTEYWSQSYATTTTVTAPPGGTDTVIIREPPNPTVTT
FT                   TEYWSQSYATTTTVTGPPGGTDIVLIREPPNYTVTTTEYWSQSYATTTTVTGPPGNTDT
FT                   VIIREPPNPTVTTTEYWSESYATTTTITAPPGGTNSVRIREPPNFTVTTTEYWSQSYAS
FT                   TTTVTGPPGGTDTVIIKEPPNYTVTTTEYWSQSYASTSTVTAPPGGTETVIIKEPPNPT
FT                   ITTTEFWSQSYDTTTTITAPPGGTNSVIIRIRSSPSDESSESTFSILSVPSFSASISIV
FT                   SSFSRPHYVNTTVTNLPSSQSSSVNILSSDEITFTNDDRFTSSIVFESGETSVAISTTF
FT                   CDDEHGCQSSVTQGSVVRTTATTTATTTTVIGGNNGTDKPKSGELASTGSVTSKIVTPG
FT                   GPSPTAPLNPGSPNNGVPSPKSPSAETPATKNVPGSPDIPDTKSTDISRTTTVVSHTAT
FT                   ESGATGVPINPNPALTTGTPLVGKPGSVVNPSRETGINTGSRSSTKIVTPHATGTATAA
FT                   IPDTGNGATTKGHDTTGGNSHGSAATTNTQGGNNEPVNQSPPNTGGASVGTSSQGVDTT
FT                   ASQATTLSQQTTSSLITTPLASTFDGSGSIVQHSTWLYVLLTAISLFY"
FT   mobile_element  1002161..1002580
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon G,
FT                   partial"
FT   mobile_element  complement(1008042..1015021)
FT                   /mobile_element_type="retrotransposon:epsilon I, Tcd25,
FT                   LTR"
FT   mobile_element  complement(1008591..1009106)
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon E"
FT   CDS_pept        complement(1009566..1012178)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575673"
FT                   /orf_name="CD36_65030"
FT                   /product="Retrovirus-related Pol polyprotein from
FT                   transposon, putative"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAX41356.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI000192E19F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD3"
FT                   /transl_table=12
FT                   /translation="MEQLLMNYPLQNTYSESIESTFQLHQNPTSKINLKSLPPMTRIQM
FT                   RGLTQSSENPTPTTLNILATKATVPITKNSSKSLKSSNTTTNINRRTPPVSRSHAPKRT
FT                   EPQLNQHTSSQPSDINPEETIDIQMDDPTDNTPTSNTHDNDSINQSLQSYEPPQEEQSV
FT                   QNTSTSPTRDQPDYGIFNPPPASELNNELTPEDMPATNKAVNQSNYQVDKPLRSIRISQ
FT                   FDKSKIEQNNIMQSLIDNDLTAEMPLATLLGLVPQFRTYLSRSLQAHLVPRQGPQNAKL
FT                   INEATVTPIDIEIPIDNNLIVNHETIPTSTNSTSADHQELTKQTIKDNVVIQLMDPNNN
FT                   GPNTYNIAELATSFSITDSDISCASVYIPAIINNSAISLKYDTAAECSIISPITVDKLK
FT                   LPTKSIKANLQGFGSPLMKCNSMAIITANIFGKDINFKTLIHSSIQPNVIILGRPVQAQ
FT                   YFMTLGYNPATLDLELSFQYDNQFFTEIIEKSTTSKITIHNMTVDSTKLTEEQSQQLIT
FT                   AMATSILSPQDQKYFMDKVQHIPDVFYIKGTTPGRIKSHISEPIDFPIKNHDIWQCKSI
FT                   PFGNKRLAAIKILKQMLEDNQLDHSNCPYRNPIFLIPKKNKKDYRLLIDLRELNKHIVP
FT                   AAAHPPATDELINEIAQSAFNSYLDISNAFFQVGISKEAAKYTAFQTPLGLLEYRVLPQ
FT                   GFSNSVAIFSNLLTKILKPVAEKVLIFVDDVAILGPQIDIYASASETYQSALVKENIDN
FT                   VLEVLQLLKDAGLKINANKLTLAVTQATFLGYEIKPGSRTLIHDKIKTIQDMPLPTTVK
FT                   ALQRAIGLFNYYSNLIPAFSVIATELYELLKTQPKPPLTQHQPNQSQKMSTTPKSSIS"
FT   CDS_pept        complement(1012021..1014057)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18535873"
FT                   /orf_name="CD36_65060"
FT                   /product="Unidentified retrotransposon protein, putative "
FT                   /protein_id="CAX41357.2"
FT                   /db_xref="HOGENOM:HBG398463"
FT                   /db_xref="UniParc:UPI000192E1A0"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD4"
FT                   /transl_table=12
FT                   /translation="MSKNSESNASNDAQGENNPLSPINPITTLGQDNPTTVQDDDPTMV
FT                   GNTLNLTQTDQQVNELLSQRLPKMMADQFGPMVNEQLHPMMDKLFEAHLPKYISTIENH
FT                   VKAMYFDTATTRIIDTLKPFIQETVNQAVRPRFPGSFSEPANVLSNKNNISASPPPTQT
FT                   NNPGSQPNADLENPTNEALDHPESIAADTIPIQSPQDVGASANYQQDSNGKESVNSTMP
FT                   HPPSSVPSIDTTNPLKSPTHINSPNPSHQSTYSMVNSMNTHVTSQPSTDQLVNNSPPFG
FT                   SAKFFEVRKRISAIDAECQDLKVKITDINIIEKKLPYIYNPSLSKESLFIERLDLIESI
FT                   PEIERTKEEKESLKKSNHKEYPTTTSIKTTHDTLLYVKELLFYKAKYSIPDKLLKSAFV
FT                   LACNNPKDNDLKRACDLAIIPHNTNPNFNGINYGIIIDLLYDTEPAIVAESVLDSVNNY
FT                   LQNEKNAIMLVAQIDFAITSNINNITPSIWYQIYCSLWNKQKPLMTNLTKTIDNPKVSA
FT                   TLESIQFYKSSAITSNPEFQKIDFHEVWKIVSEQLRHIAKYHSDTTSSSTPQSNNQKAT
FT                   NSNDKNPNTKGKSPCTCCGKRNHSAQACFTLKQLIKNEKVKFSDNIIYKMNGTTPYELS
FT                   PSEYLLRKYRTDFPAPPKSNTENKPKESTSNDSNSNARPHSTV"
FT   mobile_element  1014499..1014876
FT                   /mobile_element_type="retrotransposon:solo LTR, san F"
FT   CDS_pept        complement(1015428..1015904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575674"
FT                   /orf_name="CD36_65070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41358.1"
FT                   /db_xref="UniParc:UPI000192E1A1"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD5"
FT                   /transl_table=12
FT                   /translation="MKLSLLLFTVFQIASASQIINLDIHLKDDCNSNCYQLANQIEDCG
FT                   YSDESVSNQDLYKCLCDKNEFWTSWEKCDCVPTKKNTFSSAVCEVAEISSLPTDEQRSA
FT                   ILGFGDSAASATESASTTSSDSHSSSKPKSSTAGGVYLKTFGIGSAFALALNLI"
FT   CDS_pept        complement(1016596..1017669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230228"
FT                   /orf_name="CD36_65100"
FT                   /product="Zinc-binding dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAX41359.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG447528"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000192E1A2"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD6"
FT                   /transl_table=12
FT                   /translation="MKAAVVSNPVEPTKLTEVKEIPKPKIQDNEILVKAKAYAINPTDW
FT                   KHIVFKMSKPGDVAGSDASGIVEEVGSQVTTFKKGDNVSSLVIGNVSPDNGAFAEYFVA
FT                   KPQATIKYDHDLVSSSDPKSSTIDSFEGAASVTIGLCTVGISFSHYLNIAQHKKEGDSI
FT                   LIWGGATATGILAIQVAKLVYNLNVITTASPKNHEYLKELGADYTLDYNDADVVSKLQS
FT                   LGHIKFGLDTIGNQETFQKLYDATTGTPEVFLDSLSLIDGNSIKTNPERKVHWGYTLGY
FT                   LVVQKEKVLGTKKLVQTPELVHDFNAWWGNVLPTIINKVKHANLKILDGGLASANEGLQ
FT                   LSRDNKVSGQKIVFRAA"
FT   CDS_pept        1018190..1018546
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575675"
FT                   /orf_name="CD36_65120"
FT                   /product="CipC-like antibiotic response protein, putative "
FT                   /protein_id="CAX41360.1"
FT                   /db_xref="HOGENOM:HBG397034"
FT                   /db_xref="InterPro:IPR022234"
FT                   /db_xref="UniParc:UPI000192E1A3"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD7"
FT                   /transl_table=12
FT                   /translation="MFGIFEENYDSVYNGKHEAKFSHEAVAGAASFAAVKLFEDRQRRE
FT                   GKPVSHAFAKEALAAIAGGEVDKLFETKGLDYLDRERLRDQAINNAQRGYDDHYGQHEE
FT                   WSPEHRPPFDYQRY"
FT   CDS_pept        1018712..1019890
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575676"
FT                   /orf_name="CD36_65140"
FT                   /product="MAP-kinase scaffold protein, putative "
FT                   /function="kinase activity"
FT                   /protein_id="CAX41361.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniParc:UPI000192E1A4"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD8"
FT                   /transl_table=12
FT                   /translation="MYHQPMLQSTPKSWKGLLKSNQSPKKPTTPTTPPSNATITPNTTP
FT                   PSATCVSPRPEKIPSRHPLQTINPGLNLSFANILNKSLANHETCFICGELLSSVFESER
FT                   ILKLNCGDSTHCECFKAYFKEDIPQAKNHGKTITFAKSCRGLNCNNTRNVVIDANNWYL
FT                   VSARKLSLIPKRPAPPHPNSANIDALRTTLQNNDIPTRSPSPDPTVSTTITEVDTFDVE
FT                   TVRNNLIKHLLDSCTKISLSRLVSLGNLRVADELSVCVEPSDYFQTRYVYLFENYMVIW
FT                   NKTDYPVFVPMKNIQLSSRGSSILQVRQKDDSLSTLLQSTSSSIVEKWVVAISDAHLQL
FT                   PARAITSTIDTTPTDSDSDIDSDEEVIQQALTKNNWTDLMIEIDNALLTSDQ"
FT   CDS_pept        complement(1019874..1022390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078851"
FT                   /orf_name="CD36_65160"
FT                   /product="Sporulation-specific protein, putative "
FT                   /protein_id="CAX41362.1"
FT                   /db_xref="HOGENOM:HBG448652"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000192E1A5"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJD9"
FT                   /transl_table=12
FT                   /translation="MKGIEWCSLVKRKFFFFFPFFFFVDLYQHSCMSTGEHRFTIPRSS
FT                   YIASLLTVFGPDVLSNYGKGVFVGGYPDIWHNDKPDLITELLKGKDTNKQVLQYNKNED
FT                   LFFKKRDAIIKELRSDTTTIDNISEVSTIPVSLPKIKFEMPHPETKVNIDEEWIEEENK
FT                   RFRKRLKKFAKKSTGGAIRASRTKIKASIFKSYEAGEIIRIDKVLVLVMKPADSGRVSE
FT                   RWREYIAVLRKTESVEEPLMLQFYDIDKSPEESHPRIGFRLNVQVKADFYSYLDKTISL
FT                   TVLNKVQYILRLNNQTNALRWLYFIKDTLGVGAETNLFNMYVPKLGYFIEVEVPEHVFV
FT                   NHFKNNQNIVVRKHDAGLEIECDEISQYLKQFLPKSLSRGWFCFRKYDRLEWAGSTGEH
FT                   LFIQNMLFSSTHQLEYREYEVPDVPPKPIEGFLGRLTNVSGKEKSVLRDFHKISYVYTN
FT                   RNLLFFTKYYRAVPPQGGDSLVNEVDLFGDIEWLESDFDGGNKIIVDDIERRTDMIVKA
FT                   EGMVDMVDICEVKISNSSQTQNLVHCALWYSKPELVNEEEIIDSCFEIRLRWGAIIKFQ
FT                   APNRAVRDIWIASLNEMCMYWRKRQMETLANHIQVSANNAQRLQATKYADSNASDEINF
FT                   LESQRARACTTNIPHLLPNILVIKSGYLYEKNKKHASFNHFYVVLCPGCLIIYHTFKRS
FT                   KGTGTRKSTAFYEHYITIPLLQCYLYTGKLTELDLLNSETRATQVDTHSVPRVYPDGWK
FT                   SMEEDCALCFTLWFGKKRNISHFEKQLPKSFEVGVQNEKNPGMVTMIRKLGITGKSIMF
FT                   TANSRQEKDQWTMCILNEMDRLTGQM"
FT   CDS_pept        1022366..1023556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000087628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575677"
FT                   /orf_name="CD36_65180"
FT                   /product="GTP-binding protein/GTPase, putative "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAX41363.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG586249"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="UniParc:UPI000192E1FD"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE0"
FT                   /transl_table=12
FT                   /translation="MNTIRYLSYTTRLLAKSTSTPKFLGRASNNLSVGLVGLANVGKST
FT                   FFQALTKSTLGNPANYPFATIEPEKSIVLVPSEKLTHYAKLYQSQKTVPTNLTIWDIAG
FT                   LVRNASSGAGLGNKFLNDIRQVDGILQIVRGFVNDEIVHIEDNKVDPVRDLVIVNDELI
FT                   LKDLEIIESEIERVNKMKNKPGIGGSYEINLQTLDKLSTLLYEGMKVVNGDWSDEEIDV
FT                   INGLNLLTAKPTVYLLNVSKEDYETGNNQFYKEVNEWIVANSPNDKLIMFSAEYETVLN
FT                   NTEESLSKGSAIGTVVEEMRSVLSLISFFTCGEMEARQWTIRKGSTAPEAAGLIHTDLQ
FT                   KTFINSIVYKWDDLKELDTFDESKLKSQGKQHKCGKKYIVEEGDVLVIKAGSGKAR"
FT   tRNA            1023747..1023864
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        complement(1023928..1026255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383111"
FT                   /orf_name="CD36_65200"
FT                   /product="RING-domain E3 ubiquitin ligase, putative "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41364.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG397565"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000192E1FE"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE1"
FT                   /transl_table=12
FT                   /translation="MAIDRQTLVFFIIMFIFLSLPSGNEQPHSDKDRETLQTYQHSVRN
FT                   SSSILHNSTYESGYGNITGYQLSYEDKLQGKSVIDWPIHKFSPSHPWVENQKYSILPDE
FT                   VSQRVRKFWGISPVKDKAYLLNISGRADGEFQLIESKVKPTKLSIPKYLKEYYKSRENS
FT                   FTSDEPAEDNREYFKKPIDRKGNVTTDEGVVSIAIKGSQYNFDDPKLSRFVSPQDRVGN
FT                   AICVSMDLDIKDYPEIEDHSLVLNGVYFQDTGSLIGVTNSAKFYGNYGLSHLTMSNKNF
FT                   EIAKKLMTQFSNMTNDNELTMDDLNYGIVKAHEQCEYIAFIQFAKTNFTHERLREIDEE
FT                   LKTPTGRPLPHEIPKIVIEEYLLYSPDCGKVLSSKPGSVFSGKKTEVTRAQMRNVLTGI
FT                   LALVGLQLFLVLRQIKNAQTPGQLSLISSKTLFLLGYQDSLVAIMTLLLSTITVELYLI
FT                   LACIATIAFISCGVFEMRFMVSVLTTQANERGTSWWEILRGANAERERQVPDEGPILPI
FT                   ANDPPQETVPNQAWQETSYSNSIFASGFSITIVSMFVIFSSLQWRIQYRKIFEYVGLVF
FT                   INSFWVPQFFRNTLKNRRKSFAWEFIFGTSVIRLLPIYYFALVKGNPLRHRYDPVLCIV
FT                   VSVWIGLQLLLLVLQNQLGPRFWINEKWLPKAYEYQRLLSMKDLQEEGFSSELLENLKA
FT                   TMSQSEDQDIVTSQCVCPICMTDVDLPISVKEDKLEEAKRKVNTKGFMITPCHHIFHTE
FT                   CLENWMKYKLQCPVCRKSLPPI"
FT   CDS_pept        complement(1026331..1027032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094337" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575678"
FT                   /orf_name="CD36_65220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAX41365.1"
FT                   /db_xref="HOGENOM:HBG397560"
FT                   /db_xref="UniParc:UPI000192E1FF"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE2"
FT                   /transl_table=12
FT                   /translation="MIVELHSDVLLHVSDLFARGVKNKFGLLLGYGLDDRLVVVKPIEL
FT                   AQVDPQYLEKRYSLFKDVYPNLSLVGVYEIGGNNPDRVNMLDISFEPRLYLSVDESIQF
FT                   KSFVEGNLVKTVIESSETEVITTKTIDSSKDYTKGRSKEDLTVAEFNQNMTSTLTKLYE
FT                   RLNKILETEGMDREIVEIANALRCYKHVKQPTDTKLQVAELALITEQIAELESAKIGIA
FT                   KKILVKEPGLV"
FT   mobile_element  complement(1027339..1027788)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon K"
FT   CDS_pept        complement(1028129..1029385)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575679"
FT                   /orf_name="CD36_65240"
FT                   /product="Aminotransferase, putative "
FT                   /EC_number="2.6.1.39"
FT                   /function="2-aminoadipate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAX41366.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0047536"
FT                   /db_xref="HOGENOM:HBG398622"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000192E200"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE3"
FT                   /transl_table=12
FT                   /translation="MINFFKGHPTRELLPVQEIAESYKRVLLGTDYLSYDTDANNQHPL
FT                   QYGTDPGNLDVRKVVAEWVNIKFGNLVSDPDCINMTAGASYGVGNILASVTSPEITQRV
FT                   FVVTPTYFLINSCFVDVGLGGKLTAIEETHNGKYSIDLEYLEQELKKYSEDLEPVHDNI
FT                   NIEPDPVRGSRKYYRFVMYLVPTFSNPGGLTYTLETRQKLVEMARKYDMLVISDDVYEF
FT                   LDYTDSKPLPRLNQLDKAAVSSKYGNTISNATFSKIIAPGLRVGWQETATPELVHQLSI
FT                   TGSNRSGGTPNQLSTLVVADLIKTGTIDTIIRKFQSVYKERVRVLKESIAKYLPDDTEV
FT                   YGGDGGYFVWVVTPSANCFDVVAKLAERKVVLAGGEHFEVTGDERNWGEHCVRLSISYL
FT                   TRKEIEMGVRLWGEVLVSK"
FT   mobile_element  1031758..1031928
FT                   /mobile_element_type="other:novel LTR element 9"
FT                   /note="RT fragment similar to Tcd24"
FT   mobile_element  complement(1031944..1032724)
FT                   /mobile_element_type="retrotransposon:solo LTR, pi H"
FT   mobile_element  1031950..1032476
FT                   /mobile_element_type="retrotransposon:solo LTR, sampi G"
FT                   /note="internal deletion"
FT   mobile_element  complement(1031968..1032447)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon H"
FT   mobile_element  complement(1032725..1032784)
FT                   /mobile_element_type="retrotransposon:solo LTR, tara C,
FT                   truncated"
FT   mobile_element  complement(1032939..1033239)
FT                   /mobile_element_type="retrotransposon:solo LTR, psi K"
FT   CDS_pept        1033221..1033760
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575680"
FT                   /orf_name="CD36_65270"
FT                   /product="Uncharacterized protein YCL012C orthologue,
FT                   putative"
FT                   /protein_id="CAX41367.1"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="UniParc:UPI000192E201"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE4"
FT                   /transl_table=12
FT                   /translation="MPRLNEINLRTSEMTTEKKNQTKIKREYIIFRGRINLHNLTMDDS
FT                   YSSFVGQSKLNILLVIIILVCFLAFHFRHKIIELHDRYRTRSRIDNGYYSNLQSFEDDI
FT                   ASGLSSSNFDLESNNIATNDNRPGLTESAKVQIKKIMKEKGVSFDDARLEYIRNELSRN
FT                   NIDENGVPNDPKLVMF"
FT   CDS_pept        1034639..1036024
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575681"
FT                   /gene_name="LIP4"
FT                   /orf_name="CD36_65300"
FT                   /product="Secreted lipase, putative "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /protein_id="CAX41368.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="HOGENOM:HBG395719"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="UniParc:UPI000192E202"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE5"
FT                   /transl_table=12
FT                   /translation="MLYLILFLAVPIYAGLILPAKPSIDPFYNAPAGFEKAAVGEILQS
FT                   RKTPKPITAVFVPVKIQNSWQLLVRSEDSFGNPNVIVTTVMQPFNADPSKVASYQVYED
FT                   SAKADCAPSYALQFGSDVSTLATQAETFLLAPLLDQGYYVVSPDYEGPKSTFTVGKQSG
FT                   QAVLNSIRAALKSGNTTNIKEDAKVVMWGYSGGSLASGWAAALQPDYASDLGGNLLGAA
FT                   LGGFVTNITATAEATDGTVFAGIVANALGGVANEYSEFKEILQNDTDKQSVFDQFDSHC
FT                   LVDGVIAYVGTHFLSGSSRIFKSGWDILKNPTISKIVEDNGLVYQKQLVPKIPIFVYHG
FT                   AIDQVVPIANVKKTYQNWCDAGIASLEFTEDATNGHVTETLVGAPAALTWIIGRFNGKQ
FT                   TVSGCQHTKRTSNFEYPNIPPSILNYFKAALNVLIQKGLGPDIQKDQISPDGLKKIPTL
FT                   VYS"
FT   CDS_pept        complement(1036032..1039916)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575682"
FT                   /orf_name="CD36_65330"
FT                   /product="TATA binding protein-associated factor, putative "
FT                   /function="metallopeptidase activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41369.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG397545"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI000192E203"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE6"
FT                   /transl_table=12
FT                   /translation="MPSASNHGTPRMVNTPLSRHISTKKVVNYQSFRVAHQRVNIDIDL
FT                   ASNSIDGFTELTVIPTSNKLKVIKLDCREMEIKDVLINGSRSLNYVHDDMLYINDGEDS
FT                   EVMDLYSDAISVHQHHFIRSKLDYIFKHDEECNTQELKILLPDNMKFELTDINSIQTPG
FT                   GTATPSHLKSKGTGSEYYYTPIQLKVVYKVKNPQNGVNFVTNEDIEKKLWHAYTTNSNY
FT                   NVSTSSWVPCIDDLSSRCTWSLEVNVPRTLKDIGNPRMIGSKEAVQYQRSKRSGDESDG
FT                   EEEDGNYDIVVACGDFNNVKETPHPIDMSKKVVSWSIFNPVCAHHVGWAVGCFESFVVF
FT                   TGPKEEDEEDTELRGDDVNNAVTIYSHPEDVEWAKNTTVITNKAMDFFSKEYGSFPFSS
FT                   YAIVFVRYSVCQTSNFAGLSVMSSKLLYPPNMIEPMFSVTDVILKSIATQWAGINISPQ
FT                   TFNDMWCTIGIAGFMAISFIKKLMGANEFRYRLRKQMDKVVAEDVGRHAIATPKLKYPV
FT                   CEVDMEFVWLKSPIVLFILDNRMTKTDKSFGLSRVLPKLFLQAMSGSLPNGTLSTEHFR
FT                   YVCEKVNRNKLDGFFKQWVFGAGAPIFRISQRFNKKKGMIEMNIRQVQHYERKPRKLDS
FT                   CGFIDDAIAYLDEETVPPQQHVFTGPMTIRVHESDGSPYEHIVELKEANTKLDIQYNSK
FT                   FRKIKKKDEGVDPGIAFNQFGDVLVSAAEMQEWNLRDWDKRDEESLSSEPFEWIRGDVD
FT                   FEWIARIDIKQPDFMFGSQLVYDRDIEAQLEAVRYFGELEKTNVTYCTALTRTLMDERY
FT                   FYGVRIAAAQALADCCSEANNFIGLEYLLKAFGELYCFDGSFIPKSNDFSDFRGFMLQR
FT                   AFPKILCGIKDNDGRVPKRVQELLLNLVKYNDNSGNVFVDSLYVSELVEALVSSTVSGG
FT                   RDDGFVDKVVGELFRLQKMDRWVVSYQNVIEVTCIQQSIRMALAGVRKVSLEELLYMTL
FT                   DKYPMEARVEAFSGILGLGGLKDKSVLQYFVKVCLLNFERPLYRSKLVEALVRAVSEVA
FT                   LHGVSTVDNTVGVSRIIIDDGNAAMKSKRDDIARASVKGAIEILRRDFSGDEGLRETMW
FT                   ELLHTSLVGLHERRSIFCLCRVLFKEVDSYMAKVPVPSMPVDEYVRKKIVAKVGYPGQV
FT                   TIKREGRFKIQLASRKVKVEHRPLKISLKPVRQEIVHVDPDVPTRVTFKLPSHRIAARR
FT                   VEVDGTVVTIKLGRDMKSKLDSLVHRYVRIDTKRRKIEASKVPFIEGGNTSKEKERRKV
FT                   YIHFGGNMGT"
FT   CDS_pept        complement(1040017..1041456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575683"
FT                   /orf_name="CD36_65350"
FT                   /product="tRNA(Ile)-lysidine synthase, putative "
FT                   /EC_number="6.3.4.-"
FT                   /function="ATP binding"
FT                   /function="ligase activity, forming carbon-nitrogen bonds "
FT                   /biological_process="tRNA modification"
FT                   /biological_process="translation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41370.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016879"
FT                   /db_xref="HOGENOM:HBG397539"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192E204"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE7"
FT                   /transl_table=12
FT                   /translation="MAIGNVVFRKSLDKLLGGTVPKKVAVALSGGPDSMLLTWLLSQCQ
FT                   FEIYAITIDHKYRTESSREALAVHERVKNWNLNHIIKSLDYPAGVDPTKLNNFEEVARE
FT                   KRYEAMAQVCYEKEIPVLFLGHHRDDQLETFIQRLQGNSSIFGLAGTHKVSPLPISRDL
FT                   SPESTLFNQASQVRILRPFWDYDKQDILETCQLNNIAYVTDPTNKDVSLTRRNYLRHLI
FT                   NDVIPAKNNQSRSPYLLIRKSELIDSHRKCLEFATMLENKAMALSNSLQRNGLIREYPG
FT                   LGSLWVKLPRQCLDHTNGIVTSRFLYRILHPYSTLKHYHWAYAKLERQLIPRITSFLDQ
FT                   GESGTFKLTMMNLVFEVTNNTSSEYVPIHIYRCPITTKDWPAVQEVLTMGEWKLFDSRF
FT                   WLRATSNTYRGQLSVISYIHKRHKRLLHGNLDASKSFDTLPAVKSSCGTIIAFPTVGVT
FT                   SSDHDIDYEWVLKKNRFSYCK"
FT   CDS_pept        1041353..1044859
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246403" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575684"
FT                   /orf_name="CD36_65370"
FT                   /product="Cytoplasmic isoleucine-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.5"
FT                   /function="ATP binding"
FT                   /function="isoleucine-tRNA ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="isoleucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAX41371.1"
FT                   /db_xref="GO:0004822"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006428"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG577712"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000192E205"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE8"
FT                   /transl_table=12
FT                   /translation="MESGPPDNATATFFGTVPPNNLSSDFRNTTLPIAILCVPLSDEDE
FT                   SRSCGLTICVTTKPEKKKKKKKNKQKIFPSISHLSNYTNMSSNNTPQGVFSFPKEEEAV
FT                   IKHWDEVNAFQRTLELTEDLPPFAFFDGPPFATGTPHYGHILASTVKDIIPRYATMNGY
FT                   HVERRFGWDTHGLPVEHEIDKKLNITSKEDVYAMGIDKYNAECRAIVMRYADEWRRTIK
FT                   RLGRWIDMDNDYKTLYPEFMESVWWAFKELFNKDAVYRGLRVMPYSTACTTPLSNFEAQ
FT                   QNYKDVNDPALTISFPLLDDEDTCLVAWTTTPWTLPANLALAVNPKFEYVKIFDEEKKK
FT                   NFILLESLISTLYKKPKSAKFKVVEKILGKDLVGLKYKPLFNYFYEDFKDTGFRVIPAD
FT                   YVTNDSGTGIVHQAPSYGEEDFNSTKAAGVITEKKLPISIVDDSGRMESNVPEFAGMYF
FT                   KDADKAIIKKLSEEGRILVNTQVKHSYPFCWRSDTPLMYRTVPAWFVRIGEVIPEMLDN
FT                   VEKTNWVPSNIKDKRFSNWIANARDWNISRNRYWGTPIPLWVSDDFEEMVCVGSIQELR
FT                   DLSGRDDITDIHRESIDSITIPSKKGKGQLKRIEEVFDCWFESGSMPYASKHYPFENEK
FT                   KFLDAFPANFISEGLDQTRGWFYTLTVLGTHLFKTAPYQNVIVTGIVLAADGKKMSKRL
FT                   KNYPDPTLVLEKYGADALRLYLINSPVLRAETLKFKEEGVKEIVSSVLLPWYNSYKFLK
FT                   DAADLFKKDNGKDFVYDGSLHSTNVMDRWLLASIQSLIKFIHEEMTGYRLYTVVPRLLH
FT                   FIDDLTNWYIRFNRRRIKGYAADDVEDTQKGLNTLAEALLTLSRAMAPFTPYLADGIYQ
FT                   RIKVYFKQEDLEKFAINSKNVDLRSVHFLSYPSVRQELFDEKIEIAVARMQKVIDMARN
FT                   IREKKMISLKTPLSELVVLSADADLLKDIDSLKGYISDELNVRNVVITSDEAKYCVEYS
FT                   CVADWPVLGKKLKSDAKKVKAALPKVSSEEVQRFAECGRITVDGIDLVTEDLQVQRGLP
FT                   ASKAEEGQEFRSHQDVLIILDVNLHPELESEGLARELINRIQRLRKKAGLNTTDDVQVQ
FT                   YHVVKDTIDLPKVIKDNEELLLKSTKYPIEELKDAQDSANIITDEEQTINDTVFNLRLL
FT                   KI"
FT   CDS_pept        complement(1044872..1047712)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078852"
FT                   /orf_name="CD36_65420"
FT                   /product="Uncharacterized WD repeat-containing protein,
FT                   putative"
FT                   /protein_id="CAX41372.1"
FT                   /db_xref="HOGENOM:HBG397529"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000192E206"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJE9"
FT                   /transl_table=12
FT                   /translation="MSDKLSTRFRPLNHYGPVTALKIYKNYIIVGYGPTLKIFHINDEA
FT                   SLIFDKQVFHRNKIHHIDINAENDTVVISGGRSFLVSSLAELIDTKSVSAMEHTINEWI
FT                   VTSYVLDDKHILLLNSHNTIIKIDTTNFSVVDKIDCKEKSILYSGSITKLPSGDIYVAA
FT                   GTVMNGTIIWDLYSQTIKHNLTDHEGSIFGIKIDPSGQYIVSCSDDRSIKLYSFNEGKL
FT                   LATGWGHGSRIWSLEFFSGKPLKIMSCGEDCTMRMWEYTPGHELLEQIELWENFHRGKH
FT                   IWSGDVDNADLKIAVTGGADGKVRVHDLTRQNRQRFSLSEISSTISLSKTDFIRDYFEL
FT                   SGFLVLLMSNGYLLIRRDNKFTSLGHFAEFDGFGVVSGFAELGVVLICARDGRILSIDD
FT                   SATPTWITTPTSNKIVNMLLDTSYGRYFVLLESPNPNVPFTLHELTLTMTGLQMSQTWD
FT                   IPKPEPRFSVTAMAVDTVHHKLILASKKVTIGIFDLETSVASVFKKISPGDSVSSLSII
FT                   TTTPESLQVLIVARDGFYTIAEITPALSLNILQQNKITRGVIEGGFMHNNELVLYGFKS
FT                   SYFFVWNETKQIEIMNEQCGGSGHRHYKFYHDEAKHFRFIYTLKSELCIRTHHVRFNDT
FT                   FGLIQNGTHGREIRDVTISSDHKLVATSSEDSSICLSKLSDDGKLVNIWNMTNHVSGMQ
FT                   KIKFLSKHFIASSAANEEFIIWKLSWSGELPMLMEYNRLNPTKEIPDLRVMDFSSIEND
FT                   VGFTIATVYSDSNIKVWQFDFDTGFHLLNSWFYSTCCILNCQFLNNHHLLIGTTDGCVT
FT                   IYDTTTAKAVAKEKLHQSGVKAIGIHQDYLITGGDDNAITVSQVNNTSIKLIDRVEDAA
FT                   SATITSIGYVDNKSFIATSVDQIVRLWTFSSGKLVCTGARYTTIADTGCCDTTTVNNKT
FT                   LAVIGGAGISTWEIVY"
FT   CDS_pept        complement(1048418..1050763)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575685"
FT                   /orf_name="CD36_65460"
FT                   /product="Sulphate permease, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41373.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG447621"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniParc:UPI000192E26B"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF0"
FT                   /transl_table=12
FT                   /translation="MPMALLDDTSPTHTHPPQIPMKRTPRSDTVSPDRSRLTSPSPSIR
FT                   HISHTRVNTERSYLLHKDTTLQVADTESIIYQNPAPNEYTPANTQNLESLSWSEILPYY
FT                   IPCLSWIGQYTVEFFIGDLIGGLSLVFFQLPLSLSYATSLAHVPVTSGLYSLGISPLIY
FT                   LIFGSVPQMIVGPEAPISLIVGQAIEPLLHHAKKAHLDPVEYLVAITFVSGSTLLGFGL
FT                   ARFGFLDNVLSASLLKGFIAGVGIVMIITSSIIVLGLEKLMKQISDDPNEMDIHSPFDK
FT                   VRFLVQYIGQRNQQSLNIGLVGFFIIFAVRLFKKYAAKQHGRLYKYAVFIPEIMLVVAG
FT                   STILCQHYRWDLGGLPVIGKVRNKGDFKFYNPVSLSNLHLIKDLCASGFMCAMLGFFES
FT                   TTASKSLGSMYDLPISSNRELVALGSINIFGSIFGALPAFGGYGRSKVNAISAKTTMSG
FT                   GIMGICTLLTIHFLLKYLYFVPQCILSVVAAVIGISLIEEAPYELYFHWKTRGIDEIIT
FT                   FCVTVFTTLFFSMEGGIAVGIGYSLVRVVKNSTFSRIQILGRYPNTNRFVDADIPAYQN
FT                   NQEKVAGSYLNLFDDAQQMQLNTQVLEEIEGCLIIKVPEPLTFTNCSDLTTRLKRVEMY
FT                   GSTKAHPASKRSRDIGMTKYVIFDLKGMSFLDSTAAKILKSLLQGYRKRGIRTCFVRMS
FT                   SDKHLRKMLLDSGICKLLIDDLTDLKYFAIQEIAEQNSSPVTTPEMEAIIECYSLIEDD
FT                   TRPYFNHISDALKVIDCFETNYVDTIDA"
FT   CDS_pept        1050883..1051872
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247865" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575686"
FT                   /orf_name="CD36_65470"
FT                   /product="Electron transfer flavoprotein complex subunit,
FT                   mitochondrial, putative"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /protein_id="CAX41374.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG615986"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="UniParc:UPI000192E26C"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF1"
FT                   /transl_table=12
FT                   /translation="MASYIAKRLFSRSRVRLDTLALVEGVSNGVSPASLSTITAATEIG
FT                   EPVTAIVFGSNGDSVAEAVAKTEGVSKVLVAKDGEYDHCLAEKVSPLLKKIIEDQKFTH
FT                   FLTAGSSIGKSVLPRLGALLDVQPVSEIIKVVDPTTFVRPIYAGNALATVKSKDSIILA
FT                   SVRASAFPPAEVGGATAPVEQVTESVESGNSAEFVSEQIVKSERPELGSATRVVSGGRG
FT                   LKNKETFDQLIDPLATKLNAAIGASRAAVDSGFCDNSLQVGQTGKIVAPDLYIAVGISG
FT                   AIQHLAGMKDSKVIVAINKDADAPIFNVADVGLVGDLNEVIPELTKKL"
FT   CDS_pept        1051980..1054352
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000206561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575687"
FT                   /gene_name="SEY1"
FT                   /orf_name="CD36_65490"
FT                   /product="Protein SEY1"
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAX41375.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG333405"
FT                   /db_xref="InterPro:IPR008803"
FT                   /db_xref="UniParc:UPI000192E26D"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9WJF2"
FT                   /transl_table=12
FT                   /translation="MELSEGELSHTSSSSSFVPVDQRQLQDAIQIIDEDKHFNTGILDY
FT                   INKTSPADVGNNYHIISVFGSQSTGKSTLLNRLFNTNFDVMDESNRQQTTKGIWLAYSP
FT                   VVSTTSGHTTSKSNILVMDVEGTDGRERGEDQDFERKAALFALSTSEILIINIWETQVG
FT                   LYQGANMGLLKTVFEVNLSLFGKSKLEKHNEHKVLLLIVIRDHVGVTPVESLAKTFTSD
FT                   LQNMWGSLSKPAELEHLRFADFFDVSFHALNHKVLQPKEFGEGINKLGDRLVVNNELFK
FT                   PEYHHDVPIDGWTMYAERCWEQIETNKDLDLPTQQILVAQFKCDEIVEGVFQEFLSKYQ
FT                   HHFKEVDVDVDFAELGELFVDLRSDSLEDYDVSASRYNKAVYEQKRAKLRGLINDKLKE
FT                   VFDVHAKKLCDTLLETFQKDLVALKGKDFAVNVKALSTKLVEQVVDTLSLMSLHGDISS
FT                   NEITSGLSKEIDATIAKQQVIELNSIVNKSVKKLSGSLSKSIQFELGDPNDETWDNVLQ
FT                   MFKESYDKFGGDFGLGTSTTQNEQAIERFKFKSWCQFYDVTRKLISKEKLLALLQDRFD
FT                   DKFRYDENGLPKLYLNEQDLEKTFAVAKQYALQVLPILTLAKLADGSEIVPEYDIFDSK
FT                   LREEFLGAYDDSDDEDDHCFAEVVTEQEKSEVLAKFKKEVDAKYIETKRSIVQHITQIP
FT                   YYIYLIILVLGWNEFMAIIRNPLFFSLSIVLGATVYVLYYLNLLKPAMLVAQRTMDEVI
FT                   IMAKTKLREVLIDDHEVTGRQLNKIAGGKENIELDDM"
FT   CDS_pept        1054509..1055993
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078853"
FT                   /gene_name="NAG5"
FT                   /orf_name="CD36_65510"
FT                   /product="N-acetylglucosamine kinase, putative "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAX41376.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG397633"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI000192E26E"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF3"
FT                   /transl_table=12
FT                   /translation="MIETSIESVGGLTSGPMYFMEIVSSQSSVLSSIVESFTSAVSASN
FT                   LGVYSEELLGDVKHSLRENSPITMLPNYNISPTGEEHGSYLVIDLGGSTLRIAVVDISK
FT                   PHPKLSRTERITIVVEKSWIIGNDFKRIDYEFFKYIGSKINEILVGQNVIDVNSVINTG
FT                   ITWSFPLETTNYNSGRIKHVSKGYTVGEDIYGKDLKTVLEETLRQEYGLALEVNSILND
FT                   SLAVYSAGCFIDSNMKLAMVLGTGINMCCSLKKSSEICRYKMLADATLFNCELSLFGQN
FT                   LCKDFATKYDSIIDQRFARTQHHFKTFMGPDPLTQTLFQPHELMTSGRYLPELTRLVVV
FT                   DLIEAGEIFQNVDCQSFYEEYGGFSGELMCFVHETDDYNDIHVKLCKAYGWTGIGRSDV
FT                   VCLKEVVSCIIKRAAFIVANAIIAFFKLLGGDELCGDVTIGYVGSVLNYFHEYRRLIIE
FT                   YVNNAAEAKQLGVTIDLKLIDNSSIIGAAIGAAYYR"
FT   CDS_pept        complement(1056038..1056886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000064979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575688"
FT                   /gene_name="NAG1"
FT                   /orf_name="CD36_65540"
FT                   /product="Glucosamine-6-phosphate deaminase, putative "
FT                   /function="glucosamine-6-phosphate deaminase activity "
FT                   /biological_process="N-acetylglucosamine metabolic process "
FT                   /protein_id="CAX41377.1"
FT                   /db_xref="GO:0004342"
FT                   /db_xref="GO:0006044"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="UniParc:UPI000192E26F"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF4"
FT                   /transl_table=12
FT                   /translation="MQPLPKKCNHHLISHIRSIICPSRRNENRTSSSTMRQAIFSNPND
FT                   AAEYLANYIIAKINASTKPFVLGLPTGSSPEGIYAKLIEAYKQGRVSFKNVVTFNMDEY
FT                   LGLAPSDLQSYHYFMYDKLFNHIDIPRENIHILNGLAKNIDEECASYERKIKQYGKIDL
FT                   FLGGLGPEGHLAFNEAGSSRDSKTRKVELVESTIKANCRFFDNDESKVPKYALSVGIST
FT                   ILDNSQEIAIIVLGKNKQFALDKTINGKPNDPKYPSSYLQDHANVLIVCDHAAAGLKSK
FT                   L"
FT   CDS_pept        1057040..1058281
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275010" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19383112"
FT                   /gene_name="NAG2"
FT                   /orf_name="CD36_65550"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase,
FT                   putative"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="CAX41378.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG464950"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI000192E270"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF5"
FT                   /transl_table=12
FT                   /translation="MSFTRFTNCHLIDRGELYEFTDLYVNNATKRICHPPADPELVSEV
FT                   IDLKQQILAPGYIDIQNNGIYGLNFSNLGEESTAEDIAEFKRFYKDAMAKYLSTGVTAT
FT                   CPTVTSNFPEVYAKVLPLYKKSVLSDQTDSLGAHVEGPFINVQKKGCHPVETFVDAKEG
FT                   ECKLLEVYGDLFDNVCIVTAAPEIAGVLDLISVVKAKNCVFSIGHTMSDYRTAVKAVEN
FT                   GATMITHLYNAMPQPHHRNAGVVGLINSPIVETPYFGLICDGVHVDPSMANFAYRSNPG
FT                   KCVLVTDAMHLIGLPDGHYKWDSQVIVKTGDRLYLENTDTLAGAATTLPQCVRNLVKWS
FT                   KVSLPQAVMTVTNNAAKSIGVDKERGFLNVGCFADFVVLDKSGYVRKVYKLGREVQSSD
FT                   IPLDRATDKLNAVL"
FT   CDS_pept        complement(1058291..1059991)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17575689"
FT                   /gene_name="NAG3"
FT                   /orf_name="CD36_65570"
FT                   /product="Polyamine transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41379.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192E271"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF6"
FT                   /transl_table=12
FT                   /translation="MSDNTTLDNTSVNSEKVVDYGDAIHHHNHQDLEKLVSNNKGVAKI
FT                   VSELAEGAGQLGPLEQPYDIHKVETHPDPHTDYNAADPWKYPIDQETQLRLVDWTHNDK
FT                   HNPKNFSKAFKWLCTVLLGMICFVVALGSAIVTGDLERPAADFGVSEEVIILASVTMFV
FT                   IGFGVGPLVFAPMSEEVGRKPIYAVTLFVAVVFIVPCGAAQNIATLLICRLIDGTAFSA
FT                   PMTLIGGSLADIWEGPERGTAMAVFSAAPFLGPVCGPIFGGLLCDYAPTWRWIYWTFLI
FT                   VAGFFYVVFIVVVPETHHGILLKKRAKKLRKDTGDSRYRSFNELQIRTFGEVAKTSLLR
FT                   PFVLLAELIVFLVTMYMSVLYGLLYMFFFAYPIVYQEGKGWSASKTGVMFIPIGVGVIL
FT                   SSLAAPFFNRDYNKRAQVYRDRGELPPAELRLIPMMIGCWFVPIGLFAFAWSSYQRISW
FT                   AGPCFSGFAVGFGFLLLYNPANNYIVDSYQHYAASALAAKTFVRSIWGACVPLFTIQMY
FT                   HRLGDEWATSLMAFISLACCAIPYLFYIYGARIRTFSKYAYAPNMDSKK"
FT   CDS_pept        complement(1060204..1061913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21078854"
FT                   /gene_name="NAG4"
FT                   /orf_name="CD36_65590"
FT                   /product="Polyamine transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAX41380.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000192E272"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF7"
FT                   /transl_table=12
FT                   /translation="MSHATDNTSVDSEKVRDFGDDLQHHPTRSILNKIRSRESGDLKSL
FT                   VSNKGVERIVSDLQEGAGQLGPLEQPYDIHKVETHPDPHTDYNDADPWKYPIDQDSGLR
FT                   LVDWTPGDKHNPKNISKAKKWLYTMVLGAVCFVVALGSAIVTGDMERPAQYFGVSEEVI
FT                   ILASVTVFVIGFGVGPLVFAPMSEEVGRKPIYAVTLFVAVVFIVPCGAAKNIGTLIVCR
FT                   LIDGIAFSAPMTLIGGSLADIWEGPERGTAMAIFSAAPFLGPVCGPIFGGLLCDHAPTW
FT                   RWIYWTFLIVAGIFYVIFIAIVPETHHGILLKKRAKKLRKDTGDSRYRSFNELQIRTFG
FT                   EVAKTSLLRPFVLLSELIVFLMTIYMAICYGLLYMFFFAYPIVYQEGKGWSASLTGVMF
FT                   IPIGVGVIIATIAAPFFNKDYNRRAQKYRDRGELPPPELRLIPMMISCWFVPVGLFAFA
FT                   WSSYPWVSWAGPCFSGLAAGFGFCCLYNPANNYIVDSYQHYAASALAAKTFVRSIWGAC
FT                   VPLFTIQMYHRLGDEWATSLMAFISLACCVIPYLFFFFGAKIRTFSKYAYTP"
FT   mobile_element  complement(1063243..1063413)
FT                   /mobile_element_type="retrotransposon:solo LTR, ruru D"
FT   CDS_pept        1063472..1064443
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094338" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230229"
FT                   /orf_name="CD36_65610"
FT                   /product="DNA damage checkpoint control protein, putative "
FT                   /EC_number="3.1.11.2"
FT                   /function="damaged DNA binding"
FT                   /function="exodeoxyribonuclease III activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAX41381.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008853"
FT                   /db_xref="HOGENOM:HBG397236"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="UniParc:UPI000192E273"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF8"
FT                   /transl_table=12
FT                   /translation="MSLFVESEPESEPICHVEESFTASTTQIGHLSDIFQSLVSISNQA
FT                   IIRIKESGITIYSSYNHTFNVNVNIDPSLFSIYQMSGGEEFALGVDLSLIGECFGSVAS
FT                   TLKYEKSVTCYLTYSGEGSPLVIEFEDSFILEKLEFYTFVIEEEDGLGIDYESVEMEAI
FT                   VRSDVLTNVMQDLYSIDTENLFVYAEADTLHFISNGPIGTSKLIFPNDKAVLEKMEIKG
FT                   RYVITQFSFEVFYRIFRSVKLSSKCKLVKDENGCFSVQLLCQKVGTSGYSGTLVTINMM
FT                   EVSHDEVMTGAILQEQEKPVLVEVQSSWRGKVGGVVEVPLYL"
FT   mobile_element  complement(1064858..1065319)
FT                   /mobile_element_type="retrotransposon:solo LTR, epsilon J
FT                   (subtelomeric)"
FT   CDS_pept        complement(1065509..1068526)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094339" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20230230"
FT                   /orf_name="CD36_65640"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAX41382.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018289"
FT                   /db_xref="UniParc:UPI000192E274"
FT                   /db_xref="UniProtKB/TrEMBL:B9WJF9"
FT                   /transl_table=12
FT                   /translation="MDSIKTKRDHKDSCCIKLGILHEYVPERIFRPSNVQQIISSVERH
FT                   VSIHQTTFKLQQYNRNEILNMSVSKNFPQLLRNFFLLDEIQKELPKHEQYEKLVKHPEN
FT                   DQQFFKRITSKPFLQEWQTNDVELFDQNGSRVTSIRPILFDSTIEPSLRLQKFFHPTTL
FT                   PNELHGNTWITFKQSEEEVKSFITEVERLQNYTKNSKSKERYYLYCEYSNRNKRKNVKT
FT                   SNKTNCQHKIRVTELKTGEFEIKWDLVHNHAFNPLKPTKSARDWLWKLINNQVDWSTCK
FT                   LRLKNTDFMNHYDVFSDQYKITNSMFNYFKNKRELKIAYLDDNVVTSMKLWEKELNENN
FT                   NIASFKKVKINDNGFDTESIDNEYIDENDTWFFGIIIKSQLSYMRDPETVFLDATHKLG
FT                   YGPNDQDIFVYNFIVKSSLTGKGTPIAFLITNKQSHEPLAAFLKLFVDHNIKIKRFIID
FT                   CSPTEVKAIERGYNNYTNDADITYCTWHLLRTFRKNVNSCVKLSVTSSENDHTAQQNPE
FT                   NEVIDTNFLMQLAQNAVSLQSNLTTGSCMDDVITNRKIALVDLMELKRMKTFEDANTKL
FT                   AEIQEKYHMYPQFVQYVLYKFNSSGKYWLNCQTKFHELTNNYVEAFHSVIKTYYFSRRR
FT                   KYRVDRIIYILVERVISHQRGQHMAYNINPNKRVADKAEKLAKNEANNLPASDIDSMVR
FT                   ISPNNIEVKSFTSSCFYKIEKNSLNIHYCSCPSFQGSIDWCKHLFLYLRVRRKNGNNIA
FT                   LVQEEEEEEEENMDINVPLNYNGKNDTVIGDDEYLIERMDSLDVESGEFEEEDGTIMDD
FT                   YSQPEIPPMSPPPTSVPTYDTQENINIETLNPANREENEENEYTVDDPDTVSLFQLPES
FT                   QISYTDTQIAVSSIQQPPNLTNQDENRTNEVSNEEFDRLFKKCGKGISNHSKKRPSLEK
FT                   KYDNAIKTLKRIKADIGKQKKKDDDISQRWTEIQEIYTRVINTELSEEERQDKLEEMKQ
FT                   FYYSLLPNSNRRQSRY"
XX
SQ   Sequence 1073895 BP; 358394 A; 179473 C; 176802 G; 359226 T; 0 other;
     tagacatccg tacaccagaa gttagacatc cgtacaccag aagttagaca tccgtacacc        60
     agaagttaga catccgtaca ccagaagtta gacatccgta caccagaagt tagacatccg       120
     tacaccagaa gttagacatc cgtacaccag aagttagaca tccgtacacc agaagttaga       180
     catccgtaca ccagaagtta gacatccgta caccagaagt tagacatccg tacaccagaa       240
     gttagacatc cgtacaccag aagttagaca tccgtacacc agaagttaga catccgtaca       300
     ccagaagtta gacatccgta caccagaagt tagacatccg tacaccagaa gttagacatc       360
     cgtacaccag aagttagaca tccgtacacc agaagttaga catccgtaca ccagaagtta       420
     gacatccgta caccagaagt tagacatccg tacaccagaa gttagacatc cgtacaccag       480
     aagttagaca tccgtacacc agaagttaga catccgtaca ccagaagtta gacatccgta       540
     caccagaagt tagacatccg tacaccagaa gttagacatc cgtacaccag aagttagaca       600
     tccgtacacc agaagttaga catccgtaca ccagaagtta gacatccgta caccagaagt       660
     tagacatccg tacaccagaa gttagacatc cgtacacaac attatctcct cgaattttaa       720
     ctttctcact ttcgaacact caccattaca ctgccccaat ccccacaatc acaacgcacc       780
     cggtttgaga cccagatctc caattttcgt ccttttcgtg accccccaaa ataccccccc       840
     taagcggtac tgcatataac tactcttcta cacctctcca ttttgccaca acagaaaaat       900
     gatcttttct atgcctcgca ccatttttcc actcacacaa aaaaagccat aacaaaatta       960
     tgtgctgttc ttacaacaac aaacttctgt cgcgcactta aaaaaatcca cgcaaaaaat      1020
     ttacaaattt aaactatata caacaccaaa cttctgtcgc actaacaaaa atccataaca      1080
     aattttctca actatgcaat ccacaaactt ttgtcgcact aacaaaaagt catagaaaaa      1140
     aatctttctc ttcaccactt ttccgcgcac taacaaaaag tcatagaaaa aaaaactctg      1200
     tttcaactat tttctgtcgc gcaccaaaaa agccatagaa aaaaaacctc caattcaact      1260
     attttctgtt gctcaccaaa aaagtcatac aaaaaaaaat tgcgattcac cacttttccg      1320
     cgcactaaga aaaaaccata gaaacaaaac ttctaataca ccactattct gcgcacttaa      1380
     aaaaatccat agaaaaaaaa ctttcaattc atcacttttc cgcgcactaa aaatttgcca      1440
     ccaagttaac tttctttttc ttctgctcac aacaaataat actttcaccc ctattttttt      1500
     tcccaactca aaccgtgaca cttaactaca cgcacataca ataccttcac ctctcttttt      1560
     tcgccacttc aaaaattttc attaccaggc atacacctat tttctttttt cctcacccaa      1620
     ctatgactaa cgcacaaaaa aaattctata ctctatctct tttccattac tcttgccacc      1680
     actaacgcat ccgtacatgt caccattccc cttgctactc cttctcccaa ttctccaatt      1740
     attgctctgt tgatcttccc actgatatat ccaaaaataa cttataaatc tcatcttcat      1800
     ccccaccaac actcggctca ttctcattcc attcagcttc acatatttct tttcctaatt      1860
     ctgaaaacat ttgcccccta agtgtcctgc atataactcg acttcccatt ccggtaacca      1920
     ccctcttttt ttgcgcgcat acgttttcaa acccctactc attcaaaccc cgcactccaa      1980
     caaaatttgc caccacctac tcaaccacta acgcatccgt acgtgtcgcc attccccaac      2040
     tattactctg ttgaccttcc attatctata cagtgttatc tttgtctgtt taatccactc      2100
     tatcccctaa ctagaaactc ccattctgcc attttccacg ctccaaaaaa atcctaccat      2160
     ctaagcatcc gtacgtccta acaacccccc aggcctattc acatgtcctt gtctaatcct      2220
     tgtcgtcaca tctctgtgtt acccagtttg tcttcctcgt taactgtcta agattaatca      2280
     aattgtcctt gtccccacta gtctcagatt gttcaatttg ccctttttgt catttgttct      2340
     tgaattttca tatagtcttt ctcgctactt gttcttgatt gataaatttg tctttgtcat      2400
     ttgtcctagt ttaatcaatt tgttttgttg tcatattcct gtttatctac atattccgtc      2460
     ttagtctcgg attattcaac ttgtgtttat cgtgacttgt tttagattat tcatcttgcc      2520
     cttgttgtca tattcctgtt tatctacaag tcccgtctta gtctcggatt attcaacttg      2580
     tcccacttgt cctagattat tcatcttgtg tttgtcttac catttattat acaccagatc      2640
     caacacactt gcaaatacag ccttgttccc aaactatctg cacacccagg cagctaagca      2700
     tccgtacgtc cagctcaaat tcatctaacc ctcgttcaac tccaacccat tatatagacc      2760
     tatttacttt gaatcaaaat ccagacttac tacactctct ataactcatt ttactacaca      2820
     ttatacagcc ttgttctaca tctcatgttc tgcacaccca gctaagcatc cgtacgtcta      2880
     gctcatattc atctaaccct cattcaactt caacccatta tatagaccca tttcctaatt      2940
     ccacagttac tacaatctgt cttattcctc tacttcattc tcttgtttat acgatctaac      3000
     tttcaagata tgcttacccc aattgttcgt taccaatgac aattcagaga cacactatag      3060
     atagagagcc aatttagatc taagtctgtg ttcacctcca ctccctcttc acccctgtcc      3120
     aacttctcct ccatcacagt agcaaaattc tcaccggaac caggtacaat attgtgttga      3180
     cccaccccaa aaactttttc gcacaacttt cttgccaaaa ataaacctaa atcaaataaa      3240
     tgctccatta gacgataaac ccacctctaa acaactccat gccctgtttt atctagtttc      3300
     cggatttgca agatcaccta gatgtctaga tgttcaaaaa tctccttgtc tcttttgagt      3360
     gctacaatcc atagtataga aacaacacat tacatagaga tcataagata accttgagaa      3420
     ccccaattat cctgtacgta tgctaattca gttacgaatg cagcatagac ttagaaagac      3480
     cgtttagagc agttaatcta tgttcagctt cagagacaaa tcatagttgt ttacttccag      3540
     gttgatagac aaaccctata gagtagattg atttaatcca cagaagaatc agttgttcgt      3600
     tgttacgatc acagatcaaa tagagttgtt tgtctagtca cagaagaatc agatacaata      3660
     cagttagaga tacattatag atttagagag agcagttaat ttgttgataa ccaaatcata      3720
     gttatttatt ttaattcacc gaagaatcca attcattttc tcttttttat gttaacataa      3780
     acaatactgc tgtttgttta gtcacataag aatcggatac aacacagttg cagatgcagt      3840
     atagatttag agagagcagt aaatttgtga tcagatatac aaatcataat tgtttatttt      3900
     aatccacaga agaatcagtt gttcgttgtt acgatcacag aaagaacatt tttgtttgtt      3960
     tagtcaaaga acaatcaaat acaacacagt ttcagattcc ttatagattt agagagaata      4020
     tttagagcaa ttaaattgag tagatttgtc ttcaggttca aagacaaatt gactatagtt      4080
     gtttgtttac ttccaggttg atagacaaat tgtttatctg ttttaattca cagaagaatt      4140
     atattcagtt gctcattttt tagttcacgg agtttgttta tttttgagtt cacagatacg      4200
     tcaaatactg ttgtttattt agaaaaatca gatatatttc agttaccaat aatatttcag      4260
     ttacagatcc cttatatcgt tatatcagtt aatctagact ccaatttatg ctccgtgagt      4320
     tctgctcgta attgtgtctc attgtcaata acttcctact ctttcactct tcccaatttc      4380
     attgtcatat tcgtctctat caatcattta tcgtgttatc aattttcgag ttatgacaaa      4440
     tttaacagtt tcctcgactt ctccatgaat tgtgatgttg atttaacaaa ctgacaaatt      4500
     tgattcacat ttcaaccaaa gagtttaatt agatgcacca aacaagcaac aagtacttat      4560
     tactgctctc ctgtgagatt gtctattttt actggaagat gtttttccaa tcccaatttg      4620
     cgatgcatct acttctgaaa tatagccatt gagtcgattg atagagtttt caacagacaa      4680
     caacttcttc tcttatactc cttgtcttga tcatgttctg agacgaaagc agtagcactt      4740
     caaattcctg caaacttatc gacaaatatg actgtcgtta ccctccacat gtgcttagat      4800
     cagtctaatt gtgttagatt ccagattagt ttgaagctaa acattgccag actgacaatt      4860
     ctgattcaca ttttgaccaa agaattcaag catcaagtac ttattactac tctcctgtgt      4920
     gattgtctat ttttgttgaa tgatgtttgt ttcaattgtc taatcttctg ccaatcaatc      4980
     taatcgtaaa cactgacaaa tagccattga atttaagcaa gtgcaccaaa ttgatgtctg      5040
     tgtgattgtc ttgtctattt ttcacggacg ttgtttgttt caattgtcga gtcttctgcc      5100
     aatctgtttc tgaacactgc aatattgcca ttgaattgat tgaaaccgcc ttccttgaaa      5160
     aagaacattt tatctaattc tcaacaatga ataacacaac ttcttttctt gtcttgacca      5220
     tgctctgaaa cgaaatcagc aacactttag attcttgaaa acttctcgac aaatatgact      5280
     gtctttcctt ccacatgtgc ttagattaat ccaattgtgt tagatgttga acattgccaa      5340
     taacagttct atccttgcta aatcatttta gaagtcagtg ttgctagcta gtatcagttc      5400
     tacttcattt ccaagtttca tatattccat ttctccatgc ttatatcagt agttgcttta      5460
     tcatgtctgt gatagtgaag tgacaaaaaa gataataaga aaattagttg tttgattgtt      5520
     gtcatttttt tttttttttt gccagctctt aagtttcgtc gacacacgaa ttagaaaacc      5580
     ggagagtcgt ttcctaatcc ggaaaaattg ttatagctta aataaacttt tttctgtcta      5640
     aataaaccct caagagtcct cacacagaag aaaaaatacc catcgatctt ttttacgtca      5700
     actttcttgt aaaaatgaac ctaaattctt acaacatcaa tgaaatactc tgctaatccc      5760
     acctctgatc agctctaaat aactctacat gttagctagt agacgatctc tcaccaatag      5820
     cttattatga taacacgtac catagtcata tgtgatatca cgttctatca aacatatctg      5880
     cttgtcagac tatttaagta gcacagttta tatagttcac atactactca atcaagacac      5940
     tagtcgttga tccttgcaat ataccccttt gctatttctc ctgccacctt gtttcctgac      6000
     gccctaataa cccagtgaaa aaagagcgaa ccacacacaa aattctacac aacccatctt      6060
     aactgaccta gatagctatc tccaaacttt aaccttccca tctctcttgg ctcagcctct      6120
     gcactccttc aaagttatac tcaaactcgg tatcactcat agttgtttgt tgtttacaga      6180
     tctacaaaaa tccggaaccc aggtcatagc aaataccttc atttttataa acttctcctc      6240
     ttttcgccgt ttttacttgc acaaatcatg aaacttttaa aaaccaaccc tccattgcct      6300
     cttcttgtta attgttttgc ttttcttctt ctctgatatc acttctatct ccaagtctga      6360
     tttcatcttc taatcttcat tgttccttgt tcagtgattc tttgtttgat tttgttaaca      6420
     aatttcaacc caacccccaa cctcaggtaa cttttctctc agattttttg taaacttgag      6480
     gtaaaccttt tttctcgccc cggatttatc ccgttttttg ccctccctta aatccgggaa      6540
     ttacaaaaac cactctgaaa gctgcacacg acattctggg aattacaaaa aaagtcgcgc      6600
     gacatgttct tcccatacaa atgaccatgt ttttgtaatt cccaaaaaaa tctatttctg      6660
     ttcatatctc tacacacact gctccaatca ctctcaaacc aagtgcattg aatttctaca      6720
     caccaaaacc acctacacac cccttgacac ctcctaagaa ctggtagttt ttgttctggt      6780
     aaatttttgt aattcccatt tgtaattccc aaaattcctt gtaattccca aatcgcgcac      6840
     taacaaaatt cgcaccaaaa aaaaattttg tagttcccaa atcacttttc catatgtatg      6900
     tatttgatat gcattaatct tctacaattc cgtgaattga ctggccttct ttcaaaatac      6960
     tatccatgat gtttcattct ctgatttgct ttgtcaaatc caacagaatt tccaatcccc      7020
     cgttcacttc catgtccatt ctctgatagt gcttcttcaa ttctttaaac tttgaatttg      7080
     atctgcatta gctttttctc tgtccgacat gcctggcgtt atttcactca aacattccat      7140
     tgagtttttt tcattctcga gctagacaac tgtcttaaat tcttagcctg gtttgattct      7200
     ctctcatttc ttgccattgc aattgttatc cttcacttga ctccatctgt tttgacaact      7260
     cccatcttta acttagtgcc atctaatttg acaactttga atttaaattt ttcttctgtc      7320
     accctgctgt tttgaccttt tcttgaatat ctagcaactc atagcagcat tcacaattgc      7380
     atatttcatt tcatctgatt gattgaatat ctgattgaat gaataactga tttgttgttg      7440
     atttgtcgaa gaagaaagtg atacaatttt tttttttttg ttgcgttgtc ttttccccac      7500
     gttacaccta cactacacca taaactctga atgacaaaca atcgattaaa tacataatct      7560
     actccttaca caatctactt aaaatctgct caacctccga agtcttccgc tcataatcct      7620
     ctaacaactt cttctctttg caagtcatct tcttattatc gtctatctcg ccactccaca      7680
     gctgccccat aatcagatta ataacacgtc gcatctgtcc tgcactcact ttactctgat      7740
     cccgtccagt ccctgaaagt gtcttcttca tcgtgtgttt tgtcaagtca aaatcaccaa      7800
     tcccaccttc ttgttctcct ctcgcattaa gcaactgcat caccgcaaca tcaacatcgt      7860
     atacttctcc atacacattg taatactgat ttagctagac tgacaaactt gattgacatt      7920
     ttaaccaaag aattgaagta gatgcaccaa acaagcaaca agtacttatt actactctcc      7980
     tgtgtgattg tctattttta ccggaagatg tttttccaat cccaatttga gataaattta      8040
     tttctgaaat atagccattg aatttaatta ggtgctccaa attcaagcct gtgtgattgt      8100
     cttgtctatt cttcccggac attgtttgtt tcaattgtcg agtcttctgc caatcaatct      8160
     attccagaaa agtgagatgt agccattgaa tcaattgaat gtgtcttcca caaataaccg      8220
     ttttatctat tcttcaacaa tgcataatac aacttcttct cttatactca ttgtcttggc      8280
     caagttctca aacaaaatca gtagcacttc aaattcttgc aaacttgact gcctttccat      8340
     ccacatgtgc tttgattagg ctaattgtgt tagatgttga acattgctaa tgagagttcc      8400
     atcgttgcaa attttccaac aggttaaatc atttcagaaa tcagtatttc taggtttcaa      8460
     atattctatt tccccattct tatatcagta gtagctttat catgcctgtg atagtgaagt      8520
     gtcaatgaag atgagaagag tattagttga ttgttgtcat ttttttcttg ccagctgtaa      8580
     agtttcgtcg actcgcgaat tagaaaaccg gggagtcgtt tcctaatccg gaaaaattgt      8640
     tatagcttaa ataaacattg ttttctgtct aaataaaccc tcgagaatct tcacacagaa      8700
     gtacccatcg atcttttttg ggtcaacatt cttgtaaaaa taaacctaaa ttcttacaat      8760
     atcgatgaaa tacgctgcta ctcgatcaag acactagtcg ttgagccttg cactataacc      8820
     ctttgttgtt tttcctgcca cctttcaaca aaaacctgac gccctaataa ctcagtgaaa      8880
     aagagcgaac cacacacagt attgtacaaa acccatctta aatgacctac ctagctatct      8940
     ccaaatttca accttcccat ctcttcgggt tcgccctctg cactccttca aagttaaccc      9000
     aaaatatgcc cttttccatg aaattctgat ttttccggtc gtgtgcgcaa aaagaagctt      9060
     tttttctctt gaccttaaaa tcaaccaact tttccaatca acagcagatc agtctatatt      9120
     aacgttataa acctaaaaac tatataaatc gcttctccag atgatataga ttgctttgat      9180
     acccttacct ttactatacg accaaaattg ggcgagttat aaagtgctaa aaaacatgac      9240
     gcatgtcacc ttcctaacaa aattctatat atctgacacc ttgtcagtgc gcatagatta      9300
     agattgcaaa atctctgcca ttttttttag ccagccattt gttccagcta gttatttttt      9360
     caacgctcca aaaaaaaaaa aaaaaaaatt tatcatttct tcgtccaacc atctatccat      9420
     ccgtacgtcc tccccaccac caacatgtcc tgtcatagct catacccgtt gtcttagatt      9480
     agtcacgttg cctattttgt catcccgtct ttgttgtgct acatcttcac atgtctgtgt      9540
     tacccagttt gcctttgtcg tggcatgtct ttgttagtca acttgtcctt gttgttacgt      9600
     ctttgcctcc tccctgttat gacttgttgt tgaatgtctt gagttttgtc attcgtcctt      9660
     gaattatcac cttgtcttct atatcccgtt tttgtcactt gccttagatt acttgtgttt      9720
     atcttgtcat gtctcagatt agtcaatttg cctttgtcat gacttgtccc cacttgtctt      9780
     acattactca actcgtgttt tccccgtatt tgctataact tgtcgataac tttctcagat      9840
     taatcaaatt gtccttgttg tgtcgtattt gcctacttcc tgttgtcact tgtcctagat      9900
     taatcaactt gttcttgttc aacttgttct tgttcatctt gtattcgtct tacacgcatt      9960
     ttacatccta tttcttatcc ttcaactcct tgtacaccag aaccaatata tgttgataca     10020
     atcctgccac ctgtgaacgc atcatagcac gcatccaatg attaaacact tgaatatctc     10080
     ccctaagccg tctacatctt gcatcaacaa acacagtata gaaatacaac aacgtcttgt     10140
     tcccaataca gccattgtga ccctcattta agcatccaca ttctcgacat acattttccc     10200
     tgggtacctc aaagtacgtc tccatagcat gcttctccca ttcctgacca gcaatttgca     10260
     cagcactccc agtcgattca gctcctaaaa ctttaagcat ccactcctcc ggttcaaatt     10320
     tattaatctt cgacaaaact cgtgcatacg tttcattcaa aatgtctctt ctactattca     10380
     acttcaaccc agtatcatcc aaaaacagac acaccaaaag tttctcatca taggcttgaa     10440
     tcatcttgtc catactgcac aacctcacaa acttcatccc cgctcattcc tcctaatata     10500
     atcctgcaag ctagactttg atgcacaacc ttatatcgct cgcaacagtt tctcgaacac     10560
     tcctcatcat tcataaaaca ccaatcacac accccttcaa ccctcacaac cggattacct     10620
     tctaacgtcg ttttatagaa cttgaaccat aaatgaagat tgtcaatact aataaatgta     10680
     tactttttgt caagctcttc caatttcctc tttgcctgtt ctaggtcact ctcctgctct     10740
     tgtgcactct cttctactcg ccgtctctta aatgcagccc ccagcgcctg caccattact     10800
     ttaacaatat cccttgtttc accatgtgtg ttcagcaccc cacaacagtt aaaatgccca     10860
     tcccatttta acaggtaaaa ctgacaaatt tgtttcttaa tgcactcacc aacatcaaca     10920
     ctctcatcat acccaccgtc tcgatcacca ctgagaaata aaacatacag cggcttgctt     10980
     ctaagtctac ctatgacttg aataacttcc ggaaccgttg ccaatctgtc taatcttcga     11040
     tatatccaag cctaccgaag cagctttcgt ggcaagtata atccgtgtcc tactaatctg     11100
     cttgtgagcc aacgcaatgt cactagtttc agaactgatg ctcacactgt tcgggaaaat     11160
     atcaccaaac tctctaagcg tcgcgaggca gctaaaataa acgaaaatga tcccctcgga     11220
     atagctctct aaaaaccgtt caacaacacc aaccatacaa ccaaccctct tctcatcatc     11280
     actcacaaat ttcgactcaa tataaacatt ccggttccgc tcactaacaa ccgcattata     11340
     tagcttcggc gacaacaact tctcctccac caaagttgca aaattctgcg gcaacgtcgc     11400
     acccaaacta ataacttttt tgaatgatcg taatatcagg cactcgattc tagataattc     11460
     gcgaaattcg cgctcctcta acaagacctg ggattcgtct aaaacaaaca acaacaactc     11520
     acccgaattt ccataacttt gtccgaaatt caaaaaaaaa aatccttcac atgtgtcttg     11580
     gtaagactct caatcgtacc cacaatcaaa tcaatactat catcaaacgc atctagatgg     11640
     tcaaagaaaa tgtgtggtct aacaaaatca gtgctcaaac aaaatgtgtg ctcaaagaaa     11700
     gtgctaccaa aaatgcgctc aaaaaaaacc tgtggtcaaa gaaaatcagt ggtcaaatct     11760
     gcggtcaaag aaaaccagtg ctcaaagaaa aatgtgtggt caaaaatcag tgctcaaaaa     11820
     atcagtgctc aaaaaatcag tgctcaaaaa aaatcagtgc tcaaagaata tgtgcggtca     11880
     aagaatatgt gcggtcaaat ctgcagtcta aaaatcagtg cccttcaaat ctgcgctctt     11940
     tggcgctacc caaaatgtgg tcaaccagag aaaaaaatgt ggtcaaaact cggcgctacc     12000
     taaaaacgtg tggtcaaaga aaatcattaa taacttgcca cacaaaaagg gtataacaat     12060
     ggttcatttt ccaaacacaa attcattgac ctatctaact gtctaccaac tatcagttta     12120
     ccacctcttg tactgctctt cctgtgctct tccaaaactg accaaaaatc gctgtttttc     12180
     aaaaaattct gatttttcgg gtcgtgcgcg caaaaaaatc attttttctc ctgactctaa     12240
     atttttaacc tttttctgat gaacaacaac tcagagtata ctaaagttat aagcctaaaa     12300
     actatatagt ttatctccct ggactatgta gattcctatg gtacccttat ttttgcgcta     12360
     ccatctaaat tgggcaaatt ataagtgcta acaaacatgt ggtcaagaaa tgtggtcaag     12420
     aaaaaaacat gtggtcaagc taacaaagtt tgttagcaca tgtggtcaaa aatgcgcggg     12480
     tagcggtaga tggtcaaacc tgcggtcaaa aaatcagtgg cctaaaaatc tgcgctcttt     12540
     ggcgctaccc aaaatgtggt caaccagaga aaaaaaatgt ggtcaaaact cggcgctacc     12600
     taaaaacgtg tggtcaaaga aaatcattaa taacttgcca cacaaaaagg gtataacaat     12660
     ggttcatttt ccaaacacaa attcattgac ctatctaact gtctaccaac tatcagttta     12720
     ccacctctcc tggctgtccg tccacgtctt tccaaaattg accaaaaatc gctgtttttt     12780
     aaaaaattct gatttttcgg gtcgtgcgcg caaaaaaatc attttttctc ctgcccctga     12840
     atttttaccc tttttctgat caacaacaac tcagtgtata tcaaagttat aagcctaaaa     12900
     actatatagt ttatctccct gaattatgta gattcatatg gtacccttac ttttgcgcta     12960
     ccgcctaaat tgggcaaatt ataagtgcta acaaacatgt ggtcaagaaa tgtggtcaaa     13020
     aaaaaaaaac atgtggtcaa gctaacaaag tttgttagca catgtggtca aaaatgtgga     13080
     aacgaagtta tttcaacttg ttgaactatc aatttcaatt tatcgaaagt attaggctca     13140
     gattttattt accaaaggtc ttgttgtaaa acaggatctg caatatttca tgtgcagtcc     13200
     ttttgaattc aactcaggga gttcgacgaa tcctttataa ttgctaattt attattctct     13260
     attatatact acttctcttt ggaagacaat tcatatttta ttactttcaa ttattacata     13320
     ctgataatta gcttcgaatc tatagaaagt tagagcaaca tatattgtcc gtcgtaatat     13380
     ctaattaata aaacctagga atacttcagt ctcttcaggt aaccaatttt ttttaaaaaa     13440
     aaaaaaaaaa actcaacaaa aaaaaccaca aaaaattttc tttttaacaa atttccattc     13500
     taacaaacaa aaaaaaaaac aaaaaaaaac tcaacaaatt tgattggacg cttttcaaag     13560
     acaagttcct agccaattaa aatcattttc accttgagat cgataactag ttcaaataaa     13620
     atgattattg attgacaata ttagttatca atcaaacaaa aaaaaaaaca catacaacca     13680
     caccttcgca ataatttttt tttcgcaacc tgcagctatt ataaaacaca caaaaacaac     13740
     acaaaaccca caaaacctca cacaaaaaaa aataattttt cccaccccaa ataatttttc     13800
     ctttgtatta atttttatta ccacaaattt tatataccgt ttacagaaca cctgtttaaa     13860
     ctcctttttg caactttatc tatcagttat ttttaattat gagtcaaaca aataaatctg     13920
     gaccaaagag tccatctcca tcttcttctg acacgtccac tgcagctact accgatacct     13980
     cgactaatgc tactaatttg gcctttcaag caagtgtgga agcgagtgtc aacaaacagt     14040
     tacaggcctt ccaagaacag atgatggaaa tgttcaatca atttgctagt cgatatgaac     14100
     agcaaacagc acagggtatc aatcaaaccc gtgaacagga agctcgtgac tttcaaaaat     14160
     ttaattctgc tggcatgaag ttggaatctc atgtccagga ggttgaacaa gaaactcacg     14220
     aattggaaaa ggaagtcgga gcttttgaag aagcttataa caagcgtgtc cgttttgaag     14280
     acgaacgttt tcaacaggct tctaatgtta tggctcaagc tcaggacaag gaatcggacc     14340
     ttcaagagca gattattgct ttaagggacc aaatggctga gttaagttct aatcaactgg     14400
     ctactctggc caatgttcct aaaccagttt tcgttactac tgatgacatt gccatacaga     14460
     ttaaacgtat ttttccactg gctgatttga ctaatactga ttgggaacaa accaccaaca     14520
     aatttccaac ctttatggaa gcctatgtta ttgattcatc cgatgatgac actatggtta     14580
     ctaaaatcca ccagattcaa aattatttcc atggtaataa attaaataag tcagcttggc     14640
     cttatgctgc acagccttat ttgcggggtg acttagctaa cggttatcgc tatgcccagt     14700
     tgaatcctct caatgctaat ttccaatgga tcgacatttt gaatgtaatt agggaaagtc     14760
     gtaattggga tatttacaat atccaaagca ctgttaaata ccaattgtat gttccacaac     14820
     ctggtcaacg tgttaccgag tacgtccaac aatttagaaa tcttgccagt agtacaacaa     14880
     gctttaagaa ccaattttat gatgtcaaag ctaccttgtt aggtcactta tccaaatatt     14940
     tccagtctga tatcatccgt cacaacttaa ccactatcaa caacgcccaa acctttttca     15000
     ccaccgttaa cctgatcttt attggtgttc attttccagc tacatcatca tctgacaatt     15060
     ctgtggccca aattgaaacc aacacagacg gaaatatgga tgtgaattac cttaacaaat     15120
     tttcaaagaa acccggtaac tataggtaca acaataactc aaactttaaa ggaaaacaac     15180
     agtatcaggg aaatttcaca cccaacggat ataagtcgaa tagcaacaat tataataaga     15240
     gcaacaagga ttatcagggt tacaaacgtg ataataatag tcgtcgtttc aaaaaaattt     15300
     atgaagtaat cctttctgag aatgaatccg acacgtctga cattgatgct aatctttctg     15360
     agctttcttc tccagctgaa aacaacaatg acgtcaatga gattgctgag ctcgacatcg     15420
     atgattttga tttcattgcg aagcatcgct tatgtattta ttttagatat gggtcgttca     15480
     aatcttaaga taatcctaga cactggagcc gcaaataatt ttgcaccagt atctattggt     15540
     acatattata gggatgccaa aattttccaa ctcaagaata ttattcgagt aaaaacagct     15600
     gacggaacta ttcatgaaat tacccaagga tgcaaaataa tgttaccacc accttttcgc     15660
     accacttatt tagccaatga atttggatgg aaagagggac agttatcaca atcttcattg     15720
     ttgcaggacc tcgatgatga cgtacaagtt cgacttgctg aattggacgg tgtaaataca     15780
     aacgttgaaa aacataatga tcttagggtt cgtcgaatgg cttatattaa tctgatgcga     15840
     caaccgttcc aaaaactggc ttcatttatg aaaggcgatt gggttcttct tttctcaatt     15900
     acagtccatc ttcctggacg tcccttttcc atcatccccc aatctggata ttcctgtcaa     15960
     cagaattgac tattcccacc cacgcccacc gtcatacaac gactatggaa actctcaatc     16020
     aatttgttag tagacatgac cagcaaacag cacaaggcat caatcaaacc cgtgagcagg     16080
     aagctcgtga ttttcagaaa ttcaattctg ctggtatgaa gttggaatct catgtccagg     16140
     acgttgaaca cgacacacac caattggaaa aggaagtcgg agcctttgaa gaagcttata     16200
     acaagcgtgt ccgttttgaa gacgaacgtt ttcaacacgc ttcggatatt atggcccaag     16260
     ctcaggacaa ggaatcggac cttcaagagc agattactgc cttaaaagaa caaatggaaa     16320
     ctttcagcac tacccaaccg gcagcggcat caactggccc caagtccagc tttgttacat     16380
     ccgaaaacat cgccactcag attaaacgta tttttcccca agccgattta accaacaacg     16440
     attggaatca acctacaaac gaattcccac cttttatgga tttcaaaatc ttgctttgct     16500
     aaattgttga aatgattccc tgtaccatgt ccgttttgat tgcaacggaa gcaatggttg     16560
     ccgtgtttac aagaccatct tgtatggaat aaagtagggg aagtggtgca atatttggca     16620
     atggatacca aatctaattt gtgatgtttc caaaagtatc tgctcttttt ttggaacatt     16680
     gtttccggac catccaatca taaaataaga cgtagcatac ttgcgaggtc tatgagcttt     16740
     tgttgctttt tcttcagcat tatgaacttc acttttcaaa atgctaaatt cgatattctc     16800
     ttctgtagtg gggatatttg ctgccagctt gagtgctggc atccattcgt ccctcttgtt     16860
     atcaaaaaag gcatgtatta atttttcaac tttccactcc tcggctgggt ggagaaaaca     16920
     gtagatgccg atgttgtcgt gatggttgtt tttaacaacc accttgtatt tgtttttacc     16980
     cacttggact tgtgggtatt tttccaaatg gctttcaatt gccatttgtg aatctaactc     17040
     tggaaactta tctgaaaatt cttctccaat ttatgagtag ataattctgt atgtaccgtc     17100
     tgtcataaat cttactctga ataagtcttt ttccgctgcg taaagtaatg ccttctccat     17160
     gtcggagtcg gctccttgtt ctctaatagt atttgggatg gtttttttca agtggacctt     17220
     gatggcctct tgttgttcaa agtaacctcc atccgagtct ctttcatcga ccagattggt     17280
     gtggtcacca ctatatttgt cggtcaccat gtcggagaca cattctctaa taaacgcctt     17340
     actggcgccg tctaatctat tcaacatagc aggccattgg cttgctccaa tgttcttcac     17400
     gtaggtaacc atattctcca actcctccaa ctcatggtcg gtatctgcat ggggctccat     17460
     ctctatttct tttttgcttt ggccaactgg tggccgtacg tgcccgtctt ggtactcccc     17520
     ttcttcggtg gtggcggtgg cagcttttct gcaaaatgca ccaacttctc tgccatggtc     17580
     ggcggcttgg ttgtcataat taaaaacgaa acttaaactc tctgaatgca ataatatgaa     17640
     gacgctagtg ttttataaac gggcctccaa ggtgtacttg tatgtaaaaa ctgaacgcaa     17700
     aggactcact tgctttcgat ggtatattgc caatatttgt aataacatcc tccattattg     17760
     aaaatgataa atttggaata acaataataa gttgtcttgg tagtttcttt ttgagaggtg     17820
     tttgcccatg actgggcccc cttctggtga agagtagtag ttgttgttgt tttttttttt     17880
     tggttgttcg ttttttcttt ttgtataggc tggtatgtgt acacaccaat taaccaaacc     17940
     gtacggatgc cccagcttat tgaaaattgg gggtgcttgt caccccctca ggatgttgta     18000
     cggatgaaga ctggtacgga tgtacaactt gtacggatgc aatagtggtg ttgagagaac     18060
     ttgtacggat gcaatacagg tgtagagaac ctttagagta gttagtctta gtaaatttgt     18120
     tacagcttca catacaaact aaatatgcta gtttgttggt tttcctaatt cacagatagg     18180
     ccttttaggg tttgatttga gtcactgaca agctgaaaag agttgttcat ttttggttga     18240
     caggaatagc aattagagct atttgtttta agttagaaaa ttgagatata gttttttatt     18300
     ctgtaagttt atagacaggc caactacagt tgtttgtttt aagtcgtaga tagatgaatt     18360
     ggagtggttc gtttttaaga ttcatacaga aatcaaatac agtttattgt ttattttgtg     18420
     tttccttgca aatagacttg tttgttttta atcgattaca gtagatttca tttagcttct     18480
     aatcaattga tctgctccag atttcgtaaa atcaaatgtt atttttgagc aatttatctc     18540
     tgtattttcg atcctgtttc tcacaaaata tccccaaaat gaacaatatc cccatttgat     18600
     gactaaaccc cttatccttt gctcataact taaccattgc acttctctat acatataatg     18660
     gcacctctgc cagcactggc ttgtcctgct ctaagatcac ccctgtcatc acctcatcgt     18720
     gactaacctc catcatattg tacttttctt tccattgcca tccttcacaa gcttgtattt     18780
     taaactcaac ctcaacctaa actgggtgat cacataccta cccgttattt ccatcttctc     18840
     aagaacggcc ttaggaatat aagttttgac gtgccccgtt gagcgtattc gccccagcac     18900
     tctccatatc gatcaggtgc aagtcttgcg ccacatctcc catctccaca aatgtgtaaa     18960
     actatcatga aacttaatag ggctgcccat gtaaccgtgc tggccaatca aactcccaac     19020
     ccaaactcta ttcacattaa acgtacaact caagtaaatc gtaatcccac ctgcttactg     19080
     atactctggg tgatatccca caagtgccca ctctgggtag tagacacact aaacgattcc     19140
     tcaacatgat ctggctctag tgactttgcc attccaacat gtgtgctttg tattccattt     19200
     gtttgcgata aattgttttg gctgtcgaaa tatttttttt gggttaggtc gctcaccatt     19260
     tctaaaccgt acggatgttt aacttctggt gttattcttc ctgggggtgc ttgtcacccc     19320
     ctaaattacg gatgagagct tgtactgatg ctagatgttc tacgaatgat ggcttgtacg     19380
     gacgcatcac agttacagat gccttttagt tctaccaagg ggctgatttt tgatctaccc     19440
     ctagagtagt ttgtttgtgt gtttttggta tagtttctcc acaaaattac accaaaaaag     19500
     catcagagac tgtattccca caagaacctc tacatttcta taatgagaag accacttatc     19560
     aaccaatcct ttgttgacta ttcctggccc ataaaactac cgtcccacaa ttactgtagg     19620
     tttatgttta cctctgccat accagcactt gcacttgtcg agccgtacag atgtcaaaca     19680
     aactaggtta tactttcagg aggtttacca ccccgacctt gttacatctg ctttatacat     19740
     ttcggcatag ctccagtttg gggtatactt gttaaaatct tagagaaggt taatttttgc     19800
     gtgtacctat gccaattttt caggtgaaac ttttatctgt ggttcaattt ttttcaccaa     19860
     tcaaaactca agtaatcaac acttcttttt cctgctccta ctcaacttca acacactctc     19920
     gttacactcg agtgctcatt atgcctactg ctgctggatt attattaagt tctgtctttg     19980
     gcgcatctgc cagactcctc caaaccgcca tgagtggcag cccatccaaa ctatcctcca     20040
     aaattattgg ctactccaca ttcatgggct tttccaccgc catctacctc cttgtcatcg     20100
     acccaactat ccaaaacaca aacctgcttt tcgaacgaag attgaccttg ttgcgtgaac     20160
     aaagagaaaa gagagctgaa ttctacgact ttgaacctgc tacaaaacaa catccatata     20220
     aaagaggtgc attcactcaa cttcttgata aattcggtgc taaatactaa ttttcccgcg     20280
     gactttcctc atttaaatca ctattatact cctcctcaac atcactctcc tcttcccccg     20340
     actcaaaatc atcatcttct tcctcatcat catcctcgac attcccattg tgttcgtgta     20400
     caatttcgac cagatcatca ctctccccct taaacgtgct atcttgaata tactgcatct     20460
     ttataaattc atcaataacc ctgtagaact tttcatctat catgccaaac tccaactctc     20520
     tttcttcccg cttcttattc aagaccgtca tattcaaact gaatgtttgg cgtgtgatat     20580
     tgctatagct ggtgtgcaac acttgactcg cctcatacac caatatcggt ttcttaaacc     20640
     caaatataaa gtatgctggg ttcgtcttat tcgcttgtaa aagaatcaac accccttctt     20700
     tggctccctt gtggcaattc accataacca acgtaggctc agacgcacca tcagtattca     20760
     tcgcaatcgc attatcgtta ttcaaactaa acgtgttcct aaaaatcgac acacacggca     20820
     agtaattcat catttcaatc ccacaaagct tgaattggcg tttaaagtaa tcaatgatcc     20880
     gttcttggat gggatttaaa gggagagagc cccttgctgt aacaaacttt gactcaatgt     20940
     cggcaggcaa cttgccactc ttgatcatca gcttcttcac tgcatccaaa ttcatctgac     21000
     aaattatcgg gtcggtaccg tcatgcatcc aaaaacacaa ataacaaatc gccttcttct     21060
     gggtgttggt ggtgttccca agtatcggca acaacaaaca aagcttgacg gtttggtcta     21120
     gttccgtaaa tgtcatttcc ggaacattgg tcgatggatt gacaattgaa agcgcgggac     21180
     tgggattccc accttcctct accaaatgaa gcgtcaaatt cattctcttc ctcactggcg     21240
     aataaaacga tatctcgttg atttcaaaaa ttatcatttc cagggcaatt tcgctactca     21300
     atttcctttt cttcgtactc ccactcaaat gctcatacaa cttttcaaac acaataaaac     21360
     tagccccatc cttctccaca acagccttga tttcattctg caactcggta ggcaactccc     21420
     gaacccatgc tgaatccatt gttgataaat agaaagtcgc caactaattt tttttttttt     21480
     ttcgcgaaac aaatcaccac ttttctttac atggacgaat tgtttgacgc caacgcaacg     21540
     atcttgcaat tactaccaag caccctcccc ggcttgattg aaaagcctag cattgagcga     21600
     tcctttaatc acgacaaggc agctgtctta accatgctat tgggatcgaa attcaccaac     21660
     gcgctagatc tcgccctaag tctgcaaata tcaggcgacc tatcaaacct aactttcacc     21720
     caagctggcc tacagttgcc tacacataca gatatgacaa actggtactg taattgcatc     21780
     gaataccaat catgctacac ttccaacatg gacataacca ccatagccgg tacctcctgg     21840
     atccaccaga ttttgggcac tcacgtgtta tctccgattc ccatatgtag tcatatacta     21900
     gctatattaa taatcaaata caacccgcag ctcgacctat cgtcgtgtgt gggtcaaact     21960
     tgaacaaccc aaaaaaaaaa aaaaaaaaaa aaaaaaatga gcaaaaaatt tttctcttgg     22020
     tgatcaccac taccaccacc aacccatgtt ctaaccctat gacctcctcc tcatcaaact     22080
     caggctctct gcgctttcgt ggagacgcag ctagcttttc acctagccag tacccaaact     22140
     accaacaaca gttccaccca caacagtaca tggcccagca gatcccggcc caacaacagt     22200
     tctactacca gttcccacaa acatacccgg taatgatgaa tcagatgtac ccagtgtttc     22260
     cttacccccc agacccattt ttccaacaac agcagcaaca gtacatgatg cagcaacagt     22320
     acatctacca ccaaccacca aaaccaccaa aacctaccaa accactaaag gtgccaccaa     22380
     aagaaaaacc ggacccgccc aaattcccct tgtacattaa tacaaccaaa tccgaattcc     22440
     tccaacgatt cagcataacc caggaggcac ggtcaataga cgagctccaa aaagccaata     22500
     cattacccca cgaaaacgga ctaactatca ccaccaacac cttccaagta atagactcta     22560
     acgaccacaa caccaccctc ataaaagaac aaccagaaga gccggccaaa gccccagctc     22620
     cgcccgtgcc aaccaccaac tgggcctctt tccttcagtc gacagcaccc ccaccaccaa     22680
     agaaagttgc aaaaccaaaa ccacccacca cccacacgac ccccgtccaa ccaccagccg     22740
     ccaaattcga catcaatacc gaatctgcac aaccgttggg ggtgttgttg ctcaaaatca     22800
     tgtttgacac caactactcg gtctttacca ccttgcccac attcgatata aaaccaagag     22860
     gcttgactaa taccggcaac atctgctaca tgaactcgat attacaaatc ttgatccact     22920
     gtgacccatt cagccggttg ctcaaactta tagaaacaaa atcaatagga agcttgggcc     22980
     catcgtcgac accattacta gatgcaacga tagccttctt caaccagttc caggacacct     23040
     ccaagggggc agtatctgcc gaacctttct acacccactt gactaaactc gacaaatttt     23100
     cccacttgaa atggggacag caagaagacg cagaagagtt tttggggtac taccttgatg     23160
     cacttaatga agagtttttg gctgccatca aacagttgaa caccccgcaa gtcgattcct     23220
     tgatacaggc ttacgcccaa gatcacgacg ccgaggctgt cgccacattc aaattcaatg     23280
     tcaaatccac catcaagaga atcaaaaacg acaccgacca ggacaccgac ggcgaatgga     23340
     gtcaggtcaa caagaaaaag aatagctcca ccaccaaaat agaaatcgac cctaccccac     23400
     ttaatatgat ctttggcggc gagttcaagt ccgttgtcac catacccaaa caatcttcgt     23460
     cattccaaaa atcaataacc ctagacccgt tccagcacgt gcagttggac atatcgtctg     23520
     tcgacaccat cgaagacgca ttcaagcatc taaacgaatc agaaatcata agctacacaa     23580
     acaacaacaa ggaaatccaa gtgaaaaagc aaacatttat tgaaaaattt ccgaacgtat     23640
     tgataataca cctaaaacgg ttcagctact tgaaggacca cgaaatcggc gtcgaaaagt     23700
     tgagaaaaaa agtagactac aatcacgacc taataatacc gaaagaagtc atggcaaagg     23760
     ataccggcgt gccaataaga taccaattgg tctcggtggt gtaccaccac ggaagcagtg     23820
     cagatgccgg gcattacacc agcgacatat acaacgtcgg ccaatggtgg agaatagacg     23880
     ataccgccgt caaacaaata aacaacgaag aggtgttgaa cgctggaaca gaggaaaata     23940
     taaagaatgc gtatatatta ttgtatagga gaatctaaat caatgcaacg agaacaccag     24000
     caacagcagc acaacccatc cctaatcgtt tagcaccatt cgactctata acactaacat     24060
     tcgcaaccga cgaaggcacg gcctctaccg tagcaacata atcaagcgta cactcgccag     24120
     ttagcgttaa ggttgtagga cccgttatcg taactacctc gtcattaaca gtaatttctg     24180
     tggattcagg acagtatgtt gtataatcgg taaccaaaga ccaggtggtg gtattagaag     24240
     cagcaacaac actaagcaaa ataaagtaaa acatgattga taaagtgtag gtagttggcc     24300
     taggtactgg attttttctt gtttaaatat tttttttttt ttcgcagctg ggctggctaa     24360
     accgaaaaaa gaaaaaaagg tggcccagaa ttttttgctg gatgaatgac aaaacacgcg     24420
     actttcatta aactataaac tataactctc taccaacatt cgtaacctcc atctacaacc     24480
     aagttatgac cagtagtgta tgacgaagca gactccgatg ccaagtacaa gatcgatcca     24540
     acaaactctt ttggctcagc cattctcttc atagggatct tggactccca ctctgctttc     24600
     atctcagtgt ggccactaat aacgtttctc gtcaatggcg ttaaaatgta ccctggcgac     24660
     aacgtgttga ctctgatatt gtacttggcc cattcacagg ccaaactcct agccaaatga     24720
     atgacaccgg ctttcgacat gttgtacata cattgtggct gtgggtcgtt cacaatcgtt     24780
     cccgacatcg acccaattaa aatgattgac cccgtcatgt tgttttgaat taatggtcta     24840
     gcaaacgctt gtgaaacgta gaatgaaccc aacccattga ctttcataag attttcagca     24900
     ttcttggcag ggtactcttc agctgggaaa ttctcagcgt atccagcagt attaaccaaa     24960
     acactcgaga tcttgccgtg gtgttcatta atggctttga atgtcatgtc cacggcctca     25020
     gcatcaccaa tattacatga ccaggcactc acttgcccga taggtgactc atatttccct     25080
     ttcatttgtt cttcccccca ttgtaaaacg tctcttgcag cttgttgtgt tctctccaag     25140
     ttcatatcga ccaacgcaat atcagcacct ttggctaaca aggctctcga tacaacagca     25200
     gctaaaccac cagagccacc agttaatatg actaactttc catccaagcg gaagcttggg     25260
     actatatttt cgtatgacca gtatgcggat tccattatgt gtagtaataa tgaagaagaa     25320
     agaaaaaaaa aatggatggt ccaaaaaaat cctgaggttc ctctgtttat atattttctg     25380
     gagacaaggg gtgtgtgatg accgccttat ttcttttttg tggtttcgga aagatataaa     25440
     aaattgttat gtatgataac accgtgggaa ttagctccac ggaagaatta taaaaaaaat     25500
     gtctatatac aggaccaacg ttctttttta aatacctttc gattggcggt tctttttata     25560
     gatacccaca tacccctaca tagatttgga aatatcttta gatataggtg tttgtgtaac     25620
     acatgaattg gcatctaacg tcatcgtcca ccttttgaat ttctttttct gaaagcattt     25680
     ggatgtggaa ttctgtcata tcgtttcttt ttgcgagatt ttgataccaa aaaaaaaaaa     25740
     aaatagggcc aaccaaaggt gcttcccctc ccacttggct gcccaatccg gcatgcccag     25800
     ccggtggtat ccccgcctaa tttaaactat ataaatggcc caccttggcc caccttggcc     25860
     cacctctttt ttttttatct acccaccacc aatgtcattc acaatcagac ctattgaaga     25920
     aaaagataaa ccagaatggt tgcacctctg gactagctac atcgagttct acaattcact     25980
     cgacaaaatc actcctgaaa tctccagcac tacctttgct agatttcttg atgccgacga     26040
     gccagtatac tctgtggtag ccgtcgactc taccagcaag atcattgggt ttgctaatta     26100
     cttgacccac agaaacactt ggacaatcga agatgcactt tacctcaacg acttgtttgt     26160
     cagctccgaa aacagattac atggcgtggg aagaaagttg attgagtaca tctacacaga     26220
     agccgataga ttaaactgta agaaatgcta ctggagcacc caatttgaaa accaccgtgc     26280
     ccaattgttg tataccaaag taggcgtcaa aagtgggttt ttattatata gaagaccctg     26340
     atcaatgtac acgaccacaa agatttgtaa acaactgttg ttgttgtttt tttttttttt     26400
     ttttttttgc ctctctgaat cttcttctct tgtttatcac ggcaatgaat tttatcaaga     26460
     agtttattgg gacaaccact accgacgagg ttgctctgat tccgtcagga aagctttatc     26520
     tcacacgttc aaaacaatca ccaaaaggtg cgattgagtg tctttacaat gacgcatttg     26580
     catctatcaa acgcaccact agcccccact actatcaatt gtgtatcacc aaagtttacc     26640
     aagaaggaga atctgatttc aaccgattcg atgactcaga agaggaatac gacggcgacg     26700
     atttggctcc tgcaagcgat accaggcgcc aatccaaaga cgaatggatt ttccccattg     26760
     ccgacgaatt aaagatccat gtgtgcgaaa aggaagacgg ctcaagagcc attgcttgga     26820
     aagatttgaa tggcgatttg ggagataagt ttgagtttgt cattgacgag gaggtgagag     26880
     ggagtgaggt tgacgccttt cgcatgacca tctataaatg tttatttgaa aacaagtacc     26940
     agaccgagta ctcaaaggca aacgatctaa acgagtttat ctacaacccc aagggagaat     27000
     tgttgacttt tgacgagttg aaagatttga atgatttaga agagtttgac gatgagacag     27060
     acgagtacga ggattgtgat gaaaccttac cggctaacaa agatgccccc aaaggtgaaa     27120
     caaaatacgt gaacactgat gttgacttgc atttatatga taccagaaca ggaacattta     27180
     tcttccaact ttcaaaacct gaggtaaagt tggtggattt gggtaattgg gaatacacgc     27240
     tctacgtcca tggcgaatct acacgaatca acactacatt gagcaagaat atgaacccga     27300
     cctttaatta ccaacacttg tcgtttattt ttaatgacta cacggttgac gaagatggga     27360
     ttaatgccca ttcgtggttg ctcaagtttc ctgattataa cgacttgtca aagttccaaa     27420
     cggtattcct tgggttgatg tatgaggcat tgaataaacg gaaatgggga gaaactgaac     27480
     aagattattt tgttgatgca ttttccaaaa ttagtattaa taaagacgcc aaggaattag     27540
     aaagcgagga agaagaagaa gaagaagaaa gcgaagacga gaatcaaggc gacggtccag     27600
     taaaatggga aagcaaacaa aacgaaaaaa acagtaattt gactgtgggg tatgccaaag     27660
     accgctcata tgtcgttcgt ggagacaaga ttggtgtgtt tagtgaagac gatgctggtc     27720
     aactcaactt ccaaacagca ataaccaatg tggcagattt aaaaggtaac catttcactc     27780
     ccgagaaaat gcttcttcat cagcaggacc aatatatgat tatttctaac ccacagtttg     27840
     acgacaaggc attatacaag atggacctta cacggggcaa gattgtcgaa gaatgggagg     27900
     tctcaaaaga cctaccagtc aagtcgtatg cccccacatc gaaatttgcc cagttgacag     27960
     acgagcagac cttaacgggt atttctgcaa acgggctatt cactatcgat ccaaggttga     28020
     gcggcaccaa gttggtgaat gacaaaacat acaaggcata caaaacctct aataaccaat     28080
     tccagacatt ggcaactacc gacaagggct atattgcgtt ggggtctggc aaaggtgata     28140
     ttagactctt cgatagatta ggggttaatg ccaagaccgc cttgccgtcg ttgggtgatc     28200
     cgataatcgg aatcgacgtg tcgaaagacg ggagatggtt gcttgctaca tgcgagacat     28260
     acttgctatt aattgataat aaaatcggcg acggtcaaaa gaatgctggc aagttaggat     28320
     ttacaaatta ttttgacaag gacaagaaac ctacaccaag acgacttgca ttaaagcccg     28380
     aacacgaagc gtatatggtg agagaaaacg gtggcaagcc tttggcgttt accccggcat     28440
     acttcaatac aggtcgtgat tccaaggaaa ccaccattgt cacatcgttg ggcaagtata     28500
     ttgtcacatg gtcgatgggt aaagtgttgt tggacaagcc aaacccatat ttggtcaaga     28560
     ggtacacaca aaacgtcatt gctgataatt tcaagtttgg gtctaacaat gaagtgatta     28620
     tggcattaca ggatgatgtt tcaatggtga gcagacgaag tttggctaac ccaaagaatg     28680
     tttttaatta ggcttatata gttcacaaat atatattatt atttaccaaa accgaaacgt     28740
     ttgtttcatc tcttgtaccc atattctgcg aaacgcattg gctttttgcc accgtgtggg     28800
     cttgaaatcg tggatgtcaa actctgtcac tttcgaagcg tcgggaaact cttgataggg     28860
     gattcgattg attctcgcat ggatctttct cacccagttg ttgaatcctg gagattcaat     28920
     aaggagtcgg tacaagtatt cctgaaggga gtttggtgga ggtctcataa tgcaaaagaa     28980
     atctggtggt tgatcgaact tgttgctgac ctattgccgt gtagtaatga ctgaattttc     29040
     cctggattgc tgttttggga gaaatgtaaa caaactttat ccatcactca ctccaaaaaa     29100
     aaaaaaaaaa aaacctcaac acaaatatcc catctttctt cttcaccatg aacacactag     29160
     catcagacaa cgagaagatg gacgatcttg aattggattt tactgatata ataccaccag     29220
     agctttcagc acagcctcgg caaagcagaa tatcattgcc tccagattac accactacca     29280
     accatataac caacgaattg ttccaagtaa ctagcagctt gagagaaaaa aaccgccaaa     29340
     accccaaacg gttgaataac gataaaatac agaaaatgat ccaggaccta gagaagacag     29400
     attacgagct tgacgatgtg gtgaggacaa gagtgtttaa aggaagacta aagaaccggc     29460
     acagcttcac ccaagtacgc cctgatttga acgaatactt tgatgaaaat aaagagaacc     29520
     gtgataagcc atcaaaagtt acaaagaaaa agtcgcctgt gcctatacta cagccaataa     29580
     caaacactat aaaacgatcg cccaagagat tgtgtttgcc caaacactcc gtgatagctc     29640
     cacgaaaacc agcactcaaa gcagaccgtg catccagcat ctttcttatg gaatcgctgt     29700
     cggggctagt caatgatgca actaaatatg ccaccgagct aaatagttca cagtgtgacg     29760
     atttcccact accggaacac gaaaacgagg tagtgcaaat ccccaccaac gaagacgaca     29820
     acccgaaaat ggccattatc cgcatgttta aaacaaaaag gtttgacacc aaagctgagg     29880
     gagaagcaag cgggttctac aatgaaaaag agttccaaaa gtataaaggc gagcaggaca     29940
     atggggtgct ggtggtttca caatcagtga atggacccac cgccaaaaag acagttaaat     30000
     gggccacgaa tctagaatgg taaatacagt taatatatga aaatgccacg ctatacgaaa     30060
     aatgcgacca acgaaaaaaa aaaaaaaaac aaaatctcgt ccacctctct tttctctatc     30120
     aacagccatg tcttctacgt tttttgatga aatgaccaaa tcgttcgctg atgtaaaggt     30180
     cagcgacggt aagattgata ctgctgactt tttactagca tccgagtcgt tggttaagtt     30240
     gtttgacctc ttggggtcgt ctgcatttac tgtggtcaag tcagatatga cgggtaatat     30300
     taccaagata cgtaataagc tattggagga cccagccaac tcgtctacct tgcaggactt     30360
     ggtgcttact gaagccaaaa ccaagacaaa gacggctacc caaggcttat tatggttatc     30420
     tcgtgggtta caatttacag ctcaagctat gagagagact gttgatgctc caagcaagga     30480
     attgacagtt acattcactg acgcttacac caagacatta tccaagttcc acgggatttt     30540
     ggtcaagcca gttttcaagt tggccatgaa agcttgtcca tatagaaaag attttttcga     30600
     aaagttgggt gcggatcaaa ctaaggtcgc tgagcaatta caaaagtggt tagaggcatt     30660
     agaaggtatt gtcaagatta tcatggactt tttcgcatca ggtaactatg gtaaaggttt     30720
     ataagtcata tatatatata tatacattta ttctatactt tcttttccga ttttctttgt     30780
     tgcctccatc aattcgtgta gttgaccgat ttgttcaggg gacatcttgt cgagatcgtc     30840
     cttactcaac tttccatgca gccatgaccc gccatcaatc tgcttcaagt agtcttgcca     30900
     ttcagttaaa aacccaacaa tgtgtagggg gttgtcgatc tttttatggt ccttgaattc     30960
     ctttttcaca tattggtcac ctaagtaacg caactcttgc ggtaacttcc tgtgatgggc     31020
     tcgtaagatt gctcggtata atggaagcgg tggaagtatc ggggaagtat ttctctctgg     31080
     acgacgtggt ttcacaagtc tcacaagggt tggacgcatg gttaaagtgt tgatgatttg     31140
     agaatttttt tctttttttt tttgtcgctg ataaaattaa gtcttaaacc tacaacaacc     31200
     tttttcgtaa aaaaaacagc aataaaaccg aatcaagatt tcgtcaatca caaccactgt     31260
     cccatatcaa tccgagacaa tgggtatact cttttggtat ccaatgtaac taaaataaaa     31320
     acaaaattta aacttctggg tgaacatttc ccaaatagga agatgtctaa tttctgacaa     31380
     aaaaaaaata tttttactaa aaatggagta caattgaagg atcaagatat atatgaaggg     31440
     tcaaagtccc acatcccaaa taattttttt gggcaccact tctttttcct catcatactt     31500
     taccaatgag atcttcatta ttaatattgt tggccagtgt tgccattgct gctgaaccaa     31560
     gtgttatccc agttgaagct gtttccgatt tacaaataaa agcaagcgta tccgacgaag     31620
     caattgtacc tactactgac aaagctagtg ggactgtggt gccaccaact attgctacta     31680
     ctgatgctgc tgctgctgct gctgccacta cttctggctc gttattggga gatttggtag     31740
     atggtctttt tggtggtaat gcccaaaatt caagtgtaaa agctacacca accaccacca     31800
     ctgctgctgc tgctgctgca caaagttccg gtggattttt agatggttta tttggtgact     31860
     tgcttggcgg aagcagttct gcttctaact caactgttac acctaccagt ggttcttctg     31920
     acggaagttt atctgattta tttgacgaat ggtttggccc atccaactat accaagacca     31980
     cagacgctgc ctcttctact ggctcagttt tggacggttt atttgatgat ttgtttggcg     32040
     attcagggtc aacaaacact gggtcaacct catctagcgg aagctggatt gatgatcttt     32100
     tgaatgaatt tttagctcct tcaaatagtt ccgactctac tactccttct tttgatggca     32160
     gcgatctttt gaatgacatt ttaggtattg gcgaaaactt ggctgacgac ttgttttcca     32220
     acattgacgg taagagcatt ttgacagggg ttttaggttt tgctggcgaa atttttgacg     32280
     atttatttgg ctcttttggt ggttccagtg cttcttcaag cggctcttcc agtgcttctt     32340
     cgggtgggtt cttgagttct ttgttggatt caatttttgg tgattcgggt tcttccggat     32400
     cttcatcttt gccatctaca tcgatttctg atattgtttc ggatgttttt acatctcttt     32460
     tcggtggtat tcttggtggg tcaagcgggt acactggatc tacaaacaag gtgtgtactt     32520
     tgaaaaagag atctcttgaa aagaaagaga tcagaaagct tgttaggaaa agtgtcaaca     32580
     aagtgattgc cagaagacaa caagtcattg ctgaaaagaa acaggccaat gccaaaagag     32640
     ccgaatctct tttagtttag tttgtatatt aataccctct attagaaaaa gttcttttta     32700
     atacaatacg aatattattt ttagaattaa tctccatatt ttcccaaatt agtaaaccac     32760
     gagcactgac ctttcggcaa attagctttc caagattgga ccccccctct tgtatgtttt     32820
     tgttttcctc tttgtgcctt ttactgtatt tggactggca attaggttta ttactgtatt     32880
     gggaatagaa aataaaaaga gtagtgcgtg gcacattttt ttttttagtt gcaaaagaat     32940
     ttcccaattg agttgtattg tattgtcctt gttaagcaca aatatatatc taccaatttg     33000
     ctgtaaagta aaaaatttgg gaaatctttt tggtttgttt cttttaagca aactttcaat     33060
     cattcgttac aagtcaagat caatcatgaa agtaacaact gtcagttcgg tgttactaac     33120
     agtcactgca gtgaccaatg caactgaaat tgacaaaaga agtttttttg gtgatctttt     33180
     ttcaggatta actgggagta aagcagctgc tcctgctgct cctgctgctg ccgtcccagc     33240
     tgccgctcag tcatcagtgt catcggccca accaactact acagctgcag ccttacagcc     33300
     tgatgcccag aataatgtgc ttttagattc atcaaacagc acctccattc aaagctcaac     33360
     gaaatcttca acaaccactc attccacagc tggtttatta gataatttgt taggatcaag     33420
     cagtgaatcg atcactcatt cctcgtctga tttattagga tcaagcagtg caacagccac     33480
     acgttcctcc actggtttat tagatagctt gttaggatca agcggtccaa caagcagtga     33540
     atcaagtgaa gcttcaagtg aatacttatc aagtagctca tcaactacca aacgaccaac     33600
     tgctgctgct aaaggttttt tcgatgattt atttggcact caagcaagtg catctgaaac     33660
     tgacgatgaa gattgtgttg aggaaactga gagtccaact tcaaacaata ttggctctaa     33720
     aacaaaaact gtgagcccaa cacaaagctc caacaatgtt ggctctgaaa cagaaactgg     33780
     ttctagtact accactagtg gtggtggagg tttcccaggc attttgtcgg atctctttcc     33840
     tggcaattcc aaatccaaat cttcaagtgt tccaagttcc agtgctgaag aggatgacga     33900
     agagtgtgaa gatccaaccg attccgtagc ctcgaattct aatcctactg gaggaatatc     33960
     atttcctagc attccaattc caagcttgcc atttcctcat agtgaagaaa caggggtgtt     34020
     gtccagccaa acaggtgtac caaaaagtac ttcttctgag gaagatgatg atgaaaccga     34080
     ttgtgagacc gaaacgccaa ttattccaac catcattcct acaggatctg tccttccaac     34140
     catcattcct acaggatcta tccttccaac cggatctatc cttccaacca tcattccaac     34200
     tgattcggtc actctcccat acaattctag ttctattgct ggtacatctt ctgttagctc     34260
     cgaagaagac gatgatgaaa ctgattgtga gactgacata ccaactggaa cagccactgt     34320
     cattccaact ggttcagtaa ctatcattcc aactggctct ggttctatca ctgttcttcc     34380
     aacaaagtca gttccaacta gttccgaaga agaagacgac gagactgatt gtgagaccga     34440
     cataccaact ggaacagcca ctatcatccc atctggctca gtaactatca ttccaactgg     34500
     ttcagtaact atcattccaa ctggttctgg ttctatcact gttcttccaa caaagtcagt     34560
     tccaactagt tccgaagaag atgacgacga aactgattgt gagactgata ttccaacgat     34620
     catcccaaca aggtcggtga ctaaaacatt tacctctgat ggtgttccaa ccacacaaac     34680
     actcactacc aaattgccgg gaacgaccaa tcaacacact gaaactgaag ttgtttccat     34740
     cacatatact ggtggtggtc aaacctttac cacatacctt acacaatccg gtgaaatatg     34800
     tgatgaaact gttactttga caatcactac tacttgtcct ctgacaactg ttgctccagg     34860
     tggtcagatt tatacaacca ctgtaactgt tattaccaca cacactgttt acccagatga     34920
     ttgggaagat gatggttacg aagatgaagg gggttcttca ggtggctctt caggaagctc     34980
     ttcaggaagc tcttctaata atgatgatga cgaatgggaa tggtatgaag aagatgatgg     35040
     taattgtgtt ccaagtggtg gttcaagttc tggttcaagt tctggttcaa gttctggttc     35100
     aagttctggt tcaagttctg gttctggcac aggctcttgg tggggttctg gtgctggttc     35160
     tggctcaagt tctggctcaa gttctggctc aagttctggt tcaagttctg gctcaagttc     35220
     taactctgga tctagctcaa gttctgtttc aggttcttca tctggttctg gtggtagttg     35280
     gtggggtggt tctggaaatg attacgtttg tccaggagaa gatggctacg acgatgaaga     35340
     gccagataat ggcggcagcg gaagcggctc aagctctggt tctagtggta gctggtgggg     35400
     tagttctggc tctagctcta gctctggttc aacttcagtt actggcggat cgtctggagg     35460
     tagctggtgg ggtggatctg gaaacgatta cgtttgccct ggagaagatg gatacgatga     35520
     tgaaggagaa gatgatcatc caacaacaac ggcagcacca gaagactgtg aagatgagga     35580
     tgacagttgg gacgatgatg aagatgactg tgacacacaa gctgctaagg aagttgttaa     35640
     ttcagttact gttgctgctg aaagtgttta cccatcatcc actgctgcca acagtttaac     35700
     cacatcatgg atttcgtcac aagttaccaa tcaatcagtt acccagattg aaaacattgg     35760
     tgccaaggtt cataccggtg gactttttgt tgctcttctt ggattgttga cattattgtt     35820
     gatataatat tgaaagggga ttgttacagg atatatttat aaaattgcag ggcagttttg     35880
     atccccccaa cagaaaaaaa ttgtttttgc ttatttcgtt aacgttagat ttataatttt     35940
     caaactagtt aagtagctat ttagtttaat accttttttt taaagttttc aaagatcgta     36000
     gtgaagtggg agtttgagca agatccaaaa aaaaaaaaaa gattggcaaa tctaggtaaa     36060
     aaaaaaaaaa tattgacacc aaggagattc gaactcctgc atcttacgat agtagaaaac     36120
     ccctgtttaa acagaagaag aaaagtagct tttcttgagt ctaccgcctt agaccaactc     36180
     ggccatagtg ccaatttacg agtgagtaat ttagctggtt ttccaagtca ggaaagttta     36240
     gtgattactg aaaatgttag aaatgggcat acaataaaca ccttctggat aatgcttgtt     36300
     taggaagcag tctaatagtt gtaaagtaga atacaagtat attcttcgca gttattgaaa     36360
     aaatttggca aaaatttatt gccaaaaaag ttagacatgc gggtgtggca aaataattgt     36420
     acaaatactc ttcaatgtct ttagtcctgt attatatgaa atgggatcca ggttacacag     36480
     aaaacaaaga gatatcttta ccaagaccac taacgatact aactcttaac tgattccccc     36540
     aagacggaca actagcccga caccaactac tgccagcatg accgacacac atctgtacac     36600
     ctccaacttt ctcaaatact gtatcaccac tagcaattga tacatttggg gtaaccaccg     36660
     acacaattaa gttgccatta aatttatttc tgaggacagg ggttttagaa ttttattttt     36720
     ttggagaaag aactttgtga aagagttttc cccatcatcc ttttttggga aaagattttt     36780
     tttttgtttg tgtttagatg caaaaacatt taccgcaatg gttagagatt gggcgttcac     36840
     aatcaataga ctacaattct caggcttaac tactatatct tatgtttttg atttcgtatt     36900
     ctatttgaca gttttaattc tttcagctac gttgggaaga actcttcctc cacgctacca     36960
     cgaattcctg ctttatgaca ttacccttag gtacacacat tttccagaaa atgccatttt     37020
     ggtccgtgtg tggctactaa tactaatatc tgctggaatc ccatttgctc agttcttgct     37080
     atttacaata tttatcgtct tgccaataag acgacgcatt tgggattttt ttgccggttg     37140
     tttatgtttg cttggagcaa tggcaacaca attgcttgtc acagtgcttt tgaaaaatat     37200
     aataggactc ccccgcccag atttcatcga caggtgtgag ccaatgatcc agaacattcc     37260
     cataacatca ttgtcaacag tagcaatatg cacacagcca gactggaact tggtccaaga     37320
     aggattcagg actttcccca gcggtcatct gtcaactgtt ttcacaggaa tgacaatagc     37380
     tgcattaaac tttgctgcta gacttcaaac atttgacaat agaaacaact cctttaaagt     37440
     gtttatcacc atattgccgt ggcttattgc cgcatgcata gccagcacca gagttagcga     37500
     caacagacac tttttaaaag atatcattgc tggtgcattc ataggaacgt ttattggttc     37560
     tgccttttat ttacaatacc accctagtat attcaaccta gccaatgcag gcagatcgtt     37620
     cccgcctcga aggtttggca ttcaaagatt tttccacaac attggcggat tttggaaact     37680
     tgagggcgag aactcggatc gggtattagg tgctgaagat cttgaaaaac tttccaatga     37740
     acaattgggc caacctgcaa gaataacatc aatggcagat aatatcgaaa ttgtaaataa     37800
     actactataa tattttcttt gctctacgtc tcgcctgctt gatcttgcta gacgtgtagt     37860
     cgacctcctc attgaatcga tccaacattt cgttttgctc ttctacttca gcattaatta     37920
     gctcgccaat ttgcttttgt cgagcaatca aggctctaag ctggtttagt tctttatctt     37980
     gattttgatg aatttgtatt tggtgctgaa gaagttcgtg gttgtttaat ggtaaagttt     38040
     ctggcgtttc cttaattgct ccacccaaca ccctctttga ttttggaacc tcctgagcta     38100
     gcaagttgtc aatactttct tgtaattggg caatcaactg cttcttcttt atcgcttcat     38160
     cacctgtacc aattgtcttg accaagtcaa caattcgtgg ttggtataca cgactgattc     38220
     gatcacgaat atgaattttc tcactaatac tactggatga ttcattgagt atgtccagct     38280
     tcaacttacg atagacatcg tgccagttat tctgcaccga gtccaaatcg gctcgattat     38340
     tttgtagcat gtccttggta aatctgaaat tagacggtaa ctgcaaaaac gataacactt     38400
     ctcgttcgtt ttgaagtgtg gaatcctgaa tgatattatt gagaaattct gcaagtccca     38460
     cttttcgttc ttcaatgatg ctggccttgt taagccagtt gatacgtttc cccggtaaat     38520
     catacggaaa atctcgacta tcaatcccta gatttcgact caagtccaat accaattgct     38580
     gaaactccag ataccgtttc tttatcgtga atgaacgaag tgggagtttg atattgattt     38640
     gatagtatgt cgatccaccc acttccactt catgggggat ggttataatt gtggacattg     38700
     aattggatag ggaaaaagaa actaactttc attttttttt tttttttttt tttttttttt     38760
     tttttctcgt gtatttctgg aaacactaga taaacagcta tgattgctat ctgcatttcc     38820
     acctcttctc cacacactct ttttcttgca aaaccaagca caagaaatga caaactacaa     38880
     ttcaacacaa gacgaacaat caaataacac agaggaaaga aggttgaatg agtcacctgt     38940
     cccttccagt gaagtgcctg ctgatgatag agaatcaact caattggaac tgcaaccttt     39000
     gctagaccct gatgacccca gagtatctcc tttaaagtta gaaagaatac gattattaaa     39060
     agttattgcc acagctttgg tctacataaa cttggcactc tttgtagtgt tgttggtaag     39120
     ccagtttttt gctatcccag gtttcaataa tcgcggtaaa tcctttttgg ggcttgattt     39180
     agccttggtg agcttattca taaatttgac taccaattgg ttttttgcag tccctgctta     39240
     ttacgagaga atattagggt acgttacgtc cgggctttta tttattgatt tcattgttgc     39300
     gttgcttgta tcgcctgttc gacacagttt ggggttttta gatttatcac ttattgtctg     39360
     ggcgtgcctc aactcgttgt ttagctcttt gattggttat tgggttgaag aaggtaagca     39420
     ttatcaagag attcggttaa ctggaagaat cgaaaaacgt aaaaccataa gtgagctagt     39480
     cattatattt ttcaaggtct tgggtgagat tgtaatacta tggatagttt ggtgtattag     39540
     cttgacattg tggataaact gttttgacac ccacgaacag ccatggggta aattagttcc     39600
     agttaacaat agccagttcc gagtacatct agcgtgtttt ggcgacgttc atgccaaatc     39660
     agaccagcca attgtccttg ttgaaggagg gcaatcaacc tcaagcgagg cttttcaaga     39720
     atggatcgag gagttgcacc atttgaacaa agttgaaagg tattgtatct gggatcgacc     39780
     aggctatggg ttttctgatt cagcccctcc accagagtct ttggggattg tcacagaata     39840
     cttgacggaa gcgttgagaa aggaaaagat cgaaggtcca tttgccgttg ttggattcga     39900
     tattggtggg ttgtatgcaa gaatgtttgc tagcagaaat agagccaaga ttcagtctat     39960
     tctatttgtt gatagctggt cgcctgattt gttaaagaaa tggccattta gtggcagtgg     40020
     cagaaaaaat gaaagcacaa aagttttcaa gaaatctctt gaagttatgg acaatataac     40080
     cgggttcaaa ttatggttac gaggatttgt atcgcccttg ggaattgtcc caaacttaca     40140
     ctggttttta caccctatgc gattctccag caagagcaga gtatttggtc gcgatatggt     40200
     gtacctgtct aaatatatta gagctcgatg ccaagagcaa ttggtttctg ggatattgtc     40260
     gtacaatgaa gttatggatg ccgatatcaa tgacttgaat gtaggagtta tatcatctga     40320
     ttttatgata aaaaaactgt tgaactgggg gaaatggcaa aatgaaatca gcaaactaag     40380
     cagaaaaaca agtgagtggg tgattgctga aaatagtgat cattttattt ggaccagttc     40440
     aaaaggtaga aaggagttac aacaactatt attaagacta ataggtgaac aagagtatgt     40500
     taggtagttt gtattggcgc atatatttta gtagtggtag taatcaaaaa aaaaaaaaaa     40560
     aaaaaaaaga aaaaaactaa aacgacaaca aattcaacaa aacgagattc aacatttctc     40620
     aaggtaattt tgttgtcgtt tcatcttttt tttctttttt ccttttagag agacgggcca     40680
     tagaaatcac agatgccaga aagctcatcc aacatgatag gcagggaagc tgcaccgtcc     40740
     aatcgaagaa cattgtcgtc caagtccaat aactcaacac cacctataaa ctcgtcaggg     40800
     tcgagtcgtc catcatcgcc attagagcca ccctcacaac aacaacaaca acaacaacaa     40860
     caacaacaac aatcacaaca aacatctaga agaccatctt ttggtttgaa ttttttaaat     40920
     aattttacca tgcgctcgca ttcatctgaa acagcatcac agccattaat gtcaaatagt     40980
     cctactttgg ggaacgtgca ttcgcacacg caagacgagg tctcgggcaa tagtcaatca     41040
     ttccatgaag ttgctgaaga gtctccatta gaggaggagg aagaagcatc tcaagaaaat     41100
     ggacagcccc aaaaccctgc atcagaagga ttaccaccag cacaggatgc tacatacatt     41160
     gacgaagagg caaagggcgg gttagataaa gacgggttct tttcagtgag attaacgcca     41220
     ttaatcgatc attcgtcaac atcgtcagga ctatattttt caccaataat tcgtcggcta     41280
     ccaccaaaga catcaatcaa catagggaga tacactgaaa aaaacaaggc tgcagcacat     41340
     gcacctcagg gctcttcagc accgattgtt tttaaaagca aggttgtttc acgtacacat     41400
     gcattgttct tttgtaatga agatggccaa tggtttctaa aagatacgaa aagctcgtcg     41460
     ggtacattcc tcaatcatat tagactttcg ccggcatcac aagagagttc gttgatgcct     41520
     atcatagatg gtgatataat tcaattagga atggactata gagggggcac tgaagaagtg     41580
     taccgactgg tcaaaatgag atgccacttt aataacagct ggcagcggaa aatgaaccct     41640
     tataatattg aaatgtttaa aaaattgcaa ataggggaca aacaagccac cgaatgttca     41700
     atttgtttga acgccataca acctggccat ccactattta taagtacgtg tggccattgg     41760
     tggcattata gatgcataca cccattacta cagaaaagct atcccctgtt ttcatgcccc     41820
     aattgtcgat atgtttgtga tttggagtat ttttcagagt cagaatagta gtattcttgt     41880
     tttgtgagca atgtttgtag ttgtaacata tacatatata tttctttctt cacatatgta     41940
     gatgcttgaa tttataaatg atacgagtga tgtttagcgt ggccctgcac attagcagtt     42000
     ttggtgttgt ttactttttc tgtttttcaa catccaattt tttttttttt tttttgaaag     42060
     tttttttttt tttttttact ctgttgtttg gcgttactac aacaatgtca gccataaaaa     42120
     ctaaacccaa tccaaccata accaatgcta gaagaataat catactagtt accatcttgt     42180
     tggtgttacc atttgctgga tattactatc tagaacactc aacaacatca agcgtattca     42240
     ttgaagagcc aattttccaa caagttcacg tatcgattgt gtctgatggc aacaagaaga     42300
     ttgatttggg tatagaaagc ttatttgatg agattattcc ggcagagttt aaggataggt     42360
     tgggaataac aaccaatata cagaataaca ttgaattgtt caaactgaat tccagtgtgt     42420
     tggaaccatc agagatacct tatttgatta atttagatga attatacagt accaacaatt     42480
     taaattatgt gatatttttg cctcaaaacg gattgactat taaggactca actaccaaca     42540
     gtttcacagt tgaagggttc ggcacaattg gtatattgaa tgattggagc ttacaaaaga     42600
     aggatttgtt accccttctc aatattttta aatctaattt aataaggaca ttgaaacagt     42660
     ctcaaagtgc aacaccaaag ggagtttcca ctgagattac atcattcaca ccaatggatc     42720
     ataaattagc agtgtttcta ccaattcttg gtccaattgg gatttcaata ttaaatggct     42780
     tggcaaattt ttcgaaataa taggccagtt aggctgtact cctgttagtt attatttaga     42840
     agaaatataa actggtgatt taaagtgtgt atgctattgt aatattcaac ctttaatttt     42900
     tgccaaggtc aatcgaattt tctgttaaaa atatatacga tagaataagc ttgtgctata     42960
     tatactcact tctcttgctc cgctttctga aatgaccaga tcacccctct cctctatcat     43020
     ttgagtacat ggtagcttgt gttttgggag ggaccaacgt agaacgacta gcttatcgac     43080
     ggttgatatg ttgtggatag cccctcctcc tttccctggc atcacaaaaa ttcacccact     43140
     aagaaataaa ataaaagata ataaccgtta cgtcaacata atacactgtt tagaaatata     43200
     attttgttcc caaaaaacaa aggagttggc aggaaaaaaa gaaagaccaa tcagcaagga     43260
     gatcaaatac gaaaagcata gtgagaatag aatgaggggg agaagtaaga gaagtttgta     43320
     attacaattg aatccacaag tcttgtttat gggatggttt cagtgttgaa ggatctaaat     43380
     cccatctttg cagataaagt aaattctctg cattattagg atttctcgaa cgaaagcttc     43440
     ctccaccact gtaagtcaag ggttgttcgg tttttttttt ttgccccaga ttaaaaccga     43500
     cttacgtgga gttaacgcta gagatattgt gtaacaaatt taagcgaagg aagtaaaaaa     43560
     cataaaaaaa aaaaaaataa ctggacttgc ttgcagcacc accatctccg atggcccttt     43620
     tgaaaagaaa ttgaagtagt attctacagc accagaagat acgtatatca atatgatcga     43680
     gcacctcaaa cgtgtgtatt aattagcaag ttattaacct atctctgtac ctacatcctg     43740
     tggtcaccct tctgcatatc tcaaaaaagg ttaattattc ccagatatga caactataat     43800
     cttagggaca cgtgaataaa ccattcgtct ctatacacaa gaaaaagaaa agatgcaaaa     43860
     caaaaaaatc aggccatttg gattattgtg caggactcgc aatttttgca attttaattt     43920
     tcctattgtt attcagagtg tcacaacaat aaactcttgt ccatacatat tcacacattt     43980
     tgctattttt gagttctaac aaaccacaaa aatacatgac aattaagacg gttctagtaa     44040
     agagagtttt aagaggttta gaaaaggagg tcgggaaaaa aaaaatgacc tgataaaaaa     44100
     attaaataat tttctttttt gttttcatct ctttcttttt aactaatcaa aagtgaattc     44160
     aaactgaact caatttttcc attataaatc gaatcccata gtaaaaggaa aagtatccac     44220
     ggttctccat cgatcaataa tattttgaaa ttagaattga gtttttgtat tcaattataa     44280
     caaaaattat tttccgtcca ataaaaaatt ttttatattt tgatatatct ttcttttttt     44340
     tttttttttt tcctttttat tttattccaa ccatacagcc tactagccat atctagtagt     44400
     accaacatag acagcttata tcattgattt aattatatta caagaataaa caagctttca     44460
     ggatataatt ttaattggat tgatatcacc acagtttccc tatacatatt tttttgtcgt     44520
     cccccttttt tttttttttc acaaggtaac gctatttaag cacaaactat cacgcttata     44580
     aaacaggtct catccatcat agggttatcc tgtttattta ttttactata tttattagag     44640
     cctattccat cagaggtttc ctattttttt gaaagaaaga atctttttct ttagtgtgtg     44700
     catcagaatc caaaaaaaaa aaaaaactcg ttcgattttg tttttgaatc caacaataac     44760
     tttttttcta cacgtaaatc aacggtgttc aatatccatt tatcgtcgtg ttacgaatta     44820
     ttattataat atttatttat aattcaacca actattttga ttttgttgtt gttcacaggt     44880
     aaaggaacaa ttctttagtt ataactatct acaacatgtt atcacagtat aacgaacaac     44940
     ttgctgcggg tgacaatgtt gacggattca acaatggtaa acaagcaaat gcaacgttat     45000
     attcctttga ttttgttgat gcagatgatt tcttagactc aatatcaggg gcgttgccaa     45060
     atagtgccca taacaatgtc agtgttaaca ccagcaacac caacgatatt acatttgaag     45120
     atatgaatat catgaatcca aatatctatt ctccagtatc agcagcaagc ggtgacgatt     45180
     atgcacatac ttctggccaa cccatggtta gtgaagggag taactacact ggacagaact     45240
     ttactgatta tttatcagac aactccttgg agggatatga taacaaaaat gtaaatcatc     45300
     cattgaatgg agtcgacatt gtcttgtcta acaaacgctc taattcaact tcaactggaa     45360
     gtttaagtca caatgaggaa atcacaccaa tttcacatta ctcagtcgat tcaatagtaa     45420
     cttcaccaga gcctccaatg agtaaacaag gtgaatttcc acctattaaa cgaagcacaa     45480
     ccgtgaattc aaccaatagt atcaccaaca ccaaaaaatc atcgaaagtc actaaaccaa     45540
     aatcaaaaga taagaactct cataatatga ttgaaaagaa atacagaacc aacatcaaca     45600
     caaaaatctt ggctttgaga gatgcagtac ctgctcttag aattgctgct ggttgtgacg     45660
     atgtttccat agctgattta gaagggttga cgccagcatc taagttgaat aaagctagtg     45720
     ttttaaccaa agctacagaa tacattaaac atttggaaag caaaaactcc gttttgaaac     45780
     aacaaaatat tgaattgcac agattaattc agcatgccaa cttgaatcca aagtctttac     45840
     ctccacctcc acaacaaatg ccaatgcaaa caccatttcc accaccacca ccacaacaac     45900
     agcaaccagg atttggcttt tatccacagc aaaaccaatc gttcaatgtt tcacctgctt     45960
     ctcaataccc ctctcctcaa cagcaagtat ccccaatcca gcaacagcca gcacaacacc     46020
     caccacaacc taatagatat ttgttgggag gtatggctgc tgtcatgggt acctccttat     46080
     ttggtggatc aggtgagaat gatttccgca gtttgggtgc attaccattt tcatacttgt     46140
     ttcctaacgc tattctcaat ccatctccat tgactattca attatggaca ttgaccaagg     46200
     tgttgctagt tgttggaagc ttggccagca tttttattcc aatgtataaa caagcacaac     46260
     ttgaaaagga cgaaaaatcc actactgtcc ccgaaacttc gctattggat tggattttga     46320
     tttcaatagg attcaaagtt cctgccaagt tgtcagcctc taaaagagac gctatattat     46380
     ccaatttaca aggaggaaat aattggccac aattggtttc tgattatttc tatttgactg     46440
     gttgtgaaat aaattttgaa aattgctttt tatctttggt attaggctca atgattagac     46500
     acagattacc tagggttgca aaggttttga atcattattt gctgatgaag gaatctttgc     46560
     ttttgaatct tgactacaag ggagctgaca aatcattgaa aagattaaat caattggttg     46620
     gtaaggttga tggaatttcc atattcgaga gtactaattt gacaactaga ttaaccaatg     46680
     tttttaccaa tagtcggatc aatgcaaata tagttgatgg acaaaatcat gtgaagtaca     46740
     ttgaatttta tcaacgcaac attaacgatt attatgcaat cattttcaat tggaggttgt     46800
     tggaacttat tcacgaattg aatgtaactt atttggaaga attgaatgac gaccaatcac     46860
     aaatattaac tgatttgaag atcattgaag tattcattgg tgaacaggac gataagttgt     46920
     ttggttatta tcaattattt accagtattt taaatgccaa ttatgctccg tatttgtttg     46980
     agagtttgaa agataaagtt gaatcatcgt tggagaaatt tagaattgct tatgaaggaa     47040
     ttgatttaac agatcacgaa attcacaata cttcgtctga agatgaacac gaagacgatc     47100
     ctgttgtttc taaatatgtg ccaccgttaa agtcacagaa atcattaatc tcatcgttga     47160
     acttggtaaa tgaagaagag tttataatac taacatgctc attgactatt tactactaca     47220
     agaataaaga atatgaccgt gcattgaaaa tattgagcta cttgagattg gacgatgatg     47280
     ccaaaacagt cagtctttta acgtttactg cattgatgac attgatcaat gagttgatac     47340
     cgggtagaat tgaagacaat gataatttgg actcagccat taaaatctgt cgcgattggc     47400
     ttgagaatcc tgatttaact cgatacatgg atgaaaatat caaacatgaa ttaacgaaaa     47460
     ttgtggtcaa taaaggcatg attgttaatg gaattgacgt taatgagagt gatgaggaat     47520
     gaaggctgac tgatatagat tgttttaata atttttttgt ttcataatta atgtgggttg     47580
     tggtattatt tgcaaatgtg tgtgtttttc tttcttgttt ttttattgtt ttcatttaat     47640
     tatttatata atttattgtg tttatttaat atatcgataa cctgattctt tgcttatacg     47700
     attttcctag tgctgatgta aagccattgg gcaatatttc ctgatatctt cttttttttt     47760
     tttgggttta gatttgcaaa tagaaatata cccaaaaaaa gattatatac ttacctttca     47820
     tgagattcgg catgtgccaa agaaaaaggg gtttataatt gatttgcgac tatcttcgaa     47880
     ggaaggagtt gttcactgcg acatttctag ttctttatct caaactagta gttcttgcat     47940
     caaccaaatc ttcatacaga agtctaaaat gttcaattag ttgaattcat tgcaccaggt     48000
     atcaaaacac acgttagaac ttgtttccac tctgtgcaat tcatccaaaa agagttaaat     48060
     atctttggtt acagtccagc acattgcaac cctacaaatt aatattgata tttattatcc     48120
     ttctacctca gttgcatttt taaactgtgc agaatgtgtg actatatcaa ttcaatctac     48180
     ttattgaaat ataacaagtt aatggtgccc aaaacgaatg caagatttcg ccttttttta     48240
     taagattacc gagcataccc gtcctgtcac agatgcagat ttataaacat cattgaatta     48300
     tgttgaataa aaacaaaaag taacaaaaaa taatgctgtt catacatgag tgatgtaact     48360
     tgaaatttat aaattacaac tgctacaaag caaaagcatt ttaaacttct ttaagtaatg     48420
     ttacataaca attgttgttt ttggaccaac tattaaagaa atataatcat aaagacaacc     48480
     aaaattggca ttagaaagaa gaaaccaagg tgcattcgag tgtgttatgg ttacagtttg     48540
     ccaaaatatc agtagcttta taattatatt tttttctttt ctggtcgtat atgcaaaata     48600
     caagatccaa ttatcaattg aaatgaaaca ttggttaaca tcataaaaca cacattatcc     48660
     caagcaataa cgctgggtgg aaatatcgga tataatatta ttctctacaa aaatacaaca     48720
     actggcgata aagaacacaa agtgttatga tgtcagtaat gttcccaatc ttgtatacgg     48780
     gttgttcttt cctataacaa attaacaata gaaatgacag aaataacacc agtgcattaa     48840
     gccatacatc taattgacgg caaaaattcc gaatgtgccc gtaatgattg cctttattca     48900
     cttgcatatg tagcaaatta tagctaacta ctaccaccga aatttcattc tatcagccgc     48960
     cacttggttg ctcttccaat tgtgtaacaa gtctatttca gaatacaaca ttaaatgaaa     49020
     tagaggagca acaaagacct ttagtaaccc gaaatgataa attgttgact aaaactcctt     49080
     tttttttttc aagcatcttt gtaaatagat aataacaaaa ctgaattata accacacaca     49140
     ttaaaattac acaaagcata aactcttgta aaacgtgcga ctgatgacat tcatctgctc     49200
     aaacatttat acgaattgct catcaagtat aatccagccc tagtaataac ctctgacatc     49260
     caatatcaaa agggattgtt tttaatctga attggcttag aacctatcat atcttaatac     49320
     gttgttgatt tgtatatggc tttctataat taagatttat aattgaagtt tttttttttt     49380
     tttttttttt tttatagcac atttagcgta actagttgga acaggaagaa gctacaagat     49440
     gacgaattgt gcataaccca caatttcaag ttaaacttac ttttaactta aagttttgta     49500
     gatttgattc taattacaat gaattattcg gcaatctcac aagtccaagt acaactttaa     49560
     ttcaattgag gcaaaaaaaa aaagaaaata aatcaggaca acaattaaca atccaattct     49620
     tggtgtaatt acagctatta agccaaagag aatttcaaga atttaagtga tatgcatata     49680
     cgtagatgta gactttaaat aatctaaaaa aaatcattga gatagttacc acaaaaagcc     49740
     cttgccatcg cctccgccga aggagccagc tgattcactg aattttaatt tcaaattcca     49800
     ctactaattc catatacatc ctaaattatt agaagttttg catgtgaata ccttgtgtat     49860
     atgcaaaatg tttattaatt ccgagttctt gaatttaggt tttaacataa gcttggttcg     49920
     tgaggtaaaa ttcttcactt ctatgtcttg ctctttgaat tatcacagaa agatggtgac     49980
     ttctttgaga ggcttttcac acagcaagtg tcatacgatt tttatcttcc agctatgttc     50040
     cataaaccaa gaacatctta acaagaagtt tacacttgta gcgccacgat accttccacg     50100
     caaaaacaaa ggaaatatta tatggcgtca gcttaatacc ataaacttag ttgataagat     50160
     cctattcctt tgttgagtta caaggtcatg tgcaaataaa tcgtattacc tatgttaacc     50220
     tgtcattttg gtttactagg taaagagata atgttaagaa cgttggtata cgagaattta     50280
     ttcagtaagg tgtcattctc tcctttcttt tttctttttt tttttttttt tttggaatga     50340
     tggtttgtta acaataagaa tggaaaataa cacaatatta atacaataga agaaaattaa     50400
     acaagtttct ttctcttgtt tatagaatca ttctggaaac tcaatggaaa ccgcatcaag     50460
     cggttaattt aaaagtcaac ttcgtaattc ttgtgggcgt taaagaatga caactgaagt     50520
     gaaacaacac aattacaagg caggaaaaca gtccaaaagc atgttatcat ccagagttga     50580
     atatatttaa ctttctaaca ttctcaatgc tccaaaaata acatatactt tatcactctt     50640
     cacatatacg taaatacact tatacttctt gtaatgagaa atataatctg tcattaaagt     50700
     ctaataattt ataaattaca tctatatgta ttataattgt gaggcaagca ttattattat     50760
     tattattatt gtgttattgg ttattgggta gtagtagtac attgtttaaa cttctattat     50820
     gtttcaattg caatgttgct cacatacatg actcacatta ttcttcgata atctaaaaat     50880
     aagaagaaaa aaaaaaaaaa aaacaaaata aacgtttctt tttgatcatt caaaaataac     50940
     aaattatttc gtcattcaaa acaaattctt tatataattc aacatcttaa taacatatct     51000
     ttcaactgaa ttaaaactaa aatgtaatca gtttaggttc cattttcttt cacctttgtg     51060
     tttgtgattg taaatgaatt ttagtgtaag tttctttttt ttttttcttg ttaaatgttt     51120
     aaataattaa aatttggaat ctccagatat caaaagacga tgggaagaat ttcagcaagg     51180
     caaataataa aaataaatta aaataaaaaa aaaaaaaaaa aaagtataaa tgtatcgtcg     51240
     actctacttt aaagtttata atattgatat tcccctcctc ctcctcctct tgctagtttt     51300
     ctattttcaa tattaccaac accattttga gttttagtca acaactcact tcataggtat     51360
     gtactgatac tttattcaca taaacatata taaaccctca tatgattcct tgtttctgta     51420
     actatcacaa ctatctaata aatctatatg attcctgtga tggaaactat caagatcttc     51480
     taattattgc taatacaaac cggggcattt ccaaactaag aaaaaaaaat taccaaaaag     51540
     caaagcaaga aaacaagaaa aaaaaaattg tctaataaaa caggaatgaa gtcactccat     51600
     ttaatccatg ataattatat gagaaaatat gtactatatg ttagtgattg attataaatg     51660
     agtaaaataa cctaaacttg aattactaac aaaagatata tcaatttagt tatttaattt     51720
     caacaagtga tatttataaa taacatagtc cataagaaaa ttggtgtcaa aactcgacta     51780
     taattgacat cgatcattat ttaggccaca aagaaaaaaa aaaaaaaaaa gaaacaaaaa     51840
     aaagacatat tacagaaaga aagaaagaaa gagagagaaa gagagaagag aagtgaagca     51900
     acgacattct ccttcccacc catcaatagt atagctacga catttactga agacaaaaaa     51960
     aatttccttt ttctttcgag tggcagtgcc acaaaccaga gacaaggcaa ctaactgcag     52020
     actaaagaat tacgtacttc caaactttta tagttgggaa agaaaaaaaa atcactaaag     52080
     acaactaagc attaccttgg gtccaaactt tacaaaagaa tttagagttc ctacaattgc     52140
     ttcaattcac ctgagacaaa aaataatatt ctcaagcata tatattaacc aatttgcagg     52200
     ttgagataaa atctttaagg tccgttcttt gctgtctatt attattttta actaacttga     52260
     cacaaacatt atttcacatc caaagttatt aggctactgt gacacacaaa cacacgcaca     52320
     tacatagcat caaatcctcc ccgattacct aatcctgtta cacctacttc caattctcct     52380
     agaaatttat caacttgtgt cttactacct tgtaataaca atataatttc taacaattgt     52440
     catcaactat actggaatta atttacgtgt gatttcttaa acatcaacaa tacaccaaga     52500
     gattacgaga taggtaataa gattaagaac aacaatcaag acaaccacca ccgttcaaaa     52560
     caaaaataga aaaagtcgga aaggaatagt tttctattgt atttttgtgt ggtttctaaa     52620
     ttgacattga atcttttttg taaggaagga aagccaaaac aaaacaggga aaaaaaagtc     52680
     caccaaaagt gagacagtga gacagagagg taaaaaaaaa aaaaaaaaaa gagaacaagg     52740
     atttattatc aaaacgaaaa aaaaaaaaaa ataaaaaact aaaaaaaaaa taaaaaaagt     52800
     tttttttgtt tgtccttttt tcccccctaa aaacaaccat aggaagccag aaaatttact     52860
     attattagcc atgtcagatt ctgaagattc cgaagattta aatcaatata ctattgacga     52920
     ttattacaaa cttgttagac ctctactaga ggctaataac atcaatgcaa actatttgga     52980
     caatcacaaa ctactacgaa ctttggtcga ctttagttta tcgcactcat tgtcattaaa     53040
     aaatttacaa aaacgagact tggagtttcg aaacttaatc ccggaaaaga taaactatgt     53100
     cgatagttta ataattaaaa ccaaggccta taatgaacct cagttttctg gatgtttccg     53160
     aaaccggtac attgagtttt gtcctcattt tgccattgct gcttatttat tcagccgttt     53220
     ccatatcgct gatgaatatg gagcatacga gtttatattt accgactcga taaaaaaaat     53280
     atctttggaa aatgtcaagt tattaaaagg taattcgaag cacctggcaa tatcttatag     53340
     ccaacaacac aagtcggcta ttaatgcttt gagtataagt ggcttggatt ataaggatgt     53400
     aaatttaacc aaacttttga ctacgcataa caataatgaa acactagaga acatgggtag     53460
     attggccaag aattcagtca aggaactatc ttgtccatta atgttggcat tagctgggtt     53520
     taatagtttt gaagattatg aaataataag gaattcaata gacccccctc aacaattact     53580
     agataagata tttccctttc taaccaatat catcgacgat tctacttctt ccaaagattt     53640
     gttacaaata aaagagttgt tttcaatgtt aagaaggagt ctctgccagg atatggtaat     53700
     catcaagaaa aaatacccct ataacccatt atcaaaaagt gaaatattta attcgcccga     53760
     gtttctggac tttgttcaat ccattgaaaa tgaaaccccc ggaaagttgg acacaataat     53820
     aaataactcc tgtttcattc ccaaagatca ccctatgcct agtggcgatc ttttggtcgc     53880
     cggttccggt gataataaaa attccgaatc tgagatgaag gaaccgatat caaaggactt     53940
     agaaaaccaa ctttctatat tagcacggca acaaaaagag ctcgataagt ctttctacaa     54000
     attcactgaa tcccaaactg agattttcct gcaacaaagc gagcttatgc aaaaagtcaa     54060
     caatacgtta aacggggtca tgattttatt atctgcacaa aacaaaactt ccatcccatt     54120
     actccagcaa gcggctcaag aaacccaaaa ttacatttca aatgtgggac aatcgaatat     54180
     tgaacgagga atgaacaata ctgccgaatt actaaatgct ttgaactcaa attctggaca     54240
     ccctcaatcc caatctcaac cacaatcgca ttcatcaact tcactactac cactgacgca     54300
     agcaccacaa ccagtagcat cttcattgtc aaatttatta catccccaag cactggagtt     54360
     tcctcgagcc gcgctttcag aaccaccaca agttcaacca ttacttacac agcgacatgc     54420
     aatgcccttg caacaacaac aacaacaaca acaacaacaa caacaacaac aacaacaaca     54480
     acaacaacag caacaacaat tttatatgca cacgtcaaat tcaccttcaa ttcatcaatc     54540
     tgcagctatg gtgcctatgg catcgtatcc ttcgaccaca acaacatctg cagctacagt     54600
     acagagacaa ataccagcac aaccacaacc ttcttctagt gcagacattg gtttgactcc     54660
     agaacaaatg gaacgacaac gcgttttaca tagacgatta tcaaggcaag caacgacgtt     54720
     atttgaaatg tgggacgatt tcaagtcaat ggaaaaagca cttcaagatc atgatatcac     54780
     agttacagag tggctaaaat tacacggtag ttcagaacgg caattccgtc atactagatt     54840
     gaaaatcatc agatttattg aggaagaagc ccaacatcgt aatactagtg ttgagattgt     54900
     caaagaacta ttgcataata aaatgagaaa taggctaagg ccgtggacat tggatgaagt     54960
     ccaaagaatg ttgacggcca ataaacggat taatttagat gacgatagtt agagtttata     55020
     agttgtttgt ataatttaca taattaagat tggaagagaa ttagacaaca ctaaaaaggt     55080
     gtgtctaatg tggtacacca ttatcaagcc catgccaaac taataccagt ctcaaaataa     55140
     tctttatatt tttgatttgg atcatcaaga tttatatccc ccctcctctg atattttctg     55200
     aatcacatac gactagcagt gtaaattctt cttatgcctt taatattgaa aatggatatt     55260
     tgtactgcca tgattgtttc tgggaaagtt ggacacatcc tatcttaaat gaaagttggc     55320
     aaagcgttat cttcctgtca aaaaaaaaaa aaaaaattgt ttcacattca aattaaatac     55380
     aaaaagagga actcagatcc tattcctttt gcttcatcat gaaaccctac ctctctttta     55440
     atttggttat aattatattt ataccactaa acgaggctgt attggtattg atttatttct     55500
     ctgttgactt tgaattgctg acttttgaac cgtcaaagaa atcgaagacg actggggctt     55560
     ttagtcgcag ttaacatggg gagggagcca acataggttc acgacatttt tgttaatatt     55620
     cttttcttat tatgactgag taaatagcac aaactgactg actttttgtt gggcatttct     55680
     gtcagtcacg ggacttggtg gtttaaattg atcattttcc cccaaatttc ctatttttgt     55740
     attcttgatg ttatcgtcta aatttgtagt tttttttttt gttgtttcga acctaaatgt     55800
     cgtgccagga accaaaaagc ctccttgtgc atatgtattc gaacaataaa gacaaacacc     55860
     agcatggaac agaaatagta agactcaagg cgacaatgat acatcaaaaa atacaggaac     55920
     tcagaattat taatgtaagc aaaatcctta agctagcggt gtgtagcaat tttttgtctt     55980
     attgtctttt taaaagacac agaatacatt ggctacacct tccccatgat cgctggtgtt     56040
     gtttggtccc agagataaat cggagagtat ttcctaagcc actacttagt tactattaaa     56100
     agaagctttt tttgtcatct tacaggttag aagcagcagg ttgcattgac gactgcatga     56160
     ctcggatcat ctgatacata ttcttttatt gggtgcaaaa gttctattgt gcaacactat     56220
     aatattttac aggattgaat tttttttttt ttttttggtg cgcactacta cttcagattt     56280
     caatgtcgta aaaaattttt ggtttcagaa acggcaccgg aaagggataa gtctgtaatt     56340
     gcctcgtttc attttttttt tttttccggc gcaagttctt ggtccccaac tcgttgttgt     56400
     tgttttgaag aaagttatgt cgctaggtga ataactttga cattgtccaa agctaacatt     56460
     cccactttat attacttttc tttgttccta atcatcgtca attataaatt tttttttttt     56520
     tgagagtttt ttttttgtgt ttaacatttg taaatttgat gacaaatttt aggctaaaac     56580
     tgaattagat tatttcattg taatttgtta atattatcaa accttcgacg aaatctttaa     56640
     actttgtaaa tcaatctctc aatttttttc ttgttacaaa atcgtttaag aaatcgaaaa     56700
     taaagttatt gttgtttttt tgggtttttg ttcaacattt aaccttttat gatacgagca     56760
     gatgacacaa tactggattt tttctttgca aaaccagaca acgacatttt tttctggagg     56820
     gttgtatgta tgacgatgat gtatattcac tatcgaaaat attcgatgat ttacaatttt     56880
     gctgttgttg ttgttgttgt tgttcctgat cttataaaaa cattctattt ctttttcttg     56940
     gttagcaaaa atacgacaat ataaatgaat tgccagtttt ttcacacttt tgtgggtggg     57000
     ttgatggatc catttctcgt cctattataa ttaatttact acaaacaata aacagatggc     57060
     atttgctcgt aacgataagt ccgctagttg aaagtcgaaa ttatcaacca caacatacgc     57120
     tgttactttg tgtgttctaa cactcctagc aattgggatc tacaagattc gtcttcttca     57180
     tattccagtg ctagaagttt cttttatata tctatagatt taaatgtaaa tggttcgtag     57240
     gcatagcctt caccttggaa aaactttgac attgcttcaa cccaatgcaa tcttaatgaa     57300
     tgaagcatgg ctgatgtacc ttccataaag accaatatac acaccgtcaa caggaaccac     57360
     atagcaaata acaccactgt catgattaca cctacagttc cggtcttgcc aaacgcattc     57420
     tgtatagtca ttgaccacaa tacggtcgat aattgtgcgt gagccaaaga aagagcccat     57480
     aatcttaaat acgaggcagt atgactaaca cagttcaaac aaaactcaat tgtatgaatc     57540
     acttggtgaa taacaatatc cccgaaatta aacccctctt catcatcacc gccaccatga     57600
     ccaccaccac cagcagaggg gaacattggc tcaacatcgt tagggaatct aaactcttgt     57660
     tcttcctcgt cactgccacc taacaattca aacgaatcat ctggagcgtc atgattcaat     57720
     tcttgatcgt gcatcgcaag agctcgttct tcttcgtgta gttgcaaaga atgctgacgt     57780
     tgggaacgta aatcgctata ccctaattgt atagctcgat cgttctgttt cttcaacacc     57840
     aacggcttgt aaatcaacaa ccaaggcaca caaactgctg ccactaatac caaaaacact     57900
     tgaatatact tttgtccagc atacaacggc tcttcaatag tgccaggcga caaaaacata     57960
     ttgattaaca tgttcaacaa accaggtggc tgtctattac ttccaaacca atcaactgac     58020
     catttataaa caattgtcaa tgccaaatat ccaaatatac tttgcataaa caaaaaccca     58080
     ggaatgaagt taccaataat gtctactcga cttttgaaga ataagtaatt gaccaaacta     58140
     aacatcaacg aataattcat atgggtgtac cccatcaaga ctgataattt cattttgtac     58200
     gaattggtga ataaaagatt attttcagta ccatgccaag cccagtccaa tccaaatgga     58260
     taaaccttac cagtaattct ctcggcaacc aatgtggcac ccttcttgga atcataattc     58320
     tcgggaatta catatttcca gccggaggaa aaaatcgcca ttgatttgga aaaaacatca     58380
     ttataaatca acccagtata catggaaaac acccccatca ataatatgat atatcttcca     58440
     ctaaaagcca tatcaaatat ttcatctcga tcccgcatag ctccaaaccg cacttcattt     58500
     ttgatcaaat ataatgccat taaaaataca atgaacccat gcccaagatc accaaacatt     58560
     atggaaaaca taaatggaaa agtaataatt gtggcaagac caggattcac ttcctgataa     58620
     gtggcaatcc cataggcatc aatgatcagt tgaaatgctg cggtaaactt atttgtcttg     58680
     tgaaatgttg gaggagttcg attcgtagca agttcattaa ccaccgcaat taaagaccct     58740
     acttcttctt cttcttcaat ttcgaaccca gtcaattcgt gatcactatc atcaatagca     58800
     aataacgatg cttccgttgc tatagattca gagatgttga cactctcgtt tgaatctctg     58860
     tcactgttac cactcccatc tcgtctcgtc ttttgcctga tcaaatttct caatgctaat     58920
     cgtattttat caaaatcact agtgggtatc cacccttctc caactaaaca tcttctagta     58980
     ctatcttcat caaatttatt caacgtctca taaataagct tttcacgttg tacaatataa     59040
     caataatctg ggtagagctc ctgaaatatc atcaattccg tcaccaattg atctttggtg     59100
     gtctgtacaa cattgcttaa atcttcaatc ttaccattta tttctgtcaa tgtctcattt     59160
     cgagcctctg atcccccagt ggcattatca aataatattc catctaaaga ttggataatc     59220
     ttacgcactc gagttcgcaa aaactcaccg tgaataaaga taatgaaaac atttttataa     59280
     actaattcca ttgatgactc tgtagtaggg aattcttcat caagaggtat atcatggaaa     59340
     tacaaatttc cacgtaaaac tctccataat atgtttctta aaattggcac tttgtctcga     59400
     gcaattgttc ctgctaaaga attgaacgaa atatcatcca aattatgaac ctcatatcca     59460
     atctctaaac tatgattcct ttgttcattt aaaagtgctg cattatcatc aacatctcct     59520
     tcttcttctg tatgttggtc atcgtaacct cctaccaagt tcgatctatg gaaatcattc     59580
     aaactattca acacacatct attttcaata aattttagcc tcttacgatc taggttgttg     59640
     tatgattgat ctaggtgttt aattctttca taaaattcat tcaatcgagt tttgatatcg     59700
     tcaatctcgg atgtagtggg caagggcttc atatctgcat gtaaattgac ataaatatca     59760
     ctctttatgg tattctgttt gatcataatc gaatgaagaa actccaattg agaaactaac     59820
     ccatcaattg atcttaattc agtaataaat gttctttgga aaggagtcaa ctttgaattt     59880
     agatccctga attggacatt acccaatttc cctaatactc caaccatatc tcttgccaat     59940
     tcaattgtga cataaaattg aactagtgtc attggcgccg atcggaatat ggcctcattc     60000
     gattcgctgt tcaaagataa tccgttagtt tcagaaagtc ttataggagc catggcttga     60060
     ttttatatat attcttcttg tttatgctag gactctatga ttataattat gtatttgcat     60120
     cgatatgcgt gaataatgaa atttgctaac tcgttggtct ataaaatccg aatacaacaa     60180
     aaacaagcaa aacaaaaaat aaaagattga aaagataaaa aaaaaaagga aaagtaataa     60240
     tgttcttgtt gttggaatcc aaatttgctt tctttttttc ttgtataatt ttttggggga     60300
     ggtgtttgtt tgttgtcctt tggttggttg gttggttggt tgatctcaac aattcggatt     60360
     acgtgtataa agggaggagg gcaaagaatt atagatttgc gtgtatccga ggagaaaata     60420
     atttgtactc tttgattcaa tttccacaca cgaccaacaa tgataactat agtttttttt     60480
     tttctgtttt ggctgacgta ttgcggaacc ataactctta ttagcggaag tgatagaatt     60540
     ctgtgatcct tacacatttg taaatgattg tacattacat tatattactg gtgtggtcgc     60600
     tactagtatt agccagtacc agcaacgacg cacaatacaa tcaagctatc gttgaattag     60660
     aaaaacttgc aggaaatttc acaagaccta agttgtacaa tattgacaat atagagggaa     60720
     acttgtacat accacaattt gatcaattga caaatgacta taaatcaaca caaaagaagc     60780
     cacaaccacc gccagaattg actaaaagca ttatccccct tttgaagaaa tctgcatcag     60840
     aatcccgtaa tgtcaatgca ttagtaactt tgggagacct ctatttgttt ggaaattact     60900
     cattgactcc agactattac atggcaaaaa agtattatca agaggcaata agtttggctc     60960
     cgaatggtca tgcttatttc atgttaggtt acatatattc tacgggatta tttggaacat     61020
     tccccataga ccagaaacga ggtgttttat actatcagtt tgcagcggaa aatggagaca     61080
     gaaatgccca aatggtcatg gcgtacaaga atttcaaagg actaggagtg ccgacagatt     61140
     gtgagttggc attggaatat tatactgatt tagcagaaca agggaaagat tggatgtcaa     61200
     agaatgatgc taatggccaa gtggactata atattagaat atctgatttt aatggtgggt     61260
     tatatggaga gaaaatgagt gaatccactt ctaccattga aattaggtcg aaatatttca     61320
     aagacctccg aaacactttt gaggaataca agttgactgc caatgaacat gaatatgcga     61380
     ctttgtttta tgatgcattg gaaagttata aaggcgatta ttttgtaccc aaaaacttaa     61440
     ccaaggcttt caccaccttt caagaatgtg ttgctttggg agaagaaatc tatggtgcct     61500
     ccgattataa aaatattgat ggaatagaca aaatcttttt aagttcgtgt caatcgaaat     61560
     taggaagaat gtatttgcaa ggtatgggtg tatctcaaga taccaggaaa gctaaacaaa     61620
     tgttagatcg ttcattgaaa gtacaagcta cccctgaagc attgggcctt ttgggtttca     61680
     ttgaagaaca aggattattg ggcgagccta atgtctcaaa agcaattgat tattatgtag     61740
     ctgctgtaaa gaaaaaatcc cctgaagcta atagaaactt ggccaagttg ttgatgagat     61800
     taaatggcgg cgaccctcat accagtgagc atcacaagga aatttacacc tacatgaaag     61860
     atgcagtgta ttaccgagat acggaggctc tttactatat gggaagtttt ctacaatctg     61920
     gtttatcgaa aattgccgac tcgaaaaatg acatttcctg tcctaacata gtaatgtact     61980
     accgtgtttt cctagaaagg ttatcttcct tttatgcccc acatttgaaa tttgctttcg     62040
     aagagttgat tgctgggaat tatcaaaacg ctcttattgg ctatctgata gcagcagagc     62100
     atgggtttga agaagctcaa atatcaactg cgtacttgtt gtatcaacta caaccattat     62160
     attccaagca accaccaaag actttcccgc ctgaaagagt tgaaatggct gtactctatc     62220
     ttgaaagagc atcaaaacaa tcaaatgtgg acgctactat tttacttggt gatttatact     62280
     caggtcaagc aggcgcttct catattacgc cagactttga tcgagcattc aattattatc     62340
     gaacagccgc ggaaagagaa tcatcgcatg gcgcttataa acttgccgaa atgtatgagt     62400
     atggaattgg accagcaaac aactcagttg actactttat ggcaaaacgt tattacgact     62460
     ttagtctaaa atacaatgaa atactcaatc atgcaaaact ggaatcgtca tctcaattca     62520
     tttctagtaa aacacatatt gactgggcat tattgagatt gcgtttgaaa tatttgttta     62580
     atagactggc attcaagcag tcagggaatt ctgatggcgg ttggctaagt gcatttaaaa     62640
     aagtgggtaa tagggtgtcc aacgaagttc ctcaagattc aaatagcata tcaagagcga     62700
     atgctcatca tgaaggtgat acatacaatg acgatttgat tgaacaatac gatattggag     62760
     actatttggt aattgctatg acgttcatat ttttctttgt gttttttgta caaaacattt     62820
     taagacagtt tcgaagaatg agaaacggtc aaaggagaga tgaagcagat aacaacaata     62880
     acaataatgg tgatgacaat gatgacaatc aagggcaaaa tgggtggaac ggcaatcagt     62940
     tccatttcag aagaggaaat tttgagtttc atttctttgc gatatagagc tatagccaaa     63000
     tcagaaatgc ataatatcaa ctgtatattt ttgataaaag cagtcacccg aagttatcta     63060
     tattatctag taagatcttg aactacattc ttaagtatcg ggtttctatt caatattgga     63120
     gaatcatgac ttctttgcga tgtagtagat gaaccgttaa cctttggaac ctcataaatc     63180
     ttgtgagctg attgtggaag aggataatac catttttcgc tttccaagta atcaacaaat     63240
     gtattggtta actcgttggt ggataatgta aacctcgatc caaggattat tagcttggat     63300
     ttggctctag ttgcagcaac atttaatcta cgatattctg tcattagatt accagcaaac     63360
     ttcctttcgt ttgaccgtac taaagatatt ataatacact ctttgtctct tccttgatat     63420
     tggtcggctg tgagtatttc caagtctttc aaattacaaa gatttttttt caataccgat     63480
     aattgagcac gataaaacga cataacccca atctgatctt ctttcactcc tccaagaacc     63540
     aacgcgttga caagttgttg aattaaaagt gcctcccttg tatttgttat catttcaccc     63600
     accgtttctt caacagccgg caccgcatcg tagtctaaga ataacacttt gttcttctca     63660
     tcaaatactt tgtgtatcca ttgcaggtcc gagggaacgt cttcagttaa gaaactattt     63720
     aggacttctg agttaggtat ttttaaggat tgttgggcaa ctttttcgga accgcacttt     63780
     aatttgttat tataaattaa agtattgcaa acattcataa tatcattatt cattcggtat     63840
     tgatatgtca agtaactaat cgaatctgga tgctctttgg ccaacaaact gaaaagcgat     63900
     cgcgataatt cttgtttgac tcttttgtct ggatgggtaa ctaaaggtgg caactgatca     63960
     tggtcgccta ccatgacaaa tttgtcagca aatcccaagg gacccaaatt taccggtaag     64020
     gttatttgcg aagcttcatc cacaatacaa taatcaaaag tccttcttaa attaaaacac     64080
     gtatcagtga tgttcaagca ggtggtcgca attacttttg ggcgcatata ggtattgaca     64140
     tattgctcat atgtagttat tgagtcttta aatccaggaa tatagtcttt aatatctttg     64200
     tgaactctct gtggatatcc aagtcttaga aagtcaatat ccaattcttt aagtttaagt     64260
     agtatattgt caactgctga atttgtgtaa gaagtaagta aaaccgattt cttctgtgat     64320
     acaagtactt ttataagttg agcaatcacc gtcgttttac ctgtgccggg catccctact     64380
     attaaagaat agtcattagc gctaaaggcc ttattcaaag ctgcaatttg atcaggattg     64440
     aacttttcag cgtcaggaat ctcccaagaa gacgtgccaa atgtgggctt ctcaagatca     64500
     actaccaatt ttctcaactt tgatgccccg ccaggtaaga ataaacttaa aacattatat     64560
     cttgccaatc ccaaaccgta aaacattcca tccttatcaa tgcggaactt tttttcaatt     64620
     gtggtttgtg tgttctgttg ggttgatcga ataacacttt gaaatacttg gttgtttgcc     64680
     ctattgtaat ttttcaattt gtaatcagaa gtgatgattt tccgtctagt ggaaatcact     64740
     acaaaatctt tggtgatttg cttgaccaat cctgttgtta aagcaaaatg gccttcttcg     64800
     tcacttatga taaccttatc gttaacatta attagcgatc ttgccaaatt aaacttggaa     64860
     gcattctcag cctttgcgaa tgtgtacata aattgctgat tctgggattt atcatgatgt     64920
     gttgacgaga ataggaaatt gttcgactcc ttctcattcg aatttgtgat tctcatgtca     64980
     gaaaagcatt taccttgaaa ctctttttcc tctgctggga tcgtccataa atctttgacg     65040
     gctctactca gaatgtcttc ttccttggaa ataagctcat cccagtgctg gaagtaatta     65100
     cgatataaat cgttttcaaa aatgtctcta gttatagctt cgtataagtc ttcctcaata     65160
     ccagattcct ctttggtacc attttctgtt aggtggttta aggtcataca agcgcttcta     65220
     atttcgcatc gttcacagtt ggaattctta accaacggtg gtagcttcaa gttgttcttt     65280
     atgtagtgag acactttgtt tctcaaattc accaaagaac gtaaatcaga aattctgata     65340
     ttgcactttt gggtaagctt ctcctttgta tacacaagca aaaatgaatc gatagtcata     65400
     tcatatcgat ccttaaacaa caatgaatat aaagacgcct gtgcccggtg gtaaatatac     65460
     tctctacctg tttttatttc cattggtatc atgaattgac ctttcatttt tttgttttca     65520
     aattttgctg ttatggtagc gtcgattttt cctttgatac caaatattgg cgatcttatt     65580
     tcttcttcaa tatccaaggc ttcttccaca gcaaacataa tcggatccct ttcagatgtt     65640
     tcgtcaatta gattctttcg actgagtggt tgcttgtagt aggtattaaa ccatgtttgc     65700
     aaataatcaa agtgtttaac aacttcttct ctaacttctt taacctcttt ttgtatcccg     65760
     aatattaaca acatgtattg cagcaataac tcatctaata cttggttcat gaattccgta     65820
     tcccactttt cagtacaaat acattcttga aaaataaaat gaactatttc accggcaata     65880
     ataggcaacg tcagtgttgc gggaaatttg tacctagaca atatcactgt tttccttgaa     65940
     cagttaagct gctgagcaat tgttgttgct gataacaaaa tgtctgggtt ccaaattaat     66000
     aagttgtgca tgtcatcaat taatcttgga ttggaactat cggtgactat aacgtggatc     66060
     acgtcccctt tttccaactc caattcacag taatcaccac gaacaagtat ctttgactta     66120
     tctctcattg aatctacaac ttctagaata aattgcttct cgtggtttcg gccataatac     66180
     tgttcgataa catttacaat tcgaaatctc tgggttttca ccctatcata aaccaaatcc     66240
     agtacttcct caagatcctc ttcctgatgg gtgttttcaa tatttaattt ttcaaagttt     66300
     tggatacctt gttgaaaaga cttagtatat tcagatgtta cactgggtgt cagagtcttt     66360
     aatactgcca ttaattcaga atcgtcgtct gaaaacgggt catcagtcga ttcgccatca     66420
     tccaatacgt tctcagaggg tggtttcata gacaccttat cttcagagat aggctgtggt     66480
     tgcatttgag tatgtaacaa ttgaaataaa tcatcatcat cggaaaaggg atcctcggat     66540
     tgaagtgacg catttgggtt tgctagagtt ttgttttcgg gaatagtttc attgttatca     66600
     acagtgcctg gttgcaagtt tgagttttgg ttatcctgtg ggtcagcttc aaatttattt     66660
     atccaattat tcaaggtgtt ttggaaggag tcggtaatag accctgacat tgatttgact     66720
     ttataatcat caccagattt tgctctttga agttgggata tttcgttgtt ttgtttcttg     66780
     tgtttgctac tggaagatgt tatatctgaa cgcgtttttg tcattaaggg agttcgtctt     66840
     ttggaaacat tatcaaaatt agatccatat ctgtttaaaa cgtctgacgt gcgatcatcc     66900
     acattctcgg attctgggtt aatgtttttc aatggagatg aaggtagccc actaaaagaa     66960
     ttctttatat ccagctgctt atggctgctt ttgatttcgg gactttcttt ccagcgaatt     67020
     ccatcaaaac tatcatctga attctcttga agaaaattga gctcctgttg tttctgaact     67080
     tttgttgaat tgtgggtact gtttttgtta atttcttgaa ctgggttgac ttttgtggta     67140
     agcgaattta tattgattgg tcgaatcggg ggcttttgaa cattcgattg atcgttttgg     67200
     ggattggtga ggttattgac tgggaaatac atggttttct tgagtcgttt aacggggttt     67260
     atagcttcgt tggaatcctt gaaacgcttg gtcgtcagcg acgcgtcttc ctttacaccc     67320
     agcatattaa cgattaatat tacttggtgt agaagtagtt tcaataaaat aaagggtaaa     67380
     aaaaaaaaaa aacaaaattt gaaaaatgaa aacaatgtga ttcagcgcgt ttgatttcat     67440
     gcacaaaaac aagctccatg aggaataggc cactactatt aatcaagttg tatatgaact     67500
     cgattttaat tggtaattta tagcttcaaa ttacagaacc gttgaactag aaaagaataa     67560
     ataagtaaac gcaaactatg tactaggtat tgtggtaatc tattgcacca aaggtattca     67620
     aagctatgga actttgattt tgatgcaaaa tttatgcaaa tatttaaaga aaaaacactg     67680
     gcagtaccat tcatagatat tcaacattaa ttagaagtag acacattcaa aactaaacat     67740
     atcttgaact gataatgtag tacaagaatt cgattgtcac gtgcaccata caaaattagt     67800
     tacaacttca ataaaatcat caatttacac gtacattttt taaatagaaa aactcaatac     67860
     acaacaaagt ctatttcaat gactaaaagc aaatatcact atttttttat gccaaggagc     67920
     tctttcccat ttgtcttgtt cctcttgtct ttctaggttc aagatttctt cgtcgaaaat     67980
     agttctttcg ttgttaatat caatttcact tattggaatc aacaatctcc atttacgagt     68040
     gtacaatttg tgtccaacgt aaaatacaac taaaacaata gcaccaaggt aactttggaa     68100
     aaagttattt gcatctggtt tcgatgcacc aattgggaac aaagcaatcc agaattgtga     68160
     aattaaaacc aatgcatacc aaatcaaggc atagtatgag ccccaaactc cagtagtagc     68220
     cttgtaacct aatgcatcgg tcgagatatt gttgtatttc aacgcttgcc taaatctaac     68280
     atgtgaaaga caaattccac tccatgtgaa cacttgtgat aaaccagaaa tagctaaaag     68340
     ccaattgaaa acagtgactt gctttttgta tgcagcaata aatgcaaaca aaccaatgat     68400
     agcagcaatc aataatgctc ttgttggtct accagctcta tcaatatagt tgaaccaagt     68460
     tggtgcgaat ccttgttccg ccaatgattg caaagttctt gatgcggaat acaaagacga     68520
     cgaagcaact gatgtgacag acataagaat aacggcattg ataatagaag gaactgcttt     68580
     gacaccatga agggcagcag aaagaacata tggtgaggtg ttggaactac tgctaccttc     68640
     actcatcaaa tgagtcgagt tcgatggcac aagcaaacca acaatggtaa gtgacccaag     68700
     gaacaaaaca atgatacgcc agaagataag tctgcatgca gttgggattg ctttgcgtgg     68760
     gtttggttgt tcagcggcag ataatgcgac aaactcagat tgtccatacg aaaatgcagc     68820
     ggtgacgaaa actgaacaga atcctttaaa tccattatta gttggacctg ggtttttcca     68880
     atatctacca ccaatgaatt caccagttgg tccaccacca gtgtcaagaa caatacccat     68940
     gataatgaaa ccgatgagca aacaaacttt aatcagcccg ataataaact caaattcacc     69000
     ataggctttg gaaccaataa aatgaataac aacaataaca acataaaaaa tggcgaccca     69060
     tgcatcggga ttcacttttg tttcactaat ccaatattca atggtaatgg cagctgtaac     69120
     aagctcaata ctaataacac tcaaccactg aatacaataa ttccaagaaa tggcaaaatt     69180
     gatactgtct tcaacaaaca tccttgtata tgaattgtaa ccaccagata actcagagta     69240
     attcactgcc atttcaccag cagcttgcaa tgtagggtac acaaacgacc cggcaatggc     69300
     ataaccaaca acaagaaata atggaccaga cttacgcaaa acctgacccg taccaaccaa     69360
     aagaccagta cctataccag taaccaagga catcaaaatt aaatgacgct tgctaatacc     69420
     ttttgccaat tgcttccctg cactttcatc ttcactggct tgttttcttc ggaaggaatc     69480
     aataaagttt tggaatgcag ttttattttc agtatttaga aattcattgc ttgaatattt     69540
     ttcttcggag ccagtaaagc ttcccaactc ctctggccga acctccttgg aaacagcctg     69600
     gtcttccttt ttaaacatgg tatctaatat atttgaggac aaaacaaaca aataaaataa     69660
     aattaatggg ctatgaaaga tgagatatga ctaaatggaa aaaaataaaa aaaaaagtaa     69720
     tgcctgaaag aaggagaact tggtaaaaaa aaaaaaaaaa cagaaagcaa aataataaaa     69780
     atctaggtta taagagaaat aatcgcatct atatatggaa tggaatcaac tttttctcat     69840
     tacacataga aaactcgtgt cggctgattt ctattcgatt ttggtaaatt tcaaacaaga     69900
     aaattcttat ctaaaagcaa ggagtagcga ttgtgtttga agcaaaactg cttatatatt     69960
     acgtttactc aaatcctggt tccctgctat ttaatttgtt gatgtgtgtt ttagattaga     70020
     tgctagaaca atacgttaag cttggggcaa atttcgggtt tttgtctatg caacatgaaa     70080
     cctaatcatt atcatcatga tcatcaactc atgcattttt tagggaaccc aaaaaatgcc     70140
     ttaaactgaa gatagagcaa tcattggcct gcatgctttt tttttgtttt ccaacaatat     70200
     gtattgtgtt gtttaaattc tgcgatggat tccgtaaggc attctgtcaa aaaaaatgtt     70260
     tttgtgttgc gtttggccgg aataattctc tttcttttgc ggcaaaagaa agatactttt     70320
     tcctacatac aggtaaaaag aaattcaaat tcaaaagaaa ttttgcagaa cgaattaaaa     70380
     tttacagtca cgttaaatat tggcattgag agacaggaat ttcttttatg cacatgatta     70440
     ccatctaccc agaaacaagc taaacctaat attcagatca aatttcttgt tccatctata     70500
     ttcttttaag cacgatttta ttttgattca attgaaacaa accacgagtg tatgccggta     70560
     atagtatgtt catacttgca aatacttttt ggtggggaaa ataagtacaa caataaatga     70620
     ctacagaaga ataacaaatt ctgctagata acacctattg gcaagtggct ttggtgtaag     70680
     gcattttgat attacattgc aaaaacttcc ttcccttttt atttttattt tttttttttt     70740
     tttttttgca tttctttgtt acacgttttg agtgtcccca cttgttcccc aaaatgaata     70800
     ggatatagta gattgagcaa ttaaagtcga ggggaaccgg ctacgataat tctggaccac     70860
     taaagttaaa ccccactaaa cactctcaaa gagaataatt agaaaggatt gactgaacaa     70920
     tggtgtatga ctgttttgcc ttcacgcata ggaatagtag tctcttcggt tcaggaatca     70980
     ggaattacaa cacttccgta tcatggggct tacctgcaat tacatacttc catgatatag     71040
     aattggttac acgttctgct ttagcaaaaa taacagtata aaatttctaa ttacggaata     71100
     ccaaactata gcaaaaaaaa cgcacacaca aaggtaaaca acataagttt gtataacctc     71160
     ttccccaagc agcctcatca catctgacaa tgatctacac taccattaag cattagatat     71220
     atctaattct atatacaagc taatcacatt cttcctatct ataaattact attctgacca     71280
     ataatttcca ttgctcgtga gtcaccctgc tttaattcgt catttcccaa tgcatcagca     71340
     agacattccc atggatctct agtaccaccc cattttaaaa cactctcctt atacttttta     71400
     ccggcctcgc cattccatgg atctttagca aatagtcctt gccaaatctt atcggcaatt     71460
     gctcgatcca aaagatagga gtaatacact gctccataag aaaacaaatg aggaaacttt     71520
     ccgtgccatg tagaccattc atctgcaaag actctcaatt ccttttcaac cagatgatac     71580
     accttagtag aatcaacttc atatagcccc ttggccaata atttaaccat ctcttcatta     71640
     tgcaattttt gatccaacat ggccattttt gattgcataa atgtttcaca cgcgtccaac     71700
     atgatcctat gttcttgtgc ttgttcaaga agtgcttcag gtagcttttc gtctgtgtca     71760
     aaatgacgac ctatttggca tataactctt ggatctttac taaaagactc catcaacacc     71820
     gacggtaatt ccacgaaatc cgtagagcaa cgagtccccg ataaattatg caattccgtt     71880
     ctcccaatca tcgagtgcat tgcgtgtccc atttcatgga aaatcgtatc aacctggtct     71940
     aatgtcaata atgttggctt ttcattttca acaccagcaa atcttccaaa cagaaagttg     72000
     cctgaactgg caaaattgca cacaagtgaa acaactggca attgataatc atcatccaat     72060
     tggacaagat tctccatact ttctattgtt