(data stored in ACNUC8465 zone)

HOGENOMDNA: CATAD_1

ID   CATAD_1; SV 1; empty ; DNA; empty ; PRO; 10467782 BP.
XX
AC   NC_013131;
XX
PR   Project: 59077;
XX
DE   Catenulispora acidiphila DSM 44928, complete genome.
XX
OS   Catenulispora acidiphila DSM 44928
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Catenulisporineae; Catenulisporaceae; Catenulispora.
XX
RN   [1]
RP   1-10467782
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Mikhailova,N., Chertkov,O., Brettin,T., Detter,J.C., Han,C., Larimer,F.,
RA   Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
RA   Wu,D., Klenk,H.-P. and Eisen,J.A.;
RT   "The complete genome of Catenulispora acidiphila DSM 44928";
RL   Unpublished
XX
RN   [2]
RP   1-10467782
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-AUG-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-10467782
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Mikhailova,N., Chertkov,O., Brettin,T., Detter,J.C., Han,C., Larimer,F.,
RA   Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
RA   Wu,D., Klenk,H.-P. and Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (12-AUG-2009) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001700.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082785
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..10467782
FT                   /strain="DSM 44928"
FT                   /mol_type="genomic DNA"
FT                   /organism="Catenulispora acidiphila DSM 44928"
FT                   /db_xref="taxon:479433"
FT   gene            370..2082
FT                   /db_xref="GeneID:8340452"
FT                   /locus_tag="Caci_0001"
FT   CDS_pept        370..2082
FT                   /locus_tag="Caci_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:256389233"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:8340452"
FT                   /translation="MPARRYHQGRQHRMEPQAVSDPQGYTPVPHPPAAPGDAIALWSHF
FT                   RARVESDSSLTKSEQAFLMIPEARTVIGDTIVLAVPDDFSKNYLEQRLEPMLTTHLAAM
FT                   FGPDIKFSLFVDKIMENTPAPAAAGPVAPPAPVIQQLAPPPAHWTPPPAMQSGAELQVP
FT                   AAFHSDPPAFAPDVPRPGLGGMALPPPRVSEPAPEENDPIAATLSLSTGRPGARSSTPD
FT                   DGAKAQQAKLNEKYVFETFVIGSSNRFAHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHL
FT                   LHAIGHYARNLYPGTRVRYVSTEEFTNDFINAIRDGAGNHLRKRYRDVDILMVDDIQFL
FT                   ENKEGTQEEFFHTFNTLHNASKQIVISSDRPPKQLNTLEDRLRSRFEWGLITDIQPPEL
FT                   ETRIAILRKKAQQEGLNAPPEVLEFIASKISTNIRELEGALIRVTAFASLNRAPVDLSL
FT                   AEDVLKNLMPDAAGPEITVSTIMAQTAMYFGITMEDLCGTSRSRILVTARQIAMYLCRE
FT                   LTDLSLPKIGQAFGGRDHTTVMHADRKIRSLLPERRAIFNQVTELTNRIKQSG"
FT                   /protein_id="YP_003110797.1"
FT   misc_feature    472..>717
FT                   /note="chromosomal replication initiation protein;
FT                   Provisional; Region: dnaA; PRK14086"
FT                   /db_xref="CDD:172576"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    1162..1539
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    1165..1545
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    1183..1206
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    order(1186..1209,1372..1374,1471..1473)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    1360..1377
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    <1507..>1710
FT                   /note="DNA polymerase III, delta subunit [DNA replication,
FT                   recombination, and repair]; Region: HolA; COG1466"
FT                   /db_xref="CDD:31655"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    1510..1512
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    1804..2067
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Caci_0001"
FT   misc_feature    order(1867..1869,1891..1896,1915..1917,1933..1941,
FT                   1966..1980,1987..1989,1996..2001)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Caci_0001"
FT   gene            2834..4024
FT                   /db_xref="GeneID:8331325"
FT                   /locus_tag="Caci_0002"
FT   CDS_pept        2834..4024
FT                   /locus_tag="Caci_0002"
FT                   /gene_family="HOG000071793" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="binds the polymerase to DNA and acts as a sliding
FT                   clamp"
FT                   /db_xref="GI:256389234"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:8331325"
FT                   /translation="MKFRVERDVLSEAVAWTARSLPSRPAAPVLAGLVFEAVEGEGGED
FT                   HGSVTLSGFDYEVSSRAQIGADVTEPGRILIHGKLLADIAKSLPNRPVEFSTEGSKVLL
FT                   SCGSSRFTLQTLPVEDYPALPTMPTATGAVTASGLAGAVSQVAIAAGRDDTIPMLTGIR
FT                   VEIEGEKITLVATDRFRLAVRELQWKPEQDDMSATALIPSKVLSDTAKALTGGDWVSLA
FT                   LSGGDAGEGLIGFESGEGTSGKAKGSRRMTSRLLSGEFVKYRSLFPNEYNITATVETAP
FT                   FLEAAKRVSLVADRTSPIKLAFTQGEVTLEAGAGDEAQASEAMDAVLDGEDISVSFNPS
FT                   FLLDGLQVIDTQYAQLSFTVASKPAVLMGRPALDAPAQEEFRYLMMPLRVPGQSAG"
FT                   /product="DNA polymerase III subunit beta"
FT                   /protein_id="YP_003110798.1"
FT   misc_feature    2834..4009
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK07761"
FT                   /db_xref="CDD:169087"
FT                   /locus_tag="Caci_0002"
FT   misc_feature    2834..4000
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Caci_0002"
FT   misc_feature    order(2903..2905,3068..3070,3089..3091,3443..3445)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Caci_0002"
FT   misc_feature    order(3071..3073,3080..3082,3155..3157,3161..3163,
FT                   3704..3706,3794..3799)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Caci_0002"
FT   misc_feature    order(3359..3361,3365..3376,3845..3847,3989..4000)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Caci_0002"
FT   misc_feature    order(3359..3361,3365..3370,3629..3631,3731..3733,
FT                   3770..3775,3854..3856,3989..4000)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Caci_0002"
FT   gene            4110..4988
FT                   /db_xref="GeneID:8331326"
FT                   /locus_tag="Caci_0003"
FT   CDS_pept        4110..4988
FT                   /locus_tag="Caci_0003"
FT                   /gene_family="HOG000255146" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase-like protein"
FT                   /transl_table="11"
FT                   /note="similar to full-length Gnd, these proteins seems to
FT                   have a truncated C-terminal 6PGD domainin; in
FT                   Methylobacillus flagellatus this gene is essential for
FT                   NAD+-dependent oxidation of 6-phosphogluconate"
FT                   /db_xref="GI:256389235"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="GeneID:8331326"
FT                   /translation="MEIGLVGLGKMGGNMRERIRQAGHTVVGYDRDPKLADVGSLKELV
FT                   QTLAAPRVIWIMVPAGEATDATVNELADLLHTGDMVIDGGNSRWTEDIKHAELLKAQGV
FT                   AFVDAGVSGGVWGLQNGYALMVGGDEADIARVQPVFDALKPAGDSGFVHAGGVGAGHFS
FT                   KMVHNGIEYGIMQSYAEGWELLEAAPNVTNVREVFRSWQEGTVIRSWLLDLLVRALDDD
FT                   EHLAGIRGYADDSGEGRWTVEAGIDMAVPTPAITASLYARFTSRQEDSPQMKAIAALRN
FT                   QFGGHAVKKES"
FT                   /protein_id="YP_003110799.1"
FT   misc_feature    4110..4985
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Caci_0003"
FT   misc_feature    4110..4979
FT                   /note="6-phosphogluconate dehydrogenase-like protein;
FT                   Reviewed; Region: PRK12490"
FT                   /db_xref="CDD:171538"
FT                   /locus_tag="Caci_0003"
FT   gene            4998..6143
FT                   /db_xref="GeneID:8331327"
FT                   /locus_tag="Caci_0004"
FT   CDS_pept        4998..6143
FT                   /locus_tag="Caci_0004"
FT                   /gene_family="HOG000269561" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV_4319 recombination
FT                   protein F"
FT                   /db_xref="GI:256389236"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:8331327"
FT                   /translation="MRVTHLSLADFRSYASLDVALGGGVTAFVGPNGQGKTNLVEAIGY
FT                   IATLDSHRVATDQPLVRFGAPRAIVRANVEREGRTQLVEIELNPGGANRARLNRNPVPR
FT                   PREVLGVLRTVLFAPEDLALVKGDPGERRRFLDELLVARWPRFAGVRADYDRVLKQRNT
FT                   LLRTAAMARRNKASGPNISTLDAWDHHLALAGAELVAARLALISALSPLVDKCYVEIAE
FT                   GGQTRIGYRSTISAEPDPTAAALTEQFMTALGEARANELDRGITLVGPHRDEMVLELTS
FT                   SSGDNMPARGYASHGESWSYALALRLAAYDLLRSDGSDGGEPVLILDDVFAELDAKRRR
FT                   RLAERVSGADQVLITAAVDADVPEQLIGQKFTVADGQVSAA"
FT                   /protein_id="YP_003110800.1"
FT   misc_feature    5004..>5495
FT                   /note="RecF is a recombinational DNA repair ATPase that
FT                   maintains replication in the presence of DNA damage.  When
FT                   replication is prematurely disrupted by DNA damage, several
FT                   recF pathway gene products play critical roles processing
FT                   the arrested replication...; Region: ABC_RecF; cd03242"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    5085..5108
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    order(5094..5099,5103..5111,5301..5303)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    5292..5303
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    <5784..6134
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    5874..5903
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    5967..5984
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    5991..6002
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Caci_0004"
FT   misc_feature    6057..6077
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Caci_0004"
FT   gene            6140..6658
FT                   /db_xref="GeneID:8331328"
FT                   /locus_tag="Caci_0005"
FT   CDS_pept        6140..6658
FT                   /locus_tag="Caci_0005"
FT                   /gene_family="HOG000235671" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF721"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   sgr:SGR_3704 hypothetical protein"
FT                   /db_xref="GI:256389237"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="GeneID:8331328"
FT                   /translation="MNPQPVDNGSGAEGGDPQDSGVDLARAALAAARARGKDNGAGWSG
FT                   NRRRNSNSGQRSGSGPDERDPQLLSSAIPRMIEARGWSVPAAVGGVMGRWGEIVGSHIS
FT                   AHCTPVEFHDGVLMVRTDSAAWATELRMLAPQLLAKLNAELGTSRAAHGGRDAAGAIAT
FT                   LKVVGPGGR"
FT                   /protein_id="YP_003110801.1"
FT   misc_feature    6344..6577
FT                   /note="Protein of unknown function (DUF721); Region:
FT                   DUF721; cl02324"
FT                   /db_xref="CDD:174721"
FT                   /locus_tag="Caci_0005"
FT   gene            7225..9210
FT                   /db_xref="GeneID:8331329"
FT                   /locus_tag="Caci_0006"