(data stored in ACNUC13530 zone)

HOVERGEN: CCRK_HUMAN

ID   CCRK_HUMAN              Reviewed;         346 AA.
AC   Q8IZL9; A2A389; B4DQX1; Q5EDC4; Q5VYW1; Q9BUF4;
DT   20-DEC-2005, integrated into UniProtKB/Swiss-Prot.
DT   01-MAR-2003, sequence version 1.
DT   13-OCT-2009, entry version 62.
DE   RecName: Full=Cell cycle-related kinase;
DE            EC=2.7.11.22;
DE   AltName: Full=Cyclin-kinase-activating kinase p42;
DE   AltName: Full=CDK-activating kinase p42;
DE   AltName: Full=CAK-kinase p42;
DE   AltName: Full=Cyclin-dependent protein kinase H;
GN   Name=CCRK; Synonyms=CDCH;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
RC   TISSUE=Heart;
RA   Qiu H., Depre C.;
RT   "Cardiac CCRK splice variant.";
RL   Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases.
RN   [2]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS LEU-86; THR-137 AND
RP   ARG-281.
RG   NIEHS SNPs program;
RL   Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases.
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
RC   TISSUE=Uterus;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RP   FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, AND MUTAGENESIS OF THR-161.
RX   PubMed=14597612; DOI=10.1074/jbc.M309995200;
RA   Liu Y., Wu C., Galaktionov K.;
RT   "p42, a novel cyclin-dependent kinase-activating kinase in mammalian
RT   cells.";
RL   J. Biol. Chem. 279:4507-4514(2004).
RN   [8]
RP   VARIANT [LARGE SCALE ANALYSIS] ASN-106.
RX   PubMed=17344846; DOI=10.1038/nature05610;
RA   Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C.,
RA   Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S.,
RA   O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S.,
RA   Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E.,
RA   Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J.,
RA   Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K.,
RA   Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T.,
RA   West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P.,
RA   Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E.,
RA   DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E.,
RA   Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T.,
RA   Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.;
RT   "Patterns of somatic mutation in human cancer genomes.";
RL   Nature 446:153-158(2007).
CC   -!- FUNCTION: Involved in cell growth. Activates CDK2, a kinase
CC       involved in the control of the cell cycle, by phosphorylating
CC       residue 'Thr-160'.
CC   -!- CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
CC   -!- SUBUNIT: Monomer.
CC   -!- SUBCELLULAR LOCATION: Nucleus.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1;
CC         IsoId=Q8IZL9-1; Sequence=Displayed;
CC       Name=2; Synonyms=Cardiac CCRK;
CC         IsoId=Q8IZL9-2; Sequence=VSP_016748, VSP_016750;
CC       Name=3;
CC         IsoId=Q8IZL9-3; Sequence=VSP_016749, VSP_016751, VSP_016752;
CC         Note=No experimental confirmation available;
CC   -!- SIMILARITY: Belongs to the protein kinase superfamily. CMGC
CC       Ser/Thr protein kinase family. CDC2/CDKX subfamily.
CC   -!- SIMILARITY: Contains 1 protein kinase domain.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=CAH72843.1; Type=Erroneous gene model prediction;
CC   -!- WEB RESOURCE: Name=NIEHS-SNPs;
CC       URL="http://egp.gs.washington.edu/data/ccrk/";
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
CC   -!- GENE_FAMILY: HBG014652 [ FAMILY / ALN / TREE ]
DR   EMBL; AY904367; AAW82349.1; -; mRNA.
DR   EMBL; AF547664; AAN28684.1; -; Genomic_DNA.
DR   EMBL; AK298993; BAG61083.1; -; mRNA.
DR   EMBL; AL353572; CAM17657.1; -; Genomic_DNA.
DR   EMBL; AL353572; CAH72843.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; CH471089; EAW62746.1; -; Genomic_DNA.
DR   EMBL; BC002655; AAH02655.1; -; mRNA.
DR   IPI; IPI00218021; -.
DR   IPI; IPI00554807; -.
DR   IPI; IPI00748335; -.
DR   RefSeq; NP_001034892.1; -.
DR   RefSeq; NP_036251.2; -.
DR   UniGene; Hs.522274; -.
DR   HSSP; Q00535; 1H4L.
DR   STRING; Q8IZL9; -.
DR   PRIDE; Q8IZL9; -.
DR   Ensembl; ENST00000286878; ENSP00000286878; ENSG00000156345; Homo sapiens.
DR   Ensembl; ENST00000325303; ENSP00000322343; ENSG00000156345; Homo sapiens.
DR   Ensembl; ENST00000336654; ENSP00000338975; ENSG00000156345; Homo sapiens.
DR   Ensembl; ENST00000375871; ENSP00000365031; ENSG00000156345; Homo sapiens.
DR   Ensembl; ENST00000375883; ENSP00000365043; ENSG00000156345; Homo sapiens.
DR   GeneID; 23552; -.
DR   KEGG; hsa:23552; -.
DR   UCSC; uc004apr.1; human.
DR   UCSC; uc004apu.1; human.
DR   CTD; 23552; -.
DR   GeneCards; GC09M089771; -.
DR   H-InvDB; HIX0008148; -.
DR   HGNC; HGNC:21420; CCRK.
DR   MIM; 610076; gene.
DR   PharmGKB; PA134991422; -.
DR   HOVERGEN; Q8IZL9; -.
DR   BRENDA; 2.7.11.22; 247.
DR   NextBio; 46104; -.
DR   ArrayExpress; Q8IZL9; -.
DR   Bgee; Q8IZL9; -.
DR   CleanEx; HS_CCRK; -.
DR   Genevestigator; Q8IZL9; -.
DR   GermOnline; ENSG00000156345; Homo sapiens.
DR   GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
DR   GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
DR   GO; GO:0004693; F:cyclin-dependent protein kinase activity; IEA:EC.
DR   GO; GO:0007049; P:cell cycle; IEA:UniProtKB-KW.
DR   GO; GO:0051301; P:cell division; IEA:UniProtKB-KW.
DR   GO; GO:0006468; P:protein amino acid phosphorylation; IEA:InterPro.
DR   InterPro; IPR000719; Prot_kinase_core.
DR   InterPro; IPR017441; Protein_kinase_ATP_BS.
DR   InterPro; IPR017442; Se/Thr_pkinase-rel.
DR   InterPro; IPR008271; Ser_thr_pkin_AS.
DR   InterPro; IPR002290; Ser_thr_pkinase.
DR   Pfam; PF00069; Pkinase; 1.
DR   ProDom; PD000001; Prot_kinase; 1.
DR   SMART; SM00220; S_TKc; 1.
DR   PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
DR   PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
DR   PROSITE; PS00108; PROTEIN_KINASE_ST; 1.
PE   1: Evidence at protein level;
DR   PRODOM; Q8IZL9.
DR   SWISS-2DPAGE; Q8IZL9.
KW   Alternative splicing; ATP-binding; Cell cycle; Cell division;
KW   Complete proteome; Kinase; Nucleotide-binding; Nucleus; Polymorphism;
KW   Serine/threonine-protein kinase; Transferase.
FT   DOMAIN        4    211       PRODOM:2005.1:PD000001  8496
FT   DOMAIN      247    287       PRODOM:2005.1:PD874866  4
FT   DOMAIN      288    346       PRODOM:2005.1:PD208210  3
FT   CHAIN         1    346       Cell cycle-related kinase.
FT                                /FTId=PRO_0000085701.
FT   DOMAIN        4    288       Protein kinase.
FT   NP_BIND      10     18       ATP (By similarity).
FT   ACT_SITE    127    127       Proton acceptor (By similarity).
FT   BINDING      33     33       ATP (By similarity).
FT   VAR_SEQ     168    243       WYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKN
FT                                DIEQLCYVLRILGTPNPQVWPELTELPDYNKISFK -> SS
FT                                LSCRTTTRSPLRSRCPCPWRRCCLTSLPRHWICWVNSFSTL
FT                                LTSASQLPRLSSISTSSQLPCLPIHLSCRFLSV (in
FT                                isoform 2).
FT                                /FTId=VSP_016748.
FT   VAR_SEQ     168    188       Missing (in isoform 3).
FT                                /FTId=VSP_016749.
FT   VAR_SEQ     244    346       Missing (in isoform 2).
FT                                /FTId=VSP_016750.
FT   VAR_SEQ     282    296       ALLHQYFFTAPLPAH -> LPCLPIHLSCRFLSV (in
FT                                isoform 3).
FT                                /FTId=VSP_016751.
FT   VAR_SEQ     297    346       Missing (in isoform 3).
FT                                /FTId=VSP_016752.
FT   VARIANT      86     86       S -> L (in dbSNP:rs28364953).
FT                                /FTId=VAR_024762.
FT   VARIANT     106    106       S -> N.
FT                                /FTId=VAR_041957.
FT   VARIANT     137    137       A -> T (in dbSNP:rs28364955).
FT                                /FTId=VAR_024763.
FT   VARIANT     281    281       K -> R.
FT                                /FTId=VAR_024764.
FT   MUTAGEN     161    161       T->A: Impairs CDK2 T-160 phosphorylation
FT                                and activity.
SQ   SEQUENCE   346 AA;  38695 MW;  EB6A53E97301D5AE CRC64;
     MDQYCILGRI GEGAHGIVFK AKHVETGEIV ALKKVALRRL EDGFPNQALR EIKALQEMED
     NQYVVQLKAV FPHGGGFVLA FEFMLSDLAE VVRHAQRPLA QAQVKSYLQM LLKGVAFCHA
     NNIVHRDLKP ANLLISASGQ LKIADFGLAR VFSPDGSRLY THQVATRWYR APELLYGARQ
     YDQGVDLWSV GCIMGELLNG SPLFPGKNDI EQLCYVLRIL GTPNPQVWPE LTELPDYNKI
     SFKEQVPMPL EEVLPDVSPQ ALDLLGQFLL YPPHQRIAAS KALLHQYFFT APLPAHPSEL
     PIPQRLGGPA PKAHPGPPHI HDFHVDRPLE ESLLNPELIR PFILEG
//

If you have problems or comments...

PBIL Back to PBIL home page